BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF010D23

Length=736
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004245560.1|  PREDICTED: reticulon-like protein B4               295   2e-96   Solanum lycopersicum
ref|XP_006343915.1|  PREDICTED: reticulon-like protein B1-like          293   9e-96   Solanum tuberosum [potatoes]
ref|XP_009793558.1|  PREDICTED: reticulon-like protein B4               291   4e-95   Nicotiana sylvestris
ref|XP_009598008.1|  PREDICTED: reticulon-like protein B2               286   5e-94   
gb|KHG24129.1|  Reticulon-like protein B3                               277   1e-89   Gossypium arboreum [tree cotton]
ref|XP_002509881.1|  conserved hypothetical protein                     276   3e-89   Ricinus communis
emb|CDP12094.1|  unnamed protein product                                275   8e-89   Coffea canephora [robusta coffee]
ref|XP_010251601.1|  PREDICTED: reticulon-like protein B2               275   1e-88   Nelumbo nucifera [Indian lotus]
ref|XP_009597328.1|  PREDICTED: reticulon-like protein B5               274   5e-88   Nicotiana tomentosiformis
ref|XP_010658515.1|  PREDICTED: reticulon-like protein B2               272   1e-87   Vitis vinifera
ref|XP_006339640.1|  PREDICTED: reticulon-like protein B1-like          271   3e-87   Solanum tuberosum [potatoes]
ref|XP_009766982.1|  PREDICTED: reticulon-like protein B5               271   4e-87   Nicotiana sylvestris
gb|KDP25363.1|  hypothetical protein JCGZ_20519                         270   8e-87   Jatropha curcas
ref|XP_004229935.1|  PREDICTED: reticulon-like protein B1               270   2e-86   
ref|XP_008796064.1|  PREDICTED: reticulon-like protein B2               268   3e-86   Phoenix dactylifera
ref|XP_009763462.1|  PREDICTED: reticulon-like protein B1 isoform X2    269   3e-86   Nicotiana sylvestris
gb|AFK41983.1|  unknown                                                 267   7e-86   Medicago truncatula
ref|XP_008805646.1|  PREDICTED: reticulon-like protein B3               268   7e-86   Phoenix dactylifera
ref|XP_010915765.1|  PREDICTED: reticulon-like protein B2               267   9e-86   Elaeis guineensis
ref|XP_003633964.1|  PREDICTED: reticulon-like protein B1               267   9e-86   Vitis vinifera
ref|XP_007160119.1|  hypothetical protein PHAVU_002G294100g             266   2e-85   Phaseolus vulgaris [French bean]
ref|NP_001239711.1|  uncharacterized protein LOC100811024               266   3e-85   Glycine max [soybeans]
gb|ACJ84486.1|  unknown                                                 266   3e-85   Medicago truncatula
ref|XP_003525365.1|  PREDICTED: reticulon-like protein B2-like is...    266   4e-85   Glycine max [soybeans]
gb|ACU23452.1|  unknown                                                 265   5e-85   Glycine max [soybeans]
ref|XP_010055800.1|  PREDICTED: reticulon-like protein B1               266   6e-85   Eucalyptus grandis [rose gum]
ref|XP_011026963.1|  PREDICTED: reticulon-like protein B2               265   6e-85   Populus euphratica
gb|KCW72347.1|  hypothetical protein EUGRSUZ_E00805                     265   7e-85   Eucalyptus grandis [rose gum]
ref|XP_008792381.1|  PREDICTED: reticulon-like protein B2 isoform X2    265   7e-85   
ref|XP_006439447.1|  hypothetical protein CICLE_v10021801mg             265   8e-85   Citrus clementina [clementine]
ref|XP_010924771.1|  PREDICTED: reticulon-like protein B2               265   8e-85   Elaeis guineensis
gb|KCW72348.1|  hypothetical protein EUGRSUZ_E00805                     266   1e-84   Eucalyptus grandis [rose gum]
ref|XP_006476478.1|  PREDICTED: reticulon-like protein B2-like          264   2e-84   Citrus sinensis [apfelsine]
ref|XP_010925814.1|  PREDICTED: reticulon-like protein B2               264   2e-84   Elaeis guineensis
ref|XP_009626480.1|  PREDICTED: reticulon-like protein B2 isoform X1    263   3e-84   Nicotiana tomentosiformis
ref|XP_009765582.1|  PREDICTED: reticulon-like protein B2               263   5e-84   Nicotiana sylvestris
ref|XP_009603968.1|  PREDICTED: reticulon-like protein B1               263   9e-84   Nicotiana tomentosiformis
ref|XP_009763461.1|  PREDICTED: reticulon-like protein B6 isoform X1    263   1e-83   Nicotiana sylvestris
ref|XP_008810936.1|  PREDICTED: reticulon-like protein B5               262   1e-83   Phoenix dactylifera
ref|XP_011093062.1|  PREDICTED: reticulon-like protein B1               261   2e-83   Sesamum indicum [beniseed]
ref|XP_007038874.1|  VIRB2-interacting protein 2                        259   7e-83   Theobroma cacao [chocolate]
ref|XP_002299504.1|  reticulon family protein                           259   2e-82   Populus trichocarpa [western balsam poplar]
gb|KJB52210.1|  hypothetical protein B456_008G250900                    258   3e-82   Gossypium raimondii
gb|AEZ00899.1|  putative 24 kDa seed maturation protein                 258   3e-82   Elaeis guineensis
ref|XP_004503660.1|  PREDICTED: reticulon-like protein B2-like          258   4e-82   Cicer arietinum [garbanzo]
ref|XP_006358652.1|  PREDICTED: reticulon-like protein B1-like          257   1e-81   Solanum tuberosum [potatoes]
ref|XP_010053196.1|  PREDICTED: reticulon-like protein B1               256   2e-81   Eucalyptus grandis [rose gum]
ref|XP_010676393.1|  PREDICTED: reticulon-like protein B2               256   2e-81   Beta vulgaris subsp. vulgaris [field beet]
gb|KHG04885.1|  Reticulon-like protein B5                               256   2e-81   Gossypium arboreum [tree cotton]
ref|XP_004234204.1|  PREDICTED: reticulon-like protein B2               255   4e-81   Solanum lycopersicum
ref|XP_004248066.1|  PREDICTED: reticulon-like protein B1               255   6e-81   Solanum lycopersicum
gb|EYU19605.1|  hypothetical protein MIMGU_mgv1a012182mg                255   8e-81   Erythranthe guttata [common monkey flower]
gb|KJB24634.1|  hypothetical protein B456_004G154600                    254   1e-80   Gossypium raimondii
ref|XP_010545343.1|  PREDICTED: reticulon-like protein B3               254   1e-80   Tarenaya hassleriana [spider flower]
gb|ABC01908.1|  putative 24 kDa seed maturation protein-like protein    254   1e-80   Solanum tuberosum [potatoes]
ref|XP_010916969.1|  PREDICTED: reticulon-like protein B3               256   2e-80   Elaeis guineensis
gb|KJB06451.1|  hypothetical protein B456_001G157900                    254   2e-80   Gossypium raimondii
gb|KJB19087.1|  hypothetical protein B456_003G084400                    253   2e-80   Gossypium raimondii
ref|XP_006645662.1|  PREDICTED: reticulon-like protein B1-like          253   2e-80   Oryza brachyantha
ref|XP_003528823.2|  PREDICTED: reticulon-like protein B1-like          255   3e-80   Glycine max [soybeans]
ref|XP_006422079.1|  hypothetical protein CICLE_v10005564mg             253   4e-80   Citrus clementina [clementine]
gb|KDO56851.1|  hypothetical protein CISIN_1g023137mg                   253   4e-80   Citrus sinensis [apfelsine]
ref|NP_001149653.1|  LOC100283279                                       252   9e-80   Zea mays [maize]
gb|EAY73097.1|  hypothetical protein OsI_00974                          253   9e-80   Oryza sativa Indica Group [Indian rice]
gb|KHG15548.1|  Reticulon-like protein B3                               252   9e-80   Gossypium arboreum [tree cotton]
ref|NP_001150474.1|  seed maturation protein                            253   1e-79   
ref|XP_007051689.1|  Reticulon family protein                           252   1e-79   
tpg|DAA52789.1|  TPA: seed maturation protein                           253   1e-79   
ref|XP_010533622.1|  PREDICTED: reticulon-like protein B4               252   1e-79   Tarenaya hassleriana [spider flower]
gb|KHG29253.1|  Reticulon-like protein B5                               251   1e-79   Gossypium arboreum [tree cotton]
ref|XP_003565836.1|  PREDICTED: reticulon-like protein B1               252   2e-79   Brachypodium distachyon [annual false brome]
gb|KHG09260.1|  Reticulon-like protein B3                               251   3e-79   Gossypium arboreum [tree cotton]
ref|XP_011022600.1|  PREDICTED: reticulon-like protein B1               251   3e-79   Populus euphratica
ref|XP_006288443.1|  hypothetical protein CARUB_v10001704mg             251   3e-79   Capsella rubella
ref|XP_010541290.1|  PREDICTED: reticulon-like protein B1               251   3e-79   Tarenaya hassleriana [spider flower]
ref|XP_009388111.1|  PREDICTED: reticulon-like protein B1               250   4e-79   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP08746.1|  unnamed protein product                                250   5e-79   Coffea canephora [robusta coffee]
ref|XP_008437352.1|  PREDICTED: reticulon-like protein B2               250   5e-79   Cucumis melo [Oriental melon]
ref|XP_002303615.1|  reticulon family protein                           250   6e-79   Populus trichocarpa [western balsam poplar]
dbj|BAB32723.1|  unknown protein                                        251   7e-79   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002511930.1|  conserved hypothetical protein                     249   1e-78   Ricinus communis
ref|XP_010529625.1|  PREDICTED: reticulon-like protein B1               250   1e-78   Tarenaya hassleriana [spider flower]
ref|XP_009415169.1|  PREDICTED: reticulon-like protein B2               249   1e-78   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008655792.1|  PREDICTED: reticulon-like protein B1               250   1e-78   
gb|EYU23406.1|  hypothetical protein MIMGU_mgv1a012325mg                249   2e-78   Erythranthe guttata [common monkey flower]
gb|KHG20258.1|  Reticulon-like protein B3                               249   2e-78   Gossypium arboreum [tree cotton]
ref|XP_008792378.1|  PREDICTED: reticulon-like protein B3 isoform X1    249   2e-78   
ref|NP_001056102.1|  Os05g0526400                                       248   2e-78   
ref|XP_006366650.1|  PREDICTED: putative 24 kDa seed maturation p...    253   2e-78   
gb|KDP28552.1|  hypothetical protein JCGZ_14323                         248   2e-78   Jatropha curcas
ref|XP_004143883.1|  PREDICTED: reticulon-like protein B2-like          248   3e-78   Cucumis sativus [cucumbers]
ref|XP_004969875.1|  PREDICTED: reticulon-like protein B1-like          248   3e-78   Setaria italica
ref|XP_002874678.1|  VIRB2-interacting protein 2                        248   4e-78   Arabidopsis lyrata subsp. lyrata
ref|XP_009416410.1|  PREDICTED: reticulon-like protein B2               248   4e-78   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004967455.1|  PREDICTED: reticulon-like protein B1-like          248   4e-78   Setaria italica
ref|XP_008234814.1|  PREDICTED: reticulon-like protein B1               248   5e-78   Prunus mume [ume]
ref|XP_010261408.1|  PREDICTED: reticulon-like protein B2               248   6e-78   Nelumbo nucifera [Indian lotus]
gb|EMS62606.1|  Reticulon-like protein B1                               247   9e-78   Triticum urartu
ref|XP_011073407.1|  PREDICTED: reticulon-like protein B2 isoform X1    246   1e-77   Sesamum indicum [beniseed]
ref|XP_006360189.1|  PREDICTED: reticulon-like protein B2-like          246   1e-77   Solanum tuberosum [potatoes]
gb|EMT19773.1|  Reticulon-like protein B1                               248   1e-77   
ref|XP_008232963.1|  PREDICTED: reticulon-like protein B6               246   2e-77   Prunus mume [ume]
gb|EMT18983.1|  Reticulon-like protein B1                               245   2e-77   
ref|XP_006847055.1|  hypothetical protein AMTR_s00017p00194840          247   2e-77   
ref|XP_009772131.1|  PREDICTED: reticulon-like protein B2               246   2e-77   Nicotiana sylvestris
ref|XP_006374289.1|  hypothetical protein POPTR_0015s05710g             246   3e-77   
emb|CDJ26559.1|  unnamed protein product                                247   3e-77   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006374290.1|  hypothetical protein POPTR_0015s05710g             246   3e-77   
ref|XP_009134231.1|  PREDICTED: reticulon-like protein B2               246   4e-77   Brassica rapa
ref|XP_010092876.1|  Reticulon-like protein                             245   4e-77   Morus notabilis
emb|CDP05124.1|  unnamed protein product                                245   5e-77   Coffea canephora [robusta coffee]
ref|XP_004240710.1|  PREDICTED: reticulon-like protein B6               245   5e-77   Solanum lycopersicum
ref|XP_008376662.1|  PREDICTED: reticulon-like protein B1               245   6e-77   Malus domestica [apple tree]
ref|XP_010422067.1|  PREDICTED: reticulon-like protein B2               245   6e-77   Camelina sativa [gold-of-pleasure]
ref|XP_009406786.1|  PREDICTED: reticulon-like protein B1 isoform X2    244   8e-77   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007218819.1|  hypothetical protein PRUPE_ppa010065mg             245   9e-77   Prunus persica
ref|XP_010455527.1|  PREDICTED: reticulon-like protein B2               244   1e-76   Camelina sativa [gold-of-pleasure]
ref|XP_011080892.1|  PREDICTED: reticulon-like protein B2               244   1e-76   Sesamum indicum [beniseed]
gb|EAY75742.1|  hypothetical protein OsI_03655                          244   1e-76   Oryza sativa Indica Group [Indian rice]
ref|XP_010669728.1|  PREDICTED: reticulon-like protein B4               245   1e-76   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010544774.1|  PREDICTED: reticulon-like protein B6               244   1e-76   Tarenaya hassleriana [spider flower]
ref|XP_009368711.1|  PREDICTED: reticulon-like protein B1               243   2e-76   Pyrus x bretschneideri [bai li]
gb|KHN15986.1|  Reticulon-like protein B5                               243   3e-76   Glycine soja [wild soybean]
gb|EAZ13460.1|  hypothetical protein OsJ_03377                          243   4e-76   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001241367.1|  uncharacterized protein LOC100796111               243   4e-76   Glycine max [soybeans]
ref|XP_010435260.1|  PREDICTED: reticulon-like protein B2               243   4e-76   Camelina sativa [gold-of-pleasure]
ref|NP_001044177.1|  Os01g0736900                                       243   4e-76   
ref|XP_003568063.1|  PREDICTED: reticulon-like protein B1               242   5e-76   Brachypodium distachyon [annual false brome]
ref|XP_009380544.1|  PREDICTED: reticulon-like protein B2               242   6e-76   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007218268.1|  hypothetical protein PRUPE_ppa008259mg             244   1e-75   
ref|XP_008354289.1|  PREDICTED: reticulon-like protein B1               241   1e-75   
ref|XP_006644671.1|  PREDICTED: reticulon-like protein B1-like          241   1e-75   Oryza brachyantha
ref|XP_011047748.1|  PREDICTED: reticulon-like protein B1               241   2e-75   Populus euphratica
gb|EAY98759.1|  hypothetical protein OsI_20691                          241   2e-75   Oryza sativa Indica Group [Indian rice]
ref|XP_011084470.1|  PREDICTED: reticulon-like protein B2               241   2e-75   Sesamum indicum [beniseed]
ref|NP_192861.1|  reticulon-like protein B2                             241   3e-75   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ89699.1|  predicted protein                                      241   3e-75   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009375555.1|  PREDICTED: reticulon-like protein B1               241   4e-75   Pyrus x bretschneideri [bai li]
gb|ACF87936.1|  unknown                                                 239   4e-75   Zea mays [maize]
ref|XP_008343772.1|  PREDICTED: reticulon-like protein B1               240   4e-75   Malus domestica [apple tree]
gb|EYU25170.1|  hypothetical protein MIMGU_mgv1a012274mg                239   7e-75   Erythranthe guttata [common monkey flower]
ref|NP_001130478.1|  Seed maturation protein                            239   7e-75   Zea mays [maize]
gb|EYU32181.1|  hypothetical protein MIMGU_mgv1a012219mg                239   8e-75   Erythranthe guttata [common monkey flower]
gb|KJB24285.1|  hypothetical protein B456_004G137000                    239   8e-75   Gossypium raimondii
ref|XP_002320163.1|  reticulon family protein                           239   9e-75   Populus trichocarpa [western balsam poplar]
ref|XP_009406784.1|  PREDICTED: reticulon-like protein B1 isoform X1    239   9e-75   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABK94480.1|  unknown                                                 239   1e-74   Populus trichocarpa [western balsam poplar]
ref|XP_006654676.1|  PREDICTED: reticulon-like protein B1-like          239   1e-74   Oryza brachyantha
gb|KDO86331.1|  hypothetical protein CISIN_1g025719mg                   239   1e-74   Citrus sinensis [apfelsine]
gb|KJB24288.1|  hypothetical protein B456_004G137000                    238   1e-74   Gossypium raimondii
gb|KFK31901.1|  hypothetical protein AALP_AA6G173800                    239   2e-74   Arabis alpina [alpine rockcress]
ref|XP_010035177.1|  PREDICTED: reticulon-like protein B1               238   2e-74   Eucalyptus grandis [rose gum]
ref|XP_006444935.1|  hypothetical protein CICLE_v10021860mg             237   4e-74   Citrus clementina [clementine]
ref|XP_004149448.1|  PREDICTED: reticulon-like protein B1-like          237   5e-74   Cucumis sativus [cucumbers]
ref|NP_001042463.1|  Os01g0226300                                       234   5e-74   
ref|NP_194094.1|  VIRB2-interacting protein 1                           238   8e-74   Arabidopsis thaliana [mouse-ear cress]
gb|KJB06453.1|  hypothetical protein B456_001G157900                    238   8e-74   Gossypium raimondii
gb|ABR17571.1|  unknown                                                 236   2e-73   Picea sitchensis
ref|XP_010433883.1|  PREDICTED: reticulon-like protein B1               236   2e-73   Camelina sativa [gold-of-pleasure]
ref|XP_002869770.1|  VIRB2-interacting protein 1                        236   3e-73   Arabidopsis lyrata subsp. lyrata
ref|XP_006422078.1|  hypothetical protein CICLE_v10005564mg             236   4e-73   
gb|KDO56850.1|  hypothetical protein CISIN_1g023137mg                   236   4e-73   Citrus sinensis [apfelsine]
ref|XP_010439152.1|  PREDICTED: reticulon-like protein B1 isoform X1    236   5e-73   Camelina sativa [gold-of-pleasure]
ref|XP_010509305.1|  PREDICTED: reticulon-like protein B1               235   5e-73   Camelina sativa [gold-of-pleasure]
gb|ACN40158.1|  unknown                                                 234   7e-73   Picea sitchensis
gb|KHN29299.1|  Reticulon-like protein B5                               234   9e-73   Glycine soja [wild soybean]
ref|XP_006284300.1|  hypothetical protein CARUB_v10005469mg             234   1e-72   
ref|XP_010112604.1|  Reticulon-like protein                             233   2e-72   Morus notabilis
ref|XP_008375931.1|  PREDICTED: reticulon-like protein B1               233   2e-72   Malus domestica [apple tree]
ref|XP_002870630.1|  VIRB2-interacting protein 3                        233   2e-72   
emb|CDY57657.1|  BnaC01g15350D                                          234   2e-72   Brassica napus [oilseed rape]
gb|EMS62854.1|  Reticulon-like protein B1                               232   3e-72   Triticum urartu
ref|XP_006396933.1|  hypothetical protein EUTSA_v10028886mg             233   4e-72   Eutrema salsugineum [saltwater cress]
ref|NP_001240231.1|  uncharacterized protein LOC100778096               233   4e-72   Glycine max [soybeans]
ref|XP_008344578.1|  PREDICTED: reticulon-like protein B1               233   5e-72   
ref|XP_004298843.1|  PREDICTED: reticulon-like protein B2               232   5e-72   Fragaria vesca subsp. vesca
gb|KHN40449.1|  Reticulon-like protein B5                               232   5e-72   Glycine soja [wild soybean]
emb|CDY10954.1|  BnaA03g46130D                                          233   5e-72   Brassica napus [oilseed rape]
ref|XP_009338786.1|  PREDICTED: reticulon-like protein B1               232   5e-72   Pyrus x bretschneideri [bai li]
ref|XP_009341126.1|  PREDICTED: reticulon-like protein B1               232   1e-71   Pyrus x bretschneideri [bai li]
dbj|BAJ98297.1|  predicted protein                                      231   1e-71   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY44123.1|  BnaA01g13310D                                          232   1e-71   Brassica napus [oilseed rape]
ref|XP_010538815.1|  PREDICTED: reticulon-like protein B1               231   1e-71   Tarenaya hassleriana [spider flower]
ref|XP_009137263.1|  PREDICTED: reticulon-like protein B1               232   1e-71   Brassica rapa
ref|XP_009137373.1|  PREDICTED: reticulon-like protein B1               231   1e-71   Brassica rapa
gb|KDP22201.1|  hypothetical protein JCGZ_26032                         231   1e-71   Jatropha curcas
ref|NP_001239653.1|  uncharacterized protein LOC100793862               231   2e-71   Glycine max [soybeans]
ref|XP_009345612.1|  PREDICTED: reticulon-like protein B1               231   2e-71   Pyrus x bretschneideri [bai li]
ref|NP_198975.1|  reticulon-like protein B4                             230   3e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007139767.1|  hypothetical protein PHAVU_008G057300g             230   3e-71   Phaseolus vulgaris [French bean]
ref|XP_006413535.1|  hypothetical protein EUTSA_v10025959mg             231   4e-71   Eutrema salsugineum [saltwater cress]
emb|CDY05135.1|  BnaC03g29330D                                          232   4e-71   
emb|CDY25557.1|  BnaC09g11820D                                          229   5e-71   Brassica napus [oilseed rape]
ref|XP_004306726.1|  PREDICTED: reticulon-like protein B5               230   5e-71   Fragaria vesca subsp. vesca
ref|XP_011003673.1|  PREDICTED: reticulon-like protein B1               229   1e-70   Populus euphratica
ref|XP_006391670.1|  hypothetical protein EUTSA_v10023649mg             229   1e-70   Eutrema salsugineum [saltwater cress]
dbj|BAH57206.1|  AT1G64090                                              228   1e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003569752.1|  PREDICTED: reticulon-like protein B1               229   1e-70   Brachypodium distachyon [annual false brome]
dbj|BAJ33905.1|  unnamed protein product                                229   1e-70   Eutrema halophilum
emb|CDX90792.1|  BnaA03g24720D                                          229   1e-70   
ref|XP_010473658.1|  PREDICTED: reticulon-like protein B3 isoform X3    229   1e-70   Camelina sativa [gold-of-pleasure]
ref|XP_010418453.1|  PREDICTED: reticulon-like protein B3               228   2e-70   Camelina sativa [gold-of-pleasure]
ref|XP_010430525.1|  PREDICTED: reticulon-like protein B3               228   2e-70   Camelina sativa [gold-of-pleasure]
ref|NP_176592.1|  reticulon-like protein B3                             228   2e-70   Arabidopsis thaliana [mouse-ear cress]
gb|KFK37395.1|  hypothetical protein AALP_AA4G251600                    228   2e-70   Arabis alpina [alpine rockcress]
ref|NP_001185307.1|  reticulon-like protein B3                          229   2e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010506615.1|  PREDICTED: reticulon-like protein B5               228   2e-70   Camelina sativa [gold-of-pleasure]
ref|XP_010508058.1|  PREDICTED: reticulon-like protein B5               228   2e-70   Camelina sativa [gold-of-pleasure]
emb|CDY41666.1|  BnaC03g62180D                                          229   2e-70   Brassica napus [oilseed rape]
emb|CDY24806.1|  BnaA08g15040D                                          228   3e-70   Brassica napus [oilseed rape]
ref|XP_010518282.1|  PREDICTED: reticulon-like protein B5               228   3e-70   Camelina sativa [gold-of-pleasure]
ref|XP_008377768.1|  PREDICTED: reticulon-like protein B2               228   3e-70   Malus domestica [apple tree]
ref|XP_007040378.1|  Reticulan like protein B3, putative isoform 3      228   5e-70   
ref|XP_006294850.1|  hypothetical protein CARUB_v10023902mg             227   6e-70   Capsella rubella
ref|XP_002887921.1|  reticulon family protein                           227   6e-70   Arabidopsis lyrata subsp. lyrata
emb|CDM81762.1|  unnamed protein product                                227   7e-70   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004965478.1|  PREDICTED: reticulon-like protein B2-like          226   8e-70   Setaria italica
ref|XP_008367699.1|  PREDICTED: reticulon-like protein B2               226   1e-69   Malus domestica [apple tree]
ref|XP_006397801.1|  hypothetical protein EUTSA_v10001599mg             226   1e-69   Eutrema salsugineum [saltwater cress]
ref|XP_007040377.1|  Reticulan like protein B3, putative isoform 2      228   1e-69   
ref|XP_007209494.1|  hypothetical protein PRUPE_ppa010244mg             226   1e-69   Prunus persica
ref|XP_009334492.1|  PREDICTED: reticulon-like protein B2               226   1e-69   Pyrus x bretschneideri [bai li]
emb|CDY34396.1|  BnaA09g11380D                                          226   2e-69   Brassica napus [oilseed rape]
gb|AFK42059.1|  unknown                                                 226   2e-69   Lotus japonicus
ref|XP_009142682.1|  PREDICTED: reticulon-like protein B5               225   2e-69   Brassica rapa
ref|XP_010447719.1|  PREDICTED: reticulon-like protein B4               226   2e-69   Camelina sativa [gold-of-pleasure]
ref|XP_002301382.1|  hypothetical protein POPTR_0002s16690g             225   3e-69   Populus trichocarpa [western balsam poplar]
emb|CDY38194.1|  BnaA09g11950D                                          225   3e-69   Brassica napus [oilseed rape]
emb|CDY52012.1|  BnaC06g42920D                                          225   4e-69   Brassica napus [oilseed rape]
ref|XP_009349323.1|  PREDICTED: reticulon-like protein B1               225   4e-69   Pyrus x bretschneideri [bai li]
ref|XP_006284372.1|  hypothetical protein CARUB_v10005543mg             224   5e-69   Capsella rubella
ref|XP_009104316.1|  PREDICTED: reticulon-like protein B6               224   8e-69   Brassica rapa
ref|XP_009112901.1|  PREDICTED: reticulon-like protein B3               224   9e-69   Brassica rapa
emb|CDY42012.1|  BnaC04g00900D                                          223   1e-68   Brassica napus [oilseed rape]
ref|XP_006302727.1|  hypothetical protein CARUB_v10020840mg             223   1e-68   Capsella rubella
gb|KFK40472.1|  hypothetical protein AALP_AA2G000200                    223   1e-68   Arabis alpina [alpine rockcress]
ref|XP_006656127.1|  PREDICTED: reticulon-like protein B2-like          223   2e-68   Oryza brachyantha
ref|XP_009395750.1|  PREDICTED: reticulon-like protein B2               223   2e-68   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACG32549.1|  seed maturation protein                                 223   2e-68   Zea mays [maize]
ref|XP_002880222.1|  reticulon family protein                           223   2e-68   Arabidopsis lyrata subsp. lyrata
ref|NP_001046501.1|  Os02g0265900                                       222   2e-68   
ref|XP_010671578.1|  PREDICTED: reticulon-like protein B4               224   3e-68   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010441324.1|  PREDICTED: reticulon-like protein B4               223   3e-68   Camelina sativa [gold-of-pleasure]
ref|XP_010436110.1|  PREDICTED: reticulon-like protein B4               223   3e-68   Camelina sativa [gold-of-pleasure]
ref|XP_002441411.1|  hypothetical protein SORBIDRAFT_09g026210          222   4e-68   Sorghum bicolor [broomcorn]
ref|XP_004308034.1|  PREDICTED: reticulon-like protein B2               223   5e-68   Fragaria vesca subsp. vesca
ref|NP_001057713.1|  Os06g0503400                                       222   6e-68   
gb|EPS71452.1|  hypothetical protein M569_03311                         221   1e-67   Genlisea aurea
gb|EAY85291.1|  hypothetical protein OsI_06662                          220   1e-67   Oryza sativa Indica Group [Indian rice]
ref|XP_007135152.1|  hypothetical protein PHAVU_010G105400g             221   1e-67   Phaseolus vulgaris [French bean]
ref|XP_009112802.1|  PREDICTED: reticulon-like protein B3               221   1e-67   Brassica rapa
gb|KFK33000.1|  hypothetical protein AALP_AA6G316900                    221   1e-67   Arabis alpina [alpine rockcress]
gb|EMT25698.1|  Reticulon-like protein B2                               221   1e-67   
gb|ABB51093.1|  reticulon                                               219   1e-67   Hordeum vulgare [barley]
ref|XP_006402470.1|  hypothetical protein EUTSA_v10006190mg             221   1e-67   Eutrema salsugineum [saltwater cress]
emb|CDY08353.1|  BnaC09g12430D                                          220   2e-67   Brassica napus [oilseed rape]
ref|NP_566065.1|  reticulon-like protein B5                             221   2e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006647139.1|  PREDICTED: reticulon-like protein B2-like          220   2e-67   Oryza brachyantha
ref|XP_011037168.1|  PREDICTED: reticulon-like protein B5               220   2e-67   Populus euphratica
ref|XP_002438444.1|  hypothetical protein SORBIDRAFT_10g019720          219   4e-67   Sorghum bicolor [broomcorn]
ref|NP_001130268.1|  uncharacterized protein LOC100191362               219   4e-67   Zea mays [maize]
gb|AFK34557.1|  unknown                                                 220   5e-67   Medicago truncatula
ref|XP_004133840.1|  PREDICTED: reticulon-like protein B5-like          219   6e-67   Cucumis sativus [cucumbers]
gb|ACG36034.1|  reticulon                                               219   7e-67   Zea mays [maize]
ref|XP_008437980.1|  PREDICTED: reticulon-like protein B5               218   1e-66   Cucumis melo [Oriental melon]
dbj|BAJ94514.1|  predicted protein                                      218   1e-66   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001130603.1|  uncharacterized protein LOC100191702               217   1e-66   Zea mays [maize]
ref|XP_004510697.1|  PREDICTED: reticulon-like protein B1-like          218   2e-66   Cicer arietinum [garbanzo]
ref|XP_011023265.1|  PREDICTED: reticulon-like protein B5               218   2e-66   Populus euphratica
gb|EMS50148.1|  Reticulon-like protein B2                               217   2e-66   Triticum urartu
ref|XP_009109295.1|  PREDICTED: reticulon-like protein B1               218   3e-66   Brassica rapa
gb|AFW77088.1|  hypothetical protein ZEAMMB73_846644                    216   3e-66   
gb|KCW72350.1|  hypothetical protein EUGRSUZ_E00805                     216   3e-66   Eucalyptus grandis [rose gum]
gb|EPS73616.1|  hypothetical protein M569_01145                         217   3e-66   Genlisea aurea
ref|XP_006291739.1|  hypothetical protein CARUB_v10017909mg             217   4e-66   Capsella rubella
gb|ABK22748.1|  unknown                                                 216   5e-66   Picea sitchensis
gb|EMT06999.1|  Reticulon-like protein B1                               216   6e-66   
ref|XP_008458672.1|  PREDICTED: reticulon-like protein B2               216   8e-66   Cucumis melo [Oriental melon]
ref|XP_004961431.1|  PREDICTED: reticulon-like protein B1-like          216   8e-66   Setaria italica
ref|NP_001130091.1|  uncharacterized protein LOC100191184               216   1e-65   
ref|XP_010469092.1|  PREDICTED: reticulon-like protein B6               216   1e-65   
ref|XP_010413382.1|  PREDICTED: reticulon-like protein B6               215   2e-65   
ref|XP_010105716.1|  Reticulon-like protein                             216   2e-65   
ref|XP_010523772.1|  PREDICTED: reticulon-like protein B5               215   3e-65   
ref|XP_004159803.1|  PREDICTED: reticulon-like protein B2-like          214   4e-65   
ref|NP_191715.2|  reticulon-like protein B6                             214   5e-65   
ref|XP_002876621.1|  reticulon family protein                           214   5e-65   
ref|XP_003563831.1|  PREDICTED: reticulon-like protein B1               213   3e-64   
ref|XP_010512508.1|  PREDICTED: reticulon-like protein B6               211   6e-64   
gb|EEE65781.1|  hypothetical protein OsJ_21474                          224   7e-64   
ref|XP_007040376.1|  Reticulan like protein B3, putative isoform 1      211   1e-63   
ref|XP_008788043.1|  PREDICTED: reticulon-like protein B5               209   2e-63   
ref|XP_009419823.1|  PREDICTED: reticulon-like protein B2               209   3e-63   
ref|XP_008239009.1|  PREDICTED: reticulon-like protein B2               209   4e-63   
ref|XP_003572248.1|  PREDICTED: reticulon-like protein B2               208   6e-63   
ref|XP_003592173.1|  Reticulon family protein                           208   8e-63   
ref|XP_004951242.1|  PREDICTED: reticulon-like protein B2-like          208   9e-63   
gb|ABK23818.1|  unknown                                                 205   9e-63   
ref|XP_002317731.1|  hypothetical protein POPTR_0012s00980g             207   2e-62   
gb|KJB52679.1|  hypothetical protein B456_008G272900                    207   2e-62   
ref|XP_006842617.1|  hypothetical protein AMTR_s00077p00178230          207   3e-62   
ref|XP_010938076.1|  PREDICTED: reticulon-like protein B1               207   3e-62   
ref|XP_009399837.1|  PREDICTED: reticulon-like protein B5               204   4e-61   
ref|XP_004496510.1|  PREDICTED: reticulon-like protein B1-like          204   6e-61   
ref|XP_002275520.1|  PREDICTED: reticulon-like protein B5               203   8e-61   
ref|XP_010931411.1|  PREDICTED: reticulon-like protein B6               202   1e-60   
gb|KHN21799.1|  Reticulon-like protein B1                               201   4e-60   
ref|XP_006589518.1|  PREDICTED: reticulon-like protein B1-like          201   4e-60   
ref|XP_010921231.1|  PREDICTED: reticulon-like protein B1 isoform X1    200   1e-59   
ref|XP_008793405.1|  PREDICTED: reticulon-like protein B1               200   1e-59   
ref|XP_007143486.1|  hypothetical protein PHAVU_007G075900g             199   5e-59   
gb|ABK26525.1|  unknown                                                 198   6e-59   
gb|EMS49910.1|  Reticulon-like protein B3                               200   1e-58   
ref|XP_010278922.1|  PREDICTED: reticulon-like protein B5               197   1e-58   
ref|XP_003555396.1|  PREDICTED: reticulon-like protein B1-like          197   2e-58   
gb|KHN12926.1|  Reticulon-like protein B1                               197   2e-58   
ref|XP_009404680.1|  PREDICTED: reticulon-like protein B2               196   4e-58   
gb|EPS64109.1|  hypothetical protein M569_10676                         196   7e-58   
gb|KCW46475.1|  hypothetical protein EUGRSUZ_K00300                     192   9e-58   
gb|EPS69502.1|  hypothetical protein M569_05265                         194   3e-57   
gb|EEC80692.1|  hypothetical protein OsI_23118                          205   6e-57   
dbj|BAH20346.1|  AT4G11220                                              190   7e-57   
ref|XP_009400146.1|  PREDICTED: reticulon-like protein B1               193   8e-57   
ref|XP_009787619.1|  PREDICTED: reticulon-like protein B5               192   1e-56   
ref|XP_004247011.1|  PREDICTED: reticulon-like protein B5               191   3e-56   
ref|XP_006654252.1|  PREDICTED: reticulon-like protein B1-like          190   9e-56   
ref|XP_009621222.1|  PREDICTED: reticulon-like protein B5               189   2e-55   
gb|EAY97489.1|  hypothetical protein OsI_19418                          189   3e-55   
ref|XP_009783850.1|  PREDICTED: reticulon-like protein B8               188   8e-55   
ref|NP_001055164.1|  Os05g0312500                                       187   1e-54   
ref|XP_009601019.1|  PREDICTED: reticulon-like protein B8               187   1e-54   
ref|XP_004962474.1|  PREDICTED: reticulon-like protein B1-like          187   2e-54   
ref|XP_009631244.1|  PREDICTED: reticulon-like protein B2 isoform X1    186   3e-54   
ref|XP_009793495.1|  PREDICTED: reticulon-like protein B2               186   4e-54   
ref|NP_001149072.1|  LOC100282693                                       186   4e-54   
ref|XP_009631245.1|  PREDICTED: reticulon-like protein B2 isoform X2    186   4e-54   
ref|XP_008647873.1|  PREDICTED: LOC100282693 isoform X1                 186   6e-54   
gb|KJB39437.1|  hypothetical protein B456_007G013600                    185   9e-54   
dbj|BAK06264.1|  predicted protein                                      185   1e-53   
gb|EPS67049.1|  hypothetical protein M569_07727                         183   2e-53   
ref|XP_010323110.1|  PREDICTED: reticulon-like protein B2               181   4e-53   
ref|NP_001150935.1|  seed maturation protein                            183   5e-53   
gb|EYU36885.1|  hypothetical protein MIMGU_mgv1a013116mg                182   9e-53   
ref|XP_004161550.1|  PREDICTED: reticulon-like protein B8-like          181   2e-52   
ref|XP_010904667.1|  PREDICTED: reticulon-like protein B8               181   3e-52   
ref|XP_010054120.1|  PREDICTED: reticulon-like protein B8 isoform X2    181   3e-52   
ref|XP_007017116.1|  VIRB2-interacting protein 2, putative              182   3e-52   
ref|XP_002521590.1|  conserved hypothetical protein                     180   5e-52   
ref|XP_003568686.1|  PREDICTED: reticulon-like protein B1               180   7e-52   
gb|KCW89791.1|  hypothetical protein EUGRSUZ_A02040                     181   1e-51   
ref|XP_006836413.1|  hypothetical protein AMTR_s00092p00151450          179   1e-51   
ref|XP_006366828.1|  PREDICTED: reticulon-like protein B2-like          180   1e-51   
ref|XP_004499535.1|  PREDICTED: reticulon-like protein B8-like is...    179   1e-51   
ref|XP_002302126.2|  reticulon family protein                           179   2e-51   
gb|EMS52545.1|  Reticulon-like protein B1                               179   3e-51   
ref|XP_011026205.1|  PREDICTED: reticulon-like protein B8               178   4e-51   
ref|XP_006437080.1|  hypothetical protein CICLE_v10032550mg             178   4e-51   
ref|XP_008451843.1|  PREDICTED: reticulon-like protein B8 isoform X2    178   4e-51   
ref|XP_007048924.1|  Reticulon family protein                           177   6e-51   
ref|XP_008451841.1|  PREDICTED: reticulon-like protein B8 isoform X1    178   9e-51   
ref|XP_006339395.1|  PREDICTED: reticulon-like protein B5-like          178   9e-51   
ref|XP_006485002.1|  PREDICTED: reticulon-like protein B8-like is...    177   1e-50   
ref|XP_010906987.1|  PREDICTED: reticulon-like protein B2               176   1e-50   
ref|XP_011080610.1|  PREDICTED: reticulon-like protein B5               176   2e-50   
ref|XP_010054092.1|  PREDICTED: reticulon-like protein B8 isoform X1    176   2e-50   
gb|KDP36280.1|  hypothetical protein JCGZ_10290                         176   4e-50   
ref|NP_566371.1|  reticulon-like protein B8                             175   5e-50   
gb|KDP45665.1|  hypothetical protein JCGZ_17272                         174   5e-50   
ref|XP_002306759.1|  reticulon family protein                           175   7e-50   
gb|ABC69764.1|  unknown                                                 174   8e-50   
ref|NP_850552.1|  reticulon-like protein B8                             175   9e-50   
ref|XP_011032748.1|  PREDICTED: reticulon-like protein B8 isoform X1    174   2e-49   
gb|KCW46474.1|  hypothetical protein EUGRSUZ_K00300                     172   2e-49   
ref|XP_009777726.1|  PREDICTED: reticulon-like protein B8               174   2e-49   
ref|XP_008229593.1|  PREDICTED: reticulon-like protein B8               174   2e-49   
ref|XP_007215866.1|  hypothetical protein PRUPE_ppa010481mg             174   2e-49   
ref|XP_011032749.1|  PREDICTED: reticulon-like protein B8 isoform X2    173   3e-49   
ref|XP_008461104.1|  PREDICTED: reticulon-like protein B9               172   3e-49   
gb|ABK26009.1|  unknown                                                 172   3e-49   
ref|XP_009596514.1|  PREDICTED: reticulon-like protein B8               173   4e-49   
ref|XP_010247587.1|  PREDICTED: reticulon-like protein B8               173   5e-49   
ref|XP_006407589.1|  hypothetical protein EUTSA_v10021400mg             172   6e-49   
emb|CDY41331.1|  BnaA01g31880D                                          172   6e-49   
gb|KFK30707.1|  hypothetical protein AALP_AA6G017300                    172   6e-49   
gb|KCW72351.1|  hypothetical protein EUGRSUZ_E00805                     171   8e-49   
ref|XP_011467620.1|  PREDICTED: reticulon-like protein B8 isoform X2    172   1e-48   
ref|XP_010486627.1|  PREDICTED: reticulon-like protein B8               172   1e-48   
ref|XP_004963616.1|  PREDICTED: reticulon-like protein B9-like          171   3e-48   
ref|XP_009123032.1|  PREDICTED: reticulon-like protein B8               171   3e-48   
ref|XP_002283026.1|  PREDICTED: reticulon-like protein B8               171   3e-48   
ref|XP_010552962.1|  PREDICTED: reticulon-like protein B8               170   5e-48   
ref|XP_010482050.1|  PREDICTED: reticulon-like protein B8               170   5e-48   
ref|XP_009146855.1|  PREDICTED: reticulon-like protein B8 isoform X2    170   6e-48   
gb|KDO44767.1|  hypothetical protein CISIN_1g025770mg                   170   7e-48   
emb|CDP18758.1|  unnamed protein product                                169   1e-47   
ref|XP_009146854.1|  PREDICTED: reticulon-like protein B8 isoform X1    169   1e-47   
gb|KHN11998.1|  Reticulon-like protein B8                               169   1e-47   
ref|XP_002463790.1|  hypothetical protein SORBIDRAFT_01g006220          169   1e-47   
ref|XP_010464699.1|  PREDICTED: reticulon-like protein B8               169   2e-47   
emb|CDY00916.1|  BnaC05g42840D                                          168   2e-47   
emb|CDY56712.1|  BnaC01g38700D                                          171   2e-47   
ref|NP_001051461.1|  Os03g0781700                                       168   2e-47   
ref|XP_009415631.1|  PREDICTED: reticulon-like protein B2               167   3e-47   
emb|CDY13240.1|  BnaC09g24160D                                          166   3e-47   
ref|XP_009356582.1|  PREDICTED: reticulon-like protein B8 isoform X2    167   4e-47   
gb|AGT16133.1|  hypothetical protein SHCRBa_127_N06_F_30                167   4e-47   
gb|EAY92056.1|  hypothetical protein OsI_13754                          168   5e-47   
ref|XP_004137485.1|  PREDICTED: reticulon-like protein B9-like          166   6e-47   
ref|XP_011467618.1|  PREDICTED: reticulon-like protein B8 isoform X1    167   6e-47   
gb|EMT10142.1|  Reticulon-like protein B1                               168   6e-47   
gb|EAY98925.1|  hypothetical protein OsI_20880                          166   7e-47   
ref|XP_010036176.1|  PREDICTED: reticulon-like protein B8               167   8e-47   
ref|XP_008782310.1|  PREDICTED: reticulon-like protein B1               166   1e-46   
ref|XP_010906857.1|  PREDICTED: reticulon-like protein B8 isoform X1    167   1e-46   
ref|NP_001150885.1|  seed maturation protein                            166   1e-46   
ref|NP_001241930.1|  uncharacterized protein LOC100787981               166   1e-46   
ref|XP_006650682.1|  PREDICTED: reticulon-like protein B8-like          166   1e-46   
ref|XP_008811812.1|  PREDICTED: reticulon-like protein B8               166   2e-46   
ref|XP_011008495.1|  PREDICTED: reticulon-like protein B2               166   2e-46   
ref|XP_003532073.1|  PREDICTED: reticulon-like protein B8-like is...    166   2e-46   
gb|KHG28741.1|  Reticulon-like protein B8                               166   3e-46   
ref|XP_009403393.1|  PREDICTED: reticulon-like protein B8               166   4e-46   
ref|XP_004981542.1|  PREDICTED: reticulon-like protein B8-like          167   4e-46   
ref|XP_006351999.1|  PREDICTED: reticulon-like protein B8-like          165   4e-46   
ref|XP_006366629.1|  PREDICTED: reticulon-like protein B8-like is...    166   4e-46   
ref|XP_007141449.1|  hypothetical protein PHAVU_008G196600g             165   4e-46   
ref|XP_008792884.1|  PREDICTED: reticulon-like protein B6               164   4e-46   
ref|XP_007146289.1|  hypothetical protein PHAVU_006G028000g             165   5e-46   
gb|ACG31942.1|  seed maturation protein                                 165   6e-46   
ref|NP_192032.1|  reticulon-like protein B7                             164   6e-46   
ref|XP_006366628.1|  PREDICTED: reticulon-like protein B8-like is...    165   6e-46   
sp|Q9M145.2|RTNLG_ARATH  RecName: Full=Reticulon-like protein B7;...    164   6e-46   
ref|XP_009376960.1|  PREDICTED: reticulon-like protein B8               164   7e-46   
ref|XP_004251554.1|  PREDICTED: reticulon-like protein B8 isoform X2    164   9e-46   
ref|XP_006855801.1|  hypothetical protein AMTR_s00044p00221140          163   1e-45   
emb|CDY07184.1|  BnaCnng01990D                                          164   1e-45   
ref|XP_010926506.1|  PREDICTED: reticulon-like protein B2               163   1e-45   
ref|XP_006654743.1|  PREDICTED: reticulon-like protein B9-like          163   1e-45   
ref|XP_009111430.1|  PREDICTED: reticulon-like protein B7 isoform X1    164   1e-45   
ref|XP_009111438.1|  PREDICTED: reticulon-like protein B7 isoform X2    164   1e-45   
gb|KDP35031.1|  hypothetical protein JCGZ_09319                         163   2e-45   
ref|XP_011096983.1|  PREDICTED: reticulon-like protein B9               162   2e-45   
ref|XP_008380166.1|  PREDICTED: reticulon-like protein B8 isoform X4    164   2e-45   
gb|AFK34561.1|  unknown                                                 164   2e-45   
ref|XP_008380160.1|  PREDICTED: reticulon-like protein B8 isoform X2    164   2e-45   
ref|XP_010313685.1|  PREDICTED: reticulon-like protein B8 isoform X1    164   2e-45   
gb|ACG26944.1|  seed maturation protein                                 163   2e-45   
ref|XP_002441477.1|  hypothetical protein SORBIDRAFT_09g027580          162   2e-45   
tpg|DAA51729.1|  TPA: seed maturation protein                           164   2e-45   
ref|NP_001137021.1|  seed maturation protein isoform 1                  163   2e-45   
ref|XP_010279360.1|  PREDICTED: reticulon-like protein B9               162   4e-45   
ref|XP_010023631.1|  PREDICTED: reticulon-like protein B8 isoform X2    164   5e-45   
gb|KJB52212.1|  hypothetical protein B456_008G250900                    161   6e-45   
ref|XP_004243617.1|  PREDICTED: reticulon-like protein B8               162   8e-45   
ref|XP_002319442.2|  hypothetical protein POPTR_0013s15680g             162   9e-45   
ref|XP_011085435.1|  PREDICTED: reticulon-like protein B8               162   1e-44   
ref|XP_008342327.1|  PREDICTED: reticulon-like protein B8               161   1e-44   
ref|XP_011100485.1|  PREDICTED: reticulon-like protein B8               161   1e-44   
ref|XP_002872901.1|  reticulon family protein                           161   1e-44   
ref|XP_009385406.1|  PREDICTED: reticulon-like protein B2 isoform X1    160   2e-44   
ref|XP_009356580.1|  PREDICTED: reticulon-like protein B8 isoform X1    160   3e-44   
ref|XP_006289795.1|  hypothetical protein CARUB_v10003398mg             160   3e-44   
ref|XP_003519525.1|  PREDICTED: uncharacterized LOC100500122 isof...    160   4e-44   
gb|KJB71174.1|  hypothetical protein B456_011G126300                    160   4e-44   
emb|CDP04019.1|  unnamed protein product                                159   5e-44   
ref|XP_002884786.1|  reticulon family protein                           159   7e-44   
ref|XP_004299572.1|  PREDICTED: reticulon-like protein B9               158   9e-44   
ref|XP_006298417.1|  hypothetical protein CARUB_v10014488mg             159   1e-43   
ref|XP_010093192.1|  Reticulon-like protein                             159   1e-43   
ref|XP_010688858.1|  PREDICTED: reticulon-like protein B8               159   1e-43   
gb|KJB71173.1|  hypothetical protein B456_011G126300                    160   1e-43   
dbj|BAK05980.1|  predicted protein                                      158   1e-43   
ref|XP_007209013.1|  hypothetical protein PRUPE_ppa023407mg             157   2e-43   
ref|XP_010023623.1|  PREDICTED: reticulon-like protein B8 isoform X1    159   2e-43   
ref|NP_001058867.1|  Os07g0142000                                       158   3e-43   
ref|XP_003565315.1|  PREDICTED: reticulon-like protein B4               157   3e-43   
ref|XP_010228928.1|  PREDICTED: reticulon-like protein B8               157   3e-43   
ref|XP_010036908.1|  PREDICTED: reticulon-like protein B9               156   5e-43   
gb|KHN28537.1|  Reticulon-like protein B8                               156   8e-43   
gb|KJB41425.1|  hypothetical protein B456_007G104000                    152   1e-42   
ref|XP_008380161.1|  PREDICTED: reticulon-like protein B8 isoform X3    156   1e-42   
ref|XP_007139766.1|  hypothetical protein PHAVU_008G057300g             155   1e-42   
gb|ABK94711.1|  unknown                                                 153   1e-42   
ref|XP_009347494.1|  PREDICTED: reticulon-like protein B9               155   1e-42   
ref|XP_006396287.1|  hypothetical protein EUTSA_v10029354mg             155   1e-42   
ref|XP_008380159.1|  PREDICTED: reticulon-like protein B8 isoform X1    156   2e-42   
gb|EYU42855.1|  hypothetical protein MIMGU_mgv1a012522mg                155   2e-42   
ref|XP_008240229.1|  PREDICTED: reticulon-like protein B9               155   2e-42   
gb|KJB41424.1|  hypothetical protein B456_007G104000                    151   2e-42   
ref|XP_006491909.1|  PREDICTED: reticulon-like protein B5-like is...    156   2e-42   
ref|XP_006432015.1|  hypothetical protein CICLE_v10002112mg             156   3e-42   
emb|CAN77759.1|  hypothetical protein VITISV_034907                     155   3e-42   
ref|XP_002527026.1|  conserved hypothetical protein                     154   4e-42   
gb|KEH33648.1|  reticulon-like protein B2                               154   5e-42   
dbj|BAH20230.1|  AT4G23630                                              150   6e-42   
ref|XP_006602275.1|  PREDICTED: reticulon-like protein B8-like is...    154   6e-42   
ref|XP_009416749.1|  PREDICTED: reticulon-like protein B8 isoform X1    154   6e-42   
gb|KEH33647.1|  reticulon-like protein B2                               154   7e-42   
ref|XP_006413534.1|  hypothetical protein EUTSA_v10025959mg             153   7e-42   
ref|XP_006491906.1|  PREDICTED: reticulon-like protein B5-like is...    156   8e-42   



>ref|XP_004245560.1| PREDICTED: reticulon-like protein B4 [Solanum lycopersicum]
Length=270

 Score =   295 bits (756),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 155/184 (84%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWRNKKIS G LGGATAIW+LFEV+EYHLLT +CHGL++ALA LFLWSNAS+FI K
Sbjct  85   ADVFLWRNKKISAGFLGGATAIWVLFEVVEYHLLTLLCHGLMIALAGLFLWSNASTFIHK  144

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            SAPHIPEVHIPE+PVL+FASALRN++N  LAVLR+IASGRDLKMFL+VI GLW+ SI+G 
Sbjct  145  SAPHIPEVHIPEKPVLEFASALRNEINRALAVLREIASGRDLKMFLLVIGGLWLASILGG  204

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            CCDFLTLFYI VV+LHTVPVLYEKYED+VDAFAEKA+HELKKQYAV DAKVLSKIPRGPL
Sbjct  205  CCDFLTLFYIIVVVLHTVPVLYEKYEDQVDAFAEKALHELKKQYAVLDAKVLSKIPRGPL  264

Query  193  KDKK  182
            KDKK
Sbjct  265  KDKK  268



>ref|XP_006343915.1| PREDICTED: reticulon-like protein B1-like [Solanum tuberosum]
Length=270

 Score =   293 bits (751),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 155/184 (84%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWRNKKIS G LGGATAIW+LFEV+EYHLLT +CHGL++ALA LFLWSNAS+FI K
Sbjct  85   ADVFLWRNKKISAGFLGGATAIWVLFEVVEYHLLTLLCHGLMVALAGLFLWSNASTFIHK  144

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            SAPHIPEVHIPE+PVL FASALRN++N  LAVLR+IASGRDLK FL+VI GLW+ SI+G 
Sbjct  145  SAPHIPEVHIPEKPVLAFASALRNEINRALAVLREIASGRDLKTFLLVIGGLWLASILGG  204

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            CCDFLTLFYI VV+LHTVPVLYEKYED+VDAFAEKA+HELKKQYAVFDAKVLSKIPRGPL
Sbjct  205  CCDFLTLFYIIVVVLHTVPVLYEKYEDQVDAFAEKALHELKKQYAVFDAKVLSKIPRGPL  264

Query  193  KDKK  182
            KDKK
Sbjct  265  KDKK  268



>ref|XP_009793558.1| PREDICTED: reticulon-like protein B4 [Nicotiana sylvestris]
Length=268

 Score =   291 bits (746),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 150/186 (81%), Positives = 172/186 (92%), Gaps = 0/186 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWRNKKIS G LGGATAIW+LFEV+EYH LT +CHGLI+ALA LFLWSNAS+FI K
Sbjct  83   ADVFLWRNKKISAGFLGGATAIWVLFEVVEYHFLTLLCHGLIVALAGLFLWSNASAFIHK  142

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            SAPHIPEVHIPE+PVL+FA+ LRN++N   AVLR+IA+GRDLK FLMVI GLWI+S++GS
Sbjct  143  SAPHIPEVHIPEKPVLEFATGLRNEINRAFAVLREIAAGRDLKTFLMVIGGLWILSVLGS  202

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            CCDFL+LFYI VV+LHTVPVLYEKYED++D+FAEKA+HELKKQYAVFDAKVLSKIPRGPL
Sbjct  203  CCDFLSLFYIIVVVLHTVPVLYEKYEDQIDSFAEKALHELKKQYAVFDAKVLSKIPRGPL  262

Query  193  KDKKLA  176
            +DKK A
Sbjct  263  RDKKKA  268



>ref|XP_009598008.1| PREDICTED: reticulon-like protein B2, partial [Nicotiana tomentosiformis]
Length=197

 Score =   286 bits (733),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 150/186 (81%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWRNKKIS G LGGATAIW+LFEV+EYH LT +CH LI+ALA LFLWSNAS+FI K
Sbjct  12   ADVFLWRNKKISAGFLGGATAIWVLFEVVEYHFLTLLCHCLIVALAGLFLWSNASAFIHK  71

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            SAPHIPEVHIPE+PVL+FA+ LRN++N   AVLR+IA+GRDLKMFLMVI GLWI+S++GS
Sbjct  72   SAPHIPEVHIPEKPVLEFATGLRNEINRAFAVLREIAAGRDLKMFLMVIGGLWILSVLGS  131

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            CCDFL+LFYI VV+LHTVPVLYEKYED++D+FAEKA HELKKQYAVFDAKVLSKIPRGPL
Sbjct  132  CCDFLSLFYIIVVVLHTVPVLYEKYEDQIDSFAEKAFHELKKQYAVFDAKVLSKIPRGPL  191

Query  193  KDKKLA  176
            +DKK A
Sbjct  192  RDKKKA  197



>gb|KHG24129.1| Reticulon-like protein B3 [Gossypium arboreum]
Length=250

 Score =   277 bits (708),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 145/184 (79%), Positives = 162/184 (88%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+FLWRNKKIS G LG AT IWILFE+LEYHLLT VCH LILALAVLFLWSNA++FI K
Sbjct  65   ADIFLWRNKKISAGALGVATVIWILFEMLEYHLLTLVCHLLILALAVLFLWSNAATFINK  124

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IPEV IP++PV++FA ALR ++N   AVLRDIASGR+LK FL VI GLW++SIVGS
Sbjct  125  SPPRIPEVQIPKDPVMEFAQALRFEINRAFAVLRDIASGRELKKFLSVIAGLWVLSIVGS  184

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
             C+FLTLFYI  VLLHTVPVLYEKYED+VD FAEKAMHE+KKQYAVFDAKVLSKIPRGPL
Sbjct  185  WCNFLTLFYIVFVLLHTVPVLYEKYEDKVDPFAEKAMHEIKKQYAVFDAKVLSKIPRGPL  244

Query  193  KDKK  182
            K+KK
Sbjct  245  KEKK  248



>ref|XP_002509881.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51268.1| conserved hypothetical protein [Ricinus communis]
Length=260

 Score =   276 bits (707),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 148/186 (80%), Positives = 167/186 (90%), Gaps = 0/186 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+FLWRNKK+S GVLG ATA+W+LFE++EYHLLT +CHG ILALA+LFLWSNAS+FI K
Sbjct  75   ADIFLWRNKKVSAGVLGFATAVWVLFELIEYHLLTLICHGFILALAILFLWSNASTFINK  134

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S PHIPEVHIPEEPVLQ A+ALR ++N+  A+LRDIASGRDLK FL VI GLW++SIVGS
Sbjct  135  SPPHIPEVHIPEEPVLQVAAALRMEINYAFAILRDIASGRDLKKFLSVIAGLWVLSIVGS  194

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
             C+FLTLFYIA VLLHTVPV YEKYED+VDAFAEKA  E+KKQYAVFDAKVLSKIPRGPL
Sbjct  195  WCNFLTLFYIAFVLLHTVPVFYEKYEDKVDAFAEKAAIEIKKQYAVFDAKVLSKIPRGPL  254

Query  193  KDKKLA  176
            KDKK A
Sbjct  255  KDKKKA  260



>emb|CDP12094.1| unnamed protein product [Coffea canephora]
Length=252

 Score =   275 bits (703),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 142/184 (77%), Positives = 161/184 (88%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVF+WRNK+IS GVLG ATAIW+LFE+LEYHLLT VCHGLI+ LAVLFLWSNAS+FI K
Sbjct  67   ADVFMWRNKQISAGVLGVATAIWVLFEILEYHLLTLVCHGLIIVLAVLFLWSNASTFINK  126

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IPEV +PE+PVLQFAS  R  +N   A+LRD+ASGR+LK FL VI GLWI SI+GS
Sbjct  127  SPPRIPEVSVPEKPVLQFASDARVAINQTFALLRDVASGRNLKKFLSVIAGLWIFSILGS  186

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            CCDFLTL YI+ VLLHTVPV+Y+KYED+VD+FAEKA+ ELKKQYAVFD KVLSKIPRGPL
Sbjct  187  CCDFLTLLYISAVLLHTVPVIYDKYEDQVDSFAEKALAELKKQYAVFDKKVLSKIPRGPL  246

Query  193  KDKK  182
            KDKK
Sbjct  247  KDKK  250



>ref|XP_010251601.1| PREDICTED: reticulon-like protein B2 [Nelumbo nucifera]
Length=254

 Score =   275 bits (702),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 146/186 (78%), Positives = 166/186 (89%), Gaps = 0/186 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWRNKKIS GVLGGATA W+LFE+LEYHLLT VCH LI++LAVLFL+SNA +F+ K
Sbjct  69   ADVFLWRNKKISAGVLGGATATWVLFELLEYHLLTLVCHCLIVSLAVLFLYSNAIAFMHK  128

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            + P IPEV+IPE+PVLQFASALR ++N   AVLRDIASGRDLK FL VI GLW++SIVGS
Sbjct  129  TPPRIPEVYIPEDPVLQFASALRIEINRAFAVLRDIASGRDLKKFLAVIAGLWVLSIVGS  188

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
             C+FLTLFYIA VLLHTVPVLYEKYED+VD+FAEKAM E+KKQY +FDAKVLSKIP+GPL
Sbjct  189  WCNFLTLFYIAFVLLHTVPVLYEKYEDQVDSFAEKAMAEIKKQYVIFDAKVLSKIPKGPL  248

Query  193  KDKKLA  176
            KDKK A
Sbjct  249  KDKKHA  254



>ref|XP_009597328.1| PREDICTED: reticulon-like protein B5 [Nicotiana tomentosiformis]
Length=268

 Score =   274 bits (700),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 143/184 (78%), Positives = 164/184 (89%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWRNKKIS  VLGGATAIW+LFE+LEYHLLT +CH LI++LAVLFLWSNA++FI K
Sbjct  83   ADVFLWRNKKISASVLGGATAIWVLFELLEYHLLTLICHILIISLAVLFLWSNATTFINK  142

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
              PHIPE+H+P++P LQ ASALR ++N  LA+LR+IASGR+LK FL V+ GLWIISIVGS
Sbjct  143  KPPHIPEIHLPQDPFLQVASALRIEINRALALLREIASGRELKKFLGVVAGLWIISIVGS  202

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
             C+FLTLFYI+ VLLHTVPVLYEKYED+VD  AEKAMHE+KKQYAVFD KVLSKIPRGPL
Sbjct  203  WCNFLTLFYISFVLLHTVPVLYEKYEDKVDPLAEKAMHEIKKQYAVFDKKVLSKIPRGPL  262

Query  193  KDKK  182
            KDKK
Sbjct  263  KDKK  266



>ref|XP_010658515.1| PREDICTED: reticulon-like protein B2 [Vitis vinifera]
 emb|CBI34409.3| unnamed protein product [Vitis vinifera]
Length=252

 Score =   272 bits (696),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 145/187 (78%), Positives = 166/187 (89%), Gaps = 0/187 (0%)
 Frame = -1

Query  736  QADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIK  557
             ADV LWRNKKIS GVLGGATA+WILFE+LEYHLLT VCH  ILALA+LFLWSNA++FI 
Sbjct  66   PADVVLWRNKKISAGVLGGATAVWILFELLEYHLLTLVCHCSILALAILFLWSNATTFIN  125

Query  556  KSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVG  377
            K+ PHIPEVHIPE+PVLQFASALR ++N    +LR++ASG+DLK FL VI GLW++SIVG
Sbjct  126  KAPPHIPEVHIPEDPVLQFASALRIEINRGFTLLRNVASGKDLKKFLSVIAGLWVVSIVG  185

Query  376  SCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGP  197
            S C+FLTLFYI  VLLHTVPVLYEKYED VD+FAEKAM E+K+QYAVFDAKVLS+IPRGP
Sbjct  186  SWCNFLTLFYIVFVLLHTVPVLYEKYEDPVDSFAEKAMVEIKRQYAVFDAKVLSRIPRGP  245

Query  196  LKDKKLA  176
            LKDKK+A
Sbjct  246  LKDKKIA  252



>ref|XP_006339640.1| PREDICTED: reticulon-like protein B1-like [Solanum tuberosum]
Length=265

 Score =   271 bits (694),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 144/184 (78%), Positives = 163/184 (89%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWRNKKIS  VLGGATAIW+LFE+LEYHLLT +CH LI+ LAVLFLWSNA++FI K
Sbjct  80   ADVFLWRNKKISGTVLGGATAIWVLFELLEYHLLTLICHILIITLAVLFLWSNATTFINK  139

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
              PHIPEVH+PE P+LQ ASALR ++N  L +LR+IASGR+LK FL VI GLWI+SIVGS
Sbjct  140  KPPHIPEVHLPEGPILQVASALRIEINRALDLLREIASGRELKKFLAVIAGLWILSIVGS  199

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
             C+FLTLFYI+ VLLHT+PVLYEKYED+VD  AEKAMHE+KKQYAVFDAKVLSKIPRGPL
Sbjct  200  WCNFLTLFYISFVLLHTIPVLYEKYEDKVDPLAEKAMHEIKKQYAVFDAKVLSKIPRGPL  259

Query  193  KDKK  182
            KDKK
Sbjct  260  KDKK  263



>ref|XP_009766982.1| PREDICTED: reticulon-like protein B5 [Nicotiana sylvestris]
Length=266

 Score =   271 bits (693),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 142/184 (77%), Positives = 163/184 (89%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWRNKKIS  VLGGATAIW+LFE+LEYHLLT +CH LI++LAVLFLWSNA++FI K
Sbjct  81   ADVFLWRNKKISASVLGGATAIWVLFELLEYHLLTLICHILIISLAVLFLWSNATTFINK  140

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
              PHIPE+H+P++P LQ ASALR ++N  LA+LR+IASGR+LK FL V+ GLWI+SIVGS
Sbjct  141  KPPHIPEIHLPQDPFLQVASALRIEINRALALLREIASGRELKKFLGVVAGLWILSIVGS  200

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
             C+FLTLFYI  VLLHTVPVLYEKYED+VD  AEKAMHE+KKQYAVFD KVLSKIPRGPL
Sbjct  201  WCNFLTLFYILFVLLHTVPVLYEKYEDKVDPLAEKAMHEIKKQYAVFDEKVLSKIPRGPL  260

Query  193  KDKK  182
            KDKK
Sbjct  261  KDKK  264



>gb|KDP25363.1| hypothetical protein JCGZ_20519 [Jatropha curcas]
Length=257

 Score =   270 bits (691),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 145/184 (79%), Positives = 163/184 (89%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+FLWRNKKIS GVLGGATAIW+LFE++EYHLLT +CHGLIL+LAVLFLWSNAS+FI K
Sbjct  72   ADIFLWRNKKISAGVLGGATAIWVLFELIEYHLLTLICHGLILSLAVLFLWSNASTFINK  131

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IPEV+IPEEPVLQ A ALR+++N   AVLRDIASGRDLK FL VI GLW++SIVGS
Sbjct  132  SPPRIPEVYIPEEPVLQVADALRSEINWGFAVLRDIASGRDLKKFLSVIAGLWVLSIVGS  191

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
              +FLTLFYI  VLL+TVPV YEKYED+VD+ AEKA+ ELKKQYAV DAKVLSKIPRGPL
Sbjct  192  WVNFLTLFYIVFVLLYTVPVFYEKYEDKVDSLAEKALIELKKQYAVLDAKVLSKIPRGPL  251

Query  193  KDKK  182
            KDKK
Sbjct  252  KDKK  255



>ref|XP_004229935.1| PREDICTED: reticulon-like protein B1 [Solanum lycopersicum]
Length=263

 Score =   270 bits (689),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 142/184 (77%), Positives = 162/184 (88%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWRNKKIS  V+GGATAIW+LFE+LEYHLLT +CH LI+ LAVLFLWSNA++FI K
Sbjct  78   ADVFLWRNKKISATVIGGATAIWVLFELLEYHLLTLICHILIITLAVLFLWSNATTFINK  137

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
              PHIPEVH+PE P+LQ ASALR ++N  L +LR+IASGR+LK FL VI GLWI+SIVGS
Sbjct  138  KPPHIPEVHLPEGPILQVASALRIEINRALDLLREIASGRELKKFLAVIAGLWILSIVGS  197

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
             C+FLTLFYI+ VLLHTVPV+YEKYED+VD  AEKAMHE+KKQYAVFD KVLSKIPRGPL
Sbjct  198  WCNFLTLFYISFVLLHTVPVIYEKYEDKVDPLAEKAMHEIKKQYAVFDEKVLSKIPRGPL  257

Query  193  KDKK  182
            KDKK
Sbjct  258  KDKK  261



>ref|XP_008796064.1| PREDICTED: reticulon-like protein B2 [Phoenix dactylifera]
Length=253

 Score =   268 bits (686),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 135/184 (73%), Positives = 159/184 (86%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWRNKKIS GV+GGATA+W+LFE+LEYHLL+ VCH LIL+LA+LFLWSNAS+FI K
Sbjct  69   ADVFLWRNKKISAGVIGGATAVWVLFELLEYHLLSLVCHCLILSLAILFLWSNASTFINK  128

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            + P IPE  IPE+  +  A +LR ++N   AVLR+IASGRDLK FL+VI GLW++SI+GS
Sbjct  129  APPRIPEASIPEDLAVNVALSLRYEINRAFAVLREIASGRDLKKFLVVIAGLWVLSILGS  188

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            CC+FLTLFY  +V LHTVPVLYEKYED+VD+FAEKAM E+KKQY VFDAKVLSKIPR PL
Sbjct  189  CCNFLTLFYTMLVTLHTVPVLYEKYEDKVDSFAEKAMAEIKKQYGVFDAKVLSKIPRSPL  248

Query  193  KDKK  182
            KDKK
Sbjct  249  KDKK  252



>ref|XP_009763462.1| PREDICTED: reticulon-like protein B1 isoform X2 [Nicotiana sylvestris]
Length=263

 Score =   269 bits (687),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 139/186 (75%), Positives = 162/186 (87%), Gaps = 0/186 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWRNKKIS  VLGGATAIW+LFE+LEYHLL  VCH LI  LA+LFLWSNA++FI K
Sbjct  78   ADVFLWRNKKISASVLGGATAIWVLFELLEYHLLGLVCHLLIFTLAILFLWSNATTFINK  137

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
              PHIPE H+ EEP+L+ ASALR ++NH L VLR+IASGRDLK FL VI GLW++S++G+
Sbjct  138  KRPHIPEFHLLEEPILEIASALRIEINHILHVLREIASGRDLKKFLAVIAGLWVLSMLGN  197

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            CC+FLTLFYI+ VLLHTVPVLYEKYED+VD  AEKA+ E+KKQYAVFDA+VLSKIP+GPL
Sbjct  198  CCNFLTLFYISFVLLHTVPVLYEKYEDKVDPLAEKAVQEIKKQYAVFDARVLSKIPKGPL  257

Query  193  KDKKLA  176
            KDKK A
Sbjct  258  KDKKKA  263



>gb|AFK41983.1| unknown [Medicago truncatula]
Length=237

 Score =   267 bits (682),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 142/184 (77%), Positives = 158/184 (86%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWRNKKIS   LG ATA+W+LFE+LEYHLLT + H  ILALAVLFLWSNAS+FI K
Sbjct  52   ADVFLWRNKKISATTLGVATALWVLFELLEYHLLTLISHLAILALAVLFLWSNASTFINK  111

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IP+VHIPEEPVLQ ASA+R ++N   A+LRDIASGRDLK FL VI GLW++SIVGS
Sbjct  112  SPPKIPQVHIPEEPVLQIASAIRIEINRAFAILRDIASGRDLKQFLSVIAGLWVLSIVGS  171

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
              +FLTLFYIA VLLHTVPVLYEKYED VD+F EKA+HE KKQYAVFD KVLSKIP+GPL
Sbjct  172  WTNFLTLFYIAFVLLHTVPVLYEKYEDRVDSFGEKALHEFKKQYAVFDEKVLSKIPKGPL  231

Query  193  KDKK  182
            KDKK
Sbjct  232  KDKK  235



>ref|XP_008805646.1| PREDICTED: reticulon-like protein B3 [Phoenix dactylifera]
Length=254

 Score =   268 bits (684),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 139/185 (75%), Positives = 158/185 (85%), Gaps = 0/185 (0%)
 Frame = -1

Query  736  QADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIK  557
             ADV LWRNKKIS GVLGGATA+W+LFE+LEYHLLT V H LIL+LA+LFLWSNAS+FI 
Sbjct  69   PADVLLWRNKKISAGVLGGATAVWVLFELLEYHLLTLVGHCLILSLAILFLWSNASTFIS  128

Query  556  KSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVG  377
            K+ PHIPEV IPE+  +  A +LR ++N   A+LRDIASGRDLK FL VI GLW++SI+G
Sbjct  129  KTPPHIPEVSIPEDLAVNVALSLRYEINRAFAILRDIASGRDLKKFLAVIAGLWVLSILG  188

Query  376  SCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGP  197
            SCC+FLTLFYI  V LHTVPVLYEKYED+VD FAEKAM E+KKQY VFDAKVLSKIPRGP
Sbjct  189  SCCNFLTLFYIVFVTLHTVPVLYEKYEDKVDPFAEKAMAEIKKQYVVFDAKVLSKIPRGP  248

Query  196  LKDKK  182
            LKDKK
Sbjct  249  LKDKK  253



>ref|XP_010915765.1| PREDICTED: reticulon-like protein B2 [Elaeis guineensis]
Length=254

 Score =   267 bits (683),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 139/184 (76%), Positives = 159/184 (86%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWRNKKIS GVLGGATA+W+LFE+L+YHLLT V H L+L+LA+LFLWSNAS+FI K
Sbjct  70   ADVFLWRNKKISAGVLGGATAVWVLFELLDYHLLTLVGHCLVLSLAILFLWSNASTFINK  129

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
              PHIPEV IPE+  +  A +LR ++N   AVLRDIASGRDLK FL VI GLW++SI+GS
Sbjct  130  IPPHIPEVSIPEDVAINVALSLRYEINRAFAVLRDIASGRDLKKFLAVIAGLWVLSILGS  189

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            CC+FLTLFYI  V LHTVPVLYEKYED+VD+FAEKAM E+KKQY VFDAKVLSKIPRGPL
Sbjct  190  CCNFLTLFYILFVTLHTVPVLYEKYEDKVDSFAEKAMAEIKKQYVVFDAKVLSKIPRGPL  249

Query  193  KDKK  182
            KDKK
Sbjct  250  KDKK  253



>ref|XP_003633964.1| PREDICTED: reticulon-like protein B1 [Vitis vinifera]
 ref|XP_003633965.1| PREDICTED: reticulon-like protein B1 [Vitis vinifera]
 ref|XP_010661856.1| PREDICTED: reticulon-like protein B1 [Vitis vinifera]
 emb|CBI40444.3| unnamed protein product [Vitis vinifera]
Length=255

 Score =   267 bits (683),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 141/187 (75%), Positives = 163/187 (87%), Gaps = 0/187 (0%)
 Frame = -1

Query  736  QADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIK  557
             ADVFLWRNKKIS GVLGGATA+W+LFE+LEYHLLT VCH LIL+LA+LFLWSNA++FI 
Sbjct  69   HADVFLWRNKKISAGVLGGATAMWVLFELLEYHLLTLVCHILILSLAILFLWSNATTFIN  128

Query  556  KSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVG  377
            KS P IPEVHIPE+P LQ  +ALR ++N   AVLRDIASGRDLK FL++I GLW++SI+G
Sbjct  129  KSPPRIPEVHIPEDPFLQAVNALRIEINCGFAVLRDIASGRDLKKFLIIIAGLWVLSILG  188

Query  376  SCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGP  197
            SCC+FLTLFYI  VLLHTVPV+YEKYED +D FAEKA  E+KKQYAVFDAKVLSKIP+ P
Sbjct  189  SCCNFLTLFYITFVLLHTVPVIYEKYEDRIDPFAEKATIEIKKQYAVFDAKVLSKIPKVP  248

Query  196  LKDKKLA  176
            LK KK+A
Sbjct  249  LKYKKMA  255



>ref|XP_007160119.1| hypothetical protein PHAVU_002G294100g [Phaseolus vulgaris]
 gb|ESW32113.1| hypothetical protein PHAVU_002G294100g [Phaseolus vulgaris]
Length=254

 Score =   266 bits (681),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 143/185 (77%), Positives = 160/185 (86%), Gaps = 0/185 (0%)
 Frame = -1

Query  736  QADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIK  557
            QADVFLWRNKKIS   LG AT IWILFE+LEYHLLT VCH +ILALA LFLWSNAS+FI 
Sbjct  68   QADVFLWRNKKISASTLGVATVIWILFELLEYHLLTLVCHFVILALAGLFLWSNASTFIN  127

Query  556  KSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVG  377
            K  P IP+VHIPE+P+LQFASALR ++N   +VLRDIASGRDLK FL VI GLW+ SI+G
Sbjct  128  KRPPKIPQVHIPEDPILQFASALRIEINRAFSVLRDIASGRDLKKFLSVIAGLWVFSILG  187

Query  376  SCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGP  197
            S  +FLTLFYIA VLLHTVPVLYEKYED+VD+F EKA+ E+KKQYAVFDAKVLSKIP+GP
Sbjct  188  SWANFLTLFYIAFVLLHTVPVLYEKYEDQVDSFGEKAIAEIKKQYAVFDAKVLSKIPKGP  247

Query  196  LKDKK  182
            LKDKK
Sbjct  248  LKDKK  252



>ref|NP_001239711.1| uncharacterized protein LOC100811024 [Glycine max]
 gb|ACU21063.1| unknown [Glycine max]
 gb|KHN16777.1| Reticulon-like protein B2 [Glycine soja]
Length=254

 Score =   266 bits (680),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 144/184 (78%), Positives = 159/184 (86%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWRNKKIS   LG ATAIW+LFE+LEYHLLT VCH LIL LAVLFLWSNAS+FI K
Sbjct  69   ADVFLWRNKKISASTLGVATAIWVLFELLEYHLLTLVCHFLILGLAVLFLWSNASTFINK  128

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IP+VHIPE+PVL+FASALR ++N   A+LRDIASGRDLK FL VI GLW+ SI+GS
Sbjct  129  SPPKIPQVHIPEKPVLEFASALRVEINRAFALLRDIASGRDLKKFLSVIAGLWVFSILGS  188

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
              +FLTLFYIA VLLHTVPVLYEKYED VD+F  KA+ E+KKQYAVFDAKVLSKIPRGPL
Sbjct  189  WANFLTLFYIAFVLLHTVPVLYEKYEDHVDSFGGKAIAEIKKQYAVFDAKVLSKIPRGPL  248

Query  193  KDKK  182
            KDKK
Sbjct  249  KDKK  252



>gb|ACJ84486.1| unknown [Medicago truncatula]
 gb|AFK36476.1| unknown [Medicago truncatula]
 gb|KEH21160.1| seed maturation protein [Medicago truncatula]
Length=260

 Score =   266 bits (680),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 142/184 (77%), Positives = 158/184 (86%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWRNKKIS   LG ATA+W+LFE+LEYHLLT + H  ILALAVLFLWSNAS+FI K
Sbjct  75   ADVFLWRNKKISATTLGVATALWVLFELLEYHLLTLISHLAILALAVLFLWSNASTFINK  134

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IP+VHIPEEPVLQ ASA+R ++N   A+LRDIASGRDLK FL VI GLW++SIVGS
Sbjct  135  SPPKIPQVHIPEEPVLQIASAIRIEINRAFAILRDIASGRDLKQFLSVIAGLWVLSIVGS  194

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
              +FLTLFYIA VLLHTVPVLYEKYED VD+F EKA+HE KKQYAVFD KVLSKIP+GPL
Sbjct  195  WTNFLTLFYIAFVLLHTVPVLYEKYEDRVDSFGEKALHEFKKQYAVFDEKVLSKIPKGPL  254

Query  193  KDKK  182
            KDKK
Sbjct  255  KDKK  258



>ref|XP_003525365.1| PREDICTED: reticulon-like protein B2-like isoform 1 [Glycine 
max]
 gb|KHM99936.1| Reticulon-like protein B2 [Glycine soja]
Length=254

 Score =   266 bits (679),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 146/184 (79%), Positives = 159/184 (86%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWRNKKIS   LG ATAIW+LFE+LEYHLLT VCH LILALA LFLWSNAS+FI K
Sbjct  69   ADVFLWRNKKISASTLGVATAIWVLFELLEYHLLTLVCHFLILALAGLFLWSNASTFINK  128

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IP+VHIPEEPVL+FASALR ++N   AVLRDIASGRDLK FL VI GLW+ SI+G 
Sbjct  129  SPPKIPQVHIPEEPVLKFASALRIEINRAFAVLRDIASGRDLKKFLSVIAGLWVFSILGC  188

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
              +FLTLFYIA VLLHTVPVLYEKYED VD+F EKA+ E+KKQYAVFDAKVLSKIPRGPL
Sbjct  189  WANFLTLFYIAFVLLHTVPVLYEKYEDHVDSFGEKAIAEIKKQYAVFDAKVLSKIPRGPL  248

Query  193  KDKK  182
            KDKK
Sbjct  249  KDKK  252



>gb|ACU23452.1| unknown [Glycine max]
Length=253

 Score =   265 bits (678),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 146/184 (79%), Positives = 159/184 (86%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWRNKKIS   LG ATAIW+LFE+LEYHLLT VCH LILALA LFLWSNAS+FI K
Sbjct  68   ADVFLWRNKKISASTLGVATAIWVLFELLEYHLLTLVCHFLILALAGLFLWSNASTFINK  127

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IP+VHIPEEPVL+FASALR ++N   AVLRDIASGRDLK FL VI GLW+ SI+G 
Sbjct  128  SPPKIPQVHIPEEPVLKFASALRIEINRAFAVLRDIASGRDLKKFLSVIAGLWVFSILGC  187

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
              +FLTLFYIA VLLHTVPVLYEKYED VD+F EKA+ E+KKQYAVFDAKVLSKIPRGPL
Sbjct  188  WANFLTLFYIAFVLLHTVPVLYEKYEDHVDSFGEKAIAEIKKQYAVFDAKVLSKIPRGPL  247

Query  193  KDKK  182
            KDKK
Sbjct  248  KDKK  251



>ref|XP_010055800.1| PREDICTED: reticulon-like protein B1 [Eucalyptus grandis]
 gb|KCW72349.1| hypothetical protein EUGRSUZ_E00805 [Eucalyptus grandis]
Length=262

 Score =   266 bits (679),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 141/184 (77%), Positives = 159/184 (86%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWRNKKIS G LG ATA+WILFE+LEYHLLT VCH LIL LA+LFLWSNA++FI K
Sbjct  77   ADVFLWRNKKISAGALGVATALWILFELLEYHLLTLVCHVLILGLAILFLWSNATTFIHK  136

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
              PHIPEV IPE+PVL+FAS L +++N  +A LR+IASGRDLK FL+V+   W+ SIVGS
Sbjct  137  MPPHIPEVSIPEKPVLEFASVLSSEINQGIATLREIASGRDLKKFLLVVAVFWVFSIVGS  196

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            CC+FLTLFYIA VLLHTVPVLYEKYED+VD FAEKA  E+KKQYAVFD KVLSKIPRGPL
Sbjct  197  CCNFLTLFYIAFVLLHTVPVLYEKYEDKVDPFAEKATIEIKKQYAVFDEKVLSKIPRGPL  256

Query  193  KDKK  182
            KDKK
Sbjct  257  KDKK  260



>ref|XP_011026963.1| PREDICTED: reticulon-like protein B2 [Populus euphratica]
Length=254

 Score =   265 bits (678),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 153/184 (83%), Positives = 166/184 (90%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWRNKKIS GVLGGATAIW+LFE+LEYHLLT VCH LILALA+LFLWSNAS+FI K
Sbjct  69   ADVFLWRNKKISAGVLGGATAIWVLFELLEYHLLTLVCHCLILALALLFLWSNASTFINK  128

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IPEVHIPEEPVLQ A+ALR ++N   AVLRDIASGRDLK FL VI GLW++SIVGS
Sbjct  129  SPPRIPEVHIPEEPVLQIAAALRIEINQGFAVLRDIASGRDLKKFLTVIAGLWVLSIVGS  188

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
             C+F+TLFYIA VLLHTVPV YEKYED+VDAFAEKAM E+KKQYAVFDAKVLSKIPRGPL
Sbjct  189  WCNFVTLFYIAFVLLHTVPVFYEKYEDQVDAFAEKAMIEIKKQYAVFDAKVLSKIPRGPL  248

Query  193  KDKK  182
            KDKK
Sbjct  249  KDKK  252



>gb|KCW72347.1| hypothetical protein EUGRSUZ_E00805 [Eucalyptus grandis]
Length=265

 Score =   265 bits (678),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 141/184 (77%), Positives = 159/184 (86%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWRNKKIS G LG ATA+WILFE+LEYHLLT VCH LIL LA+LFLWSNA++FI K
Sbjct  77   ADVFLWRNKKISAGALGVATALWILFELLEYHLLTLVCHVLILGLAILFLWSNATTFIHK  136

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
              PHIPEV IPE+PVL+FAS L +++N  +A LR+IASGRDLK FL+V+   W+ SIVGS
Sbjct  137  MPPHIPEVSIPEKPVLEFASVLSSEINQGIATLREIASGRDLKKFLLVVAVFWVFSIVGS  196

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            CC+FLTLFYIA VLLHTVPVLYEKYED+VD FAEKA  E+KKQYAVFD KVLSKIPRGPL
Sbjct  197  CCNFLTLFYIAFVLLHTVPVLYEKYEDKVDPFAEKATIEIKKQYAVFDEKVLSKIPRGPL  256

Query  193  KDKK  182
            KDKK
Sbjct  257  KDKK  260



>ref|XP_008792381.1| PREDICTED: reticulon-like protein B2 isoform X2 [Phoenix dactylifera]
Length=251

 Score =   265 bits (677),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 135/183 (74%), Positives = 158/183 (86%), Gaps = 0/183 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+FLWRNKKIS GVLGGATAIW+LF+++EYHLL  VCH LIL+LA+LFLWSNA++FI K
Sbjct  67   ADIFLWRNKKISAGVLGGATAIWVLFDLMEYHLLALVCHCLILSLAILFLWSNATTFINK  126

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IPEV IPE+  + FA +LR ++N   AVLRDIASGRDLK FLMVI GLW++SIVGS
Sbjct  127  SPPRIPEVSIPEDVAVSFALSLRYEINRGFAVLRDIASGRDLKKFLMVIAGLWVLSIVGS  186

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            CC+FLTLFYIA V LHT+PVLYEKYED+VD+FAEKAM ++KK YA F+AK LSKIPRGPL
Sbjct  187  CCNFLTLFYIAFVTLHTLPVLYEKYEDKVDSFAEKAMTKVKKNYATFNAKCLSKIPRGPL  246

Query  193  KDK  185
            K K
Sbjct  247  KKK  249



>ref|XP_006439447.1| hypothetical protein CICLE_v10021801mg [Citrus clementina]
 gb|ESR52687.1| hypothetical protein CICLE_v10021801mg [Citrus clementina]
Length=256

 Score =   265 bits (677),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 146/186 (78%), Positives = 162/186 (87%), Gaps = 1/186 (1%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWRNKKIS GVLGGATAIW+LFE+LEYHLLT VCH LI+ALAVLFLWSNAS+FI K
Sbjct  72   ADVFLWRNKKISAGVLGGATAIWVLFELLEYHLLTLVCHCLIVALAVLFLWSNASTFINK  131

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IPEV+IPEEPVLQ ASALR ++N    +LR+IASGRDLK FL VI GLW++SIVGS
Sbjct  132  SPPRIPEVYIPEEPVLQLASALRFEINRAFPLLREIASGRDLKKFLSVIAGLWVVSIVGS  191

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
             C+FLTLFYI  VLLHTVPV+YEKYED VD+F+EKA  E+KKQYAVFDAKVLSKIPR  L
Sbjct  192  WCNFLTLFYIVFVLLHTVPVIYEKYEDRVDSFSEKAWAEIKKQYAVFDAKVLSKIPRS-L  250

Query  193  KDKKLA  176
            KDKK A
Sbjct  251  KDKKKA  256



>ref|XP_010924771.1| PREDICTED: reticulon-like protein B2 [Elaeis guineensis]
Length=252

 Score =   265 bits (677),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 137/184 (74%), Positives = 155/184 (84%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWRNKKIS GVLGGATAIW+LFE++EYHLL  VCH LIL+LA+LFLWSNAS+FI K
Sbjct  67   ADVFLWRNKKISAGVLGGATAIWVLFELMEYHLLALVCHCLILSLAILFLWSNASTFIHK  126

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IPEV IPE+  +  A +LR ++N    VLRDIASGRDLK FL+VI GLW++SIVGS
Sbjct  127  SPPRIPEVSIPEDVAVNVALSLRYEINRGFTVLRDIASGRDLKKFLVVIAGLWVLSIVGS  186

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            CC+FLTLFYIA V LHTVPVLYEKYED+VD FAEK M E+KK YA F AK LSKIPRGPL
Sbjct  187  CCNFLTLFYIAFVTLHTVPVLYEKYEDKVDPFAEKVMTEVKKHYATFHAKCLSKIPRGPL  246

Query  193  KDKK  182
            K+KK
Sbjct  247  KEKK  250



>gb|KCW72348.1| hypothetical protein EUGRSUZ_E00805 [Eucalyptus grandis]
Length=296

 Score =   266 bits (680),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 141/184 (77%), Positives = 159/184 (86%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWRNKKIS G LG ATA+WILFE+LEYHLLT VCH LIL LA+LFLWSNA++FI K
Sbjct  77   ADVFLWRNKKISAGALGVATALWILFELLEYHLLTLVCHVLILGLAILFLWSNATTFIHK  136

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
              PHIPEV IPE+PVL+FAS L +++N  +A LR+IASGRDLK FL+V+   W+ SIVGS
Sbjct  137  MPPHIPEVSIPEKPVLEFASVLSSEINQGIATLREIASGRDLKKFLLVVAVFWVFSIVGS  196

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            CC+FLTLFYIA VLLHTVPVLYEKYED+VD FAEKA  E+KKQYAVFD KVLSKIPRGPL
Sbjct  197  CCNFLTLFYIAFVLLHTVPVLYEKYEDKVDPFAEKATIEIKKQYAVFDEKVLSKIPRGPL  256

Query  193  KDKK  182
            KDKK
Sbjct  257  KDKK  260



>ref|XP_006476478.1| PREDICTED: reticulon-like protein B2-like [Citrus sinensis]
 gb|KDO76366.1| hypothetical protein CISIN_1g039009mg [Citrus sinensis]
Length=256

 Score =   264 bits (675),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 145/186 (78%), Positives = 162/186 (87%), Gaps = 1/186 (1%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWRNKKIS GVLGGATAIW+LF++LEYHLLT VCH LI+ALAVLFLWSNAS+FI K
Sbjct  72   ADVFLWRNKKISAGVLGGATAIWVLFQLLEYHLLTLVCHCLIVALAVLFLWSNASTFINK  131

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IPEV+IPEEPVLQ ASALR ++N    +LR+IASGRDLK FL VI GLW++SIVGS
Sbjct  132  SPPRIPEVYIPEEPVLQLASALRFEINRAFTLLREIASGRDLKKFLSVIAGLWVVSIVGS  191

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
             C+FLTLFYI  VLLHTVPV+YEKYED VD+F+EKA  E+KKQYAVFDAKVLSKIPR  L
Sbjct  192  WCNFLTLFYIVFVLLHTVPVIYEKYEDRVDSFSEKAWAEIKKQYAVFDAKVLSKIPRS-L  250

Query  193  KDKKLA  176
            KDKK A
Sbjct  251  KDKKKA  256



>ref|XP_010925814.1| PREDICTED: reticulon-like protein B2 [Elaeis guineensis]
Length=253

 Score =   264 bits (674),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 157/184 (85%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWRNKKIS GVLGGATA+W+LFE+LEYHLLT VCH LIL+LA+LFLWSNAS FI K
Sbjct  69   ADVFLWRNKKISAGVLGGATAVWVLFELLEYHLLTLVCHCLILSLAILFLWSNASIFINK  128

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            + P I EV IP++  +  A +LR ++N  +AVLR+I SG+DLK FL VI GLW++ ++GS
Sbjct  129  APPRILEVSIPKDLAVNVALSLRYEINRAIAVLREITSGQDLKKFLAVIAGLWVLLVLGS  188

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            CC+F+TLFYI VV LHTVPVLYEKYED+VD+FAEKAM E+KKQY VFDAKVLSKIPR PL
Sbjct  189  CCNFMTLFYIMVVTLHTVPVLYEKYEDKVDSFAEKAMTEIKKQYKVFDAKVLSKIPREPL  248

Query  193  KDKK  182
            KDKK
Sbjct  249  KDKK  252



>ref|XP_009626480.1| PREDICTED: reticulon-like protein B2 isoform X1 [Nicotiana tomentosiformis]
Length=254

 Score =   263 bits (673),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 140/185 (76%), Positives = 161/185 (87%), Gaps = 0/185 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+FLWR+KKI+ GVLG ATAIW+LFE+LEYHLLT VCH LILALAVLFLWSNAS+FI K
Sbjct  69   ADIFLWRDKKITAGVLGFATAIWVLFELLEYHLLTLVCHILILALAVLFLWSNASTFINK  128

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IPEV +PE+ VL  ASALR ++N  L +LRDIASG++LK FL VI GLW++SI+G+
Sbjct  129  SPPQIPEVILPEDIVLGVASALRIEINRALEILRDIASGKELKKFLAVIAGLWVLSILGN  188

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            C +FLTLFYI  VLLHTVPVLYEKYED+VDAFAEKA  E+KKQYAVF+ KVLSKIPRGPL
Sbjct  189  CWNFLTLFYICFVLLHTVPVLYEKYEDQVDAFAEKAEAEIKKQYAVFNVKVLSKIPRGPL  248

Query  193  KDKKL  179
            KDKKL
Sbjct  249  KDKKL  253



>ref|XP_009765582.1| PREDICTED: reticulon-like protein B2 [Nicotiana sylvestris]
Length=254

 Score =   263 bits (671),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 140/184 (76%), Positives = 160/184 (87%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWR+KKI+ GVLG ATAIW+LFE+LEYHLLT VCH LILALAVLFLWSNAS+FI K
Sbjct  69   ADVFLWRDKKITAGVLGFATAIWVLFELLEYHLLTLVCHILILALAVLFLWSNASTFINK  128

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IPEV +PE+ VL  ASALR ++N  L +LRDIASG++LK FL VI GLW++SI+G+
Sbjct  129  SPPQIPEVILPEDIVLGVASALRIEINRALEILRDIASGKELKKFLAVIAGLWVLSILGN  188

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            C +FLTLFYI  VLLHTVPVLYEKYED+VDAFAEKA  E+KKQYAVF+ KVLSKIPRGPL
Sbjct  189  CWNFLTLFYICFVLLHTVPVLYEKYEDQVDAFAEKAEAEIKKQYAVFNVKVLSKIPRGPL  248

Query  193  KDKK  182
            KDKK
Sbjct  249  KDKK  252



>ref|XP_009603968.1| PREDICTED: reticulon-like protein B1 [Nicotiana tomentosiformis]
 ref|XP_009603969.1| PREDICTED: reticulon-like protein B1 [Nicotiana tomentosiformis]
Length=263

 Score =   263 bits (671),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 137/186 (74%), Positives = 162/186 (87%), Gaps = 0/186 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWRNKK+S  VLGGATAIW+LFE+LEYHLL  VCH LI  LA+LFLWSNA++FI K
Sbjct  78   ADVFLWRNKKVSASVLGGATAIWVLFELLEYHLLGLVCHLLIFTLAILFLWSNATTFINK  137

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
              PHIPEVH+PEEP+L+ ASALR ++N+ L VLR+IASGRDL  FL VI GLW++S++G+
Sbjct  138  KRPHIPEVHLPEEPILEIASALRIEINYTLRVLREIASGRDLTKFLSVIAGLWVLSVLGN  197

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            CC+FLTLFYI+ VLLHTVPVLYEKYED+VD   EKA+ E+KKQYAVFDAKVLSKIP+GPL
Sbjct  198  CCNFLTLFYISFVLLHTVPVLYEKYEDKVDPLVEKAVKEIKKQYAVFDAKVLSKIPKGPL  257

Query  193  KDKKLA  176
            +DKK A
Sbjct  258  RDKKKA  263



>ref|XP_009763461.1| PREDICTED: reticulon-like protein B6 isoform X1 [Nicotiana sylvestris]
Length=267

 Score =   263 bits (671),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 162/190 (85%), Gaps = 4/190 (2%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWRNKKIS  VLGGATAIW+LFE+LEYHLL  VCH LI  LA+LFLWSNA++FI K
Sbjct  78   ADVFLWRNKKISASVLGGATAIWVLFELLEYHLLGLVCHLLIFTLAILFLWSNATTFINK  137

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLM----VITGLWIIS  386
              PHIPE H+ EEP+L+ ASALR ++NH L VLR+IASGRDLK FL     VI GLW++S
Sbjct  138  KRPHIPEFHLLEEPILEIASALRIEINHILHVLREIASGRDLKKFLAVNCSVIAGLWVLS  197

Query  385  IVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIP  206
            ++G+CC+FLTLFYI+ VLLHTVPVLYEKYED+VD  AEKA+ E+KKQYAVFDA+VLSKIP
Sbjct  198  MLGNCCNFLTLFYISFVLLHTVPVLYEKYEDKVDPLAEKAVQEIKKQYAVFDARVLSKIP  257

Query  205  RGPLKDKKLA  176
            +GPLKDKK A
Sbjct  258  KGPLKDKKKA  267



>ref|XP_008810936.1| PREDICTED: reticulon-like protein B5 [Phoenix dactylifera]
Length=253

 Score =   262 bits (669),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 135/184 (73%), Positives = 157/184 (85%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+FLWRNKKIS GVLG ATAIW+LFE++EYHLLT VCH LIL+LA+LFLWSNAS+FI K
Sbjct  68   ADIFLWRNKKISAGVLGVATAIWVLFELMEYHLLTLVCHCLILSLAILFLWSNASTFINK  127

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S+PHIPEV IPE+  +  A +LR ++N   AVLRDIASGR+LK FLMVI GLW++SI+G+
Sbjct  128  SSPHIPEVSIPEDVAVDVALSLRYEINRGFAVLRDIASGRELKKFLMVIAGLWVLSIIGT  187

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            CC+FLTLFYI  V LHTVPVLYEKYED+VD FAEK M E+KK YA F AK LSKIPRGPL
Sbjct  188  CCNFLTLFYIVFVTLHTVPVLYEKYEDKVDPFAEKVMAEIKKHYATFHAKCLSKIPRGPL  247

Query  193  KDKK  182
            K+KK
Sbjct  248  KEKK  251



>ref|XP_011093062.1| PREDICTED: reticulon-like protein B1 [Sesamum indicum]
Length=257

 Score =   261 bits (667),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 135/184 (73%), Positives = 159/184 (86%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+FLWRNKKIS  VLGGATA+W+LFE+LEYHLLT VCH  ILAL++LFLWSNA++FI K
Sbjct  73   ADIFLWRNKKISATVLGGATAVWVLFELLEYHLLTLVCHVSILALSLLFLWSNATTFINK  132

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
              PHIPEV +PE+P L+ AS LR ++N   AVLR+IASGRDLK FLMV+ GLW +SIVGS
Sbjct  133  RPPHIPEVRLPEDPFLEVASVLRTEINRGFAVLREIASGRDLKKFLMVVVGLWALSIVGS  192

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
             C+FLTLFYI  +LLHTVPVLYEKY+D++DAFAEKAM ++KKQYAVFDAKVLSKIPRGPL
Sbjct  193  FCNFLTLFYIVFILLHTVPVLYEKYDDKIDAFAEKAMIQIKKQYAVFDAKVLSKIPRGPL  252

Query  193  KDKK  182
              K+
Sbjct  253  GKKR  256



>ref|XP_007038874.1| VIRB2-interacting protein 2 [Theobroma cacao]
 gb|EOY23375.1| VIRB2-interacting protein 2 [Theobroma cacao]
Length=247

 Score =   259 bits (663),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 135/184 (73%), Positives = 160/184 (87%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWR+KKIS GVLGGATA+WILFE+LEYHL+T +CH LIL+LA+LFLWSNAS+FI K
Sbjct  62   ADVFLWRDKKISAGVLGGATALWILFEMLEYHLITLLCHTLILSLAILFLWSNASTFINK  121

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P+IPEV +PE+ VL+ ASALR +VN  L V+RDIASG DLK FL VI GLW +S+VG+
Sbjct  122  SPPNIPEVVLPEKCVLEVASALRIEVNRALDVVRDIASGNDLKKFLGVIVGLWALSLVGN  181

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            CC+FLTLFYI  VLLHTVPV YE YED+VD+F+EKA+ E+KKQYA FD KVLSKIP+GPL
Sbjct  182  CCNFLTLFYIVFVLLHTVPVFYEIYEDQVDSFSEKAIIEIKKQYAAFDEKVLSKIPKGPL  241

Query  193  KDKK  182
            K+KK
Sbjct  242  KEKK  245



>ref|XP_002299504.1| reticulon family protein [Populus trichocarpa]
 gb|ABK93406.1| unknown [Populus trichocarpa]
 gb|EEE84309.1| reticulon family protein [Populus trichocarpa]
Length=254

 Score =   259 bits (661),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 149/184 (81%), Positives = 165/184 (90%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWRNKKIS GVLGGATAIW+LFE+LEY+L+T VCH LILALA+LFLWSNAS+FI K
Sbjct  69   ADVFLWRNKKISAGVLGGATAIWVLFELLEYNLVTLVCHCLILALALLFLWSNASTFINK  128

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IPEV IPEEPVLQ A+ALR ++N   +VLRDIASGRDLK FL VI GLW++SIVGS
Sbjct  129  SPPRIPEVCIPEEPVLQTAAALRIEINQGFSVLRDIASGRDLKNFLTVIAGLWVLSIVGS  188

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
             C+F+TLFYIA VLLHTVPV YEKYED+VDAFAEKAM E+KKQYAVFDAKVLSKIPRGPL
Sbjct  189  WCNFVTLFYIAFVLLHTVPVFYEKYEDQVDAFAEKAMIEIKKQYAVFDAKVLSKIPRGPL  248

Query  193  KDKK  182
            KDKK
Sbjct  249  KDKK  252



>gb|KJB52210.1| hypothetical protein B456_008G250900 [Gossypium raimondii]
Length=250

 Score =   258 bits (659),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 144/184 (78%), Positives = 161/184 (88%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+FLWRNKKIS G LG AT IWILFE+LEYHLLT VCH LILALA+LFLWSNA++F+ K
Sbjct  65   ADIFLWRNKKISAGALGVATVIWILFEMLEYHLLTLVCHLLILALALLFLWSNAATFVNK  124

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IPEV IP++PV++FA ALR ++N   AVLRDIASGRDLK FL VI GLWI+SIVGS
Sbjct  125  SPPRIPEVQIPKDPVMEFAQALRFEINRAFAVLRDIASGRDLKKFLSVIAGLWILSIVGS  184

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
             C+FLTLFYI  VLLHTVPVLYEKYED+VD FAEKAMHE+KKQYAVFDAKVL KIPRGPL
Sbjct  185  WCNFLTLFYIVFVLLHTVPVLYEKYEDKVDPFAEKAMHEIKKQYAVFDAKVLRKIPRGPL  244

Query  193  KDKK  182
            K+KK
Sbjct  245  KEKK  248



>gb|AEZ00899.1| putative 24 kDa seed maturation protein [Elaeis guineensis]
Length=253

 Score =   258 bits (659),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 156/184 (85%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+FLWRNKKIS GVLGGATAIW+LFE++EYHLL+ VCH LIL+LA+LFLWSNA++FI K
Sbjct  68   ADIFLWRNKKISAGVLGGATAIWVLFELMEYHLLSLVCHCLILSLAILFLWSNATTFINK  127

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S PHIPEV IPE+  +  A +LR D+N   AVLRDIASGRDLK FL+VI GLW++SI+GS
Sbjct  128  SPPHIPEVSIPEDVAVSVALSLRYDINRAFAVLRDIASGRDLKKFLLVIAGLWVLSIIGS  187

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            CC+FLTLFYI  V LHTVPVLYEKYED+VD+F EKAM E+KK YA   AK LSKIP+G L
Sbjct  188  CCNFLTLFYIVFVTLHTVPVLYEKYEDKVDSFGEKAMAEIKKHYATVHAKCLSKIPKGAL  247

Query  193  KDKK  182
            K+KK
Sbjct  248  KEKK  251



>ref|XP_004503660.1| PREDICTED: reticulon-like protein B2-like [Cicer arietinum]
Length=255

 Score =   258 bits (659),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 143/184 (78%), Positives = 158/184 (86%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWRNKKIS  VLG ATA WILFE+LEYHLLT VCH  ILALAVLFLWSNAS+FI K
Sbjct  70   ADVFLWRNKKISATVLGVATASWILFELLEYHLLTLVCHLAILALAVLFLWSNASTFINK  129

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            + P IP+VHIPEEPVLQ A+ALR ++N   AVLRDIASG+DLK FL VI GLW++SIVGS
Sbjct  130  APPKIPQVHIPEEPVLQIAAALRIEINRVFAVLRDIASGKDLKKFLSVIAGLWVLSIVGS  189

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
              +FLTLFYIA VLLHTVPVLYEKYED VD+F EKA+ E KKQYAVFDAKVLSKIP+G L
Sbjct  190  WANFLTLFYIAFVLLHTVPVLYEKYEDRVDSFGEKALAEFKKQYAVFDAKVLSKIPKGAL  249

Query  193  KDKK  182
            K+KK
Sbjct  250  KNKK  253



>ref|XP_006358652.1| PREDICTED: reticulon-like protein B1-like [Solanum tuberosum]
Length=255

 Score =   257 bits (656),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 136/186 (73%), Positives = 159/186 (85%), Gaps = 0/186 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWRNKKIS  VLGGATAIW+LFE+LEY L+  VCH LI  LAVLFLWSNA++FI K
Sbjct  70   ADVFLWRNKKISASVLGGATAIWVLFELLEYFLVGLVCHLLIFTLAVLFLWSNATTFINK  129

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
              PHIPEV +PEEP+L+ ASAL  ++N  L++LR+IA+G+DLK FL V+ GLWI+S+VG+
Sbjct  130  KRPHIPEVQLPEEPILEIASALSIEINRALSMLREIATGKDLKKFLAVVAGLWILSVVGN  189

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            CC+FLTLFYI  VLLHTVPVLYEKYED+VD  AEKAM E+KKQYAVFDA+VLSKIP GPL
Sbjct  190  CCNFLTLFYILFVLLHTVPVLYEKYEDKVDPLAEKAMQEIKKQYAVFDARVLSKIPIGPL  249

Query  193  KDKKLA  176
            KDKK A
Sbjct  250  KDKKNA  255



>ref|XP_010053196.1| PREDICTED: reticulon-like protein B1 [Eucalyptus grandis]
 gb|KCW77460.1| hypothetical protein EUGRSUZ_D01798 [Eucalyptus grandis]
Length=256

 Score =   256 bits (655),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 140/186 (75%), Positives = 155/186 (83%), Gaps = 0/186 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWRNKK+S G LG  T IW LFE+ EYHLLT   H LIL LAVLFLWSNA +FI K
Sbjct  70   ADVFLWRNKKVSAGALGVVTVIWALFELAEYHLLTLAAHCLILTLAVLFLWSNAHAFIHK  129

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IPEV IPEEPVLQFASALR ++N   AVLRDIASG+DLK FL+VI GLW++SI G+
Sbjct  130  SPPRIPEVSIPEEPVLQFASALRLEINQAFAVLRDIASGKDLKKFLLVIAGLWLLSIAGN  189

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
             C+FLTLFYI  VLLHTVPVLYEK+ED++D FAE+AM ELKKQYAVFDAKVLSKIP GPL
Sbjct  190  WCNFLTLFYIVFVLLHTVPVLYEKFEDKIDPFAERAMGELKKQYAVFDAKVLSKIPLGPL  249

Query  193  KDKKLA  176
            KDKK A
Sbjct  250  KDKKKA  255



>ref|XP_010676393.1| PREDICTED: reticulon-like protein B2 [Beta vulgaris subsp. vulgaris]
Length=248

 Score =   256 bits (654),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 133/187 (71%), Positives = 156/187 (83%), Gaps = 0/187 (0%)
 Frame = -1

Query  736  QADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIK  557
             AD+ LWR+KKIS  VLG  TA+W LFE+ EYHLL+ +CH L+L + VLFLWSNAS+FI 
Sbjct  62   PADILLWRDKKISATVLGTVTAVWALFEIFEYHLLSLICHLLMLTITVLFLWSNASTFIN  121

Query  556  KSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVG  377
            K+ P IP+V IPE PVL+ ASAL+ ++N  LA LR+IASG+DLK FL VI GLWI SI+G
Sbjct  122  KAPPKIPDVRIPEGPVLEIASALKYEINRGLASLREIASGKDLKKFLAVIAGLWIFSILG  181

Query  376  SCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGP  197
            SCC+FLTLFYI  V+LHT+PVLYEKYED+VDAFAEKAM E+KKQY VFDAKVLSKIPRGP
Sbjct  182  SCCNFLTLFYICFVMLHTLPVLYEKYEDQVDAFAEKAMIEIKKQYIVFDAKVLSKIPRGP  241

Query  196  LKDKKLA  176
            LKDKK A
Sbjct  242  LKDKKAA  248



>gb|KHG04885.1| Reticulon-like protein B5 [Gossypium arboreum]
Length=255

 Score =   256 bits (654),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 139/185 (75%), Positives = 157/185 (85%), Gaps = 0/185 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWRNKKIS GVLGGATAIW+LFE++EYHLLT +CH  IL LA+LFLWSNA +FI K
Sbjct  71   ADVFLWRNKKISAGVLGGATAIWVLFELIEYHLLTLICHISILCLALLFLWSNAHTFIHK  130

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IPE+H+PEEP LQ ASAL  ++N  L +LRDIASGR+LK FLMVI   W++SIVGS
Sbjct  131  SPPRIPEIHLPEEPFLQVASALAIELNQGLKLLRDIASGRNLKEFLMVIAAFWVLSIVGS  190

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
             C+FLTLFYI  VLLHTVPVLYEKYED+VD FAEKA  E+KKQYAVFDAKVLSKIP GPL
Sbjct  191  WCNFLTLFYICFVLLHTVPVLYEKYEDKVDPFAEKAAIEVKKQYAVFDAKVLSKIPMGPL  250

Query  193  KDKKL  179
            K KK+
Sbjct  251  KAKKV  255



>ref|XP_004234204.1| PREDICTED: reticulon-like protein B2 [Solanum lycopersicum]
Length=255

 Score =   255 bits (652),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 134/185 (72%), Positives = 160/185 (86%), Gaps = 0/185 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+FLWR+KKI+ GVLG AT++W+LFE+L+YHLLT VCH LILALAVLFLWSNAS+FI K
Sbjct  70   ADIFLWRDKKITAGVLGFATSLWVLFELLQYHLLTLVCHILILALAVLFLWSNASTFINK  129

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IP+V +PE+ VL  A+ALR ++N  L V RDIASG++LK FL VI GLW++SI+G+
Sbjct  130  SPPQIPDVILPEDIVLGVAAALRIEINRALEVFRDIASGKELKKFLGVIAGLWVLSILGN  189

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            C +FLTLFYI  VLLHTVPVLYEK+ED+VDAFAEKA  E+KKQYAVF+ KVLSKIPRGPL
Sbjct  190  CWNFLTLFYICFVLLHTVPVLYEKFEDQVDAFAEKAEAEIKKQYAVFNVKVLSKIPRGPL  249

Query  193  KDKKL  179
            KDKKL
Sbjct  250  KDKKL  254



>ref|XP_004248066.1| PREDICTED: reticulon-like protein B1 [Solanum lycopersicum]
Length=263

 Score =   255 bits (652),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 135/186 (73%), Positives = 159/186 (85%), Gaps = 0/186 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWRNKKIS  VLGGATAIW+LFE+LEY L+  VCH LI  LAVLFLWSNA++FI K
Sbjct  78   ADVFLWRNKKISASVLGGATAIWVLFELLEYFLVGLVCHLLIFTLAVLFLWSNATTFINK  137

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
              PHIPEV +PEEP+L+ ASAL  ++N  L++LR+IA+G+D K FL V+TGLWI+S+VG+
Sbjct  138  KRPHIPEVQLPEEPILEIASALSIEINRALSMLREIATGKDPKKFLAVVTGLWILSVVGN  197

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            CC+FLTLFYI  VLLHTVPVLYEKYED+VD  AEKA+ E+KKQYA+FDAKVLSKIP GPL
Sbjct  198  CCNFLTLFYILFVLLHTVPVLYEKYEDKVDPLAEKAVQEIKKQYAIFDAKVLSKIPIGPL  257

Query  193  KDKKLA  176
            KDKK A
Sbjct  258  KDKKNA  263



>gb|EYU19605.1| hypothetical protein MIMGU_mgv1a012182mg [Erythranthe guttata]
Length=259

 Score =   255 bits (651),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 131/185 (71%), Positives = 157/185 (85%), Gaps = 0/185 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+FLWR+KK+S GVLG ATAIW+LFE++EYHLL+ VCH LIL LA++FLWSNASSFI K
Sbjct  74   ADIFLWRDKKVSAGVLGFATAIWVLFELIEYHLLSLVCHILILGLAIIFLWSNASSFINK  133

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IPEV + E+ V+  A+ALR + N   A+LRDI SG+DLK FL VI GLW++S++GS
Sbjct  134  SPPKIPEVVVREDIVIGVANALRIEFNRAFAILRDIVSGKDLKKFLAVIAGLWVLSMLGS  193

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            C +FLTLFYI  VLLHTVP+LYEKY+D++DAFAEKA  ELKKQYAVFDAKVLSKIP+GPL
Sbjct  194  CFNFLTLFYICFVLLHTVPLLYEKYDDQIDAFAEKAEAELKKQYAVFDAKVLSKIPKGPL  253

Query  193  KDKKL  179
            KDKK 
Sbjct  254  KDKKF  258



>gb|KJB24634.1| hypothetical protein B456_004G154600 [Gossypium raimondii]
Length=255

 Score =   254 bits (650),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 138/185 (75%), Positives = 156/185 (84%), Gaps = 0/185 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWRNKKIS GVLGGATAIW+LFE++EYHLL  +CH  IL LA+LFLWSNA +FI K
Sbjct  71   ADVFLWRNKKISAGVLGGATAIWVLFELIEYHLLALICHISILCLALLFLWSNAHTFIHK  130

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IPE+H+PEEP LQ ASAL  ++N  L +LRDIASGR+LK FLMVI   W++SIVGS
Sbjct  131  SPPRIPEIHLPEEPFLQVASALAIELNQGLKLLRDIASGRNLKEFLMVIAAFWVLSIVGS  190

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
             C+FLTLFYI  VLLHTVPVLYEKYED+VD FAEKA  E+KKQYAVFDAKVLSKIP GPL
Sbjct  191  WCNFLTLFYICFVLLHTVPVLYEKYEDKVDPFAEKAAIEIKKQYAVFDAKVLSKIPMGPL  250

Query  193  KDKKL  179
            K KK+
Sbjct  251  KAKKV  255



>ref|XP_010545343.1| PREDICTED: reticulon-like protein B3 [Tarenaya hassleriana]
Length=259

 Score =   254 bits (649),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 137/188 (73%), Positives = 154/188 (82%), Gaps = 4/188 (2%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+ LWRNKK+S GVLG ATA W+LFE+LEYHLL+ VCH  ILALAVLFLWSNAS+FI K
Sbjct  71   ADIVLWRNKKVSGGVLGAATAAWVLFELLEYHLLSLVCHSSILALAVLFLWSNASTFIHK  130

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            + P IPEVHIPEE VLQ AS LR ++N   A LRDIASGRDLK FLMVI GLW++SI+GS
Sbjct  131  TPPRIPEVHIPEEHVLQLASGLRTEINRGFAALRDIASGRDLKKFLMVIAGLWVLSILGS  190

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVL----SKIP  206
            CC+F+TLFYIA VLL T+PVLYEKYED+VDAF EKAM E+KKQY V D KVL    SKIP
Sbjct  191  CCNFVTLFYIATVLLFTIPVLYEKYEDKVDAFGEKAMKEIKKQYEVLDEKVLSKIMSKIP  250

Query  205  RGPLKDKK  182
            RG L  KK
Sbjct  251  RGALSKKK  258



>gb|ABC01908.1| putative 24 kDa seed maturation protein-like protein [Solanum 
tuberosum]
Length=255

 Score =   254 bits (649),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 132/184 (72%), Positives = 159/184 (86%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+FLWR+KKI+ GVLG AT++W+LFE+L+YHLLT VCH LILALAVLFLWSNAS+FI K
Sbjct  70   ADIFLWRDKKITAGVLGFATSLWVLFELLQYHLLTLVCHILILALAVLFLWSNASTFINK  129

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IP+V +PE+ VL  A+ALR ++N  L + RDIASG++LK FL VI GLW++SI+G+
Sbjct  130  SPPQIPDVILPEDIVLGVAAALRIEINKALEIFRDIASGKELKKFLAVIAGLWVLSILGN  189

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            C +FLTLFYI  VLLHTVPVLYEK+ED+VDAFAEKA  E+KKQYAVF+ KVLSKIPRGPL
Sbjct  190  CWNFLTLFYICFVLLHTVPVLYEKFEDQVDAFAEKAEAEIKKQYAVFNVKVLSKIPRGPL  249

Query  193  KDKK  182
            KDKK
Sbjct  250  KDKK  253



>ref|XP_010916969.1| PREDICTED: reticulon-like protein B3 [Elaeis guineensis]
Length=310

 Score =   256 bits (654),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 138/222 (62%), Positives = 168/222 (76%), Gaps = 5/222 (2%)
 Frame = -1

Query  736  QADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIK  557
             AD+FLWRNKKIS GVLGGATAIW+LFE++EYHLL+ VCH LIL+LA+LFLWSNA++FI 
Sbjct  67   PADIFLWRNKKISAGVLGGATAIWVLFELMEYHLLSLVCHCLILSLAILFLWSNATTFIN  126

Query  556  KSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVG  377
            KS PHIPEV IPE+  +  A +LR D+N   AVLRDIASGRDLK FL+VI GLW++SI+G
Sbjct  127  KSPPHIPEVSIPEDVAVSVALSLRYDINRAFAVLRDIASGRDLKKFLLVIAGLWVLSIIG  186

Query  376  SCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGP  197
            SCC+FLTLFYI  V LHTVPVLYEKYED+VD+F EKAM E+KK YA   AK LSKIP+G 
Sbjct  187  SCCNFLTLFYIVFVTLHTVPVLYEKYEDKVDSFGEKAMAEIKKHYATVHAKCLSKIPKGA  246

Query  196  LKDKKLA*DCNSVWCHYVRMCN*SLKNLCFSVIYQQTCWICH  71
            LK +     C   +C +V  C      +  S++ + + W  H
Sbjct  247  LKRRS---SCR--FCQFVASCGFLCVVVTLSILLRTSTWCMH  283



>gb|KJB06451.1| hypothetical protein B456_001G157900 [Gossypium raimondii]
Length=257

 Score =   254 bits (648),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 133/185 (72%), Positives = 157/185 (85%), Gaps = 0/185 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWRNKKIS GVLGGATAIW+LFE++EYHLLT +CH  IL+LAVLFLWSN  +FI K
Sbjct  73   ADVFLWRNKKISAGVLGGATAIWVLFELIEYHLLTLLCHISILSLAVLFLWSNVHTFIHK  132

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            + P IP+VH+PEEP LQ ASAL  ++N  L +LRDIASGR+LK FL+V+   W++S+VGS
Sbjct  133  TPPRIPQVHLPEEPFLQIASALTIELNQALELLRDIASGRNLKKFLVVVAAFWVLSVVGS  192

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
             C+FLTLFY + VLLHTVPVLYEKYED+VD FAEKA+ E+KKQYAVFDA VLSKIP GPL
Sbjct  193  WCNFLTLFYTSFVLLHTVPVLYEKYEDKVDPFAEKAVIEIKKQYAVFDANVLSKIPTGPL  252

Query  193  KDKKL  179
            K KK+
Sbjct  253  KSKKV  257



>gb|KJB19087.1| hypothetical protein B456_003G084400 [Gossypium raimondii]
 gb|KJB19090.1| hypothetical protein B456_003G084400 [Gossypium raimondii]
Length=252

 Score =   253 bits (647),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 145/184 (79%), Positives = 159/184 (86%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+ LWRNKKIS G LG AT IW+LFE+LEYHLLT VCH LILALA+LFLWSNA+ FI K
Sbjct  67   ADILLWRNKKISAGALGVATVIWVLFELLEYHLLTLVCHLLILALALLFLWSNATQFINK  126

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S PHIPEV IP+EPVL+F  ALR ++N   AVLRDIA GRDLKMFL VI GLW++SIVGS
Sbjct  127  STPHIPEVQIPKEPVLEFVMALRFEINRAFAVLRDIALGRDLKMFLSVIAGLWVLSIVGS  186

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
             C+FLTLFYI  VLLHTVPVLYEKYED+VD FAEKAMHE+KKQYAVFDAKVLSKIPRGPL
Sbjct  187  WCNFLTLFYIVFVLLHTVPVLYEKYEDKVDPFAEKAMHEIKKQYAVFDAKVLSKIPRGPL  246

Query  193  KDKK  182
            K KK
Sbjct  247  KQKK  250



>ref|XP_006645662.1| PREDICTED: reticulon-like protein B1-like [Oryza brachyantha]
Length=249

 Score =   253 bits (647),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 129/184 (70%), Positives = 154/184 (84%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWRN+ IS GVLGGATAIWILFE+L YHLLT VCHGLI +L +LFLWSNASSFI K
Sbjct  65   ADVFLWRNRNISAGVLGGATAIWILFELLGYHLLTFVCHGLIFSLGLLFLWSNASSFINK  124

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S+P IPEV IPE+ V+  A + R ++N   A LR IA GRD+K FL+VI GLW++S++GS
Sbjct  125  SSPRIPEVVIPEDLVVNIALSTRYEINRAFANLRQIALGRDIKKFLIVIAGLWLLSVLGS  184

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            CC+FLTL YI  V+LHTVP+LYEKYED++D++ EK   E+KKQYAVFDAKVLSK+PRGPL
Sbjct  185  CCNFLTLLYIVFVVLHTVPILYEKYEDQIDSYGEKGWVEIKKQYAVFDAKVLSKVPRGPL  244

Query  193  KDKK  182
            KDKK
Sbjct  245  KDKK  248



>ref|XP_003528823.2| PREDICTED: reticulon-like protein B1-like [Glycine max]
Length=314

 Score =   255 bits (652),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 141/187 (75%), Positives = 155/187 (83%), Gaps = 0/187 (0%)
 Frame = -1

Query  736  QADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIK  557
             ADV LWRNKKIS GVLG ATAIWI FE+LEYHLLT VCH  IL LAVLFLWSNA +FI 
Sbjct  128  PADVLLWRNKKISAGVLGVATAIWIFFELLEYHLLTLVCHISILLLAVLFLWSNAHTFIH  187

Query  556  KSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVG  377
            K+ P IP VHIPEEP+LQFASAL  ++N   A LR I SGRDLK FL+VI G WIISIVG
Sbjct  188  KAPPRIPVVHIPEEPILQFASALTIEINRGFAALRAIGSGRDLKTFLIVIVGTWIISIVG  247

Query  376  SCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGP  197
            S C+FLTLFYIA VLLHTVPVLY+KYED++D  AEKA+ E KKQYAVFD KVLSKIP+GP
Sbjct  248  SWCNFLTLFYIAFVLLHTVPVLYDKYEDKIDPLAEKALVEFKKQYAVFDEKVLSKIPKGP  307

Query  196  LKDKKLA  176
            LK+KKLA
Sbjct  308  LKEKKLA  314



>ref|XP_006422079.1| hypothetical protein CICLE_v10005564mg [Citrus clementina]
 ref|XP_006490603.1| PREDICTED: reticulon-like protein B3-like [Citrus sinensis]
 gb|ESR35319.1| hypothetical protein CICLE_v10005564mg [Citrus clementina]
Length=255

 Score =   253 bits (646),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 133/187 (71%), Positives = 158/187 (84%), Gaps = 4/187 (2%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+FLWRNKKIS GVLGGATA+W+LFE+LEYHL+T VCH  IL+LAVLFLWSNAS+FI K
Sbjct  68   ADIFLWRNKKISAGVLGGATAMWVLFELLEYHLITLVCHISILSLAVLFLWSNASTFINK  127

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IP V +PE+ VL+FASALR ++N  LAVLR+IASGRDLK FL VI GLW++SIVG+
Sbjct  128  SPPEIPVVTLPEKFVLEFASALRYEINRALAVLREIASGRDLKKFLGVIAGLWLLSIVGN  187

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDA----KVLSKIP  206
             C+F+TLFYI  VLLHTVPV+YEKYED++D+F EKA  E+KKQYAVFD     KVLS+IP
Sbjct  188  WCNFVTLFYIVFVLLHTVPVIYEKYEDKIDSFGEKATIEIKKQYAVFDEKVLKKVLSRIP  247

Query  205  RGPLKDK  185
            +G LK K
Sbjct  248  KGALKKK  254



>gb|KDO56851.1| hypothetical protein CISIN_1g023137mg [Citrus sinensis]
Length=255

 Score =   253 bits (646),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 133/187 (71%), Positives = 158/187 (84%), Gaps = 4/187 (2%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+FLWRNKKIS GVLGGATA+W+LFE+LEYHL+T VCH  IL+LAVLFLWSNAS+FI K
Sbjct  68   ADIFLWRNKKISAGVLGGATAMWVLFELLEYHLITLVCHISILSLAVLFLWSNASTFINK  127

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IP V +PE+ VL+FASALR ++N  LAVLR+IASGRDLK FL VI GLW++SIVG+
Sbjct  128  SPPEIPVVTLPEKFVLEFASALRYEINRALAVLREIASGRDLKKFLGVIAGLWLLSIVGN  187

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDA----KVLSKIP  206
             C+F+TLFYI  VLLHTVPV+YEKYED++D+F EKA  E+KKQYAVFD     KVLS+IP
Sbjct  188  WCNFVTLFYIVFVLLHTVPVIYEKYEDKIDSFGEKATIEIKKQYAVFDEKVLKKVLSRIP  247

Query  205  RGPLKDK  185
            +G LK K
Sbjct  248  KGALKKK  254



>ref|NP_001149653.1| LOC100283279 [Zea mays]
 gb|ACG36248.1| seed maturation protein [Zea mays]
 gb|ACN31840.1| unknown [Zea mays]
 tpg|DAA57749.1| TPA: Seed maturation protein isoform 1 [Zea mays]
 tpg|DAA57750.1| TPA: Seed maturation protein isoform 2 [Zea mays]
Length=257

 Score =   252 bits (644),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 130/185 (70%), Positives = 154/185 (83%), Gaps = 0/185 (0%)
 Frame = -1

Query  736  QADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIK  557
             AD+ LWRN+KIS GVL GATAIW+LFEV+EYHLLT VCH LIL+LA+LFLWSNAS+FI 
Sbjct  72   PADLILWRNRKISGGVLAGATAIWLLFEVMEYHLLTLVCHCLILSLAILFLWSNASTFIN  131

Query  556  KSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVG  377
            KS P+IPEV IPE+  +  A +LR ++N   A LR+I  GRDLK FL+VI GLW++S++G
Sbjct  132  KSPPNIPEVKIPEDVAVNVALSLRYEINRGFATLREIGHGRDLKKFLIVIAGLWLLSVLG  191

Query  376  SCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGP  197
            SCC+FLTLFYI  V L+TVPVLYEKYED+VDAF EKAM ELKK YA+FD K LSKIP+GP
Sbjct  192  SCCNFLTLFYIVFVALYTVPVLYEKYEDKVDAFGEKAMTELKKYYAIFDEKCLSKIPKGP  251

Query  196  LKDKK  182
            LKDKK
Sbjct  252  LKDKK  256



>gb|EAY73097.1| hypothetical protein OsI_00974 [Oryza sativa Indica Group]
Length=279

 Score =   253 bits (646),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 129/184 (70%), Positives = 153/184 (83%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWRN+ IS GVLGGATAIWILFE+L YHLLT VCHGLI +L +LFLWSNASSFI K
Sbjct  95   ADVFLWRNRNISAGVLGGATAIWILFELLGYHLLTFVCHGLIFSLGLLFLWSNASSFINK  154

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IPEV IPE+ V+  A + R ++N   A LR IA GRD+K FL+VI GLW++S++GS
Sbjct  155  SPPRIPEVIIPEDLVVNIALSTRYEINRAFANLRQIALGRDIKKFLIVIAGLWLLSVLGS  214

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            CC+FLTL YI  V+LHTVP+LYEKYED++D++ EK   E+KKQYAVFDAKVLSK+PRGPL
Sbjct  215  CCNFLTLVYIVFVVLHTVPILYEKYEDQIDSYGEKGWVEIKKQYAVFDAKVLSKVPRGPL  274

Query  193  KDKK  182
            KDKK
Sbjct  275  KDKK  278



>gb|KHG15548.1| Reticulon-like protein B3 [Gossypium arboreum]
Length=248

 Score =   252 bits (643),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 135/184 (73%), Positives = 153/184 (83%), Gaps = 0/184 (0%)
 Frame = -1

Query  736  QADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIK  557
             AD FLWRNKKIS GVLG AT IW+LFE+LEYHLLT VCH LI AL +LFLWSNA +FI 
Sbjct  62   SADTFLWRNKKISAGVLGVATVIWVLFELLEYHLLTLVCHVLIFALVILFLWSNAYAFIN  121

Query  556  KSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVG  377
            KS   IPEVHIP++PV++FA ALR + N    VLRDIA GRDLK FL VI GLWI+SIVG
Sbjct  122  KSPLCIPEVHIPKDPVIEFAEALRFESNLAFTVLRDIAPGRDLKKFLYVIAGLWILSIVG  181

Query  376  SCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGP  197
            S C+F+TLFY+  VLLH+VPVLYEKYED+VD FAEKAMHE+KKQ AVF+AKVLSKIPRGP
Sbjct  182  SWCNFVTLFYLVFVLLHSVPVLYEKYEDKVDPFAEKAMHEIKKQCAVFNAKVLSKIPRGP  241

Query  196  LKDK  185
             K+K
Sbjct  242  SKEK  245



>ref|NP_001150474.1| seed maturation protein [Zea mays]
 gb|ACG39226.1| seed maturation protein [Zea mays]
Length=283

 Score =   253 bits (646),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 130/184 (71%), Positives = 150/184 (82%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWRNK IS G+LGGATAIWILFE+L YHLLT VCHGLI AL VLFLWSNASSFI K
Sbjct  99   ADVFLWRNKNISAGILGGATAIWILFELLGYHLLTFVCHGLIFALGVLFLWSNASSFIHK  158

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            + P IPEV IPE+ V+  A + R ++N   A LR IA GRDLK FLMVI G W++S++GS
Sbjct  159  APPKIPEVIIPEDLVVNIALSTRYEINRAFANLRQIALGRDLKKFLMVIAGFWLLSVLGS  218

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            CC+FLTL YI  V+LHTVPVLYEKYED++D++ EK   E+KKQYAVFD KVLSK+PRGP 
Sbjct  219  CCNFLTLVYIVFVVLHTVPVLYEKYEDQIDSYGEKGWAEIKKQYAVFDEKVLSKVPRGPA  278

Query  193  KDKK  182
            KDKK
Sbjct  279  KDKK  282



>ref|XP_007051689.1| Reticulon family protein [Theobroma cacao]
 gb|EOX95846.1| Reticulon family protein [Theobroma cacao]
Length=255

 Score =   252 bits (643),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 137/185 (74%), Positives = 159/185 (86%), Gaps = 0/185 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWRNKKIS GVLGGATAIW+LFE++EY+LLT VCH  IL+LA++FLWSNA +FI K
Sbjct  71   ADVFLWRNKKISAGVLGGATAIWVLFELIEYNLLTLVCHISILSLALMFLWSNAHTFIHK  130

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IPEVH+PEEP LQ A+AL  ++N  L +LRDIASGR+LK FLMVI   W++SIVGS
Sbjct  131  SPPRIPEVHLPEEPFLQVAAALTFELNQALKLLRDIASGRNLKKFLMVIAAFWVLSIVGS  190

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
             C+FLTLFYI+ VLLHTV VLYEKYED+VD  AEKAM E+KKQYAVFDAKVLSKIP+GPL
Sbjct  191  WCNFLTLFYISFVLLHTVLVLYEKYEDKVDPCAEKAMIEIKKQYAVFDAKVLSKIPKGPL  250

Query  193  KDKKL  179
            K KK+
Sbjct  251  KTKKV  255



>tpg|DAA52789.1| TPA: seed maturation protein [Zea mays]
Length=283

 Score =   253 bits (645),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 131/184 (71%), Positives = 150/184 (82%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWRNK IS GVLGGATAIWILFE+L YHLLT VCHGLI AL VLFLWSNASSFI K
Sbjct  99   ADVFLWRNKNISAGVLGGATAIWILFELLGYHLLTFVCHGLIFALGVLFLWSNASSFIHK  158

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            + P IPEV IPE+ V+  A + R ++N   A LR IA GRDLK FLMVI G W++S++GS
Sbjct  159  APPKIPEVIIPEDLVVNIALSTRYEINRAFANLRQIALGRDLKKFLMVIAGFWLLSVLGS  218

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            CC+FLTL YI  V+LHTVPVLYEKYED++D++ EK   E+KKQYAVFD KVLSK+PRGP 
Sbjct  219  CCNFLTLVYIVFVVLHTVPVLYEKYEDQIDSYGEKGWVEIKKQYAVFDEKVLSKVPRGPA  278

Query  193  KDKK  182
            KDKK
Sbjct  279  KDKK  282



>ref|XP_010533622.1| PREDICTED: reticulon-like protein B4 [Tarenaya hassleriana]
Length=259

 Score =   252 bits (643),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 136/188 (72%), Positives = 155/188 (82%), Gaps = 4/188 (2%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+FLWRNKK+S G LG ATA W+LFE+LEYHLLT VCH  I ALAVLFLWSNAS+FI K
Sbjct  71   ADIFLWRNKKVSGGALGVATAAWVLFELLEYHLLTLVCHSSIFALAVLFLWSNASTFIHK  130

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            + P IP VHIPEEPV+Q AS LR +VN     LRDIASGRDLK FL+VI+GLW++SI+GS
Sbjct  131  TPPRIPHVHIPEEPVIQLASGLRFEVNRGFTALRDIASGRDLKKFLVVISGLWVLSILGS  190

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----AKVLSKIP  206
            CC+F+TLFYIA VLL TVPVLYEKYED+VDAF EKAM E+KKQYAV D    +KV+SKIP
Sbjct  191  CCNFVTLFYIATVLLFTVPVLYEKYEDQVDAFGEKAMKEIKKQYAVLDEKVLSKVMSKIP  250

Query  205  RGPLKDKK  182
            RG L  KK
Sbjct  251  RGALTKKK  258



>gb|KHG29253.1| Reticulon-like protein B5 [Gossypium arboreum]
Length=251

 Score =   251 bits (642),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 133/185 (72%), Positives = 156/185 (84%), Gaps = 0/185 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWRNKKIS GVLGGATAIW+LFE++EYHLLT +CH  IL LAVLFLWSN  +FI K
Sbjct  67   ADVFLWRNKKISAGVLGGATAIWVLFELIEYHLLTLLCHISILCLAVLFLWSNVHTFIHK  126

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            + P IP+VH+PEEP LQ ASAL  ++N  L +LRDIASGR+LK FL+V+   W++S+VGS
Sbjct  127  TPPRIPQVHLPEEPFLQIASALTIELNQALKLLRDIASGRNLKKFLVVVAAFWVLSVVGS  186

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
             C+FLTLFY + VLLHTVPVLYEKYED+VD FAEKA+ E+KKQYAVFDAKVL KIP GPL
Sbjct  187  WCNFLTLFYTSFVLLHTVPVLYEKYEDKVDPFAEKAVIEIKKQYAVFDAKVLGKIPTGPL  246

Query  193  KDKKL  179
            K KK+
Sbjct  247  KTKKV  251



>ref|XP_003565836.1| PREDICTED: reticulon-like protein B1 [Brachypodium distachyon]
Length=286

 Score =   252 bits (644),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 129/184 (70%), Positives = 154/184 (84%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVF+WRNK IS GVLGGATAIWILFE+L YHLL  +CHGLI +L VLFLWSNASSFI K
Sbjct  102  ADVFMWRNKNISAGVLGGATAIWILFELLGYHLLAFLCHGLIFSLGVLFLWSNASSFINK  161

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IPEV IPE+ V+  A + R+++N   A LR+IA GRD+K FL+VI GLW++SI+GS
Sbjct  162  SPPRIPEVIIPEDLVVNVALSTRHEINRAFANLREIALGRDIKKFLIVIAGLWLLSILGS  221

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            CC+FLTL YI  V+LHTVPVLYEKYED++D++ EK   E+KKQY+VFDAKVLSK+PRGPL
Sbjct  222  CCNFLTLVYIVFVVLHTVPVLYEKYEDQIDSYGEKGWVEVKKQYSVFDAKVLSKVPRGPL  281

Query  193  KDKK  182
            KDKK
Sbjct  282  KDKK  285



>gb|KHG09260.1| Reticulon-like protein B3 [Gossypium arboreum]
Length=252

 Score =   251 bits (640),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 144/184 (78%), Positives = 159/184 (86%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+ LWRNKKIS G LG AT IW+LFE+LEYHLLT VCH LILALA+LFLWSNA+ FI K
Sbjct  67   ADILLWRNKKISAGALGVATVIWVLFELLEYHLLTLVCHLLILALALLFLWSNATQFINK  126

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S PHIPEV IP+EPVL+FA ALR ++N   AVLRDIA GRDLKMFL VI GLW++SIVGS
Sbjct  127  STPHIPEVQIPKEPVLEFAMALRFEINRAFAVLRDIALGRDLKMFLSVIAGLWVLSIVGS  186

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
             C+FLTLFYI  V+LHTVPVLYEKYED+VD FAEKAMHE+KKQYAVFDAKVLSKIP GPL
Sbjct  187  WCNFLTLFYIVFVVLHTVPVLYEKYEDKVDPFAEKAMHEIKKQYAVFDAKVLSKIPMGPL  246

Query  193  KDKK  182
            K KK
Sbjct  247  KQKK  250



>ref|XP_011022600.1| PREDICTED: reticulon-like protein B1 [Populus euphratica]
Length=250

 Score =   251 bits (640),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 146/184 (79%), Positives = 162/184 (88%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+FLWRNKKIS G+LGGATAIW+LFE+LE HLLT VC+ LILAL +LFLWSNAS+FI K
Sbjct  65   ADIFLWRNKKISAGLLGGATAIWVLFELLECHLLTLVCYFLILALVLLFLWSNASTFINK  124

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S PHIPEV IPEEPVLQ A+AL  ++N   +VLRDIASGRDLK FL VI GLW++SIVGS
Sbjct  125  SPPHIPEVRIPEEPVLQIAAALTTEINWAFSVLRDIASGRDLKKFLSVIAGLWVLSIVGS  184

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
             C+FLTLFYIA VLLHTVPV YEKYED+VDAFAEKAM E+KKQYAVFDAKVLSKIPRGPL
Sbjct  185  WCNFLTLFYIAFVLLHTVPVFYEKYEDQVDAFAEKAMIEIKKQYAVFDAKVLSKIPRGPL  244

Query  193  KDKK  182
            K KK
Sbjct  245  KGKK  248



>ref|XP_006288443.1| hypothetical protein CARUB_v10001704mg [Capsella rubella]
 gb|EOA21341.1| hypothetical protein CARUB_v10001704mg [Capsella rubella]
Length=271

 Score =   251 bits (641),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 131/184 (71%), Positives = 157/184 (85%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+F+W+NKK+S GV+GGAT  W+LFE++EYHLLT +CH +I+ALAVLFLWSNA+ FI K
Sbjct  86   ADIFMWKNKKMSGGVIGGATVAWVLFELMEYHLLTLLCHVMIVALAVLFLWSNATMFIHK  145

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IPEVHIPEEP+LQ AS LR ++N   + LR+IASGRDLK FL  I GLW++SI+G 
Sbjct  146  SPPKIPEVHIPEEPLLQLASGLRIEINRGFSSLREIASGRDLKKFLSAIAGLWVLSILGG  205

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            CC FLTL YIA+VLL TVP+LY+KYED+VD++ EKAM ELKKQYAV DAKVLSKIPRGPL
Sbjct  206  CCSFLTLSYIALVLLFTVPLLYDKYEDKVDSYGEKAMAELKKQYAVLDAKVLSKIPRGPL  265

Query  193  KDKK  182
            KDKK
Sbjct  266  KDKK  269



>ref|XP_010541290.1| PREDICTED: reticulon-like protein B1 [Tarenaya hassleriana]
Length=267

 Score =   251 bits (641),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 131/184 (71%), Positives = 153/184 (83%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+F+WRNKK+S GVLGG TA+W+LFE+++YHLLT  CH LI+ LAVLFLWSNAS FI K
Sbjct  82   ADIFMWRNKKMSGGVLGGITAVWVLFELMQYHLLTLFCHILIVVLAVLFLWSNASIFINK  141

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IPEVHIPEE +LQ AS LR ++N     LRDIASGRDLK FL  I GLW++S++GS
Sbjct  142  SPPKIPEVHIPEEHILQLASGLRIEINRAFTCLRDIASGRDLKKFLSAIAGLWVLSVIGS  201

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
             C+FLTL YIA+V+L TVPV+YEKYED+VDAF EKAM E+KKQYAV D KV SKIPRGPL
Sbjct  202  WCNFLTLSYIAMVMLFTVPVMYEKYEDKVDAFGEKAMVEIKKQYAVLDEKVFSKIPRGPL  261

Query  193  KDKK  182
            KDKK
Sbjct  262  KDKK  265



>ref|XP_009388111.1| PREDICTED: reticulon-like protein B1 [Musa acuminata subsp. malaccensis]
Length=258

 Score =   250 bits (639),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 129/185 (70%), Positives = 149/185 (81%), Gaps = 0/185 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWRNKK+S   LGGATAIW+LFE++EYHLLT VCH LIL+LA++FLWSNAS+FI K
Sbjct  73   ADVFLWRNKKVSAATLGGATAIWVLFELMEYHLLTFVCHSLILSLAIMFLWSNASTFINK  132

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IPEV IPE+  +  A +LR ++N   A LRDIA GRDLK FL VI GLW+ SI+G+
Sbjct  133  SPPRIPEVSIPEDMAVNIALSLRYEINWAFAALRDIALGRDLKKFLSVIAGLWVFSIIGN  192

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
             C+FLTLFYIA V LHTVP LYEKYED+VDAFAEKA  E KK Y+V  AK LSKIP+GPL
Sbjct  193  FCNFLTLFYIAFVTLHTVPPLYEKYEDKVDAFAEKAQTEFKKHYSVIHAKYLSKIPKGPL  252

Query  193  KDKKL  179
            KDKK 
Sbjct  253  KDKKF  257



>emb|CDP08746.1| unnamed protein product [Coffea canephora]
Length=263

 Score =   250 bits (639),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 138/186 (74%), Positives = 161/186 (87%), Gaps = 0/186 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWRNK+IS  VLGGATA+W+LFE+LEYHLLT VCH LILALA+LFLWSNA++FI K
Sbjct  78   ADVFLWRNKRISAAVLGGATAVWVLFELLEYHLLTLVCHILILALAILFLWSNATTFINK  137

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IPEV + EEP LQ A+A+R ++N  LAVLR+IASGRDLK FL V++GLW  SI+GS
Sbjct  138  SPPRIPEVRLSEEPFLQVAAAVRFEINRALAVLREIASGRDLKKFLAVVSGLWFFSILGS  197

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
             C+FLTLFYI  VLLHT+PVLYEKYED+VD+FAEKAM E++K+YAVFD KVLSKIPRGP 
Sbjct  198  YCNFLTLFYITFVLLHTLPVLYEKYEDKVDSFAEKAMIEIRKKYAVFDEKVLSKIPRGPS  257

Query  193  KDKKLA  176
            KDKK A
Sbjct  258  KDKKRA  263



>ref|XP_008437352.1| PREDICTED: reticulon-like protein B2 [Cucumis melo]
Length=257

 Score =   250 bits (639),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 135/187 (72%), Positives = 159/187 (85%), Gaps = 0/187 (0%)
 Frame = -1

Query  736  QADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIK  557
             AD+FLWR+KK+S GVLGGAT  WILFE+LEYH LT +CH  + ALAV+FLWSNAS FI 
Sbjct  71   PADIFLWRDKKLSGGVLGGATIAWILFELLEYHFLTLICHIFMAALAVVFLWSNASFFIN  130

Query  556  KSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVG  377
            KS PHIP+VHIPE+PV++ ASALR ++N  +AVLRDIASGRDLK FL  I GLW++SI+G
Sbjct  131  KSLPHIPQVHIPEDPVIEIASALRVEINRAIAVLRDIASGRDLKSFLYAIAGLWVLSILG  190

Query  376  SCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGP  197
            S  +FLTL YI V++L TVPV YEKY+D+VDAFAEKAM E+KKQY VFDAKVLSKIPRGP
Sbjct  191  SWFNFLTLLYIGVIVLFTVPVFYEKYDDKVDAFAEKAMAEIKKQYVVFDAKVLSKIPRGP  250

Query  196  LKDKKLA  176
            LKDKK+A
Sbjct  251  LKDKKIA  257



>ref|XP_002303615.1| reticulon family protein [Populus trichocarpa]
 gb|EEE78594.1| reticulon family protein [Populus trichocarpa]
Length=250

 Score =   250 bits (638),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 147/184 (80%), Positives = 163/184 (89%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+FLWRNKKIS GVLGGATAIW+LFE+LE HLLT VC+ LILALA+LFLWSNAS+FI K
Sbjct  65   ADIFLWRNKKISAGVLGGATAIWVLFELLECHLLTLVCYFLILALALLFLWSNASTFINK  124

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S PHIPEV IPEEPVLQ A+ALR ++N   +VLRDIASGRDLK FL VI GLW++SIVGS
Sbjct  125  SPPHIPEVRIPEEPVLQIAAALRIEINWAFSVLRDIASGRDLKKFLTVIAGLWVLSIVGS  184

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
             C+FLTLFYIA VLL+TVPV YEKYED+VDAFAEKAM E+KKQYAVFDAKVLSKIP GPL
Sbjct  185  WCNFLTLFYIAFVLLYTVPVFYEKYEDQVDAFAEKAMIEIKKQYAVFDAKVLSKIPMGPL  244

Query  193  KDKK  182
            K KK
Sbjct  245  KGKK  248



>dbj|BAB32723.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAB92114.1| unknown protein [Oryza sativa Japonica Group]
 gb|EAZ11106.1| hypothetical protein OsJ_00954 [Oryza sativa Japonica Group]
Length=279

 Score =   251 bits (640),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 128/184 (70%), Positives = 152/184 (83%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWRN+ IS GVLGGATAIWILFE+L YHLLT VCHGLI +L +LFLWSNASSFI K
Sbjct  95   ADVFLWRNRNISAGVLGGATAIWILFELLGYHLLTFVCHGLIFSLGLLFLWSNASSFINK  154

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IPEV IPE+ V+  A + R ++N   A LR IA GRD+K FL+VI GLW++S++GS
Sbjct  155  SPPRIPEVIIPEDLVVNIALSTRYEINRAFANLRQIALGRDIKKFLIVIAGLWLLSVLGS  214

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            CC+FLTL YI  V+LHTVP+LYEKYED++D++ EK   E+KKQYAV DAKVLSK+PRGPL
Sbjct  215  CCNFLTLVYIVFVVLHTVPILYEKYEDQIDSYGEKGWVEIKKQYAVLDAKVLSKVPRGPL  274

Query  193  KDKK  182
            KDKK
Sbjct  275  KDKK  278



>ref|XP_002511930.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50599.1| conserved hypothetical protein [Ricinus communis]
Length=253

 Score =   249 bits (636),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 137/186 (74%), Positives = 154/186 (83%), Gaps = 0/186 (0%)
 Frame = -1

Query  736  QADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIK  557
             ADVFLWRNKKIS  VLG ATAIWILFE++EYHLLT VCH  IL LA+LFLWSNA +FI 
Sbjct  68   PADVFLWRNKKISASVLGTATAIWILFELIEYHLLTLVCHISILTLAILFLWSNAHTFIN  127

Query  556  KSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVG  377
            K+ P IP+VHIPEEPVLQ ASAL  ++NH  AVLR IASG+DLK FL+VI   W +SIVG
Sbjct  128  KTPPRIPQVHIPEEPVLQVASALTMEINHGFAVLRSIASGKDLKKFLVVIAAFWALSIVG  187

Query  376  SCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGP  197
              C+FLTLFYI  VLLHTVPVLYEKYED+VD FAEKAM E+KKQYA+FDAKVLSKIP G 
Sbjct  188  CWCNFLTLFYITFVLLHTVPVLYEKYEDKVDPFAEKAMIEIKKQYAMFDAKVLSKIPVGA  247

Query  196  LKDKKL  179
            LK K++
Sbjct  248  LKAKRV  253



>ref|XP_010529625.1| PREDICTED: reticulon-like protein B1 [Tarenaya hassleriana]
Length=267

 Score =   250 bits (638),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 131/184 (71%), Positives = 152/184 (83%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+F+WRNKK+S  VLGG TA+W+LFE+ EYHLLT +CH LI  +AVLFLWSNAS FI K
Sbjct  82   ADIFMWRNKKMSASVLGGITAVWVLFELAEYHLLTLLCHVLIAVIAVLFLWSNASMFIHK  141

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IPEVHIPEEP+LQ AS LR ++N     LRDIASGRDLK FL  I GLW++SI+G 
Sbjct  142  SPPKIPEVHIPEEPILQLASGLRIEINRAFTCLRDIASGRDLKKFLSAIAGLWVLSILGG  201

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            CC+FLTL YIA+V+L T+PVLYEKYED+VDA+ EKAM E+KKQYAV D KVLSKIPRGPL
Sbjct  202  CCNFLTLSYIAMVMLFTIPVLYEKYEDKVDAYGEKAMVEIKKQYAVLDEKVLSKIPRGPL  261

Query  193  KDKK  182
            K KK
Sbjct  262  KGKK  265



>ref|XP_009415169.1| PREDICTED: reticulon-like protein B2 [Musa acuminata subsp. malaccensis]
Length=251

 Score =   249 bits (636),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 129/185 (70%), Positives = 155/185 (84%), Gaps = 0/185 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLW+NKK S  VLGGATAIW+LFE++EYHLLT VCH LIL+LA+LFLWSNA++FI K
Sbjct  66   ADVFLWKNKKASAIVLGGATAIWVLFELMEYHLLTLVCHCLILSLAILFLWSNATTFINK  125

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S PHIPEV IPE+  +  A +LR ++N   AVLR+IA+GRD+K FL VI GLW++S++G+
Sbjct  126  SPPHIPEVIIPEDLSVNIALSLRYEINRGFAVLREIAAGRDVKKFLAVIVGLWVLSVIGN  185

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            CC+FLTLFYIA V LHTVP LY+KYED+VD+FAEKA  E KK YAV  AK LSKIPRGPL
Sbjct  186  CCNFLTLFYIAFVTLHTVPFLYDKYEDQVDSFAEKATVEFKKHYAVIHAKYLSKIPRGPL  245

Query  193  KDKKL  179
            KDKK+
Sbjct  246  KDKKV  250



>ref|XP_008655792.1| PREDICTED: reticulon-like protein B1 [Zea mays]
 gb|AFW80459.1| hypothetical protein ZEAMMB73_353444 [Zea mays]
Length=279

 Score =   250 bits (638),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 129/184 (70%), Positives = 149/184 (81%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWRN+ IS GVLGGATAIWILFE+L YHLLT VCHGLI +L VLFLWSNASSFI K
Sbjct  95   ADVFLWRNRNISAGVLGGATAIWILFELLGYHLLTFVCHGLIFSLGVLFLWSNASSFIHK  154

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IPEV IPE+ V+  A + R ++N   A LR IA GRD+K FLMVI GLW++S++GS
Sbjct  155  SPPKIPEVVIPEDLVVNIAVSTRYEINRAFANLRRIALGRDIKKFLMVIAGLWLLSVLGS  214

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            CC+ LTL YI  V+LHTVPVLYEKYED++D + EK   E+KKQYAVFD KVLSK+PRGP 
Sbjct  215  CCNLLTLVYIVFVVLHTVPVLYEKYEDQIDTYGEKGWVEIKKQYAVFDEKVLSKVPRGPA  274

Query  193  KDKK  182
            KDKK
Sbjct  275  KDKK  278



>gb|EYU23406.1| hypothetical protein MIMGU_mgv1a012325mg [Erythranthe guttata]
Length=254

 Score =   249 bits (635),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 132/184 (72%), Positives = 152/184 (83%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+ LW++KK+S GVLGG TAIW+LF++LEYHLL  VCHGLIL L  LFL+SNAS+FIKK
Sbjct  69   ADLLLWKDKKVSGGVLGGVTAIWVLFDLLEYHLLALVCHGLILGLVGLFLYSNASTFIKK  128

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IP V IPEEPVL FASALR  +N   A LRDIASG+DLK FL VI GLW++S  GS
Sbjct  129  SPPKIPVVSIPEEPVLNFASALRIGINEGFATLRDIASGKDLKKFLSVIAGLWVLSFFGS  188

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            CCDFLTL Y   VLL TVP++Y+KYED+VD FAEKAM E+KKQYAVF+ KVLSKIPRGPL
Sbjct  189  CCDFLTLLYSITVLLFTVPLVYDKYEDQVDCFAEKAMVEIKKQYAVFNTKVLSKIPRGPL  248

Query  193  KDKK  182
            K+KK
Sbjct  249  KEKK  252



>gb|KHG20258.1| Reticulon-like protein B3 [Gossypium arboreum]
Length=251

 Score =   249 bits (635),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 142/185 (77%), Positives = 159/185 (86%), Gaps = 0/185 (0%)
 Frame = -1

Query  736  QADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIK  557
            QAD+FLWRNKKIS G LG AT IW+LFE+LEYHLLT VCH LILALA+LFLWSNA++FI 
Sbjct  65   QADIFLWRNKKISAGTLGVATVIWVLFELLEYHLLTLVCHLLILALALLFLWSNAATFIH  124

Query  556  KSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVG  377
            KS P IPEV IP++PVL+FA ALR ++N   AVLRDIASGRDLK FL VI GLW+ SIVG
Sbjct  125  KSPPRIPEVQIPKDPVLEFAQALRFEINRGFAVLRDIASGRDLKKFLSVIVGLWVSSIVG  184

Query  376  SCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGP  197
            S C+FLTLFYI  VLLHTVPVLYEKYED+VD  AEKA HE+KKQYAVFDAKVLSKIP+ P
Sbjct  185  SWCNFLTLFYIVFVLLHTVPVLYEKYEDKVDPLAEKAWHEIKKQYAVFDAKVLSKIPKRP  244

Query  196  LKDKK  182
            LK+KK
Sbjct  245  LKEKK  249



>ref|XP_008792378.1| PREDICTED: reticulon-like protein B3 isoform X1 [Phoenix dactylifera]
 ref|XP_008792379.1| PREDICTED: reticulon-like protein B3 isoform X1 [Phoenix dactylifera]
Length=280

 Score =   249 bits (637),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 135/212 (64%), Positives = 158/212 (75%), Gaps = 29/212 (14%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+FLWRNKKIS GVLGGATAIW+LF+++EYHLL  VCH LIL+LA+LFLWSNA++FI K
Sbjct  67   ADIFLWRNKKISAGVLGGATAIWVLFDLMEYHLLALVCHCLILSLAILFLWSNATTFINK  126

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLM-------------  413
            S P IPEV IPE+  + FA +LR ++N   AVLRDIASGRDLK FLM             
Sbjct  127  SPPRIPEVSIPEDVAVSFALSLRYEINRGFAVLRDIASGRDLKKFLMVCCSVFLSNVSGS  186

Query  412  ----------------VITGLWIISIVGSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDA  281
                            VI GLW++SIVGSCC+FLTLFYIA V LHT+PVLYEKYED+VD+
Sbjct  187  WSISMGVILFGILVFQVIAGLWVLSIVGSCCNFLTLFYIAFVTLHTLPVLYEKYEDKVDS  246

Query  280  FAEKAMHELKKQYAVFDAKVLSKIPRGPLKDK  185
            FAEKAM ++KK YA F+AK LSKIPRGPLK K
Sbjct  247  FAEKAMTKVKKNYATFNAKCLSKIPRGPLKKK  278



>ref|NP_001056102.1| Os05g0526400 [Oryza sativa Japonica Group]
 gb|AAU44062.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF18016.1| Os05g0526400 [Oryza sativa Japonica Group]
 dbj|BAG96540.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00639.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64429.1| hypothetical protein OsJ_19273 [Oryza sativa Japonica Group]
Length=251

 Score =   248 bits (634),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 125/184 (68%), Positives = 155/184 (84%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+FLWRNKKISVGVL GATAIW+LFEV++YHLLT +CH +IL LA+LFLWSNAS+FI K
Sbjct  67   ADLFLWRNKKISVGVLAGATAIWLLFEVMDYHLLTLLCHCIILTLAMLFLWSNASTFINK  126

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P+IPEV IPE+  +  A +LR ++N   A LR+I  G DLK FL+V+ GLW++S++GS
Sbjct  127  SPPNIPEVKIPEDLAVNVARSLRFEINRGFATLREIGQGHDLKKFLIVVVGLWVLSVLGS  186

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            CC+FLTLFYI  ++L+TVPVLYEKYED++DAF EKAM ELKK YA+FD K LSKIP+GPL
Sbjct  187  CCNFLTLFYIVFMVLYTVPVLYEKYEDQIDAFGEKAMIELKKYYAIFDEKCLSKIPKGPL  246

Query  193  KDKK  182
            K+KK
Sbjct  247  KNKK  250



>ref|XP_006366650.1| PREDICTED: putative 24 kDa seed maturation protein-like protein 
[Solanum tuberosum]
Length=403

 Score =   253 bits (647),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 131/185 (71%), Positives = 158/185 (85%), Gaps = 0/185 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+FLWR+KKI+ GVLG AT++W+LFE+L+YHLLT VCH LILALAVLFLWSNAS+FI K
Sbjct  218  ADIFLWRDKKITAGVLGFATSLWVLFELLQYHLLTLVCHILILALAVLFLWSNASTFINK  277

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IP+V +PE+ VL  A+ALR ++N  L + RDIASG++LK FL VI GLW++SI+G+
Sbjct  278  SPPQIPDVILPEDIVLGVAAALRIEINKALEIFRDIASGKELKKFLAVIAGLWVLSILGN  337

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            C +FLTLFYI  VLLHTVPVLYEK+ED+VDAFAE A  E+KKQYAVF+ KVLSKIPRGPL
Sbjct  338  CWNFLTLFYICFVLLHTVPVLYEKFEDQVDAFAENAEAEIKKQYAVFNVKVLSKIPRGPL  397

Query  193  KDKKL  179
            KDKK 
Sbjct  398  KDKKF  402



>gb|KDP28552.1| hypothetical protein JCGZ_14323 [Jatropha curcas]
Length=254

 Score =   248 bits (634),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 135/186 (73%), Positives = 156/186 (84%), Gaps = 0/186 (0%)
 Frame = -1

Query  736  QADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIK  557
             ADV LWRNKKIS  VLG ATAIW+LFE++EYHLLT  CH LIL+LAVLFLWSNA +FI 
Sbjct  69   PADVLLWRNKKISASVLGVATAIWVLFELIEYHLLTLACHILILSLAVLFLWSNAHTFIN  128

Query  556  KSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVG  377
            K+ P IP++H+PEEP L  ASAL  ++N  LAVLRDIASG+DLK FL+VI  LW++SIVG
Sbjct  129  KTPPRIPQIHLPEEPFLLVASALTLEINRGLAVLRDIASGKDLKKFLIVIAALWVVSIVG  188

Query  376  SCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGP  197
            S C+FLTLFYI+ VLLHTVPVLYEKYED+VD FAEKA  E+KKQYAVFDAKVLSKIP G 
Sbjct  189  SWCNFLTLFYISFVLLHTVPVLYEKYEDKVDPFAEKATIEIKKQYAVFDAKVLSKIPVGA  248

Query  196  LKDKKL  179
            LK K++
Sbjct  249  LKAKRV  254



>ref|XP_004143883.1| PREDICTED: reticulon-like protein B2-like [Cucumis sativus]
 ref|XP_004170740.1| PREDICTED: reticulon-like protein B2-like [Cucumis sativus]
 gb|KGN50045.1| hypothetical protein Csa_5G151610 [Cucumis sativus]
Length=257

 Score =   248 bits (634),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 134/187 (72%), Positives = 158/187 (84%), Gaps = 0/187 (0%)
 Frame = -1

Query  736  QADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIK  557
             AD+FLWR+KK+S GVLGGAT  WILFE+LEYH LT +CH  + ALAV+FLWSNAS FI 
Sbjct  71   PADIFLWRDKKLSGGVLGGATIAWILFELLEYHFLTLICHIFMAALAVVFLWSNASFFIN  130

Query  556  KSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVG  377
            KS PHIP+VHIPE PV++ ASALR ++N  +AVLR+IASGRDLK FL  I GLW++SIVG
Sbjct  131  KSLPHIPQVHIPEGPVVEIASALRVEINRAIAVLREIASGRDLKSFLYAIAGLWVLSIVG  190

Query  376  SCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGP  197
            S  +FLTL YI V++L TVP+ YEKY+D+VDAFAEKAM E+KKQY VFDAKVLSKIPRGP
Sbjct  191  SWFNFLTLLYIGVIVLFTVPLFYEKYDDKVDAFAEKAMAEIKKQYVVFDAKVLSKIPRGP  250

Query  196  LKDKKLA  176
            LKDKK+A
Sbjct  251  LKDKKIA  257



>ref|XP_004969875.1| PREDICTED: reticulon-like protein B1-like [Setaria italica]
Length=257

 Score =   248 bits (634),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 128/184 (70%), Positives = 152/184 (83%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+ LWRNKKIS GVL  ATAIW+LFEV+EYHLLT VCH LIL+LA+LFLWSNAS+FI K
Sbjct  73   ADLVLWRNKKISGGVLASATAIWLLFEVMEYHLLTLVCHCLILSLAILFLWSNASTFINK  132

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P+IPEV I E+  +  A +LR ++N   A LR+I  GRDLK FL+VI G W++S++GS
Sbjct  133  SPPNIPEVKISEDVAVNVALSLRYEINRGFATLREIGHGRDLKKFLIVIAGFWLLSVLGS  192

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            CC+FLTLFYI  V+L+TVPVLYEKYED+VDAF EKAM ELKK YA+FD K LSKIP+GPL
Sbjct  193  CCNFLTLFYIVFVVLYTVPVLYEKYEDKVDAFGEKAMIELKKYYAIFDEKCLSKIPKGPL  252

Query  193  KDKK  182
            KDKK
Sbjct  253  KDKK  256



>ref|XP_002874678.1| VIRB2-interacting protein 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50937.1| VIRB2-interacting protein 2 [Arabidopsis lyrata subsp. lyrata]
Length=271

 Score =   248 bits (634),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 131/184 (71%), Positives = 155/184 (84%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+F+W+NKK+S GV GGAT  W+LFE++EYHLLT +CH +I+ALAVLFLWSNA+ FI K
Sbjct  86   ADIFMWKNKKMSGGVFGGATVAWVLFELMEYHLLTLLCHVMIVALAVLFLWSNATMFIHK  145

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IPEVHIPEEP+LQ  S LR ++N   + LR+IASGRDLK FL  I GLW++SI+G 
Sbjct  146  SPPKIPEVHIPEEPLLQLVSGLRIEINCGFSSLREIASGRDLKKFLSAIAGLWVLSILGG  205

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            CC FLTL YIA+VLL TVP+ Y+KYED+VDA+ EKAM ELKKQYAVFDAKVLSKIPRGPL
Sbjct  206  CCSFLTLAYIALVLLFTVPLFYDKYEDKVDAYGEKAMAELKKQYAVFDAKVLSKIPRGPL  265

Query  193  KDKK  182
            KDKK
Sbjct  266  KDKK  269



>ref|XP_009416410.1| PREDICTED: reticulon-like protein B2 [Musa acuminata subsp. malaccensis]
Length=251

 Score =   248 bits (632),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 129/185 (70%), Positives = 150/185 (81%), Gaps = 0/185 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLW+NKK S  VLGGATAIWILFE++EYHLLT VCH LIL+LA+LFLWSNA++ I K
Sbjct  66   ADVFLWKNKKASAVVLGGATAIWILFELMEYHLLTLVCHCLILSLAILFLWSNATTLINK  125

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S PHIP V IPE+  +  + +L  ++N   +VLR+IA+GR+LK FL VI GLWI+SI+GS
Sbjct  126  SPPHIPVVSIPEDLAVNISRSLTYEINRGFSVLREIATGRELKKFLAVIAGLWILSIIGS  185

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            CC+FLTLFYIA V LHTVP LY+KYED VD FAEKA  E KK YAVF AK LSKIPRGPL
Sbjct  186  CCNFLTLFYIAFVTLHTVPFLYDKYEDRVDTFAEKATVEFKKHYAVFHAKCLSKIPRGPL  245

Query  193  KDKKL  179
            KDKK 
Sbjct  246  KDKKF  250



>ref|XP_004967455.1| PREDICTED: reticulon-like protein B1-like [Setaria italica]
Length=278

 Score =   248 bits (634),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 128/184 (70%), Positives = 148/184 (80%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWRN+ IS GVLGG TAIWILFE L YHLLT VCHGLI +L VLFLWSNASSFI K
Sbjct  94   ADVFLWRNRNISAGVLGGVTAIWILFECLGYHLLTFVCHGLIFSLGVLFLWSNASSFINK  153

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IPEV IPE+ V+  A + R ++N     LR IA GRD+K FLMVI GLW++S++GS
Sbjct  154  SPPRIPEVIIPEDLVVNIALSTRYEINRAFVNLRQIALGRDIKKFLMVIAGLWLLSVLGS  213

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            CC+FLTL YI  V+LHTVPVLYEKYED++D++ EK   E+KKQYAVFD KVLSK+PRGP 
Sbjct  214  CCNFLTLVYIVFVVLHTVPVLYEKYEDQIDSYGEKGWVEIKKQYAVFDEKVLSKVPRGPA  273

Query  193  KDKK  182
            KDKK
Sbjct  274  KDKK  277



>ref|XP_008234814.1| PREDICTED: reticulon-like protein B1 [Prunus mume]
Length=259

 Score =   248 bits (632),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 128/184 (70%), Positives = 151/184 (82%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADV LWRNKKIS  VLGGAT +W+ FE+LEYHL+T VCH LIL+LAV FLWSNAS+FI K
Sbjct  74   ADVLLWRNKKISASVLGGATVLWVFFELLEYHLITLVCHLLILSLAVFFLWSNASTFINK  133

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IP+V + E  VL  ASALR ++N    +LRDIASGRDLKMFL VI  LWI+S+VG 
Sbjct  134  SPPQIPKVQLSERTVLDLASALRIELNRAFHILRDIASGRDLKMFLGVIAVLWIVSLVGK  193

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
              +FLTLFYI  VLLHT+PV+YEKY+ ++DAF+EKA+ E KKQYAVFDAKVLSKIP+GPL
Sbjct  194  WFNFLTLFYITFVLLHTLPVIYEKYDVQIDAFSEKALIEFKKQYAVFDAKVLSKIPKGPL  253

Query  193  KDKK  182
            K+KK
Sbjct  254  KEKK  257



>ref|XP_010261408.1| PREDICTED: reticulon-like protein B2 [Nelumbo nucifera]
 ref|XP_010261409.1| PREDICTED: reticulon-like protein B2 [Nelumbo nucifera]
Length=255

 Score =   248 bits (632),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 139/188 (74%), Positives = 158/188 (84%), Gaps = 2/188 (1%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWRNKKIS  VLGGATA W+LFE+LEYH LT VCH LIL+L++LFLWSNA++FI K
Sbjct  68   ADVFLWRNKKISASVLGGATAAWVLFELLEYHFLTLVCHCLILSLSLLFLWSNATTFINK  127

Query  553  SAphipevhi--peepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIV  380
            S        +  PE+PVLQFASALR ++N   +VLRDIASGRDLK FL+VI GLW++SIV
Sbjct  128  SQSPPRIPEVYIPEDPVLQFASALRIEINSGFSVLRDIASGRDLKKFLVVIAGLWVLSIV  187

Query  379  GSCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRG  200
            GS C+FLTLFYI  VLLHTVPV YEKYED+VD+FAEKAM E+KKQY VFDAKVLSKIPRG
Sbjct  188  GSWCNFLTLFYIVFVLLHTVPVFYEKYEDKVDSFAEKAMAEIKKQYVVFDAKVLSKIPRG  247

Query  199  PLKDKKLA  176
            PLKDKK A
Sbjct  248  PLKDKKRA  255



>gb|EMS62606.1| Reticulon-like protein B1 [Triticum urartu]
Length=248

 Score =   247 bits (630),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 126/184 (68%), Positives = 150/184 (82%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+FLWRNKKIS GVL GATAIW+LFEVLEYHLLT +CHG IL L +LFLWSNAS+F+ K
Sbjct  63   ADLFLWRNKKISGGVLAGATAIWLLFEVLEYHLLTLLCHGFILTLGILFLWSNASAFVNK  122

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
              P+IPEV IPE+  +  A +LR ++N   A LR I  GRDLK FL+V+ GLWI+S +GS
Sbjct  123  CPPNIPEVKIPEDLAVNVARSLRYEINRGFASLRAIGQGRDLKKFLIVVAGLWILSFLGS  182

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            CC+FLTLFYI  ++L+TVPVLYEKYED++DAF EKAM ELKK YA+FD K LSKIP+GP 
Sbjct  183  CCNFLTLFYIVFMVLYTVPVLYEKYEDKIDAFGEKAMVELKKYYAIFDEKCLSKIPKGPS  242

Query  193  KDKK  182
            KDKK
Sbjct  243  KDKK  246



>ref|XP_011073407.1| PREDICTED: reticulon-like protein B2 isoform X1 [Sesamum indicum]
Length=248

 Score =   246 bits (629),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 132/184 (72%), Positives = 150/184 (82%), Gaps = 6/184 (3%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+FLW          GGATAIW+LF+VLEYHLLT VCHGLI+ LA+LFLWS+  +FI K
Sbjct  69   ADIFLWXX------XXGGATAIWVLFDVLEYHLLTLVCHGLIVGLALLFLWSSIMTFINK  122

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IPEV IPEEP L+FASALR ++NH  AVLRDIASGRDLK FL V+ GLWI+S+VG 
Sbjct  123  SPPRIPEVSIPEEPALKFASALRVEINHGFAVLRDIASGRDLKKFLSVVAGLWILSVVGG  182

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            CCDFLTL Y   VLL TVP+ YEKYED+VD+FAEKAM E+KKQY VFDA+VLSKIPRGPL
Sbjct  183  CCDFLTLLYTITVLLFTVPLFYEKYEDQVDSFAEKAMAEVKKQYVVFDARVLSKIPRGPL  242

Query  193  KDKK  182
            KDKK
Sbjct  243  KDKK  246



>ref|XP_006360189.1| PREDICTED: reticulon-like protein B2-like [Solanum tuberosum]
Length=253

 Score =   246 bits (629),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 129/185 (70%), Positives = 155/185 (84%), Gaps = 0/185 (0%)
 Frame = -1

Query  736  QADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIK  557
             AD+FLWR+KK++ GVLG AT IW LFE+LEYHLLT VCH LI+A+AVLFLWSNAS+FI 
Sbjct  68   PADIFLWRDKKVTAGVLGFATVIWALFELLEYHLLTLVCHILIVAVAVLFLWSNASAFIN  127

Query  556  KSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVG  377
             + P IPEV +P++ VL  ASALR ++N  L +LRDIASG+DLK FL+VI GLW++S++G
Sbjct  128  TAPPQIPEVVLPKDIVLGVASALRIEINRALEILRDIASGKDLKKFLVVIVGLWVVSVLG  187

Query  376  SCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGP  197
            +  +FLTLFYI  VLLHTVP+LYEKYED+VDAFAEKA  E+KK YAVFDA VLSKIPRGP
Sbjct  188  NIWNFLTLFYIVFVLLHTVPLLYEKYEDKVDAFAEKAEAEIKKHYAVFDANVLSKIPRGP  247

Query  196  LKDKK  182
            LK KK
Sbjct  248  LKGKK  252



>gb|EMT19773.1| Reticulon-like protein B1 [Aegilops tauschii]
Length=286

 Score =   248 bits (632),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 128/184 (70%), Positives = 151/184 (82%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVF+WRNK IS GVLGGATAIWILFE+L YHLL  + H LI +L VLFLWSNASSFI K
Sbjct  102  ADVFMWRNKHISAGVLGGATAIWILFELLGYHLLAFLGHALIFSLGVLFLWSNASSFINK  161

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IPEV IPE+ V+  A + R+++N   A LR IA GRD+K FL+VI GLW++SI+GS
Sbjct  162  SPPKIPEVIIPEDLVVNIALSTRHEINRAFANLRQIALGRDIKKFLIVIAGLWLLSILGS  221

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            CC+FLTLFYI  V+LHTVPV+YEKYED++D + EK   E+KKQYAVFDAKVLSK+PRGPL
Sbjct  222  CCNFLTLFYIVFVVLHTVPVIYEKYEDQIDTYGEKGWIEVKKQYAVFDAKVLSKVPRGPL  281

Query  193  KDKK  182
            KDKK
Sbjct  282  KDKK  285



>ref|XP_008232963.1| PREDICTED: reticulon-like protein B6 [Prunus mume]
Length=257

 Score =   246 bits (629),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 135/184 (73%), Positives = 155/184 (84%), Gaps = 1/184 (1%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWRNKK+S GVLGGATA+W+LFE+LEYHLLT V H LI  LAVLFLWSNA SFI K
Sbjct  74   ADVFLWRNKKVSAGVLGGATAVWVLFELLEYHLLTLVGHILIGTLAVLFLWSNAHSFIHK  133

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            + P IPEVH+PEEP LQ AS LR  +N   AVL DIASGR+LK FL+VI GLW++SIVG+
Sbjct  134  TPPRIPEVHLPEEPFLQVASELRLQINWAFAVLHDIASGRELKKFLIVIAGLWVLSIVGT  193

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
             C+FLTLFYI+ VLLHTVPV+YEKYED++D FAEKA  E KK YAVFDAKVLSKIP+G L
Sbjct  194  WCNFLTLFYISFVLLHTVPVIYEKYEDKIDPFAEKATIEFKKHYAVFDAKVLSKIPQG-L  252

Query  193  KDKK  182
            K+K+
Sbjct  253  KNKR  256



>gb|EMT18983.1| Reticulon-like protein B1 [Aegilops tauschii]
Length=225

 Score =   245 bits (625),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 126/185 (68%), Positives = 150/185 (81%), Gaps = 0/185 (0%)
 Frame = -1

Query  736  QADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIK  557
             AD+FLWRNKKIS GVL GATAIW+LFEVLEYHLLT +CHG IL L +LFLWSNAS+F+ 
Sbjct  39   SADLFLWRNKKISGGVLAGATAIWLLFEVLEYHLLTLLCHGFILTLGILFLWSNASAFVN  98

Query  556  KSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVG  377
            K  P+IPEV IPE+  +  A +LR ++N   A LR I  GRDLK FL+V+ GLWI+S +G
Sbjct  99   KCPPNIPEVKIPEDLAVNVARSLRYEINRGFASLRAIGQGRDLKKFLIVVAGLWILSFLG  158

Query  376  SCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGP  197
            SCC+FLTLFYI  ++L+TVPVLYEKYED++DAF EKAM ELKK YA+FD K LSKIP+GP
Sbjct  159  SCCNFLTLFYIVFMVLYTVPVLYEKYEDKIDAFGEKAMVELKKYYAIFDEKCLSKIPKGP  218

Query  196  LKDKK  182
             KDKK
Sbjct  219  SKDKK  223



>ref|XP_006847055.1| hypothetical protein AMTR_s00017p00194840 [Amborella trichopoda]
 gb|ERN08636.1| hypothetical protein AMTR_s00017p00194840 [Amborella trichopoda]
Length=291

 Score =   247 bits (631),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 136/184 (74%), Positives = 156/184 (85%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWRNKKIS  VLGGAT IWILFE LEYH +T +CH LIL LA+LFLWSN ++FI K
Sbjct  107  ADVFLWRNKKISASVLGGATLIWILFECLEYHFVTLLCHCLILTLALLFLWSNGTAFINK  166

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S PHIPEV IPE+     A +LR ++N   +VLRDIASGRDLKMFL V+ GLW++SI+GS
Sbjct  167  SPPHIPEVKIPEDVATNIALSLRYEINRAFSVLRDIASGRDLKMFLTVVAGLWVLSILGS  226

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            CC+FLTLFYI  V+LHTVPVLYEKYED+VD+F+EKAM E+KKQYAVFDAKVLSKIPRGPL
Sbjct  227  CCNFLTLFYITFVVLHTVPVLYEKYEDQVDSFSEKAMIEIKKQYAVFDAKVLSKIPRGPL  286

Query  193  KDKK  182
            K KK
Sbjct  287  KSKK  290



>ref|XP_009772131.1| PREDICTED: reticulon-like protein B2 [Nicotiana sylvestris]
Length=260

 Score =   246 bits (628),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 157/186 (84%), Gaps = 0/186 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            A++FLWR+KK+S GVLG AT IW LFE+L+YHLLT VCH LI+A+ VLFLWSNAS+FI  
Sbjct  75   AEIFLWRDKKVSAGVLGFATVIWALFELLQYHLLTLVCHILIVAITVLFLWSNASAFINT  134

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            + P IPEV +P + VL  ASALR ++N  L +LRDIASG+DLK FL+VI GLW++SI+G+
Sbjct  135  APPQIPEVVLPRDIVLGVASALRIEMNRILEILRDIASGKDLKKFLVVILGLWVVSILGN  194

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            C +FLTLFYI  VLLHTVPVLY+KYED+VDAFAEKA  E+KK YAVF+ +VLSKIPRGPL
Sbjct  195  CWNFLTLFYIVFVLLHTVPVLYDKYEDKVDAFAEKAEAEIKKHYAVFNDQVLSKIPRGPL  254

Query  193  KDKKLA  176
            +DK+LA
Sbjct  255  RDKRLA  260



>ref|XP_006374289.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
 gb|ERP52086.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
Length=254

 Score =   246 bits (627),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 128/184 (70%), Positives = 151/184 (82%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWRNKKIS GVLGGATA+W+ FE+LEYHL+T VCH  I +LAVLFLWSNAS+F+ K
Sbjct  69   ADVFLWRNKKISAGVLGGATAVWVFFELLEYHLITLVCHLSIFSLAVLFLWSNASNFLNK  128

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IPEV +PE+ V + AS LR ++N   AVL DIASGRDLK FL VI GL ++S+VGS
Sbjct  129  SPPKIPEVLLPEKWVREVASGLRIEINRGFAVLHDIASGRDLKKFLAVIAGLLVLSLVGS  188

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            CC+FLTL YI+ VLLHTVPVLYEKYED+VD  +EKA  ++KKQYAV D K +SKIPRGP 
Sbjct  189  CCNFLTLLYISFVLLHTVPVLYEKYEDQVDGNSEKAWTQIKKQYAVLDEKYISKIPRGPF  248

Query  193  KDKK  182
            K+KK
Sbjct  249  KEKK  252



>emb|CDJ26559.1| unnamed protein product, partial [Triticum aestivum]
Length=290

 Score =   247 bits (630),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 127/184 (69%), Positives = 151/184 (82%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVF+WRNK +S GVLGGATAIWILFE+L YHLL  + H LI +L VLFLWSNASSFI K
Sbjct  106  ADVFMWRNKHVSAGVLGGATAIWILFELLGYHLLAFLGHALIFSLGVLFLWSNASSFINK  165

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IPEV IPE+ V+  A + R+++N   A LR IA GRD+K FL+VI GLW++SI+GS
Sbjct  166  SPPRIPEVIIPEDLVVNIALSTRHEINRAFANLRQIALGRDIKKFLIVIAGLWLLSILGS  225

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            CC+FLTLFYI  V+LHTVPV+YEKYED++D + EK   E+KKQYAVFDAKVLSK+PRGPL
Sbjct  226  CCNFLTLFYIVFVVLHTVPVIYEKYEDQIDTYGEKGWIEVKKQYAVFDAKVLSKVPRGPL  285

Query  193  KDKK  182
            KDKK
Sbjct  286  KDKK  289



>ref|XP_006374290.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
 gb|ERP52087.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
Length=263

 Score =   246 bits (628),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 128/184 (70%), Positives = 151/184 (82%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWRNKKIS GVLGGATA+W+ FE+LEYHL+T VCH  I +LAVLFLWSNAS+F+ K
Sbjct  78   ADVFLWRNKKISAGVLGGATAVWVFFELLEYHLITLVCHLSIFSLAVLFLWSNASNFLNK  137

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IPEV +PE+ V + AS LR ++N   AVL DIASGRDLK FL VI GL ++S+VGS
Sbjct  138  SPPKIPEVLLPEKWVREVASGLRIEINRGFAVLHDIASGRDLKKFLAVIAGLLVLSLVGS  197

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            CC+FLTL YI+ VLLHTVPVLYEKYED+VD  +EKA  ++KKQYAV D K +SKIPRGP 
Sbjct  198  CCNFLTLLYISFVLLHTVPVLYEKYEDQVDGNSEKAWTQIKKQYAVLDEKYISKIPRGPF  257

Query  193  KDKK  182
            K+KK
Sbjct  258  KEKK  261



>ref|XP_009134231.1| PREDICTED: reticulon-like protein B2 [Brassica rapa]
Length=267

 Score =   246 bits (627),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 129/184 (70%), Positives = 156/184 (85%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+F+W+NKK+S GVLGGAT  W+LFE++EYHLLT +CH +I+ALAVLFLWSNA+ FI K
Sbjct  82   ADIFMWKNKKMSGGVLGGATVAWVLFELMEYHLLTLLCHVMIVALAVLFLWSNATMFIHK  141

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IPEVHIPE+P+LQ AS LR ++N   + L +IASGRDLK FL  + GLWI+SI+G 
Sbjct  142  SPPKIPEVHIPEDPLLQLASGLRIEINRGFSSLHEIASGRDLKKFLSALFGLWILSILGG  201

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            CC FLTL YIA+VLL TVP++Y+KYED+VD++ EKAM ELKKQYAV DAKVLSKIPRGPL
Sbjct  202  CCSFLTLAYIALVLLFTVPLVYDKYEDKVDSYGEKAMAELKKQYAVLDAKVLSKIPRGPL  261

Query  193  KDKK  182
            KDKK
Sbjct  262  KDKK  265



>ref|XP_010092876.1| Reticulon-like protein [Morus notabilis]
 gb|EXB52694.1| Reticulon-like protein [Morus notabilis]
Length=255

 Score =   245 bits (626),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 132/186 (71%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADV LWRNKKIS   LGG T  W+ FE+LEYHLLT VC+ LI++LA+LFLWSNA +FI K
Sbjct  70   ADVLLWRNKKISASFLGGVTGAWVFFELLEYHLLTLVCYTLIVSLAILFLWSNAHTFIHK  129

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IPEVHIPE+P LQ  SAL  ++N   A LR IASGRDLK FL+VI GLW++SIVGS
Sbjct  130  SPPRIPEVHIPEDPFLQVVSALTIEINQGFAALRSIASGRDLKKFLIVIAGLWVLSIVGS  189

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
              +FLTLFYI+VVLLHTVPVLYEKYED++D  AEKA+ ELKKQY VFD KVLSKIP+GPL
Sbjct  190  WANFLTLFYISVVLLHTVPVLYEKYEDKIDPLAEKALIELKKQYTVFDEKVLSKIPKGPL  249

Query  193  KDKKLA  176
            K KK A
Sbjct  250  KGKKRA  255



>emb|CDP05124.1| unnamed protein product [Coffea canephora]
Length=256

 Score =   245 bits (626),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 141/185 (76%), Positives = 159/185 (86%), Gaps = 0/185 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWR+KKIS  VLG  TAIW+LFE+LEY+LLT VCH LILALAVLFLWSNAS+FI K
Sbjct  71   ADVFLWRDKKISASVLGVVTAIWVLFELLEYYLLTLVCHILILALAVLFLWSNASTFINK  130

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P  PEV +PE+ VL  ASALR +VN  LA LR+IASGRDLK FL VI GLW+ SI+GS
Sbjct  131  SPPQFPEVILPEDIVLGVASALRIEVNRALAALREIASGRDLKKFLAVIAGLWVFSILGS  190

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            CC+FLTLFYI+ +LLHTVPVLYEKYED+VD+FAEKA  E+KKQYAVF+AKVLSKIPRGPL
Sbjct  191  CCNFLTLFYISFILLHTVPVLYEKYEDQVDSFAEKAEAEIKKQYAVFNAKVLSKIPRGPL  250

Query  193  KDKKL  179
            KDKK 
Sbjct  251  KDKKF  255



>ref|XP_004240710.1| PREDICTED: reticulon-like protein B6 [Solanum lycopersicum]
Length=253

 Score =   245 bits (625),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 132/185 (71%), Positives = 155/185 (84%), Gaps = 0/185 (0%)
 Frame = -1

Query  736  QADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIK  557
             ADVFLWR+KK++ GVLG AT IW LFE+LEYHLLT VCH LI+A+AVLFLWSNAS+FI 
Sbjct  68   PADVFLWRDKKVTAGVLGFATVIWALFELLEYHLLTLVCHILIVAVAVLFLWSNASAFIN  127

Query  556  KSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVG  377
             + PHIPEV +P++ VL  ASALR ++N  L +LRDIASG+DLK FL+VI GLWI+SI+G
Sbjct  128  TAPPHIPEVVLPKDIVLSVASALRIEINRALEILRDIASGKDLKKFLVVIVGLWIVSILG  187

Query  376  SCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGP  197
            +  +FLTLFYI  VLLHTVPVLYEK+ED+VDA AEKA  E+KK YAVFDA VLSKIPRGP
Sbjct  188  NIWNFLTLFYIVFVLLHTVPVLYEKHEDKVDAVAEKAEAEIKKHYAVFDANVLSKIPRGP  247

Query  196  LKDKK  182
            LK KK
Sbjct  248  LKGKK  252



>ref|XP_008376662.1| PREDICTED: reticulon-like protein B1 [Malus domestica]
Length=261

 Score =   245 bits (625),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 130/184 (71%), Positives = 152/184 (83%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADV LWRNKKIS  VLGGAT +W+ FE+LEYHL+T VCH LIL+LAV FLWS AS+FI K
Sbjct  76   ADVLLWRNKKISASVLGGATVLWVFFELLEYHLITLVCHLLILSLAVFFLWSYASTFINK  135

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IP+V IPE+ VL+ ASALR ++N    VLRDIASGRDLK FL VI  LWI+S+VG 
Sbjct  136  SPPQIPKVQIPEKTVLELASALRIEINKGFYVLRDIASGRDLKTFLGVIAVLWILSVVGK  195

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
              +FLTLFYI  VLLHT+PV+YEKY+D++DAF EKA  E+KKQYAVFDAKVLSKIPRGP+
Sbjct  196  WFNFLTLFYIIFVLLHTLPVIYEKYDDQIDAFGEKAWIEIKKQYAVFDAKVLSKIPRGPV  255

Query  193  KDKK  182
            K+KK
Sbjct  256  KEKK  259



>ref|XP_010422067.1| PREDICTED: reticulon-like protein B2 [Camelina sativa]
Length=265

 Score =   245 bits (626),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 127/184 (69%), Positives = 156/184 (85%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+F+W+NKK+S GV+GGAT  W+LFE++EYHLLT +CH +I+ALAVLFLWSNA+ FI K
Sbjct  80   ADIFMWKNKKMSGGVIGGATVAWVLFELMEYHLLTLLCHVMIVALAVLFLWSNATMFIHK  139

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IPEVHIPEEP+LQ AS LR ++N   + L +IASGRD+K FL  I GLW++SI+G 
Sbjct  140  SPPKIPEVHIPEEPLLQLASGLRIEINRGFSSLHEIASGRDIKKFLSAIFGLWVLSILGG  199

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            CC FLTL YIA+VLL TVP++Y+KYED++D + EKAM ELKKQYAVFDAKVLSKIPRGPL
Sbjct  200  CCSFLTLAYIALVLLFTVPLIYDKYEDKIDPYGEKAMAELKKQYAVFDAKVLSKIPRGPL  259

Query  193  KDKK  182
            K+KK
Sbjct  260  KNKK  263



>ref|XP_009406786.1| PREDICTED: reticulon-like protein B1 isoform X2 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009406787.1| PREDICTED: reticulon-like protein B1 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=252

 Score =   244 bits (624),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 128/185 (69%), Positives = 148/185 (80%), Gaps = 0/185 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLW+NKK S  VLGGATAIWI FE++EYHLLT  CH LIL+LA++FLWSNA+  I K
Sbjct  67   ADVFLWKNKKASAAVLGGATAIWIFFELMEYHLLTLFCHCLILSLAIIFLWSNATFLINK  126

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S PHIP V IPE  V+  A +LR ++N   AVLR+IA+GRDLK FL+VI GLW++S VG 
Sbjct  127  SPPHIPVVSIPENLVVDIALSLRYEINRGFAVLREIATGRDLKKFLIVIAGLWVLSTVGR  186

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            CC+FLTLFYI  V LHT+P LY+KYED+VDAFAEKA  E KK YAVF AK LSKIPRGPL
Sbjct  187  CCNFLTLFYIVFVTLHTLPFLYDKYEDKVDAFAEKASVEFKKHYAVFQAKYLSKIPRGPL  246

Query  193  KDKKL  179
            KDKK 
Sbjct  247  KDKKF  251



>ref|XP_007218819.1| hypothetical protein PRUPE_ppa010065mg [Prunus persica]
 gb|EMJ20018.1| hypothetical protein PRUPE_ppa010065mg [Prunus persica]
Length=265

 Score =   245 bits (625),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 127/184 (69%), Positives = 150/184 (82%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADV LWRNKKIS  VLGGAT +W+ FE+LEYHL+T VCH LIL+LAV FLWSNAS+FI K
Sbjct  80   ADVLLWRNKKISASVLGGATVLWVFFELLEYHLITLVCHLLILSLAVFFLWSNASTFINK  139

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IP+V + E  VL  ASALR ++N    +LRDIASGRDLK FL VI  LWI+S+VG 
Sbjct  140  SPPQIPKVQLSERTVLDLASALRIELNRAFHILRDIASGRDLKTFLGVIAILWILSVVGK  199

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
              +FLTLFYI  VLLHT+PV+YEKY+ ++DAF+EKA+ E KKQYAVFDAKVLSKIP+GPL
Sbjct  200  WFNFLTLFYITFVLLHTLPVIYEKYDVQIDAFSEKALIEFKKQYAVFDAKVLSKIPKGPL  259

Query  193  KDKK  182
            K+KK
Sbjct  260  KEKK  263



>ref|XP_010455527.1| PREDICTED: reticulon-like protein B2 [Camelina sativa]
Length=268

 Score =   244 bits (624),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 125/184 (68%), Positives = 156/184 (85%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+F+W+NKK+S GV+GGAT  W+LFE++EYHLLT +CH +I+ALAVLFLWSNA+ FI K
Sbjct  83   ADIFMWKNKKMSGGVIGGATVAWVLFELMEYHLLTLLCHVMIVALAVLFLWSNATMFIHK  142

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IPE+HIPE+P+LQ AS LR ++N   + L +IASGRD+K FL  I GLW++SI+G 
Sbjct  143  SPPKIPEIHIPEDPLLQLASGLRIEINRGFSSLHEIASGRDIKKFLSAIFGLWVLSILGG  202

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            CC FLTL YIA+VLL TVP++Y+KYED++D + EKAM ELKKQYAVFDAKVLSKIPRGPL
Sbjct  203  CCSFLTLAYIALVLLFTVPLIYDKYEDKIDPYGEKAMAELKKQYAVFDAKVLSKIPRGPL  262

Query  193  KDKK  182
            K+KK
Sbjct  263  KNKK  266



>ref|XP_011080892.1| PREDICTED: reticulon-like protein B2 [Sesamum indicum]
Length=257

 Score =   244 bits (623),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 129/184 (70%), Positives = 152/184 (83%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADV LWR+KK+S GVLGGA A+W LF+VLEYH LT +CHGLIL L  +FL SNAS+F+KK
Sbjct  72   ADVLLWRDKKVSAGVLGGAAALWFLFDVLEYHFLTLICHGLILGLVAMFLLSNASTFVKK  131

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            + P IPEV +PEEPVL+FASALR ++N   A LRDIASG+DLK FL VI GLW++S+VG 
Sbjct  132  APPRIPEVVLPEEPVLKFASALRIEINRVFADLRDIASGKDLKKFLYVIGGLWVLSVVGG  191

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
             CDF+TL +   +LL TVP LYEK ED+VD +AEKA+ ELKKQYAVFDAKVLSKIPRGPL
Sbjct  192  ICDFMTLIFSITLLLFTVPFLYEKNEDQVDCYAEKAIAELKKQYAVFDAKVLSKIPRGPL  251

Query  193  KDKK  182
            KDKK
Sbjct  252  KDKK  255



>gb|EAY75742.1| hypothetical protein OsI_03655 [Oryza sativa Indica Group]
Length=253

 Score =   244 bits (622),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 128/184 (70%), Positives = 152/184 (83%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+ LWRNKKIS GVL GATAIW+LFE++EYHLLT VCH LIL+LAVLFLWSNAS+FI K
Sbjct  69   ADLVLWRNKKISGGVLAGATAIWLLFEIMEYHLLTLVCHCLILSLAVLFLWSNASTFIHK  128

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P+IPEV IPE+  +  A +LR ++N   A LR+I  GRDLK FL+VI GLWI+S++GS
Sbjct  129  SPPNIPEVKIPEDLTVNIALSLRYEINRGFATLREIGHGRDLKKFLIVIAGLWILSVLGS  188

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
             C+FLTLFYI  V L+TVPVLYEKYED++DAF EKA  ELKK YA+F+ K LSKIP+GPL
Sbjct  189  SCNFLTLFYIVFVALYTVPVLYEKYEDKIDAFGEKAEIELKKYYALFEEKCLSKIPKGPL  248

Query  193  KDKK  182
            KDKK
Sbjct  249  KDKK  252



>ref|XP_010669728.1| PREDICTED: reticulon-like protein B4 [Beta vulgaris subsp. vulgaris]
Length=285

 Score =   245 bits (625),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 129/184 (70%), Positives = 152/184 (83%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWRNKKIS  VL  ATAIWILFE+LEYHLLT +CH LI +LAVLFLW+NAS+FI K
Sbjct  100  ADVFLWRNKKISGSVLASATAIWILFELLEYHLLTLICHSLIFSLAVLFLWANASTFINK  159

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S PHIPEV +PE+P+L+  + LR+++N  LA+L DIA G+DLK FL VI GLWI+SIVG 
Sbjct  160  SPPHIPEVILPEKPILEAVAGLRHELNRGLAMLHDIAMGKDLKKFLAVIAGLWILSIVGK  219

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
             C F+TLFYI  VLLHT+P+LYEKYED+VDAFAEKAM E KK Y V + K +SKIPRGPL
Sbjct  220  SCGFITLFYINFVLLHTIPILYEKYEDKVDAFAEKAMAEAKKHYGVINEKYISKIPRGPL  279

Query  193  KDKK  182
            K+KK
Sbjct  280  KNKK  283



>ref|XP_010544774.1| PREDICTED: reticulon-like protein B6 [Tarenaya hassleriana]
Length=253

 Score =   244 bits (622),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 132/183 (72%), Positives = 147/183 (80%), Gaps = 0/183 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADV LWR+KK+S  VLG ATAIW+LFE++EYHLL+ VCH LILAL+VLFLWSNA SFI K
Sbjct  69   ADVLLWRDKKLSAAVLGTATAIWVLFELVEYHLLSLVCHILILALSVLFLWSNAHSFINK  128

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IPE+H+ EE  L  ASALRN+VN    VLRDIA GRDLK FLMV+ GLW+IS+VGS
Sbjct  129  SPPQIPEIHLHEEHFLLVASALRNEVNQAFTVLRDIALGRDLKKFLMVVAGLWVISVVGS  188

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
             C FLTL YI  VLLHTVPVLYEK+ED+VD  AEKA  ELKKQY V D KVLSKIP GPL
Sbjct  189  WCHFLTLIYICFVLLHTVPVLYEKHEDKVDPMAEKAFVELKKQYGVLDEKVLSKIPIGPL  248

Query  193  KDK  185
            K K
Sbjct  249  KAK  251



>ref|XP_009368711.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=250

 Score =   243 bits (621),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 129/184 (70%), Positives = 152/184 (83%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADV LWRNKKIS  VLGGAT +W+ FE+LEYHL+T VCH LIL+LAV FLWS AS+FI K
Sbjct  65   ADVLLWRNKKISASVLGGATVLWVFFELLEYHLITLVCHLLILSLAVFFLWSYASTFINK  124

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IP+V IPE+ VL+ ASALR ++N    VLRDIASGRDLK FL VI  LWI+S+VG 
Sbjct  125  SPPQIPKVQIPEKTVLELASALRIEINKGFYVLRDIASGRDLKTFLGVIAVLWILSVVGK  184

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
              +FLTLFYI  VLLHT+PV+YEKY+D++DAF EKA  E+KKQYAVFDAKVLSKIP+GP+
Sbjct  185  WFNFLTLFYIIFVLLHTLPVIYEKYDDQIDAFGEKAWIEIKKQYAVFDAKVLSKIPKGPV  244

Query  193  KDKK  182
            K+KK
Sbjct  245  KEKK  248



>gb|KHN15986.1| Reticulon-like protein B5, partial [Glycine soja]
Length=242

 Score =   243 bits (619),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 132/187 (71%), Positives = 150/187 (80%), Gaps = 0/187 (0%)
 Frame = -1

Query  736  QADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIK  557
             ADV LWRNKKIS  VLG ATA+WI FE+LEYHLLT VCH  IL LAVLFLWSNA +FI 
Sbjct  56   PADVLLWRNKKISASVLGVATAVWIFFELLEYHLLTLVCHISILVLAVLFLWSNAHTFIH  115

Query  556  KSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVG  377
            K+ P IP VH+PEEP+ QFASAL  ++N   A L  I SGRDLK FL++I G WIISIVG
Sbjct  116  KAPPCIPTVHLPEEPIRQFASALTIEINRGFAALHAIGSGRDLKTFLIIIVGTWIISIVG  175

Query  376  SCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGP  197
            S C+FLTLFYI  VLLHTVPV+Y+KYED++D  AEKA+ E KKQYAVFD KVL+KIP+GP
Sbjct  176  SWCNFLTLFYIVFVLLHTVPVIYDKYEDKIDPLAEKALIEFKKQYAVFDEKVLNKIPKGP  235

Query  196  LKDKKLA  176
            LK KKLA
Sbjct  236  LKGKKLA  242



>gb|EAZ13460.1| hypothetical protein OsJ_03377 [Oryza sativa Japonica Group]
Length=253

 Score =   243 bits (619),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 128/184 (70%), Positives = 151/184 (82%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+ LWRNKKIS GVL GATAIW+LFE++EYHLLT VCH LIL+LAVLFLWSNAS+FI K
Sbjct  69   ADLVLWRNKKISGGVLAGATAIWLLFEIMEYHLLTLVCHCLILSLAVLFLWSNASTFIHK  128

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P+IPEV IPE+  +  A +LR ++N   A LR+I  GRDLK FL+VI GLWI+S++GS
Sbjct  129  SPPNIPEVKIPEDLTVNIALSLRYEINRGFATLREIGHGRDLKKFLIVIAGLWILSVLGS  188

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
             C+FLTLFYI  V L+TVPVLYEKYED+VDAF EKA  E KK YA+F+ K LSKIP+GPL
Sbjct  189  SCNFLTLFYIVFVALYTVPVLYEKYEDKVDAFGEKAEIEFKKYYALFEEKCLSKIPKGPL  248

Query  193  KDKK  182
            KDKK
Sbjct  249  KDKK  252



>ref|NP_001241367.1| uncharacterized protein LOC100796111 [Glycine max]
 gb|ACU22605.1| unknown [Glycine max]
Length=256

 Score =   243 bits (619),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 132/187 (71%), Positives = 150/187 (80%), Gaps = 0/187 (0%)
 Frame = -1

Query  736  QADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIK  557
             ADV LWRNKKIS  VLG ATA+WI FE+LEYHLLT VCH  IL LAVLFLWSNA +FI 
Sbjct  70   PADVLLWRNKKISASVLGVATAVWIFFELLEYHLLTLVCHISILVLAVLFLWSNAHTFIH  129

Query  556  KSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVG  377
            K+ P IP VH+PEEP+ QFASAL  ++N   A L  I SGRDLK FL++I G WIISIVG
Sbjct  130  KAPPCIPTVHLPEEPIRQFASALTIEINRGFAALHAIGSGRDLKTFLIIIVGTWIISIVG  189

Query  376  SCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGP  197
            S C+FLTLFYI  VLLHTVPV+Y+KYED++D  AEKA+ E KKQYAVFD KVL+KIP+GP
Sbjct  190  SWCNFLTLFYIVFVLLHTVPVIYDKYEDKIDPLAEKALIEFKKQYAVFDEKVLNKIPKGP  249

Query  196  LKDKKLA  176
            LK KKLA
Sbjct  250  LKGKKLA  256



>ref|XP_010435260.1| PREDICTED: reticulon-like protein B2 [Camelina sativa]
Length=273

 Score =   243 bits (621),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 126/184 (68%), Positives = 155/184 (84%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+F+W+NKK+S GV+GGAT  W+LFE++EYHLL  +CH +I+ALAVLFLWSNA+ FI K
Sbjct  88   ADIFMWKNKKMSGGVIGGATVAWVLFELMEYHLLAVLCHVMIVALAVLFLWSNATMFIHK  147

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IPEVHIPEEP+LQ AS LR ++N   + L +IASGRD+K FL  I GLW++SI+G 
Sbjct  148  SPPKIPEVHIPEEPLLQLASGLRIEINRGFSSLHEIASGRDIKKFLSAIFGLWVLSILGG  207

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            CC FLTL YIA+VLL TVP++Y+KYED++D + EKAM ELKKQYAVFDAKVLSKIPRGPL
Sbjct  208  CCSFLTLAYIALVLLFTVPLVYDKYEDKIDPYGEKAMAELKKQYAVFDAKVLSKIPRGPL  267

Query  193  KDKK  182
            K+KK
Sbjct  268  KNKK  271



>ref|NP_001044177.1| Os01g0736900 [Oryza sativa Japonica Group]
 dbj|BAB89453.1| putative 24 kDa seed maturation protein [Oryza sativa Japonica 
Group]
 dbj|BAF06091.1| Os01g0736900 [Oryza sativa Japonica Group]
 dbj|BAG89426.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00393.1| unnamed protein product [Oryza sativa Japonica Group]
Length=253

 Score =   243 bits (619),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 128/184 (70%), Positives = 151/184 (82%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+ LWRNKKIS GVL GATAIW+LFE++EYHLLT VCH LIL+LAVLFLWSNAS+FI K
Sbjct  69   ADLVLWRNKKISGGVLAGATAIWLLFEIMEYHLLTLVCHCLILSLAVLFLWSNASTFIHK  128

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P+IPEV IPE+  +  A +LR ++N   A LR+I  GRDLK FL+VI GLWI+S++GS
Sbjct  129  SPPNIPEVKIPEDLTVNIALSLRYEINRGFATLREIGHGRDLKKFLIVIAGLWILSVLGS  188

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
             C+FLTLFYI  V L+TVPVLYEKYED+VDAF EKA  E KK YA+F+ K LSKIP+GPL
Sbjct  189  SCNFLTLFYIVFVALYTVPVLYEKYEDKVDAFGEKAEIEFKKYYALFEEKCLSKIPKGPL  248

Query  193  KDKK  182
            KDKK
Sbjct  249  KDKK  252



>ref|XP_003568063.1| PREDICTED: reticulon-like protein B1 [Brachypodium distachyon]
Length=244

 Score =   242 bits (618),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 125/184 (68%), Positives = 149/184 (81%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+FLWRNKKIS GVL GATAIW+LFEV+EYHLLT +CH  IL L +LFLWSNAS+FI K
Sbjct  60   ADLFLWRNKKISGGVLAGATAIWLLFEVMEYHLLTLLCHCFILTLGILFLWSNASAFINK  119

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P+IPEV IPE+  +  A +LR ++N   A LRDI  GRDLK FL+VI GLW +S +GS
Sbjct  120  SPPNIPEVRIPEDLAVNVARSLRYEINRGFASLRDIGQGRDLKKFLIVIAGLWTLSALGS  179

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
             C+FLTLFYI  ++L+TVPVLYEKYED++DA+ EKAM ELKK YA+FD K LSKIP+GP 
Sbjct  180  SCNFLTLFYIVFMVLYTVPVLYEKYEDKIDAYGEKAMIELKKYYAIFDEKCLSKIPKGPS  239

Query  193  KDKK  182
            KDKK
Sbjct  240  KDKK  243



>ref|XP_009380544.1| PREDICTED: reticulon-like protein B2 [Musa acuminata subsp. malaccensis]
Length=252

 Score =   242 bits (618),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 127/184 (69%), Positives = 148/184 (80%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADV LWR+KKIS G L  ATAIW++FE++ YHLLT VCHGLIL+L +LFLWS A +FI K
Sbjct  68   ADVMLWRDKKISAGALSAATAIWVMFELVGYHLLTFVCHGLILSLVILFLWSKACTFINK  127

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IPEV IPE+  +Q A  LR ++N  LAVLR++A GRD+K FL VI GLW++S+VGS
Sbjct  128  SPPRIPEVSIPEDQAVQVARTLRYEMNRALAVLREVALGRDVKKFLTVIAGLWLLSMVGS  187

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
              +FLTL YI  V LHTVPVLYEKYED+VDA AEKAM E+KKQYAV D KVLSKIPRGPL
Sbjct  188  SVNFLTLVYILFVTLHTVPVLYEKYEDKVDAAAEKAMAEIKKQYAVLDDKVLSKIPRGPL  247

Query  193  KDKK  182
            KDKK
Sbjct  248  KDKK  251



>ref|XP_007218268.1| hypothetical protein PRUPE_ppa008259mg [Prunus persica]
 gb|EMJ19467.1| hypothetical protein PRUPE_ppa008259mg [Prunus persica]
Length=339

 Score =   244 bits (623),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 135/184 (73%), Positives = 155/184 (84%), Gaps = 1/184 (1%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWRNKK+S GVLGGATA+W+LFE+LEYHLLT V H LI  LAVLFLWSNA SFI K
Sbjct  156  ADVFLWRNKKVSAGVLGGATAVWVLFELLEYHLLTLVGHILIGTLAVLFLWSNAHSFIHK  215

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            + P IPEVH+PEEP LQ AS LR  +N   AVL DIASGR+LK FL+VI GLW++SIVG+
Sbjct  216  TPPRIPEVHLPEEPFLQVASELRLQINWAFAVLHDIASGRELKKFLIVIAGLWVLSIVGT  275

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
             C+FLTLFYI+ VLLHTVPV+YEKYED++D FAEKA  E KK YAVFDAKVLSKIP+G L
Sbjct  276  WCNFLTLFYISFVLLHTVPVIYEKYEDKIDPFAEKATIEFKKHYAVFDAKVLSKIPQG-L  334

Query  193  KDKK  182
            K+K+
Sbjct  335  KNKR  338



>ref|XP_008354289.1| PREDICTED: reticulon-like protein B1 [Malus domestica]
Length=251

 Score =   241 bits (616),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 127/184 (69%), Positives = 151/184 (82%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADV LWRNKKIS  VL GAT +W+ FE+LEYHL+T VCH LIL+LAV +LWSNAS+FI K
Sbjct  66   ADVLLWRNKKISASVLAGATVLWVFFELLEYHLITLVCHLLILSLAVFYLWSNASNFINK  125

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IP V IPE+ VL+ ASALR ++N    VLR+IASGRDLK FL VI  LWI+S+VG 
Sbjct  126  SQPQIPXVQIPEKTVLELASALRIELNKGFYVLRBIASGRDLKAFLGVIAVLWILSVVGK  185

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
              +FLTLFYI  VLLHT+PV+YEKY+D++DAF EKA  E+KKQYAVFDAKVLSKIP+GP+
Sbjct  186  WFNFLTLFYIIFVLLHTLPVIYEKYDDQIDAFGEKAWIEIKKQYAVFDAKVLSKIPKGPV  245

Query  193  KDKK  182
            K+KK
Sbjct  246  KEKK  249



>ref|XP_006644671.1| PREDICTED: reticulon-like protein B1-like [Oryza brachyantha]
Length=253

 Score =   241 bits (615),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 128/184 (70%), Positives = 151/184 (82%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+ LWRNKKIS GVL GATAIW+LFEV+EYHLLT VCH LIL+LAVLFLWSNAS+FI K
Sbjct  69   ADLVLWRNKKISGGVLAGATAIWLLFEVMEYHLLTLVCHCLILSLAVLFLWSNASTFINK  128

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P+IPEV IPE+  +  A +LR ++N   A LR+I  GR+LK FL+VI GLWI+S++GS
Sbjct  129  SPPNIPEVKIPEDLTVNIALSLRYEINRGFATLREIGHGRELKKFLIVIAGLWILSVLGS  188

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
             C+FLTLFYI  V L+TVPVLYEKYED+VDA  EKA  ELKK YA+F+ K LSKIP+GPL
Sbjct  189  SCNFLTLFYIVFVALYTVPVLYEKYEDKVDALGEKAEIELKKYYALFEEKCLSKIPKGPL  248

Query  193  KDKK  182
            KDKK
Sbjct  249  KDKK  252



>ref|XP_011047748.1| PREDICTED: reticulon-like protein B1 [Populus euphratica]
Length=254

 Score =   241 bits (615),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 126/184 (68%), Positives = 152/184 (83%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWRNKKIS GVLGGATA+W+ FE+LEYHL+T VC+  I +LAVLFLWSNAS+F+ K
Sbjct  69   ADVFLWRNKKISAGVLGGATAVWVFFELLEYHLITLVCYLSIFSLAVLFLWSNASNFLNK  128

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IPEV +PE+ V + AS LR ++N  +AVL DIASGRDLK FL VI GL ++S+VGS
Sbjct  129  SPPKIPEVLLPEKCVREVASGLRIEINRGVAVLHDIASGRDLKKFLAVIAGLLVLSLVGS  188

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            CC+FLTL YI+ VLLHTVPVLYEKYED+VD  +EK+  ++KKQYA+ D K LSKIPRGP 
Sbjct  189  CCNFLTLLYISFVLLHTVPVLYEKYEDQVDGCSEKSWIQIKKQYALLDEKYLSKIPRGPF  248

Query  193  KDKK  182
            K+KK
Sbjct  249  KEKK  252



>gb|EAY98759.1| hypothetical protein OsI_20691 [Oryza sativa Indica Group]
Length=251

 Score =   241 bits (615),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 122/184 (66%), Positives = 154/184 (84%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+FLWRNKKISVGVL GATAIW+LFEV++YHLLT +CH +IL LA+LFLWSNAS+FI K
Sbjct  67   ADLFLWRNKKISVGVLTGATAIWLLFEVMDYHLLTLLCHCIILTLAMLFLWSNASTFINK  126

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P+IPEV IPE+  +  A ++R ++N   A LR+I  G DLK FL+V+ GLW++S++GS
Sbjct  127  SPPNIPEVKIPEDLAVNVARSVRFEINRGFATLREIGLGHDLKKFLIVVAGLWVLSVLGS  186

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            CC+FLTLFYI  ++L+TVPVLYEKYED++DAF EKA+ ELKK YA+FD K LSKIP+GP 
Sbjct  187  CCNFLTLFYIVFMVLYTVPVLYEKYEDQIDAFGEKAVIELKKYYAIFDEKCLSKIPKGPS  246

Query  193  KDKK  182
            K+KK
Sbjct  247  KNKK  250



>ref|XP_011084470.1| PREDICTED: reticulon-like protein B2 [Sesamum indicum]
Length=258

 Score =   241 bits (615),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 136/185 (74%), Positives = 158/185 (85%), Gaps = 0/185 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+FLWR+KKI+ GVLG ATAIW+LFE+LEYHLLT VCH LILALA++FLWSNAS+FI K
Sbjct  73   ADIFLWRDKKITAGVLGVATAIWVLFELLEYHLLTLVCHILILALALIFLWSNASTFINK  132

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IPE+ +PE+ VL  A+A R + N  LA+LRDIASGR+LK FL VI GLW++SI+G+
Sbjct  133  SPPKIPEIIVPEDIVLGIAAAFRIEFNRALAILRDIASGRELKKFLAVIAGLWVLSILGN  192

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
              +FLTLFY   VLLHTVPVLYEKYED+VDAFAEKA  ELKKQYAVF+ KVLSKIPRGPL
Sbjct  193  YFNFLTLFYTCFVLLHTVPVLYEKYEDQVDAFAEKAEAELKKQYAVFNTKVLSKIPRGPL  252

Query  193  KDKKL  179
            KDKKL
Sbjct  253  KDKKL  257



>ref|NP_192861.1| reticulon-like protein B2 [Arabidopsis thaliana]
 sp|Q9SUT9.1|RTNLB_ARATH RecName: Full=Reticulon-like protein B2; Short=AtRTNLB2; AltName: 
Full=VirB2-interacting protein 2 [Arabidopsis thaliana]
 emb|CAB51406.1| putative protein [Arabidopsis thaliana]
 emb|CAB81223.1| putative protein [Arabidopsis thaliana]
 gb|AAK59408.1| unknown protein [Arabidopsis thaliana]
 gb|AAK82535.1| AT4g11220/F8L21_10 [Arabidopsis thaliana]
 gb|AAL14401.1| AT4g11220/F8L21_10 [Arabidopsis thaliana]
 gb|AAM64366.1| unknown [Arabidopsis thaliana]
 gb|AAN86201.1| unknown protein [Arabidopsis thaliana]
 gb|AEE82986.1| reticulon-like protein B2 [Arabidopsis thaliana]
Length=271

 Score =   241 bits (615),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 126/184 (68%), Positives = 154/184 (84%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+F+W++KK+S GV GGAT  W+LFE++EYHLLT +CH +I+ALAVLFLWSNA+ FI K
Sbjct  86   ADIFMWKDKKMSGGVFGGATVAWVLFELMEYHLLTLLCHVMIVALAVLFLWSNATMFIHK  145

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IPEVHIPEEP+LQ AS LR ++N  ++ LR+IASGRD+K FL  I GLW++SI+G 
Sbjct  146  SPPKIPEVHIPEEPLLQLASGLRIEINRGISSLREIASGRDIKKFLSAIAGLWVLSILGG  205

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            C  FLTL YIA+VLL TVP+ Y+KYED+VD++ EKAM ELKKQYAV DAKV SKIPRGPL
Sbjct  206  CYSFLTLAYIALVLLFTVPLFYDKYEDKVDSYGEKAMAELKKQYAVLDAKVFSKIPRGPL  265

Query  193  KDKK  182
            KDKK
Sbjct  266  KDKK  269



>dbj|BAJ89699.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=257

 Score =   241 bits (614),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 124/184 (67%), Positives = 148/184 (80%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+ LWRNKKIS GVL GATAIW+LFEVLEYHLLT +CHG IL L +LFLWSNAS+F+ K
Sbjct  72   ADLLLWRNKKISGGVLAGATAIWLLFEVLEYHLLTLLCHGFILTLGILFLWSNASAFVNK  131

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
              P+IPEV IPE+  +  A +LR ++N   A LR I  GRDLK FL+V+ GLWI+S +GS
Sbjct  132  CPPNIPEVKIPEDLAVNVARSLRYEINRGFASLRAIGQGRDLKKFLIVVAGLWILSALGS  191

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
             C+FLTLFYI  ++L+TVPVLYEKYED++DAF EKAM ELKK YA+FD K LSKIP+GP 
Sbjct  192  SCNFLTLFYIVFMVLYTVPVLYEKYEDKIDAFGEKAMVELKKYYAIFDEKCLSKIPKGPS  251

Query  193  KDKK  182
            KDKK
Sbjct  252  KDKK  255



>ref|XP_009375555.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
 ref|XP_009375556.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=264

 Score =   241 bits (614),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 127/184 (69%), Positives = 151/184 (82%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWRNKKIS  VL GAT +W+ FE+LEYHL+T VCH LI  LAV +LWSNAS+FI K
Sbjct  79   ADVFLWRNKKISASVLAGATVLWVFFELLEYHLITLVCHLLITFLAVFYLWSNASNFINK  138

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IP+V IPE+ VL+ ASALR ++N    VLRDIASGRDLK FL V+  LWI+S+VG 
Sbjct  139  SQPQIPKVQIPEKTVLELASALRIELNKGFYVLRDIASGRDLKAFLGVVAVLWILSVVGK  198

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
              +FLTLFYI  VLLHT+PV+YEKY+D++DAF EKA  E+KKQYAVFDAKVLSKIP+GP+
Sbjct  199  WFNFLTLFYILFVLLHTLPVIYEKYDDQIDAFGEKAWIEIKKQYAVFDAKVLSKIPKGPV  258

Query  193  KDKK  182
            K+KK
Sbjct  259  KEKK  262



>gb|ACF87936.1| unknown [Zea mays]
Length=208

 Score =   239 bits (609),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 128/185 (69%), Positives = 150/185 (81%), Gaps = 1/185 (1%)
 Frame = -1

Query  736  QADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIK  557
             AD+ LWRNKKIS GVL GATAIW+LFEV+EYHLLT VCH LI++LA+LFLWSNASSFI 
Sbjct  24   PADLVLWRNKKISGGVLAGATAIWLLFEVMEYHLLTLVCHCLIVSLAILFLWSNASSFIN  83

Query  556  KSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVG  377
            KS P+IPEV IPE+  +  A  LR ++N   A LR+I  G DLK FL+VI GLW+ S++G
Sbjct  84   KSPPNIPEVKIPEDVSVNVALTLRYEINRGFATLREIGHGHDLKKFLIVIAGLWLFSVLG  143

Query  376  SCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGP  197
            SCC+FLTLFYI  V L+T+PVLYEKYED+VDAF EKAM ELKK YA+FD K LSKIP+G 
Sbjct  144  SCCNFLTLFYIVFVALYTIPVLYEKYEDKVDAFGEKAMIELKKYYAIFDEKCLSKIPKG-  202

Query  196  LKDKK  182
            LKDKK
Sbjct  203  LKDKK  207



>ref|XP_008343772.1| PREDICTED: reticulon-like protein B1 [Malus domestica]
Length=251

 Score =   240 bits (612),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 127/184 (69%), Positives = 152/184 (83%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADV LWRNKKIS  VL GAT +W+ FE+LEYHL+T VCH LIL+LAV +LWSNAS+FI K
Sbjct  66   ADVLLWRNKKISASVLAGATVLWVFFELLEYHLITLVCHLLILSLAVFYLWSNASNFINK  125

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IP+V IPE+ VL+ ASALR ++N    VLR+IASGRDLK FL VI  LWI+S+VG 
Sbjct  126  SQPQIPKVQIPEKTVLELASALRIELNKGFYVLRNIASGRDLKAFLGVIAVLWILSVVGK  185

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
              +FLTLFYI  VLLHT+PV+YEKY+D++DAF EKA  E+KKQYAVFDAKVLSKIP+GP+
Sbjct  186  WFNFLTLFYIIFVLLHTLPVIYEKYDDQIDAFGEKAWIEIKKQYAVFDAKVLSKIPKGPV  245

Query  193  KDKK  182
            K+KK
Sbjct  246  KEKK  249



>gb|EYU25170.1| hypothetical protein MIMGU_mgv1a012274mg [Erythranthe guttata]
Length=255

 Score =   239 bits (611),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 126/185 (68%), Positives = 149/185 (81%), Gaps = 0/185 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+FLWR+KK +  VLG ATAIW+LFE+LEYHLL+ VCH LIL LA+LFLWSNAS+FI K
Sbjct  71   ADIFLWRDKKTTGYVLGVATAIWVLFELLEYHLLSLVCHFLILGLAILFLWSNASTFISK  130

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P  PEV I E  V+  ASAL  + N   A+LR++ASG+DLK FL VI GLW++S++GS
Sbjct  131  SRPKFPEVIISENVVVSVASALTIEFNRAFAILREVASGKDLKKFLAVIAGLWVLSVLGS  190

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            C +FLTLFY   VLLHTVPVLYEKYED+VDAFAEKA HE+KKQYAVFD KVLSK+P+  L
Sbjct  191  CFNFLTLFYTCFVLLHTVPVLYEKYEDQVDAFAEKAEHEIKKQYAVFDVKVLSKLPKAIL  250

Query  193  KDKKL  179
            K KK 
Sbjct  251  KYKKF  255



>ref|NP_001130478.1| Seed maturation protein [Zea mays]
 ref|XP_008654247.1| PREDICTED: seed maturation protein isoform X1 [Zea mays]
 ref|XP_008654248.1| PREDICTED: seed maturation protein isoform X1 [Zea mays]
 gb|ACF78704.1| unknown [Zea mays]
 gb|ACF84299.1| unknown [Zea mays]
 gb|ACG48055.1| seed maturation protein [Zea mays]
 gb|ACR34851.1| unknown [Zea mays]
 gb|AFW85129.1| Seed maturation protein [Zea mays]
Length=253

 Score =   239 bits (611),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 128/184 (70%), Positives = 150/184 (82%), Gaps = 1/184 (1%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+ LWRNKKIS GVL GATAIW+LFEV+EYHLLT VCH LI++LA+LFLWSNASSFI K
Sbjct  70   ADLVLWRNKKISGGVLAGATAIWLLFEVMEYHLLTLVCHCLIVSLAILFLWSNASSFINK  129

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P+IPEV IPE+  +  A  LR ++N   A LR+I  G DLK FL+VI GLW+ S++GS
Sbjct  130  SPPNIPEVKIPEDVSVNVALTLRYEINRGFATLREIGHGHDLKKFLIVIAGLWLFSVLGS  189

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            CC+FLTLFYI  V L+T+PVLYEKYED+VDAF EKAM ELKK YA+FD K LSKIP+G L
Sbjct  190  CCNFLTLFYIVFVALYTIPVLYEKYEDKVDAFGEKAMIELKKYYAIFDEKCLSKIPKG-L  248

Query  193  KDKK  182
            KDKK
Sbjct  249  KDKK  252



>gb|EYU32181.1| hypothetical protein MIMGU_mgv1a012219mg [Erythranthe guttata]
Length=258

 Score =   239 bits (611),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 148/187 (79%), Gaps = 1/187 (1%)
 Frame = -1

Query  736  QADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIK  557
             AD+FLWR+KKIS GVLGG TA+W+LFE+LEYHLLT VCH +I  L++LFLWSN + FI 
Sbjct  73   PADIFLWRDKKISGGVLGGVTAVWVLFELLEYHLLTLVCHIVIFTLSMLFLWSNVTIFIN  132

Query  556  KSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVG  377
            K  P IP V + EEP +  A ALRN++N   AVLR+IASGRDLK FL+V+  LW  SIVG
Sbjct  133  KRPPPIPVVSLSEEPFVGVALALRNEINRTCAVLREIASGRDLKKFLVVVAVLWFFSIVG  192

Query  376  SCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGP  197
            SCC+FLTLFY+  VLLHTVPVLYEKY +++DAF EKA  E+KKQYAVFDAK L KIP+GP
Sbjct  193  SCCNFLTLFYLVFVLLHTVPVLYEKYNEKIDAFTEKATVEIKKQYAVFDAKFLCKIPKGP  252

Query  196  LKDKKLA  176
              DKK A
Sbjct  253  F-DKKRA  258



>gb|KJB24285.1| hypothetical protein B456_004G137000 [Gossypium raimondii]
Length=255

 Score =   239 bits (611),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 136/181 (75%), Positives = 155/181 (86%), Gaps = 0/181 (0%)
 Frame = -1

Query  736  QADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIK  557
            QAD+FLWRNKKIS G LG AT IW+LFE+LEYHLLT VCH LILALA+LFLWSNA++FI 
Sbjct  65   QADIFLWRNKKISAGALGVATVIWVLFELLEYHLLTLVCHLLILALALLFLWSNAATFIH  124

Query  556  KSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVG  377
            KS P IPEV IP++PVL+FA ALR ++N   AVLRDIASGRDLK FL VI GLW++SIVG
Sbjct  125  KSPPRIPEVQIPKDPVLEFAQALRFEINRGFAVLRDIASGRDLKKFLSVIAGLWVLSIVG  184

Query  376  SCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGP  197
            + C+FLTLFYI  VLLHT+PVLYEKYED+VD   EKA HE+KKQYAVFDAKVLSKIP+ P
Sbjct  185  NWCNFLTLFYIVFVLLHTLPVLYEKYEDKVDQLTEKAWHEIKKQYAVFDAKVLSKIPKRP  244

Query  196  L  194
            L
Sbjct  245  L  245



>ref|XP_002320163.1| reticulon family protein [Populus trichocarpa]
 gb|ABK92738.1| unknown [Populus trichocarpa]
 gb|EEE98478.1| reticulon family protein [Populus trichocarpa]
Length=251

 Score =   239 bits (610),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 133/185 (72%), Positives = 155/185 (84%), Gaps = 0/185 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWRNKK+S GVLG ATAIW+LFE++EY+LLT VCH LIL+LA+ FLWSNA SFI K
Sbjct  67   ADVFLWRNKKVSAGVLGFATAIWVLFELVEYNLLTLVCHILILSLALSFLWSNAHSFINK  126

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IP+VH+PEEPVLQ ASAL  ++N    VLR IA+G+DLK FL+VI GLW++SIVGS
Sbjct  127  SPPRIPQVHLPEEPVLQVASALCVEINGAFVVLRSIAAGKDLKKFLIVIAGLWVMSIVGS  186

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
             C FLTLFYI  VLLHTVPVLYEK+ED++D  AEKAM E+K+QYAVFDAKVLSKIP   L
Sbjct  187  WCHFLTLFYICFVLLHTVPVLYEKFEDKIDPLAEKAMIEIKRQYAVFDAKVLSKIPVAAL  246

Query  193  KDKKL  179
            K KK+
Sbjct  247  KAKKV  251



>ref|XP_009406784.1| PREDICTED: reticulon-like protein B1 isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009406785.1| PREDICTED: reticulon-like protein B1 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=253

 Score =   239 bits (610),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 127/186 (68%), Positives = 148/186 (80%), Gaps = 1/186 (1%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIK-  557
            ADVFLW+NKK S  VLGGATAIWI FE++EYHLLT  CH LIL+LA++FLWSNA+  I  
Sbjct  67   ADVFLWKNKKASAAVLGGATAIWIFFELMEYHLLTLFCHCLILSLAIIFLWSNATFLINN  126

Query  556  KSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVG  377
            +S PHIP V IPE  V+  A +LR ++N   AVLR+IA+GRDLK FL+VI GLW++S VG
Sbjct  127  RSPPHIPVVSIPENLVVDIALSLRYEINRGFAVLREIATGRDLKKFLIVIAGLWVLSTVG  186

Query  376  SCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGP  197
             CC+FLTLFYI  V LHT+P LY+KYED+VDAFAEKA  E KK YAVF AK LSKIPRGP
Sbjct  187  RCCNFLTLFYIVFVTLHTLPFLYDKYEDKVDAFAEKASVEFKKHYAVFQAKYLSKIPRGP  246

Query  196  LKDKKL  179
            LKDKK 
Sbjct  247  LKDKKF  252



>gb|ABK94480.1| unknown [Populus trichocarpa]
Length=251

 Score =   239 bits (610),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 133/185 (72%), Positives = 155/185 (84%), Gaps = 0/185 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWRNKK+S GVLG ATAIW+LFE++EY+LLT VCH LIL+LA+ FLWSNA SFI K
Sbjct  67   ADVFLWRNKKVSAGVLGFATAIWVLFELVEYNLLTLVCHILILSLALSFLWSNAHSFINK  126

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IP+VH+PEEPVLQ ASAL  ++N    VLR IA+G+DLK FL+VI GLW++SIVGS
Sbjct  127  SPPRIPQVHLPEEPVLQVASALCVEINGAFVVLRSIAAGKDLKKFLIVIAGLWVMSIVGS  186

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
             C FLTLFYI  VLLHTVPVLYEK+ED++D  AEKAM E+K+QYAVFDAKVLSKIP   L
Sbjct  187  WCHFLTLFYICFVLLHTVPVLYEKFEDKIDPLAEKAMIEIKRQYAVFDAKVLSKIPVAAL  246

Query  193  KDKKL  179
            K KK+
Sbjct  247  KAKKV  251



>ref|XP_006654676.1| PREDICTED: reticulon-like protein B1-like [Oryza brachyantha]
Length=247

 Score =   239 bits (609),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 122/184 (66%), Positives = 152/184 (83%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+FLWRNKKISVGVL GATAIW+LFEV++YHLLT +CH +IL LA+LFLWSNAS+FI K
Sbjct  63   ADLFLWRNKKISVGVLAGATAIWLLFEVMDYHLLTLLCHCVILTLAILFLWSNASTFINK  122

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P+IPEV IPE+  +  A +LR ++N   A LR+I  G DLK FL+V+ GLWI+S++GS
Sbjct  123  SPPNIPEVRIPEDLAVNVARSLRFEINRGFATLREIGQGHDLKKFLIVVAGLWILSVLGS  182

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            CC+FLTLFYI  + L+TVPVLYEKY+D++DAF EKAM ELKK  A+FD K L+KIP+GP 
Sbjct  183  CCNFLTLFYIVFMALYTVPVLYEKYDDKIDAFGEKAMIELKKYCAIFDEKCLAKIPKGPS  242

Query  193  KDKK  182
            K+KK
Sbjct  243  KNKK  246



>gb|KDO86331.1| hypothetical protein CISIN_1g025719mg [Citrus sinensis]
Length=249

 Score =   239 bits (609),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 136/177 (77%), Positives = 153/177 (86%), Gaps = 0/177 (0%)
 Frame = -1

Query  736  QADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIK  557
             ADVFLWRNKKIS GVLGGATAIW+LFE+ EYHLLT VCH LILALA+LFLW+NA +FIK
Sbjct  67   PADVFLWRNKKISAGVLGGATAIWVLFELFEYHLLTLVCHTLILALAILFLWANAHTFIK  126

Query  556  KSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVG  377
            K+ P IPEVH+PEEP LQ ASA R ++NH  AVLR IASGRDLK FLM I  LW++S+VG
Sbjct  127  KAPPCIPEVHLPEEPFLQVASAFRIELNHAFAVLRSIASGRDLKSFLMAIAALWVLSVVG  186

Query  376  SCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIP  206
            S C+FLTLFYIA+VLLH VPVLYEKYED++D  AEKAM E+KKQYAVFDAKVLSKIP
Sbjct  187  SWCNFLTLFYIALVLLHIVPVLYEKYEDKIDPLAEKAMIEIKKQYAVFDAKVLSKIP  243



>gb|KJB24288.1| hypothetical protein B456_004G137000 [Gossypium raimondii]
Length=233

 Score =   238 bits (607),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 155/181 (86%), Gaps = 0/181 (0%)
 Frame = -1

Query  736  QADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIK  557
            +AD+FLWRNKKIS G LG AT IW+LFE+LEYHLLT VCH LILALA+LFLWSNA++FI 
Sbjct  43   KADIFLWRNKKISAGALGVATVIWVLFELLEYHLLTLVCHLLILALALLFLWSNAATFIH  102

Query  556  KSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVG  377
            KS P IPEV IP++PVL+FA ALR ++N   AVLRDIASGRDLK FL VI GLW++SIVG
Sbjct  103  KSPPRIPEVQIPKDPVLEFAQALRFEINRGFAVLRDIASGRDLKKFLSVIAGLWVLSIVG  162

Query  376  SCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGP  197
            + C+FLTLFYI  VLLHT+PVLYEKYED+VD   EKA HE+KKQYAVFDAKVLSKIP+ P
Sbjct  163  NWCNFLTLFYIVFVLLHTLPVLYEKYEDKVDQLTEKAWHEIKKQYAVFDAKVLSKIPKRP  222

Query  196  L  194
            L
Sbjct  223  L  223



>gb|KFK31901.1| hypothetical protein AALP_AA6G173800 [Arabis alpina]
Length=259

 Score =   239 bits (609),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 126/184 (68%), Positives = 152/184 (83%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+F+W+ KK+S GV GGAT  W+LFE++EYHLLT + H +IL LAVLFLWSNA+ FI K
Sbjct  74   ADIFMWKKKKMSGGVFGGATVAWVLFELMEYHLLTLLSHVMILLLAVLFLWSNATMFIHK  133

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IP++HIPEEP+LQ AS LR ++N   + L +IASGRDLK FL VI GLW++SI+G 
Sbjct  134  SPPKIPQLHIPEEPLLQLASGLRIEINRGFSSLHEIASGRDLKKFLSVIAGLWVLSILGG  193

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            CC FLTL YIA+VLL TVP+LY+KYED+VD + EKAM ELKKQYAVFDAKVLSKIP GPL
Sbjct  194  CCSFLTLAYIALVLLFTVPLLYDKYEDKVDPYGEKAMLELKKQYAVFDAKVLSKIPMGPL  253

Query  193  KDKK  182
            K+KK
Sbjct  254  KNKK  257



>ref|XP_010035177.1| PREDICTED: reticulon-like protein B1 [Eucalyptus grandis]
 gb|KCW46473.1| hypothetical protein EUGRSUZ_K00300 [Eucalyptus grandis]
Length=255

 Score =   238 bits (608),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 125/184 (68%), Positives = 154/184 (84%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+FLWR+KK+S GVLG ATAIWILFE++EYHL+T VCH LI  LA++FLW++AS+ I K
Sbjct  70   ADIFLWRDKKVSAGVLGVATAIWILFELMEYHLITLVCHILIATLAIIFLWASASTHITK  129

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P+IPEV +PE+ VL+ AS LR + N  LA+LR+IASGR+LK FL  I GLW++S+VGS
Sbjct  130  SPPNIPEVQLPEKCVLEVASVLRFEANRGLALLREIASGRELKKFLAFIAGLWVLSMVGS  189

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
              + +TLFYI  VLLHTVPV YEKYED+VD FAEKAM E+KKQ+AVF+ KVLSK+PRGPL
Sbjct  190  WFNSVTLFYITFVLLHTVPVFYEKYEDQVDPFAEKAMVEIKKQFAVFNEKVLSKVPRGPL  249

Query  193  KDKK  182
            KDKK
Sbjct  250  KDKK  253



>ref|XP_006444935.1| hypothetical protein CICLE_v10021860mg [Citrus clementina]
 ref|XP_006491199.1| PREDICTED: reticulon-like protein B5-like [Citrus sinensis]
 gb|ESR58175.1| hypothetical protein CICLE_v10021860mg [Citrus clementina]
Length=249

 Score =   237 bits (605),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 135/177 (76%), Positives = 153/177 (86%), Gaps = 0/177 (0%)
 Frame = -1

Query  736  QADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIK  557
             ADVFLWRNKKIS GVLGGATAIW+LFE+ EYHLLT VCH LILALA+LFLW+NA +FIK
Sbjct  67   PADVFLWRNKKISAGVLGGATAIWVLFELFEYHLLTLVCHTLILALAILFLWANAHTFIK  126

Query  556  KSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVG  377
            K+ P IPEVH+PEEP LQ ASA R ++NH  AVLR IASGRDLK FLM I  LW++S+VG
Sbjct  127  KAPPCIPEVHLPEEPFLQVASAFRIELNHAFAVLRSIASGRDLKSFLMAIAALWVLSVVG  186

Query  376  SCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIP  206
            S C+FLTLFYIA+VLLH +PVLYEKYED++D  AEKAM E+KKQYAVFDAKVLSKIP
Sbjct  187  SWCNFLTLFYIALVLLHILPVLYEKYEDKIDPLAEKAMIEIKKQYAVFDAKVLSKIP  243



>ref|XP_004149448.1| PREDICTED: reticulon-like protein B1-like [Cucumis sativus]
 ref|XP_004167648.1| PREDICTED: reticulon-like protein B1-like [Cucumis sativus]
 gb|KGN57883.1| hypothetical protein Csa_3G363160 [Cucumis sativus]
Length=250

 Score =   237 bits (605),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 122/184 (66%), Positives = 151/184 (82%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLW+NKK S GVLGGATA+WILFE+LEY L+T VCH LI+ LA+ FLWS A++FI K
Sbjct  65   ADVFLWKNKKNSAGVLGGATALWILFELLEYQLITLVCHILIILLAIPFLWSYANTFINK  124

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            + P IP+V +PE+ +LQ  ++LR ++N  ++ LRD+ASGRDL+ FL    GLWI+SI GS
Sbjct  125  TPPQIPDVRLPEDCLLQVVTSLRIEINRIISTLRDVASGRDLRKFLSAFLGLWILSIAGS  184

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
             C+FLTL Y+  +LLHTVPVLYEKYED+VD FAEKA+ ELKKQYA FDAKVLSKIP GPL
Sbjct  185  WCNFLTLLYMCFILLHTVPVLYEKYEDQVDPFAEKALIELKKQYAEFDAKVLSKIPLGPL  244

Query  193  KDKK  182
            ++KK
Sbjct  245  QEKK  248



>ref|NP_001042463.1| Os01g0226300 [Oryza sativa Japonica Group]
 dbj|BAF04377.1| Os01g0226300, partial [Oryza sativa Japonica Group]
Length=178

 Score =   234 bits (598),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 121/177 (68%), Positives = 145/177 (82%), Gaps = 0/177 (0%)
 Frame = -1

Query  712  NKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKKSAphipe  533
            N+ IS GVLGGATAIWILFE+L YHLLT VCHGLI +L +LFLWSNASSFI KS P IPE
Sbjct  1    NRNISAGVLGGATAIWILFELLGYHLLTFVCHGLIFSLGLLFLWSNASSFINKSPPRIPE  60

Query  532  vhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGSCCDFLTL  353
            V IPE+ V+  A + R ++N   A LR IA GRD+K FL+VI GLW++S++GSCC+FLTL
Sbjct  61   VIIPEDLVVNIALSTRYEINRAFANLRQIALGRDIKKFLIVIAGLWLLSVLGSCCNFLTL  120

Query  352  FYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  182
             YI  V+LHTVP+LYEKYED++D++ EK   E+KKQYAV DAKVLSK+PRGPLKDKK
Sbjct  121  VYIVFVVLHTVPILYEKYEDQIDSYGEKGWVEIKKQYAVLDAKVLSKVPRGPLKDKK  177



>ref|NP_194094.1| VIRB2-interacting protein 1 [Arabidopsis thaliana]
 sp|Q9SUR3.1|RTNLA_ARATH RecName: Full=Reticulon-like protein B1; Short=AtRTNLB1; AltName: 
Full=VirB2-interacting protein 1 [Arabidopsis thaliana]
 emb|CAA23029.1| putative protein [Arabidopsis thaliana]
 emb|CAB79318.1| putative protein [Arabidopsis thaliana]
 gb|AAK91338.1| AT4g23630/F9D16_100 [Arabidopsis thaliana]
 gb|AAM65433.1| unknown [Arabidopsis thaliana]
 gb|AAM91465.1| AT4g23630/F9D16_100 [Arabidopsis thaliana]
 gb|AEE84787.1| VIRB2-interacting protein 1 [Arabidopsis thaliana]
Length=275

 Score =   238 bits (606),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 126/184 (68%), Positives = 153/184 (83%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+F+W+NKK+S GVLGGATA W++FE++EYHLLT +CH +I+ LAVLFLWSNA+ FI K
Sbjct  90   ADIFMWKNKKMSGGVLGGATAAWVVFELMEYHLLTLLCHVMIVVLAVLFLWSNATMFINK  149

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IPEVHIPEEP+LQ AS LR ++N   + LR+IASGRDLK FL+ I GLW++SI+G 
Sbjct  150  SPPKIPEVHIPEEPILQLASGLRIEINRGFSSLREIASGRDLKKFLIAIAGLWVLSILGG  209

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            C +FLTL YIA+VLL TVP+ Y+KYED+VD   EKAM ELKKQYAV D KVLSKIP GPL
Sbjct  210  CFNFLTLAYIALVLLFTVPLAYDKYEDKVDPLGEKAMIELKKQYAVLDEKVLSKIPLGPL  269

Query  193  KDKK  182
            K+KK
Sbjct  270  KNKK  273



>gb|KJB06453.1| hypothetical protein B456_001G157900 [Gossypium raimondii]
Length=288

 Score =   238 bits (607),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 134/216 (62%), Positives = 157/216 (73%), Gaps = 31/216 (14%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWRNKKIS GVLGGATAIW+LFE++EYHLLT +CH  IL+LAVLFLWSN  +FI K
Sbjct  73   ADVFLWRNKKISAGVLGGATAIWVLFELIEYHLLTLLCHISILSLAVLFLWSNVHTFIHK  132

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            + P IP+VH+PEEP LQ ASAL  ++N  L +LRDIASGR+LK FL+V+   W++S+VGS
Sbjct  133  TPPRIPQVHLPEEPFLQIASALTIELNQALELLRDIASGRNLKKFLVVVAAFWVLSVVGS  192

Query  373  CCDFLTLFYI-------------------------------AVVLLHTVPVLYEKYEDEV  287
             C+FLTLFY                                A VLLHTVPVLYEKYED+V
Sbjct  193  WCNFLTLFYTCNDTGLLFLVPSSFIYTNFILNFDPSSLWKSAFVLLHTVPVLYEKYEDKV  252

Query  286  DAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKKL  179
            D FAEKA+ E+KKQYAVFDA VLSKIP GPLK KK+
Sbjct  253  DPFAEKAVIEIKKQYAVFDANVLSKIPTGPLKSKKV  288



>gb|ABR17571.1| unknown [Picea sitchensis]
 gb|ACN40850.1| unknown [Picea sitchensis]
Length=259

 Score =   236 bits (602),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 140/186 (75%), Gaps = 0/186 (0%)
 Frame = -1

Query  736  QADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIK  557
             ADV LWRNK+ S GVL GAT +W+LFE L Y+LLT +CH LIL + +LF+WSNAS+FI 
Sbjct  74   SADVILWRNKQTSAGVLAGATVMWLLFEWLGYYLLTLICHVLILGITILFVWSNASAFIN  133

Query  556  KSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVG  377
            K    IP++   E+     ASALR ++N    V+ D+ASGRDLK FLMV+ GLWI+S++G
Sbjct  134  KQPVRIPQISFSEQLFQDVASALRFEINRLFTVIHDVASGRDLKKFLMVVAGLWILSVIG  193

Query  376  SCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGP  197
            S  +FLTLFY+A V  HTVPVLYEKYED+VDAF  KAM E KK Y  FDAKVLSKIPRGP
Sbjct  194  SWANFLTLFYVAFVFAHTVPVLYEKYEDQVDAFTFKAMDEAKKHYGTFDAKVLSKIPRGP  253

Query  196  LKDKKL  179
            LKDKK 
Sbjct  254  LKDKKF  259



>ref|XP_010433883.1| PREDICTED: reticulon-like protein B1 [Camelina sativa]
Length=276

 Score =   236 bits (603),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 126/184 (68%), Positives = 153/184 (83%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+F+W+NKK+S GVLGGATA W+LFE++EYHLLT +CH +I+ LAVLFLWSNA+ FI K
Sbjct  91   ADIFMWKNKKMSGGVLGGATAAWVLFELMEYHLLTLICHVMIVVLAVLFLWSNATMFINK  150

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IPEVHIPEEP+LQ AS LR ++N   + LR+IASGR+LK FL+ I GLWI+SI+G 
Sbjct  151  SPPKIPEVHIPEEPILQLASGLRIEINRGFSTLREIASGRELKKFLIAIFGLWILSILGG  210

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            C +FLTL YIA+VLL TVP+ Y+KYED+VD   EKA+ ELKKQYAV D KVLSKIP GPL
Sbjct  211  CFNFLTLAYIALVLLFTVPLAYDKYEDKVDPLGEKAVIELKKQYAVLDEKVLSKIPLGPL  270

Query  193  KDKK  182
            K+KK
Sbjct  271  KNKK  274



>ref|XP_002869770.1| VIRB2-interacting protein 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46029.1| VIRB2-interacting protein 1 [Arabidopsis lyrata subsp. lyrata]
Length=272

 Score =   236 bits (602),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 125/184 (68%), Positives = 153/184 (83%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+F+W+NKK+S GVLGGATA W++FE++EYHLLT +CH +I+ LAVLFLWSNA+ FI K
Sbjct  87   ADIFMWKNKKMSGGVLGGATAAWVVFELMEYHLLTLLCHVMIVVLAVLFLWSNATMFINK  146

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IPEVHIPEEP+LQ AS LR ++N   + LR+IASGRDLK FL+ I GLW++SI+G 
Sbjct  147  SPPKIPEVHIPEEPILQLASGLRIEINRGFSTLREIASGRDLKKFLIAIAGLWVLSILGG  206

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            C +FLTL YIA+VLL TVP+ Y+KYED+VD   EKA+ ELKKQYAV D KVLSKIP GPL
Sbjct  207  CFNFLTLAYIALVLLFTVPLAYDKYEDKVDPLGEKAVIELKKQYAVLDEKVLSKIPLGPL  266

Query  193  KDKK  182
            K+KK
Sbjct  267  KNKK  270



>ref|XP_006422078.1| hypothetical protein CICLE_v10005564mg [Citrus clementina]
 gb|ESR35318.1| hypothetical protein CICLE_v10005564mg [Citrus clementina]
Length=287

 Score =   236 bits (602),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 133/219 (61%), Positives = 158/219 (72%), Gaps = 36/219 (16%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+FLWRNKKIS GVLGGATA+W+LFE+LEYHL+T VCH  IL+LAVLFLWSNAS+FI K
Sbjct  68   ADIFLWRNKKISAGVLGGATAMWVLFELLEYHLITLVCHISILSLAVLFLWSNASTFINK  127

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IP V +PE+ VL+FASALR ++N  LAVLR+IASGRDLK FL VI GLW++SIVG+
Sbjct  128  SPPEIPVVTLPEKFVLEFASALRYEINRALAVLREIASGRDLKKFLGVIAGLWLLSIVGN  187

Query  373  CCDFLTLFYIA--------------------------------VVLLHTVPVLYEKYEDE  290
             C+F+TLFYI                                  VLLHTVPV+YEKYED+
Sbjct  188  WCNFVTLFYIGKKHSLVLMAYFLKWIVFLLKCLDLLYGSFETVFVLLHTVPVIYEKYEDK  247

Query  289  VDAFAEKAMHELKKQYAVFDA----KVLSKIPRGPLKDK  185
            +D+F EKA  E+KKQYAVFD     KVLS+IP+G LK K
Sbjct  248  IDSFGEKATIEIKKQYAVFDEKVLKKVLSRIPKGALKKK  286



>gb|KDO56850.1| hypothetical protein CISIN_1g023137mg [Citrus sinensis]
Length=287

 Score =   236 bits (602),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 133/219 (61%), Positives = 158/219 (72%), Gaps = 36/219 (16%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+FLWRNKKIS GVLGGATA+W+LFE+LEYHL+T VCH  IL+LAVLFLWSNAS+FI K
Sbjct  68   ADIFLWRNKKISAGVLGGATAMWVLFELLEYHLITLVCHISILSLAVLFLWSNASTFINK  127

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IP V +PE+ VL+FASALR ++N  LAVLR+IASGRDLK FL VI GLW++SIVG+
Sbjct  128  SPPEIPVVTLPEKFVLEFASALRYEINRALAVLREIASGRDLKKFLGVIAGLWLLSIVGN  187

Query  373  CCDFLTLFYIA--------------------------------VVLLHTVPVLYEKYEDE  290
             C+F+TLFYI                                  VLLHTVPV+YEKYED+
Sbjct  188  WCNFVTLFYIGKKHSLVLMAYFLKWIVFLLKCLDLLYGSFETVFVLLHTVPVIYEKYEDK  247

Query  289  VDAFAEKAMHELKKQYAVFDA----KVLSKIPRGPLKDK  185
            +D+F EKA  E+KKQYAVFD     KVLS+IP+G LK K
Sbjct  248  IDSFGEKATIEIKKQYAVFDEKVLKKVLSRIPKGALKKK  286



>ref|XP_010439152.1| PREDICTED: reticulon-like protein B1 isoform X1 [Camelina sativa]
Length=276

 Score =   236 bits (601),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 126/184 (68%), Positives = 153/184 (83%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+F+W+NKK+S GVLGGATA W+LFE++EYHLLT +CH +I+ LAVLFLWSNA+ FI K
Sbjct  91   ADIFMWKNKKMSGGVLGGATAAWVLFELMEYHLLTLICHVMIVVLAVLFLWSNATMFINK  150

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IPEVHIPEEP+LQ AS LR ++N   + LR+IASGR+LK FL+ I GLWI+SI+G 
Sbjct  151  SPPKIPEVHIPEEPILQLASGLRIEINRGFSSLREIASGRELKKFLIAIFGLWILSILGG  210

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            C +FLTL YIA+VLL TVP+ Y+KYED+VD   EKA+ ELKKQYAV D KVLSKIP GPL
Sbjct  211  CFNFLTLAYIALVLLFTVPLAYDKYEDKVDPLGEKAVIELKKQYAVLDEKVLSKIPLGPL  270

Query  193  KDKK  182
            K+KK
Sbjct  271  KNKK  274



>ref|XP_010509305.1| PREDICTED: reticulon-like protein B1 [Camelina sativa]
Length=275

 Score =   235 bits (600),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 125/184 (68%), Positives = 153/184 (83%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+F+W+NKK+S GVLGGATA W+LFE++EYHLLT +CH +I+ LAVLFLWSNA+ FI K
Sbjct  90   ADIFMWKNKKMSGGVLGGATAAWVLFELMEYHLLTLICHVMIVVLAVLFLWSNATMFINK  149

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IPE+HIPEEP+LQ AS LR ++N   + LR+IASGR+LK FL+ I GLWI+SI+G 
Sbjct  150  SPPKIPEIHIPEEPILQLASGLRIEINRGFSSLREIASGRELKKFLIAIFGLWILSILGG  209

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            C +FLTL YIA+VLL TVP+ Y+KYED+VD   EKA+ ELKKQYAV D KVLSKIP GPL
Sbjct  210  CFNFLTLAYIALVLLFTVPLAYDKYEDKVDPLGEKAVIELKKQYAVLDEKVLSKIPLGPL  269

Query  193  KDKK  182
            K+KK
Sbjct  270  KNKK  273



>gb|ACN40158.1| unknown [Picea sitchensis]
Length=259

 Score =   234 bits (598),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 116/186 (62%), Positives = 140/186 (75%), Gaps = 0/186 (0%)
 Frame = -1

Query  736  QADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIK  557
             ADV LWRNK+ S GVL GAT +W+LFE L Y+LLT +CH LIL + +LF+WSNAS+FI 
Sbjct  74   SADVILWRNKQTSAGVLAGATVMWLLFEWLGYYLLTLICHVLILGITILFVWSNASAFIN  133

Query  556  KSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVG  377
            K    IP++   E+     ASALR ++N    V+ ++ASGRDLK FLMV+ GLWI+S++G
Sbjct  134  KQPVRIPQISFSEQLFQDVASALRFEINRLFTVIHNVASGRDLKKFLMVVAGLWILSVIG  193

Query  376  SCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGP  197
            S  +FLTLFY+A V  HTVPVLYEKYED+VDAF  KAM E KK Y  FDAKVLSKIPRGP
Sbjct  194  SWANFLTLFYVAFVFAHTVPVLYEKYEDQVDAFTFKAMDEAKKHYGTFDAKVLSKIPRGP  253

Query  196  LKDKKL  179
            LKDKK 
Sbjct  254  LKDKKF  259



>gb|KHN29299.1| Reticulon-like protein B5 [Glycine soja]
Length=250

 Score =   234 bits (596),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 135/183 (74%), Positives = 153/183 (84%), Gaps = 0/183 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADV LWRNKKIS GVLGGATA+W+LFE+LEYHLLT VCH LIL LAVLFLWSNA +FI K
Sbjct  66   ADVLLWRNKKISAGVLGGATAVWVLFELLEYHLLTLVCHILILLLAVLFLWSNAHTFIHK  125

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IPEVH+PEEP  Q ASALR ++N   A+L  I SGRDLK FL++I G+WI+SIVG+
Sbjct  126  SPPRIPEVHLPEEPFQQVASALRIEINRGFAILHSIGSGRDLKKFLVIIAGVWILSIVGN  185

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
             C+FLTLFYI  VLLHTVPVLYEKYED++D  AEKA+ E+KKQY VFDAKVLSKIP GPL
Sbjct  186  WCNFLTLFYITFVLLHTVPVLYEKYEDKIDPLAEKAVIEIKKQYVVFDAKVLSKIPLGPL  245

Query  193  KDK  185
            K K
Sbjct  246  KAK  248



>ref|XP_006284300.1| hypothetical protein CARUB_v10005469mg [Capsella rubella]
 gb|ACC91263.1| reticulon family protein [Capsella rubella]
 gb|EOA17198.1| hypothetical protein CARUB_v10005469mg [Capsella rubella]
Length=274

 Score =   234 bits (598),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 125/184 (68%), Positives = 152/184 (83%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+F+W+NKK+S GVLG ATA W+LFE++EYHLLT +CH +I+ LAVLFLWSNA+ FI K
Sbjct  89   ADIFMWKNKKMSGGVLGAATAAWVLFELMEYHLLTLLCHVMIVVLAVLFLWSNATMFINK  148

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IPEVHIPEEP+LQ AS LR ++N   + LR+IASGRDLK FL+ I GLW++SI+G 
Sbjct  149  SPPKIPEVHIPEEPILQLASGLRIEINRGFSSLREIASGRDLKKFLIAIAGLWVLSILGG  208

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            C +FLTL YIA+VLL TVP+ Y+KYED+VD   EKA+ ELKKQYAV D KVLSKIP GPL
Sbjct  209  CFNFLTLAYIALVLLFTVPLAYDKYEDKVDPLGEKAVIELKKQYAVLDEKVLSKIPLGPL  268

Query  193  KDKK  182
            K+KK
Sbjct  269  KNKK  272



>ref|XP_010112604.1| Reticulon-like protein [Morus notabilis]
 gb|EXC34329.1| Reticulon-like protein [Morus notabilis]
Length=254

 Score =   233 bits (595),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+FLWRNKK+S GVLG AT IWILFE++EYHLLT VCH LILALA+LFLWSNAS+FI K
Sbjct  72   ADIFLWRNKKVSAGVLGVATVIWILFELVEYHLLTLVCHLLILALALLFLWSNASTFINK  131

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P +P+V+IPE+PVLQ A+ALR ++N  LA+LR+IASGRDLK FL VI GLW++S+ G+
Sbjct  132  SPPRLPDVYIPEDPVLQVAAALRIEINRGLAILREIASGRDLKKFLSVIAGLWVLSVAGN  191

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
              +FLTLFY A VLL TVPV+YEKYED+VD FAEKA+ E+KKQY VFDAKVLSK+PRGPL
Sbjct  192  LFNFLTLFYTAFVLLFTVPVIYEKYEDKVDPFAEKAIIEIKKQYKVFDAKVLSKLPRGPL  251

Query  193  K  191
            K
Sbjct  252  K  252



>ref|XP_008375931.1| PREDICTED: reticulon-like protein B1 [Malus domestica]
Length=255

 Score =   233 bits (594),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 127/184 (69%), Positives = 150/184 (82%), Gaps = 1/184 (1%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWRNKK+S GVLGGAT +WILFE+LEY+LLT V H LI  LA+LFLWSNA +FI K
Sbjct  72   ADVFLWRNKKVSGGVLGGATVVWILFELLEYNLLTLVAHILIATLAILFLWSNAHTFIHK  131

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            + P IPEV +PEEP LQ AS LR  +N   A+L +IASG+DLK FL VI GLW++S+VG 
Sbjct  132  TPPRIPEVRLPEEPFLQVASELRVVINCAFALLHNIASGKDLKKFLAVIAGLWVLSVVGK  191

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
             C+FLTLFYI+ VLLHTVPV+YEKYED++D  AEK   E KKQYAVFDAKVL+KIPRG L
Sbjct  192  WCNFLTLFYISFVLLHTVPVIYEKYEDKIDPLAEKVTIEFKKQYAVFDAKVLNKIPRG-L  250

Query  193  KDKK  182
            K+K+
Sbjct  251  KNKR  254



>ref|XP_002870630.1| VIRB2-interacting protein 3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46889.1| VIRB2-interacting protein 3 [Arabidopsis lyrata subsp. lyrata]
Length=257

 Score =   233 bits (594),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 127/188 (68%), Positives = 152/188 (81%), Gaps = 4/188 (2%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+FLWRNKK+S GV G  TA W+LFE+ EYHLL  +CH  I ALA LFLWSNA +FI K
Sbjct  69   ADIFLWRNKKVSGGVFGAVTASWVLFELFEYHLLAFLCHFAIFALAALFLWSNACTFIHK  128

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            ++PHIPEV+IPE+PVLQ  S LR ++N  L VLR+IASG+D+K F++VI GLW++SI+GS
Sbjct  129  ASPHIPEVNIPEDPVLQLVSGLRIEINRGLTVLRNIASGKDVKKFILVIAGLWVLSIIGS  188

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----AKVLSKIP  206
            C +FLTLFYIA VLL T+PVLYEKYED+VDAF EKAM E+KKQYAV D    +KVLSKIP
Sbjct  189  CYNFLTLFYIATVLLFTIPVLYEKYEDKVDAFGEKAMKEIKKQYAVLDEKVLSKVLSKIP  248

Query  205  RGPLKDKK  182
            RG L  KK
Sbjct  249  RGALNKKK  256



>emb|CDY57657.1| BnaC01g15350D [Brassica napus]
Length=275

 Score =   234 bits (596),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 126/184 (68%), Positives = 153/184 (83%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+F+W++KKIS GVLGGATA W+LFE++EYHLLT +CH +I+ LAVLFLWSNA+ FI K
Sbjct  90   ADIFMWKDKKISGGVLGGATAAWVLFELMEYHLLTLLCHVMIVVLAVLFLWSNATMFINK  149

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IPEVHIPEEP+LQ AS LR ++N  L+ LR+IASGRDLK FL  I GLW++SI+G 
Sbjct  150  SPPKIPEVHIPEEPILQLASGLRIEINRGLSSLREIASGRDLKKFLCAIVGLWVLSIMGG  209

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
              +FLTL YIA+VLL TVP++Y+KYED+VD   EKAM E+KKQYAV D KVLSKIP GPL
Sbjct  210  WFNFLTLAYIALVLLFTVPLVYDKYEDKVDPLGEKAMIEIKKQYAVLDEKVLSKIPMGPL  269

Query  193  KDKK  182
            K+KK
Sbjct  270  KNKK  273



>gb|EMS62854.1| Reticulon-like protein B1 [Triticum urartu]
Length=237

 Score =   232 bits (592),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 128/217 (59%), Positives = 151/217 (70%), Gaps = 32/217 (15%)
 Frame = -1

Query  736  QADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIK  557
             ADVF+WRNK IS GVLGGATAIWILFE+L YHLL  + H LI +L VLFLWSNASSFI 
Sbjct  20   PADVFMWRNKHISAGVLGGATAIWILFELLGYHLLAFLGHALIFSLGVLFLWSNASSFIN  79

Query  556  KSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVG  377
            KS P IPEV IPE+ V+  A + R+++N   A LR IA GRD+K FL+VI GLW++SI+G
Sbjct  80   KSPPRIPEVIIPEDLVVNIALSTRHEINRAFANLRQIALGRDIKKFLIVIAGLWLLSILG  139

Query  376  SCCDFLTLFYIA--------------------------------VVLLHTVPVLYEKYED  293
            SCC+FLTLFYI                                  V+LHTVPV+YEKYED
Sbjct  140  SCCNFLTLFYIGEGSQLSIPFLAPLLPNVDLVFTVDLSLLCQTVFVVLHTVPVIYEKYED  199

Query  292  EVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPLKDKK  182
            ++D + EK   E+KKQYAVFDAKVLSK+PRGPLKDKK
Sbjct  200  QIDTYGEKGWIEVKKQYAVFDAKVLSKVPRGPLKDKK  236



>ref|XP_006396933.1| hypothetical protein EUTSA_v10028886mg [Eutrema salsugineum]
 dbj|BAJ34499.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ38386.1| hypothetical protein EUTSA_v10028886mg [Eutrema salsugineum]
Length=265

 Score =   233 bits (593),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 129/184 (70%), Positives = 155/184 (84%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+F+W+NKK+S GV GGAT  W+LFE++EYHLLT +CH +I+ LAVLFLWSNA+ FI K
Sbjct  80   ADIFMWKNKKMSGGVFGGATVAWVLFELIEYHLLTLLCHVMIVLLAVLFLWSNATMFIHK  139

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IPEVHIPEEP+LQ AS LR ++N   + LR IASGRDLK FL  I GLW++S++G 
Sbjct  140  SPPKIPEVHIPEEPLLQLASGLRIEINRGFSSLRQIASGRDLKKFLSAIVGLWVLSVLGG  199

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            CC FLTL YIA+VLL T+P+LY+KYED+VD++ EKAM ELKKQYAVFDAKVLSKIPRGPL
Sbjct  200  CCSFLTLAYIALVLLFTLPLLYDKYEDKVDSYGEKAMAELKKQYAVFDAKVLSKIPRGPL  259

Query  193  KDKK  182
            KDKK
Sbjct  260  KDKK  263



>ref|NP_001240231.1| uncharacterized protein LOC100778096 [Glycine max]
 gb|ACU20901.1| unknown [Glycine max]
Length=259

 Score =   233 bits (593),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 135/184 (73%), Positives = 153/184 (83%), Gaps = 0/184 (0%)
 Frame = -1

Query  736  QADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIK  557
             ADV LWRNKKIS G+LGGATA+W+LFE+LEYHLLT VCH LIL LAVLFLWSNA +FI 
Sbjct  74   PADVLLWRNKKISAGMLGGATAVWVLFELLEYHLLTLVCHILILLLAVLFLWSNAHTFIH  133

Query  556  KSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVG  377
            KS P IPE H+PEEP LQ ASALR +VN   AVL  I SGRDLK FL+VI  +WI+SIVG
Sbjct  134  KSPPRIPEFHLPEEPFLQVASALRIEVNRGFAVLHSIGSGRDLKKFLVVIASVWILSIVG  193

Query  376  SCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGP  197
            + C+FLTLFYI  +LLHTVPVLYEKY+D++D  AEKA+ E+KKQYAVFDAKVLSKIP GP
Sbjct  194  NWCNFLTLFYITFILLHTVPVLYEKYDDKIDPLAEKAVIEIKKQYAVFDAKVLSKIPLGP  253

Query  196  LKDK  185
            LK K
Sbjct  254  LKAK  257



>ref|XP_008344578.1| PREDICTED: reticulon-like protein B1 [Malus domestica]
Length=260

 Score =   233 bits (593),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 127/184 (69%), Positives = 148/184 (80%), Gaps = 1/184 (1%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWRNKK+S GVL GAT IW+LFE+L+YHLLT V H LI ALA+LFLWSNA +FI K
Sbjct  77   ADVFLWRNKKVSAGVLSGATVIWVLFELLQYHLLTLVGHILIGALAILFLWSNAHAFIHK  136

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            + P IPEV +PEEP LQ AS LR  +N   A+L DIASGRDLK FL VI GLW++S+VG 
Sbjct  137  TPPRIPEVRLPEEPFLQVASELRVQINCAFALLHDIASGRDLKKFLAVIAGLWVLSVVGK  196

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
             C+FLTLFYI  V+LHTVPV+YEKYED++D  AE+A  E KKQYA FDAKVLSKIP G L
Sbjct  197  WCNFLTLFYICFVVLHTVPVIYEKYEDKIDPLAERATIEFKKQYAXFDAKVLSKIPHG-L  255

Query  193  KDKK  182
            K+K+
Sbjct  256  KNKR  259



>ref|XP_004298843.1| PREDICTED: reticulon-like protein B2 [Fragaria vesca subsp. vesca]
Length=246

 Score =   232 bits (591),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 119/185 (64%), Positives = 148/185 (80%), Gaps = 0/185 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+FLWR+KK+S G+LGGAT +W+LFE+LEYHLLT V H LI A+ + FLWSN   FI K
Sbjct  62   ADIFLWRDKKLSGGILGGATVMWLLFELLEYHLLTLVAHVLIAAITLFFLWSNGLGFINK  121

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IPE+ IPE+ +LQ  S++  ++N  L V+RDIASG+DLK FL VI GLW++SI+G 
Sbjct  122  SPPKIPEIQIPEKTLLQIVSSITFEINRALVVIRDIASGKDLKQFLSVIAGLWVVSILGK  181

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
             C+FLTL YIA+VLL +VPV YEKY+ ++D  AEKAM E+KKQYAVFDAKVLSKIPRG L
Sbjct  182  SCNFLTLLYIAIVLLFSVPVFYEKYDHKIDPLAEKAMFEIKKQYAVFDAKVLSKIPRGAL  241

Query  193  KDKKL  179
            K KK+
Sbjct  242  KAKKI  246



>gb|KHN40449.1| Reticulon-like protein B5 [Glycine soja]
Length=259

 Score =   232 bits (592),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 135/184 (73%), Positives = 153/184 (83%), Gaps = 0/184 (0%)
 Frame = -1

Query  736  QADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIK  557
             ADV LWRNKKIS G+LGGATA+W+LFE+LEYHLLT VCH LIL LAVLFLWSNA +FI 
Sbjct  74   PADVLLWRNKKISAGMLGGATAVWVLFELLEYHLLTLVCHILILLLAVLFLWSNAHTFIH  133

Query  556  KSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVG  377
            KS P IPE H+PEEP LQ ASALR +VN   AVL  I SGRDLK FL+VI  +WI+SIVG
Sbjct  134  KSPPRIPEFHLPEEPFLQVASALRIEVNRGFAVLHSIGSGRDLKKFLVVIASVWILSIVG  193

Query  376  SCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGP  197
            + C+FLTLFYI  +LLHTVPVLYEKY+D++D  AEKA+ E+KKQYAVFDAKVLSKIP GP
Sbjct  194  NWCNFLTLFYITFILLHTVPVLYEKYDDKIDPLAEKAVIEIKKQYAVFDAKVLSKIPLGP  253

Query  196  LKDK  185
            LK K
Sbjct  254  LKAK  257



>emb|CDY10954.1| BnaA03g46130D [Brassica napus]
Length=270

 Score =   233 bits (593),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 125/184 (68%), Positives = 151/184 (82%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+F+W+NKK+S GVLGGATA W+LFE++EYHLLT +CH +I+ LAVLFLWSNA+ FI K
Sbjct  85   ADIFMWKNKKMSGGVLGGATAAWVLFELMEYHLLTLLCHVMIVVLAVLFLWSNATMFINK  144

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IPEVHIPEEP+LQ AS LR ++N   + LR+IASGRDLK FL  I GLW++SI+G 
Sbjct  145  SPPKIPEVHIPEEPILQLASGLRVEINRGFSSLREIASGRDLKKFLTAIAGLWVMSILGG  204

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
              +FLTL YIA+VLL TVP+ Y+KYED+VD   EKAM E+KKQYAV D KVLSKIP GPL
Sbjct  205  WFNFLTLAYIALVLLFTVPLAYDKYEDKVDPLGEKAMIEIKKQYAVLDEKVLSKIPLGPL  264

Query  193  KDKK  182
            K+KK
Sbjct  265  KNKK  268



>ref|XP_009338786.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=259

 Score =   232 bits (592),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 126/185 (68%), Positives = 149/185 (81%), Gaps = 1/185 (1%)
 Frame = -1

Query  736  QADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIK  557
             ADVFLWRNKK+S GVLGGAT +W+LFE+L+YHLLT V H LI  LA+LFLWSNA +FI 
Sbjct  75   SADVFLWRNKKVSGGVLGGATVVWVLFELLQYHLLTLVAHILIATLAILFLWSNAHTFIH  134

Query  556  KSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVG  377
            K+ P IPEV +PEEP LQ AS LR  +N   A+L  IASG+DLK FL VI GLW++S+VG
Sbjct  135  KTPPRIPEVRLPEEPFLQVASELRVVINCAFALLHSIASGKDLKKFLAVIAGLWVLSVVG  194

Query  376  SCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGP  197
              C+FLTLFYI+ VLLHTVP +YEKYED++D  AEK + E KKQYAVFDAKVLSKIPRG 
Sbjct  195  KWCNFLTLFYISFVLLHTVPFIYEKYEDKIDPLAEKVIIEFKKQYAVFDAKVLSKIPRG-  253

Query  196  LKDKK  182
            LK+K+
Sbjct  254  LKNKR  258



>ref|XP_009341126.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=260

 Score =   232 bits (591),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 131/184 (71%), Positives = 150/184 (82%), Gaps = 1/184 (1%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWRNKK+S GVL G TAIW+LFE+LEYHLLT V + LI ALA+LFLWSNA +FI K
Sbjct  77   ADVFLWRNKKVSAGVLIGTTAIWVLFELLEYHLLTLVGYILICALAILFLWSNAHAFIHK  136

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            + PHIP+VH+PEEP LQ AS LR  +N   A+L DIASGRDLK FL VI GLW++S+VG 
Sbjct  137  TPPHIPKVHLPEEPFLQVASELRVQINCGFALLHDIASGRDLKKFLAVIAGLWVLSVVGK  196

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
             C+FLTLFYI  VLLHTVPV+YEKYED++D  AEKA  E KKQYAVFDAKVLSKIP G L
Sbjct  197  WCNFLTLFYICFVLLHTVPVIYEKYEDKIDPLAEKATIEFKKQYAVFDAKVLSKIPHG-L  255

Query  193  KDKK  182
            K K+
Sbjct  256  KSKR  259



>dbj|BAJ98297.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97542.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=255

 Score =   231 bits (590),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 124/184 (67%), Positives = 150/184 (82%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+ LWRNKKIS GVL GATAIW+LFEV+EYHLLT V H LIL+LA LFLWSN   FI K
Sbjct  71   ADLVLWRNKKISGGVLAGATAIWLLFEVMEYHLLTLVGHCLILSLATLFLWSNVCIFIHK  130

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P+IPEV IPE+  +  A +LR+++N  L  LR+I  GRDLK FL+VI GLW++S++GS
Sbjct  131  SPPNIPEVKIPEDLTVNIALSLRHEINRGLFTLREIGHGRDLKKFLIVIGGLWVLSVLGS  190

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            CC+FLTL YI  V+L+TVPVLYEKY+D+VDAF EKAM ELKK YA+F+ KVLSKIP+G L
Sbjct  191  CCNFLTLSYIVFVVLYTVPVLYEKYDDKVDAFGEKAMIELKKYYAIFEEKVLSKIPKGAL  250

Query  193  KDKK  182
            K+KK
Sbjct  251  KNKK  254



>emb|CDY44123.1| BnaA01g13310D [Brassica napus]
Length=276

 Score =   232 bits (592),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 125/184 (68%), Positives = 153/184 (83%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+F+W++KK+S GVLGGATA W+LFE++EYHLLT +CH +I+ LAVLFLWSNA+ FI K
Sbjct  91   ADIFMWKDKKMSGGVLGGATAAWVLFELMEYHLLTLLCHVMIVVLAVLFLWSNATMFINK  150

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IPEVHIPEEP+LQ AS LR ++N  L+ LR+IASGRDLK FL  I GLW++SI+G 
Sbjct  151  SPPKIPEVHIPEEPILQLASGLRIEINRGLSSLREIASGRDLKKFLCAIFGLWVLSIMGG  210

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
              +FLTL YIA+VLL TVP++Y+KYED+VD   EKAM E+KKQYAV D KVLSKIP GPL
Sbjct  211  WFNFLTLAYIALVLLFTVPLVYDKYEDKVDPLGEKAMIEIKKQYAVLDEKVLSKIPMGPL  270

Query  193  KDKK  182
            K+KK
Sbjct  271  KNKK  274



>ref|XP_010538815.1| PREDICTED: reticulon-like protein B1 [Tarenaya hassleriana]
Length=267

 Score =   231 bits (590),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 127/184 (69%), Positives = 152/184 (83%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+F+WR+KK+S  VLGG TA+W+LFE++EYHLL+ + H LI+ LAVLF+WSNAS FI K
Sbjct  82   ADIFMWRDKKMSASVLGGITAVWVLFELMEYHLLSLLSHVLIVVLAVLFIWSNASMFINK  141

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IPEVHIPEEP+LQ AS LR ++N     LRDIASGRDLK FL  I GLW++SIVG 
Sbjct  142  SPPKIPEVHIPEEPILQLASGLRIEINRAFTCLRDIASGRDLKKFLTAIAGLWVLSIVGG  201

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            CC+FLTL YI +V+L T+PVLYEK+ED+VDA+ EKAM E+KKQYAV D KVLSKIPRGPL
Sbjct  202  CCNFLTLSYIGMVMLFTIPVLYEKHEDKVDAYGEKAMVEMKKQYAVLDEKVLSKIPRGPL  261

Query  193  KDKK  182
            K KK
Sbjct  262  KGKK  265



>ref|XP_009137263.1| PREDICTED: reticulon-like protein B1 [Brassica rapa]
Length=276

 Score =   232 bits (591),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 125/184 (68%), Positives = 153/184 (83%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+F+W++KK+S GVLGGATA W+LFE++EYHLLT +CH +I+ LAVLFLWSNA+ FI K
Sbjct  91   ADIFMWKDKKMSGGVLGGATAAWVLFELMEYHLLTLLCHVMIVVLAVLFLWSNATMFINK  150

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IPEVHIPEEP+LQ AS LR ++N  L+ LR+IASGRDLK FL  I GLW++SI+G 
Sbjct  151  SPPKIPEVHIPEEPILQLASGLRIEINRGLSSLREIASGRDLKKFLCAIFGLWVLSIMGG  210

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
              +FLTL YIA+VLL TVP++Y+KYED+VD   EKAM E+KKQYAV D KVLSKIP GPL
Sbjct  211  WFNFLTLAYIALVLLFTVPLVYDKYEDKVDPLGEKAMIEIKKQYAVLDEKVLSKIPMGPL  270

Query  193  KDKK  182
            K+KK
Sbjct  271  KNKK  274



>ref|XP_009137373.1| PREDICTED: reticulon-like protein B1 [Brassica rapa]
Length=268

 Score =   231 bits (590),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 125/184 (68%), Positives = 150/184 (82%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+F+W+NKK+S GVLGGATA W+LFE++EYHLLT +CH +I+ LAVLFLWSNA+ FI K
Sbjct  83   ADIFMWKNKKMSGGVLGGATAAWVLFELMEYHLLTLLCHVMIVVLAVLFLWSNATMFINK  142

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IPEVHIPEEP+LQ AS LR ++N   + LR+IASGRDLK FL  I GLW +SI+G 
Sbjct  143  SPPKIPEVHIPEEPILQLASGLRVEINRGFSSLREIASGRDLKKFLAAIAGLWFVSILGG  202

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
              +FLTL YIA+VLL TVP+ Y+KYED+VD   EKAM E+KKQYAV D KVLSKIP GPL
Sbjct  203  WFNFLTLAYIALVLLFTVPLAYDKYEDKVDPLGEKAMIEIKKQYAVLDEKVLSKIPLGPL  262

Query  193  KDKK  182
            K+KK
Sbjct  263  KNKK  266



>gb|KDP22201.1| hypothetical protein JCGZ_26032 [Jatropha curcas]
Length=248

 Score =   231 bits (588),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 120/184 (65%), Positives = 147/184 (80%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADV LWRNK++S  VLGGAT +W+LFE+LEYHL+T VCH  IL LA+LFLWSNAS+F+ K
Sbjct  63   ADVLLWRNKQVSASVLGGATVVWVLFELLEYHLITLVCHISILTLAILFLWSNASTFVNK  122

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IP++ +PE+ VL+ ASALR ++N  LAVL DIA+GRD+K FL VI  LW++SI+GS
Sbjct  123  SPPEIPQIVLPEKYVLEIASALRIEINRALAVLHDIAAGRDVKTFLTVIASLWVLSIIGS  182

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
              +FLTL YI  VLLHTVP+ YEKYED++D  AEKA  E+KKQY VFD KVLSKIP G L
Sbjct  183  WFNFLTLLYIVFVLLHTVPLAYEKYEDQIDPIAEKAWIEIKKQYVVFDEKVLSKIPVGLL  242

Query  193  KDKK  182
            K+ K
Sbjct  243  KELK  246



>ref|NP_001239653.1| uncharacterized protein LOC100793862 [Glycine max]
 gb|ACU21118.1| unknown [Glycine max]
Length=257

 Score =   231 bits (588),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 134/183 (73%), Positives = 152/183 (83%), Gaps = 0/183 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADV LWRNKKIS GVLGGATA+W+LFE+LEYHLLT VCH LIL LAVLFLWSNA +FI K
Sbjct  73   ADVLLWRNKKISAGVLGGATAVWVLFELLEYHLLTLVCHILILLLAVLFLWSNAHTFIHK  132

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IPEVH+PEEP  Q ASALR ++N   A+L  I SGRDLK FL++I G+WI+SIVG+
Sbjct  133  SPPRIPEVHLPEEPFQQVASALRIEINRGFAILHSIGSGRDLKKFLVIIAGVWILSIVGN  192

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
             C+FLTLFYI  VL HTVPVLYEKYED++D  AEKA+ E+KKQY VFDAKVLSKIP GPL
Sbjct  193  WCNFLTLFYITFVLSHTVPVLYEKYEDKIDPLAEKAVIEIKKQYVVFDAKVLSKIPLGPL  252

Query  193  KDK  185
            K K
Sbjct  253  KAK  255



>ref|XP_009345612.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
 ref|XP_009345624.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=260

 Score =   231 bits (588),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 130/184 (71%), Positives = 150/184 (82%), Gaps = 1/184 (1%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWRNKK+S GVL G TAIW+LFE+LEYHLLT V + LI ALA+LFLWSNA +FI K
Sbjct  77   ADVFLWRNKKVSAGVLIGTTAIWVLFELLEYHLLTLVGYILICALAILFLWSNAHAFIHK  136

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            + PHIP+VH+PEEP LQ AS LR  +N   A+L DIASGRDLK FL VI GLW++S+VG 
Sbjct  137  TPPHIPKVHLPEEPFLQVASELRVQINCGFALLHDIASGRDLKKFLAVIAGLWVLSVVGK  196

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
             C+FLTLFYI  VLLHTVPV+YE+YED++D  AEKA  E KKQYAVFDAKVLSKIP G L
Sbjct  197  WCNFLTLFYICFVLLHTVPVIYERYEDKIDPLAEKATIEFKKQYAVFDAKVLSKIPHG-L  255

Query  193  KDKK  182
            K K+
Sbjct  256  KSKR  259



>ref|NP_198975.1| reticulon-like protein B4 [Arabidopsis thaliana]
 sp|Q9FFS0.1|RTNLD_ARATH RecName: Full=Reticulon-like protein B4; Short=AtRTNLB4; AltName: 
Full=VirB2-interacting protein 3 [Arabidopsis thaliana]
 dbj|BAB11466.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAK59673.1| unknown protein [Arabidopsis thaliana]
 gb|AAL15269.1| AT5g41600/MBK23_13 [Arabidopsis thaliana]
 gb|AAN12890.1| unknown protein [Arabidopsis thaliana]
 gb|AED94696.1| reticulon-like protein B4 [Arabidopsis thaliana]
Length=257

 Score =   230 bits (587),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 126/188 (67%), Positives = 150/188 (80%), Gaps = 4/188 (2%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+FLWRNKK+S GVLG  TA W+LFE+ EYHLL  +CH  I ALA LFLWSNA +FI K
Sbjct  69   ADIFLWRNKKVSGGVLGAVTASWVLFELFEYHLLAFLCHFAIFALAALFLWSNACTFIHK  128

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S PHIPEVHIPE+P+LQ  S LR ++N  L +LR+IASG+D+K F++VI GLW++SI+GS
Sbjct  129  STPHIPEVHIPEDPILQLVSGLRIEINRGLTLLRNIASGKDVKKFILVIAGLWVLSIIGS  188

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVL----SKIP  206
            C +FLTLFY A VLL T+PVLYEKYED+VDA+ EKAM E+KKQYAV D KVL    SKIP
Sbjct  189  CYNFLTLFYTATVLLFTIPVLYEKYEDKVDAYGEKAMREIKKQYAVLDEKVLRKVISKIP  248

Query  205  RGPLKDKK  182
            RG L  KK
Sbjct  249  RGALNKKK  256



>ref|XP_007139767.1| hypothetical protein PHAVU_008G057300g [Phaseolus vulgaris]
 gb|ESW11761.1| hypothetical protein PHAVU_008G057300g [Phaseolus vulgaris]
Length=256

 Score =   230 bits (587),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 134/183 (73%), Positives = 152/183 (83%), Gaps = 0/183 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADV LWRNKKIS GVLGGATA+W+LFE+LEYH LT VCH LIL LAVLFLWSNA +FI K
Sbjct  72   ADVLLWRNKKISAGVLGGATAVWVLFELLEYHFLTLVCHILILLLAVLFLWSNAHTFIHK  131

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IP+VH+PEEP+LQ AS LR ++N   AVL  I SGRDLK FLMVI G+WI+SIVG+
Sbjct  132  SPPRIPDVHLPEEPILQVASVLRIEINRGFAVLHSIGSGRDLKKFLMVIAGVWILSIVGN  191

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
             C+FLTLFYI  +LLHT PVLYEKYED++D  AEKA+ E+KKQYAVFDAKVLSKIP G L
Sbjct  192  WCNFLTLFYITFILLHTTPVLYEKYEDKIDPLAEKAVIEIKKQYAVFDAKVLSKIPVGLL  251

Query  193  KDK  185
            K K
Sbjct  252  KAK  254



>ref|XP_006413535.1| hypothetical protein EUTSA_v10025959mg [Eutrema salsugineum]
 gb|ESQ54988.1| hypothetical protein EUTSA_v10025959mg [Eutrema salsugineum]
Length=275

 Score =   231 bits (588),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 122/184 (66%), Positives = 151/184 (82%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+F+W+NKK+S GVLG ATA W+LFE++EYHLLT +CH +I+ LAVLFLWSNA+ FI K
Sbjct  90   ADIFMWKNKKMSGGVLGAATAAWVLFELMEYHLLTLLCHVMIVVLAVLFLWSNATMFINK  149

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IPEVHIPEEP+LQ AS LR ++N   + LR+IASGRDLK FL  + GLW++S++G 
Sbjct  150  SPPKIPEVHIPEEPILQLASGLRIEINRGFSSLREIASGRDLKKFLSAVAGLWVLSVLGG  209

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
              +FLTL YIA+VLL TVP++Y+KYED+VD   EKAM E+KKQYAV D KVLSKIP GPL
Sbjct  210  WFNFLTLAYIALVLLFTVPIVYDKYEDKVDPLGEKAMIEIKKQYAVLDEKVLSKIPLGPL  269

Query  193  KDKK  182
            K+KK
Sbjct  270  KNKK  273



>emb|CDY05135.1| BnaC03g29330D [Brassica napus]
Length=313

 Score =   232 bits (591),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 122/184 (66%), Positives = 151/184 (82%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+F+W+NKK+S GVLGGAT  W+LFE++EYHLLT +CH +I+ LA LFLWSNA+ FI+K
Sbjct  128  ADIFMWKNKKVSGGVLGGATVAWVLFELMEYHLLTLLCHVMIVTLAALFLWSNATMFIRK  187

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IPEVHIPE+P+LQ AS LR ++N   + L +IASGRDLK FL  + GLWI+SI+G 
Sbjct  188  SPPKIPEVHIPEDPLLQLASGLRIEINRGFSSLHEIASGRDLKKFLSALFGLWILSILGG  247

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            CC FLTL YIA+VLL TVP++Y+KYED+VD++ EKAM ELK QYAV DAKVLSKIPR   
Sbjct  248  CCSFLTLAYIALVLLFTVPLVYDKYEDKVDSYGEKAMAELKNQYAVLDAKVLSKIPRWTS  307

Query  193  KDKK  182
            K+KK
Sbjct  308  KNKK  311



>emb|CDY25557.1| BnaC09g11820D [Brassica napus]
Length=251

 Score =   229 bits (585),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 128/188 (68%), Positives = 150/188 (80%), Gaps = 4/188 (2%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+FLWRNKK+S GVLG AT  WILFE+L+Y+LLT   H  ILALAVLFLWS+A++FI K
Sbjct  63   ADIFLWRNKKVSGGVLGAATLSWILFELLQYNLLTLFGHISILALAVLFLWSSATTFIHK  122

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            + PHIPEVHIPE+ VLQ AS LRN++N    +LR+IA GRDLK FLMV+ GLW++S VGS
Sbjct  123  TPPHIPEVHIPEDVVLQLASGLRNEINRGFTLLRNIALGRDLKKFLMVVAGLWVLSKVGS  182

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----AKVLSKIP  206
             C+FLTL YIA VLL TVPVLYEKYED+VD F EKAM E+KKQYAV D    +KV+SKIP
Sbjct  183  SCNFLTLIYIATVLLFTVPVLYEKYEDKVDDFGEKAMKEIKKQYAVLDEKVLSKVMSKIP  242

Query  205  RGPLKDKK  182
            RG    KK
Sbjct  243  RGAFNKKK  250



>ref|XP_004306726.1| PREDICTED: reticulon-like protein B5 [Fragaria vesca subsp. vesca]
Length=257

 Score =   230 bits (586),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 125/184 (68%), Positives = 150/184 (82%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWRNKKIS GVLGGAT +++LFE++EYHLLT +CH LI ALAV+FLWSNA +   K
Sbjct  73   ADVFLWRNKKISAGVLGGATVVYVLFELVEYHLLTLICHILIGALAVMFLWSNAHTIFHK  132

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            +APHIPEV +PEEP LQ AS LR  +N   A+L +IASGR+LK FL+VI GLW++SIVGS
Sbjct  133  TAPHIPEVSLPEEPFLQVASELRLQINWAFALLHNIASGRELKKFLIVIAGLWVLSIVGS  192

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
             C+FLTLFYI  VLLHTVPVLYEKYE +VD  AEKA  E+KKQY VFDAKV++K+    L
Sbjct  193  WCNFLTLFYITFVLLHTVPVLYEKYEHKVDPLAEKATIEMKKQYGVFDAKVVTKVRETVL  252

Query  193  KDKK  182
            K+K+
Sbjct  253  KNKR  256



>ref|XP_011003673.1| PREDICTED: reticulon-like protein B1 [Populus euphratica]
Length=251

 Score =   229 bits (583),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 122/184 (66%), Positives = 145/184 (79%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWRN KIS GVLGGAT +W+LFE+L YHL+T VC+  I  LAVLFLWSN S F+ K
Sbjct  66   ADVFLWRNTKISAGVLGGATTVWVLFELLGYHLITLVCYLSIFFLAVLFLWSNTSDFLNK  125

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
              P IPEV +PE+ V + ASALR ++N   AVL DIASGRDLK  L VI GLW++S++GS
Sbjct  126  PPPKIPEVVLPEQCVREVASALRIEINRGFAVLHDIASGRDLKKVLAVIAGLWVLSLIGS  185

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            C + LTL YI+ VLLHTVPVLYEKYED+VDA++EK   E+KKQYAVFD K LSKIP+G L
Sbjct  186  CINILTLLYISFVLLHTVPVLYEKYEDQVDAYSEKTWIEIKKQYAVFDEKYLSKIPKGAL  245

Query  193  KDKK  182
            K +K
Sbjct  246  KGEK  249



>ref|XP_006391670.1| hypothetical protein EUTSA_v10023649mg [Eutrema salsugineum]
 gb|ESQ28956.1| hypothetical protein EUTSA_v10023649mg [Eutrema salsugineum]
Length=256

 Score =   229 bits (583),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 129/188 (69%), Positives = 149/188 (79%), Gaps = 4/188 (2%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+FLWRNKK+S GVLG AT  W+LFE+LEY+LLT   H  ILALA LFLWS+A +FI K
Sbjct  68   ADIFLWRNKKVSGGVLGVATISWVLFELLEYNLLTLFGHITILALACLFLWSSAITFIHK  127

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            + PHIPE+HIPEE VLQ AS LR ++N     LRDIASGRDLK FL+VI GLW++SIVGS
Sbjct  128  TPPHIPEIHIPEEVVLQLASGLRIEINRGFTTLRDIASGRDLKKFLLVIAGLWLLSIVGS  187

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----AKVLSKIP  206
             C+FLTL YIA +LL TVPVLYEKYED+VD F EKAM E+KKQYAVFD    +KV+SKIP
Sbjct  188  SCNFLTLIYIATILLFTVPVLYEKYEDKVDDFGEKAMKEIKKQYAVFDEKVLSKVMSKIP  247

Query  205  RGPLKDKK  182
            RG    KK
Sbjct  248  RGAFNKKK  255



>dbj|BAH57206.1| AT1G64090 [Arabidopsis thaliana]
Length=240

 Score =   228 bits (582),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 127/182 (70%), Positives = 146/182 (80%), Gaps = 4/182 (2%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+FLWRNKK+S GVLG AT  WILFE+LEY+LLT   H  ILALAVLFLWS+AS+FI K
Sbjct  50   ADIFLWRNKKVSGGVLGAATVSWILFELLEYNLLTLFGHISILALAVLFLWSSASTFIHK  109

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S  HIPEVHIPE+ VLQ AS LR ++N    VLRDIASGRDLK FL+VI GLW++S VGS
Sbjct  110  SPLHIPEVHIPEDVVLQLASGLRIEINRGFTVLRDIASGRDLKKFLLVIAGLWVLSKVGS  169

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----AKVLSKIP  206
             C+FLTL YIA VLL T+PVLYEKYED+VD F EKAM E+KKQY  FD    +KV+SKIP
Sbjct  170  SCNFLTLIYIATVLLFTIPVLYEKYEDKVDDFGEKAMREIKKQYVEFDVKVLSKVMSKIP  229

Query  205  RG  200
            +G
Sbjct  230  KG  231



>ref|XP_003569752.1| PREDICTED: reticulon-like protein B1 [Brachypodium distachyon]
Length=257

 Score =   229 bits (583),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 120/184 (65%), Positives = 147/184 (80%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+ LWRNKK S  VL GAT+IW+LFEV+EYHLL  VCH LIL+LA LFLWSNA +FI K
Sbjct  73   ADLVLWRNKKTSGVVLAGATSIWLLFEVMEYHLLNLVCHCLILSLATLFLWSNACTFINK  132

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P+IPEV IPE+  +  A +LR ++N   + LRDI  GRDLK FL+VI  LW++S++G+
Sbjct  133  SPPNIPEVKIPEDLTVNIALSLRYEINRGFSTLRDIGHGRDLKKFLIVIASLWVLSVLGN  192

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            CC+FLTL YI  V+L+TVPVLYEKYED+VDAF EKAM ELKK YA+F+ K LSKIP+G L
Sbjct  193  CCNFLTLSYIVFVVLYTVPVLYEKYEDKVDAFGEKAMIELKKYYAIFEEKCLSKIPKGHL  252

Query  193  KDKK  182
            K+KK
Sbjct  253  KNKK  256



>dbj|BAJ33905.1| unnamed protein product [Thellungiella halophila]
Length=275

 Score =   229 bits (584),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 121/184 (66%), Positives = 151/184 (82%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            A++F+W+NKK+S GVLG ATA W+LFE++EYHLLT +CH +I+ LAVLFLWSNA+ FI K
Sbjct  90   AEIFMWKNKKMSGGVLGAATAAWVLFELMEYHLLTLLCHVMIVVLAVLFLWSNATMFINK  149

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IPEVHIPEEP+LQ AS LR ++N   + LR+IASGRDLK FL  + GLW++S++G 
Sbjct  150  SPPKIPEVHIPEEPILQLASGLRIEINRGFSSLREIASGRDLKKFLSAVAGLWVLSVLGG  209

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
              +FLTL YIA+VLL TVP++Y+KYED+VD   EKAM E+KKQYAV D KVLSKIP GPL
Sbjct  210  WFNFLTLAYIALVLLFTVPIVYDKYEDKVDPLGEKAMIEIKKQYAVLDEKVLSKIPLGPL  269

Query  193  KDKK  182
            K+KK
Sbjct  270  KNKK  273



>emb|CDX90792.1| BnaA03g24720D [Brassica napus]
Length=267

 Score =   229 bits (584),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 130/184 (71%), Positives = 156/184 (85%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+F+W+NKK+S GVLGGAT  W+LFE+LEYHLLT +CH +I+ALAVLFLWSNA+ FI K
Sbjct  82   ADIFMWKNKKMSGGVLGGATVAWVLFELLEYHLLTLLCHVMIVALAVLFLWSNATMFIHK  141

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IPEVHIPE+P+LQ AS LR ++N   + L +IASGRDLK FL  + GLWI+SI+G 
Sbjct  142  SPPKIPEVHIPEDPLLQLASGLRIEINRGFSSLHEIASGRDLKKFLSALFGLWILSILGG  201

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            CC FLTL YIA+VLL TVP++Y+KYED+VD++ EKAM ELKKQYAV DAKVLSKIPRGPL
Sbjct  202  CCSFLTLAYIALVLLFTVPLVYDKYEDKVDSYGEKAMAELKKQYAVLDAKVLSKIPRGPL  261

Query  193  KDKK  182
            KDKK
Sbjct  262  KDKK  265



>ref|XP_010473658.1| PREDICTED: reticulon-like protein B3 isoform X3 [Camelina sativa]
Length=267

 Score =   229 bits (583),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 129/188 (69%), Positives = 149/188 (79%), Gaps = 4/188 (2%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+FLWRNKK+S GVLG AT  WILFE+LEY+LLT   H  IL LAVLFLWS+AS+FI K
Sbjct  79   ADIFLWRNKKVSGGVLGAATVSWILFELLEYNLLTLFGHISILTLAVLFLWSSASTFIHK  138

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            + PHIPEVHIPEE VLQ AS LR ++N    VLRDIASGRDLK FL+VI GLW++S VGS
Sbjct  139  TTPHIPEVHIPEEVVLQLASGLRIEINRGFTVLRDIASGRDLKKFLLVIAGLWVLSKVGS  198

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----AKVLSKIP  206
             C+FLTL YIA VLL T+PVLYEKY+D+VD F EKAM E+KKQY VFD    +KV+SKIP
Sbjct  199  SCNFLTLIYIATVLLFTIPVLYEKYDDKVDDFGEKAMREIKKQYVVFDEKVLSKVMSKIP  258

Query  205  RGPLKDKK  182
            +G    KK
Sbjct  259  KGAFYKKK  266



>ref|XP_010418453.1| PREDICTED: reticulon-like protein B3 [Camelina sativa]
 ref|XP_010473656.1| PREDICTED: reticulon-like protein B3 isoform X1 [Camelina sativa]
 ref|XP_010473657.1| PREDICTED: reticulon-like protein B3 isoform X2 [Camelina sativa]
Length=254

 Score =   228 bits (582),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 129/188 (69%), Positives = 149/188 (79%), Gaps = 4/188 (2%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+FLWRNKK+S GVLG AT  WILFE+LEY+LLT   H  IL LAVLFLWS+AS+FI K
Sbjct  66   ADIFLWRNKKVSGGVLGAATVSWILFELLEYNLLTLFGHISILTLAVLFLWSSASTFIHK  125

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            + PHIPEVHIPEE VLQ AS LR ++N    VLRDIASGRDLK FL+VI GLW++S VGS
Sbjct  126  TTPHIPEVHIPEEVVLQLASGLRIEINRGFTVLRDIASGRDLKKFLLVIAGLWVLSKVGS  185

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----AKVLSKIP  206
             C+FLTL YIA VLL T+PVLYEKY+D+VD F EKAM E+KKQY VFD    +KV+SKIP
Sbjct  186  SCNFLTLIYIATVLLFTIPVLYEKYDDKVDDFGEKAMREIKKQYVVFDEKVLSKVMSKIP  245

Query  205  RGPLKDKK  182
            +G    KK
Sbjct  246  KGAFYKKK  253



>ref|XP_010430525.1| PREDICTED: reticulon-like protein B3 [Camelina sativa]
Length=255

 Score =   228 bits (582),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 129/188 (69%), Positives = 149/188 (79%), Gaps = 4/188 (2%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+FLWRNKK+S GVLG AT  WILFE+LEY+LLT   H  IL LAVLFLWS+AS+FI K
Sbjct  67   ADIFLWRNKKVSGGVLGAATVSWILFELLEYNLLTLFGHISILTLAVLFLWSSASTFIHK  126

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            + PHIPEVHIPEE VLQ AS LR ++N    VLRDIASGRDLK FL+VI GLW++S VGS
Sbjct  127  TTPHIPEVHIPEEVVLQLASGLRIEINRGFTVLRDIASGRDLKKFLLVIAGLWVLSKVGS  186

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----AKVLSKIP  206
             C+FLTL YIA VLL T+PVLYEKY+D+VD F EKAM E+KKQY VFD    +KV+SKIP
Sbjct  187  SCNFLTLIYIATVLLFTIPVLYEKYDDKVDDFGEKAMREIKKQYVVFDEKVLSKVMSKIP  246

Query  205  RGPLKDKK  182
            +G    KK
Sbjct  247  KGAFYKKK  254



>ref|NP_176592.1| reticulon-like protein B3 [Arabidopsis thaliana]
 sp|Q9SH59.1|RTNLC_ARATH RecName: Full=Reticulon-like protein B3; Short=AtRTNLB3 [Arabidopsis 
thaliana]
 gb|AAF24576.1|AC007764_18 F22C12.15 [Arabidopsis thaliana]
 gb|AAL36421.1| unknown protein [Arabidopsis thaliana]
 gb|AAM51418.1| unknown protein [Arabidopsis thaliana]
 dbj|BAE99051.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE34190.1| reticulon-like protein B3 [Arabidopsis thaliana]
Length=255

 Score =   228 bits (582),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 127/182 (70%), Positives = 146/182 (80%), Gaps = 4/182 (2%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+FLWRNKK+S GVLG AT  WILFE+LEY+LLT   H  ILALAVLFLWS+AS+FI K
Sbjct  65   ADIFLWRNKKVSGGVLGAATVSWILFELLEYNLLTLFGHISILALAVLFLWSSASTFIHK  124

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S  HIPEVHIPE+ VLQ AS LR ++N    VLRDIASGRDLK FL+VI GLW++S VGS
Sbjct  125  SPLHIPEVHIPEDVVLQLASGLRIEINRGFTVLRDIASGRDLKKFLLVIAGLWVLSKVGS  184

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----AKVLSKIP  206
             C+FLTL YIA VLL T+PVLYEKYED+VD F EKAM E+KKQY  FD    +KV+SKIP
Sbjct  185  SCNFLTLIYIATVLLFTIPVLYEKYEDKVDDFGEKAMREIKKQYVEFDVKVLSKVMSKIP  244

Query  205  RG  200
            +G
Sbjct  245  KG  246



>gb|KFK37395.1| hypothetical protein AALP_AA4G251600 [Arabis alpina]
Length=249

 Score =   228 bits (581),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 124/183 (68%), Positives = 147/183 (80%), Gaps = 0/183 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWR+KK+S  VLG ATAIW+LFE++EYHLL+ +CH  ILAL  LFLWSNA +FIKK
Sbjct  65   ADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHISILALGGLFLWSNAHTFIKK  124

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IPE+H+PEE  L  AS+LRN+VN    +LR IA GRDLK FLMVI GLWIIS+VG+
Sbjct  125  SPPQIPEIHVPEEAFLVIASSLRNEVNQAFVILRSIALGRDLKKFLMVIVGLWIISVVGN  184

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
              +FLTL YI  V+LHTVP++YEK+ED+VD FAEKAM EL+KQY VFD KV+SKIP   L
Sbjct  185  WFNFLTLVYICFVVLHTVPMMYEKHEDKVDPFAEKAMKELQKQYLVFDEKVISKIPIASL  244

Query  193  KDK  185
            K K
Sbjct  245  KAK  247



>ref|NP_001185307.1| reticulon-like protein B3 [Arabidopsis thaliana]
 gb|AEE34191.1| reticulon-like protein B3 [Arabidopsis thaliana]
Length=271

 Score =   229 bits (583),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 127/182 (70%), Positives = 146/182 (80%), Gaps = 4/182 (2%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+FLWRNKK+S GVLG AT  WILFE+LEY+LLT   H  ILALAVLFLWS+AS+FI K
Sbjct  81   ADIFLWRNKKVSGGVLGAATVSWILFELLEYNLLTLFGHISILALAVLFLWSSASTFIHK  140

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S  HIPEVHIPE+ VLQ AS LR ++N    VLRDIASGRDLK FL+VI GLW++S VGS
Sbjct  141  SPLHIPEVHIPEDVVLQLASGLRIEINRGFTVLRDIASGRDLKKFLLVIAGLWVLSKVGS  200

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----AKVLSKIP  206
             C+FLTL YIA VLL T+PVLYEKYED+VD F EKAM E+KKQY  FD    +KV+SKIP
Sbjct  201  SCNFLTLIYIATVLLFTIPVLYEKYEDKVDDFGEKAMREIKKQYVEFDVKVLSKVMSKIP  260

Query  205  RG  200
            +G
Sbjct  261  KG  262



>ref|XP_010506615.1| PREDICTED: reticulon-like protein B5 [Camelina sativa]
Length=255

 Score =   228 bits (581),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 122/183 (67%), Positives = 146/183 (80%), Gaps = 0/183 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWR+KK+S  VLG ATAIW+LFE++EYHLL+ +CH  ILAL  LFLWSNA +FI K
Sbjct  69   ADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHISILALGGLFLWSNAHTFINK  128

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            + P IPEVH+PE+  L  AS+LRN++N    +LR IA GRDLK FLMV+ GLWIIS+VG+
Sbjct  129  TPPQIPEVHVPEDAFLVIASSLRNELNQAFVILRSIALGRDLKKFLMVVVGLWIISVVGN  188

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
             C+FLTL YI  V+LHTVP+LYEK+ED+VD  AEKAM EL+KQY VFD KVLSKIP   L
Sbjct  189  WCNFLTLVYICFVILHTVPMLYEKHEDKVDPLAEKAMKELQKQYVVFDEKVLSKIPVASL  248

Query  193  KDK  185
            K K
Sbjct  249  KAK  251



>ref|XP_010508058.1| PREDICTED: reticulon-like protein B5 [Camelina sativa]
Length=256

 Score =   228 bits (581),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 122/183 (67%), Positives = 146/183 (80%), Gaps = 0/183 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWR+KK+S  VLG ATAIW+LFE++EYHLL+ +CH  ILAL  LFLWSNA +FI K
Sbjct  70   ADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHISILALGGLFLWSNAHTFINK  129

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            + P IPEVH+PE+  L  AS+LRN++N    +LR IA GRDLK FLMV+ GLWIIS+VG+
Sbjct  130  TPPQIPEVHVPEDAFLVIASSLRNELNQAFVILRSIALGRDLKKFLMVVVGLWIISVVGN  189

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
             C+FLTL YI  V+LHTVP+LYEK+ED+VD  AEKAM EL+KQY VFD KVLSKIP   L
Sbjct  190  WCNFLTLVYICFVILHTVPMLYEKHEDKVDPLAEKAMKELQKQYVVFDEKVLSKIPVASL  249

Query  193  KDK  185
            K K
Sbjct  250  KAK  252



>emb|CDY41666.1| BnaC03g62180D [Brassica napus]
Length=276

 Score =   229 bits (583),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 122/184 (66%), Positives = 151/184 (82%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+F+W++KK+S GVLGGATA W+LFE++EYHLLT +CH +I+ LAVLFLWSN + FI K
Sbjct  91   ADIFMWKDKKMSGGVLGGATAAWVLFELMEYHLLTLLCHVMIVVLAVLFLWSNVTRFIHK  150

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IP+VHIPEEPVLQ AS LR ++N   + LR+IASGRDLK F+  I GLW++SI+G 
Sbjct  151  SPPKIPQVHIPEEPVLQLASGLRIEINRGFSSLREIASGRDLKKFISAIAGLWVLSILGG  210

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
              +FLTL YIA+VLL TVP++Y+KYED+VD   EKAM E+KKQYAV D KVLSKIP GPL
Sbjct  211  WFNFLTLAYIALVLLFTVPLVYDKYEDKVDPLGEKAMIEIKKQYAVLDEKVLSKIPLGPL  270

Query  193  KDKK  182
            K+KK
Sbjct  271  KNKK  274



>emb|CDY24806.1| BnaA08g15040D [Brassica napus]
Length=274

 Score =   228 bits (582),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 124/184 (67%), Positives = 151/184 (82%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+F+W++KK+S GVLGGATA W+LFE++EYHLLT +CH +I+ LAVLFLWSNA+ FI K
Sbjct  89   ADIFMWKDKKMSGGVLGGATAAWVLFELMEYHLLTLLCHVMIVVLAVLFLWSNATMFIHK  148

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IPEVHIPEEPVLQ AS LR ++N     LR+IASGRDLK F+  I GLW++SI+G 
Sbjct  149  SPPKIPEVHIPEEPVLQLASGLRIEINRGFYSLREIASGRDLKKFISAIAGLWVLSILGG  208

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
              +FLTL YIA+VLL TVP++Y+KYED+VD   EKAM E+KKQYAV D KVLSKIP GPL
Sbjct  209  WFNFLTLAYIALVLLFTVPLVYDKYEDKVDPLGEKAMIEIKKQYAVLDEKVLSKIPLGPL  268

Query  193  KDKK  182
            K+KK
Sbjct  269  KNKK  272



>ref|XP_010518282.1| PREDICTED: reticulon-like protein B5 [Camelina sativa]
Length=255

 Score =   228 bits (581),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 122/183 (67%), Positives = 146/183 (80%), Gaps = 0/183 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWR+KK+S  VLG ATAIW+LFE++EYHLL+ +CH  ILAL  LFLWSNA +FI K
Sbjct  69   ADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHISILALGGLFLWSNAHTFINK  128

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            + P IPEVH+PE+  L  AS+LRN++N    +LR IA GRDLK FLMV+ GLWIIS+VG+
Sbjct  129  TPPQIPEVHVPEDAFLVIASSLRNELNQAFVILRSIALGRDLKKFLMVVVGLWIISVVGN  188

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
             C+FLTL YI  V+LHTVP+LYEK+ED+VD  AEKAM EL+KQY VFD KVLSKIP   L
Sbjct  189  WCNFLTLVYICFVILHTVPMLYEKHEDKVDPLAEKAMKELQKQYVVFDEKVLSKIPVASL  248

Query  193  KDK  185
            K K
Sbjct  249  KAK  251



>ref|XP_008377768.1| PREDICTED: reticulon-like protein B2 [Malus domestica]
Length=258

 Score =   228 bits (580),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 124/185 (67%), Positives = 147/185 (79%), Gaps = 0/185 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWR+KK S GVL   T IW+ FE+ EYHLLT V H LIL +A LFLWSNAS+FI K
Sbjct  74   ADVFLWRDKKASAGVLIALTIIWVFFELFEYHLLTLVSHLLILGIASLFLWSNASTFINK  133

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S PHIP+V IPE+ VLQ AS +  ++N    +LR+IASG+DLK FL VI GLW++SI+G 
Sbjct  134  SPPHIPQVQIPEKLVLQIASVITLEINRAFVILREIASGKDLKQFLSVIAGLWVVSILGK  193

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
              +FLTL YIAVVLL T+PV YEKY+D+VDA AEKA+ E+KKQYAVFDAKV+SKIPRG L
Sbjct  194  WYNFLTLVYIAVVLLFTLPVFYEKYDDQVDAVAEKALIEIKKQYAVFDAKVMSKIPRGQL  253

Query  193  KDKKL  179
            KDKK 
Sbjct  254  KDKKF  258



>ref|XP_007040378.1| Reticulan like protein B3, putative isoform 3, partial [Theobroma 
cacao]
 gb|EOY24879.1| Reticulan like protein B3, putative isoform 3, partial [Theobroma 
cacao]
Length=277

 Score =   228 bits (581),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 140/180 (78%), Positives = 159/180 (88%), Gaps = 0/180 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+FLWRNKKIS G LG AT IW+LFE+LEY+LLT VCH LILALA+LFLWSNA++FI K
Sbjct  67   ADIFLWRNKKISAGALGVATVIWVLFELLEYYLLTLVCHLLILALAILFLWSNATTFINK  126

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IPEV IP+EPVL+FA ALR ++N   AVLRDIASGRDLK FL VI GLW++SIVGS
Sbjct  127  SPPRIPEVQIPKEPVLEFAQALRFEINRAFAVLRDIASGRDLKKFLSVIAGLWVLSIVGS  186

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
             C+FLTLFYI  VLLH+VPVLYEKYED+VD+F+EKAMHE+KKQYAVFDAKVLSKIPRGPL
Sbjct  187  WCNFLTLFYIVFVLLHSVPVLYEKYEDKVDSFSEKAMHEIKKQYAVFDAKVLSKIPRGPL  246



>ref|XP_006294850.1| hypothetical protein CARUB_v10023902mg [Capsella rubella]
 gb|EOA27748.1| hypothetical protein CARUB_v10023902mg [Capsella rubella]
Length=255

 Score =   227 bits (578),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 121/183 (66%), Positives = 146/183 (80%), Gaps = 0/183 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWR+KK+S  VLG AT IW+LFE++EYHLL+ +CH  ILAL  LFLWSNA +FI K
Sbjct  69   ADVFLWRDKKLSAAVLGVATVIWVLFELVEYHLLSLLCHISILALGGLFLWSNAHTFINK  128

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            ++P IPE+H+PEE  L  AS+LRN++N    +LR IA GRDLK FLMV+ GLWIIS+VG+
Sbjct  129  TSPQIPEIHVPEEAFLVIASSLRNELNQAFVILRSIALGRDLKKFLMVVVGLWIISVVGN  188

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
             C+FLTL YI  V+LHTVP+LYEK+ED+VD  AEKAM EL+KQY VFD KVLSKIP   L
Sbjct  189  WCNFLTLVYICFVILHTVPMLYEKHEDKVDPLAEKAMKELQKQYVVFDEKVLSKIPVASL  248

Query  193  KDK  185
            K K
Sbjct  249  KAK  251



>ref|XP_002887921.1| reticulon family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64180.1| reticulon family protein [Arabidopsis lyrata subsp. lyrata]
Length=254

 Score =   227 bits (578),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 128/188 (68%), Positives = 149/188 (79%), Gaps = 4/188 (2%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+FLWRNKK+S GVLG AT  WILFE+LEY+LLT   H  ILALAVLFLWS+A++FI K
Sbjct  66   ADIFLWRNKKVSGGVLGAATVSWILFELLEYNLLTLFGHISILALAVLFLWSSATTFIHK  125

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S PHIPEVHIPEE VL+ AS LR ++N    VLRDIASGRDLK FL+VI GLW++S +GS
Sbjct  126  SPPHIPEVHIPEEVVLELASGLRIEINRGFTVLRDIASGRDLKKFLLVIAGLWVLSKLGS  185

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----AKVLSKIP  206
             C+FLTL YIA VLL T+PVLYEKYED+VD F EKAM E+KKQY  FD    +KV+SKIP
Sbjct  186  SCNFLTLIYIATVLLFTIPVLYEKYEDKVDDFGEKAMREIKKQYVEFDVKVLSKVMSKIP  245

Query  205  RGPLKDKK  182
            +G    KK
Sbjct  246  KGAFYKKK  253



>emb|CDM81762.1| unnamed protein product [Triticum aestivum]
Length=253

 Score =   227 bits (578),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 120/184 (65%), Positives = 149/184 (81%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+ LWRNKKIS GVL GATAIW+LFE++EYHLLT V H LIL+LA LFL+SN   F+ K
Sbjct  69   ADLVLWRNKKISGGVLAGATAIWLLFEIMEYHLLTLVGHCLILSLATLFLYSNVCIFVHK  128

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P+IPEV IPE+  +  A +LR+++N     LR+I  GRDLK FL+VI GLW++S++GS
Sbjct  129  SPPNIPEVKIPEDMTVNIALSLRHEINRGFFTLREIGHGRDLKKFLIVIGGLWVLSVLGS  188

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            CC+FLTL YI  V+L+TVPVLYEKY+D+VDAF EKAM ELKK YA+F+ KVLSKIP+G L
Sbjct  189  CCNFLTLSYIVFVVLYTVPVLYEKYDDKVDAFGEKAMIELKKYYAIFEEKVLSKIPKGAL  248

Query  193  KDKK  182
            K+KK
Sbjct  249  KNKK  252



>ref|XP_004965478.1| PREDICTED: reticulon-like protein B2-like [Setaria italica]
Length=257

 Score =   226 bits (577),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 120/184 (65%), Positives = 144/184 (78%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADV LW++KK S  V+GGAT IW+LFEVL YHLLT + H LI  LA+LFL S A++FIKK
Sbjct  72   ADVLLWKDKKTSAVVIGGATVIWVLFEVLGYHLLTLISHVLIGVLAILFLLSKATTFIKK  131

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P+IP V IPE+ V+  + ALRND+N  L + R+IA G DLK FL VI GLWI+S VGS
Sbjct  132  SPPNIPLVEIPEDLVVNVSQALRNDINRALHLFREIAMGHDLKKFLGVIVGLWILSSVGS  191

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            CCDFLTL YIAV++LHTVP+LY+KY+D+VD FA +A  E +KQY V DAKVLSKIPRGP 
Sbjct  192  CCDFLTLIYIAVLMLHTVPILYDKYQDKVDHFAGRAHTEARKQYEVLDAKVLSKIPRGPA  251

Query  193  KDKK  182
            K KK
Sbjct  252  KPKK  255



>ref|XP_008367699.1| PREDICTED: reticulon-like protein B2 [Malus domestica]
Length=258

 Score =   226 bits (577),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 121/185 (65%), Positives = 148/185 (80%), Gaps = 0/185 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+FLWR KK+S GVL   T IW+ FE+LEYHLLT V H LI+ + +LFLWSNAS+FI K
Sbjct  74   ADIFLWRGKKVSAGVLIALTIIWVFFELLEYHLLTLVSHLLIIGIVMLFLWSNASTFINK  133

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S PHIP+V IPE+PVLQ ASA+ +++N    ++R+IASG+DLK FL  I GLW++SI+G 
Sbjct  134  SPPHIPQVQIPEKPVLQIASAITSEINRAFVIVREIASGKDLKQFLSAIAGLWVVSILGK  193

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
              +FLTL YIAVVLL T+PV YEKY+D+VDA AEKA+ E+KKQYAVFDAKVLSKIPRG  
Sbjct  194  YYNFLTLVYIAVVLLFTLPVFYEKYDDQVDAVAEKALTEMKKQYAVFDAKVLSKIPRGQT  253

Query  193  KDKKL  179
            K KK 
Sbjct  254  KAKKF  258



>ref|XP_006397801.1| hypothetical protein EUTSA_v10001599mg [Eutrema salsugineum]
 gb|ESQ39254.1| hypothetical protein EUTSA_v10001599mg [Eutrema salsugineum]
Length=253

 Score =   226 bits (577),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 121/183 (66%), Positives = 146/183 (80%), Gaps = 0/183 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWR+KK+S  VLG ATAIW+LFE++EYHLL+ +CH  ILAL  LFLWSNA +FI K
Sbjct  69   ADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHISILALGGLFLWSNAHTFINK  128

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            + P IPEVH+PEE  L  AS+LRN++N    +LR IA GRDLK FLMV+ GLWIIS+VG+
Sbjct  129  TPPQIPEVHVPEEAFLTIASSLRNELNQAFVILRSIALGRDLKKFLMVVVGLWIISVVGN  188

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
             C+FLTL YI  V+LHTVP++YEK+ED+VD  AEKAM EL+KQY VFD KV+SKIP   L
Sbjct  189  WCNFLTLVYICFVVLHTVPMMYEKHEDKVDPLAEKAMKELQKQYLVFDEKVISKIPIASL  248

Query  193  KDK  185
            K K
Sbjct  249  KAK  251



>ref|XP_007040377.1| Reticulan like protein B3, putative isoform 2 [Theobroma cacao]
 gb|EOY24878.1| Reticulan like protein B3, putative isoform 2 [Theobroma cacao]
Length=291

 Score =   228 bits (580),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 140/181 (77%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+FLWRNKKIS G LG AT IW+LFE+LEY+LLT VCH LILALA+LFLWSNA++FI K
Sbjct  67   ADIFLWRNKKISAGALGVATVIWVLFELLEYYLLTLVCHLLILALAILFLWSNATTFINK  126

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IPEV IP+EPVL+FA ALR ++N   AVLRDIASGRDLK FL VI GLW++SIVGS
Sbjct  127  SPPRIPEVQIPKEPVLEFAQALRFEINRAFAVLRDIASGRDLKKFLSVIAGLWVLSIVGS  186

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
             C+FLTLFYI  VLLH+VPVLYEKYED+VD+F+EKAMHE+KKQYAVFDAKVLSKIPRGPL
Sbjct  187  WCNFLTLFYIVFVLLHSVPVLYEKYEDKVDSFSEKAMHEIKKQYAVFDAKVLSKIPRGPL  246

Query  193  K  191
             
Sbjct  247  N  247



>ref|XP_007209494.1| hypothetical protein PRUPE_ppa010244mg [Prunus persica]
 gb|EMJ10693.1| hypothetical protein PRUPE_ppa010244mg [Prunus persica]
Length=257

 Score =   226 bits (576),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 123/184 (67%), Positives = 148/184 (80%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWR+KK S  VL   T IW+ FE+L YHLLT + H LIL LA+LFLWSNAS+FI K
Sbjct  73   ADVFLWRDKKGSASVLIAITIIWVFFELLGYHLLTLMAHCLILVLAMLFLWSNASTFINK  132

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IP+V IPE+PVLQ ASA+  ++N    +LR+IASG+DLK FL VI GLW++SI+G 
Sbjct  133  SPPRIPQVKIPEKPVLQIASAITIEINRAFVILREIASGKDLKQFLSVIAGLWVLSILGK  192

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
              +FLTL YI VVLL T+PV YEKY+D+VDAFAEKAM E+KKQYAVFDAKVLSK+P+G +
Sbjct  193  WYNFLTLVYIVVVLLFTLPVFYEKYDDQVDAFAEKAMIEIKKQYAVFDAKVLSKVPKGQM  252

Query  193  KDKK  182
            KDKK
Sbjct  253  KDKK  256



>ref|XP_009334492.1| PREDICTED: reticulon-like protein B2 [Pyrus x bretschneideri]
Length=258

 Score =   226 bits (576),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 124/185 (67%), Positives = 147/185 (79%), Gaps = 0/185 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWR+KK S GVL   T IW+ FE+ EYHLLT V H LIL +A LFLWSNAS+FI K
Sbjct  74   ADVFLWRDKKASAGVLIALTIIWVFFELFEYHLLTLVSHLLILGIASLFLWSNASTFINK  133

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S PHIP+V IPE+PVLQ AS +  ++N    +LR+IASG+DLK FL VI GLW++SI+G 
Sbjct  134  SPPHIPQVQIPEKPVLQIASVITMEINRAFVILREIASGKDLKQFLSVIAGLWVVSILGK  193

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
              +FLTL YI VVLL T+PV YEKY+D+VDA AEKA+ E+KKQYAVFDAKV+SKIPRG L
Sbjct  194  WYNFLTLVYIVVVLLFTLPVFYEKYDDQVDAVAEKALIEIKKQYAVFDAKVMSKIPRGQL  253

Query  193  KDKKL  179
            KDKK 
Sbjct  254  KDKKF  258



>emb|CDY34396.1| BnaA09g11380D [Brassica napus]
Length=251

 Score =   226 bits (575),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 127/188 (68%), Positives = 148/188 (79%), Gaps = 4/188 (2%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+FLWRNKK+S GVLG AT  WILFE+L+Y+LLT   H  ILALAVLFLWS+A++FI K
Sbjct  63   ADIFLWRNKKVSGGVLGAATLSWILFELLQYNLLTLFGHVSILALAVLFLWSSATTFIHK  122

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            + PHIPEVHIPEE VLQ AS LR ++N    +LR+IA GRDLK FLMV+ GLW++S VGS
Sbjct  123  TPPHIPEVHIPEEVVLQLASGLRIEINRGFTILRNIALGRDLKKFLMVVAGLWVLSKVGS  182

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----AKVLSKIP  206
             C+FLTL YIA VLL TVPV YEKYED+VD F EKAM E+KKQYAV D    +KV+SKIP
Sbjct  183  SCNFLTLIYIATVLLFTVPVFYEKYEDKVDHFGEKAMKEIKKQYAVLDEKVLSKVMSKIP  242

Query  205  RGPLKDKK  182
            RG    KK
Sbjct  243  RGAFNKKK  250



>gb|AFK42059.1| unknown [Lotus japonicus]
Length=258

 Score =   226 bits (575),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 147/188 (78%), Gaps = 4/188 (2%)
 Frame = -1

Query  736  QADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIK  557
             ADV LW+NKK+S G LG ATA+W+ FE+LEYHLLT VCH LIL++ +LFLWSNA + + 
Sbjct  69   PADVLLWKNKKVSAGALGVATAVWLFFELLEYHLLTLVCHILILSITLLFLWSNAHTLLH  128

Query  556  KSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVG  377
            K+ P IP  H+PEEP L+ ASALR ++NH  A LRDI +G+D+K FL+ I GLWI+SIVG
Sbjct  129  KAPPRIPVFHLPEEPFLEIASALRIEINHGFAALRDIGTGKDVKKFLIAIVGLWILSIVG  188

Query  376  SCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDA----KVLSKI  209
            S C+FLTLFYI  VLL T+P LY+KYED++D  AEKA HE+KKQY VFDA    KVLSKI
Sbjct  189  SWCNFLTLFYINFVLLLTIPFLYDKYEDKIDPLAEKAAHEIKKQYVVFDAKVLSKVLSKI  248

Query  208  PRGPLKDK  185
            P+G LK K
Sbjct  249  PKGLLKGK  256



>ref|XP_009142682.1| PREDICTED: reticulon-like protein B5 [Brassica rapa]
 emb|CDX79993.1| BnaA05g01630D [Brassica napus]
Length=251

 Score =   225 bits (574),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 123/183 (67%), Positives = 146/183 (80%), Gaps = 0/183 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWR+KK+S  VLG ATAIW+LFE++EYHLL+ +CH  ILAL  LFLWSNA +FIKK
Sbjct  67   ADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHVSILALGGLFLWSNAHTFIKK  126

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IPE+H+PEEP L  AS+LRN++N    +LR IA GRDLK FLMV+ GLWIIS+VG+
Sbjct  127  SPPQIPEIHVPEEPFLLIASSLRNELNQGFVILRSIALGRDLKKFLMVVVGLWIISVVGN  186

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
             C+FLTL YI  VLLHTVP++YEK+ED+VD FAEKA  EL K Y VFD KV+SKIP   L
Sbjct  187  WCNFLTLVYICFVLLHTVPMMYEKHEDKVDPFAEKAFKELHKHYLVFDEKVVSKIPIASL  246

Query  193  KDK  185
            K K
Sbjct  247  KAK  249



>ref|XP_010447719.1| PREDICTED: reticulon-like protein B4 [Camelina sativa]
Length=257

 Score =   226 bits (575),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 129/188 (69%), Positives = 152/188 (81%), Gaps = 4/188 (2%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+FLWRNKK+S GV G  TA W+LFE++EYH LT +CH  + ALA LFLWSNA +FI K
Sbjct  69   ADIFLWRNKKVSGGVFGAITASWVLFELIEYHFLTFLCHFAMAALAALFLWSNACTFIHK  128

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S PHIPEVHIPE+PVLQ  S LR ++N    VLR+IASGRDLK F++VI GLW++SI+GS
Sbjct  129  STPHIPEVHIPEDPVLQLVSGLRIEINRGFTVLRNIASGRDLKKFILVIAGLWVLSIIGS  188

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----AKVLSKIP  206
            CC+FLTLFYIA VLL T+PV+YEKYED+VDAF EKAM E+KKQYAV D    +KVLSKIP
Sbjct  189  CCNFLTLFYIATVLLFTIPVVYEKYEDKVDAFGEKAMKEIKKQYAVLDEKVFSKVLSKIP  248

Query  205  RGPLKDKK  182
            RG L  KK
Sbjct  249  RGALNKKK  256



>ref|XP_002301382.1| hypothetical protein POPTR_0002s16690g [Populus trichocarpa]
 gb|EEE80655.1| hypothetical protein POPTR_0002s16690g [Populus trichocarpa]
Length=251

 Score =   225 bits (574),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 130/185 (70%), Positives = 151/185 (82%), Gaps = 0/185 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWRNKK+S GVLG  TA+W+LFE++EYHLLT VCH LILA A+LFLWSNA + I K
Sbjct  67   ADVFLWRNKKVSAGVLGFVTAMWVLFELIEYHLLTLVCHILILAAALLFLWSNACTLINK  126

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IPEVH+PE+ VLQ ASAL  ++N   A LR +A+G+D K FLM+I GLW++SIVGS
Sbjct  127  SPPRIPEVHLPEKLVLQVASALCVEINSAFAGLRSVAAGKDFKKFLMIIAGLWVLSIVGS  186

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
             C FLTLFYI  VLLHTVPVLYEKYED+VD  AEKAM E+KKQYAVFDAKVLSKIP   L
Sbjct  187  SCHFLTLFYICFVLLHTVPVLYEKYEDKVDPLAEKAMVEIKKQYAVFDAKVLSKIPVASL  246

Query  193  KDKKL  179
            K K++
Sbjct  247  KAKRV  251



>emb|CDY38194.1| BnaA09g11950D [Brassica napus]
Length=250

 Score =   225 bits (573),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 126/187 (67%), Positives = 147/187 (79%), Gaps = 4/187 (2%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+FLWRNKK+S GVLG AT  WILFE+L+Y+LLT   H  ILALAVLFLWS+A++FI K
Sbjct  63   ADIFLWRNKKVSGGVLGAATLSWILFELLQYNLLTLFGHVSILALAVLFLWSSATTFIHK  122

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
              PHIPEVHIPEE VLQ AS LR ++N    +LR+IA GRDLK FLMV+ GLW++S VGS
Sbjct  123  KPPHIPEVHIPEEVVLQLASGLRIEINRGFTILRNIALGRDLKKFLMVVAGLWVLSKVGS  182

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----AKVLSKIP  206
             C+FLTL YIA VLL T+PVLYEKYED+VD F EKAM E+KKQYAV D    +KV+SKIP
Sbjct  183  SCNFLTLIYIATVLLFTIPVLYEKYEDKVDHFGEKAMKEIKKQYAVLDEKVLSKVMSKIP  242

Query  205  RGPLKDK  185
            RG    K
Sbjct  243  RGAFNKK  249



>emb|CDY52012.1| BnaC06g42920D [Brassica napus]
Length=254

 Score =   225 bits (573),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 121/183 (66%), Positives = 144/183 (79%), Gaps = 0/183 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWR+KK+S  VLG ATAIW+LFE++EYHLL+ VCH LI +LA +FLWSNA +F+KK
Sbjct  70   ADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLVCHILIFSLAAMFLWSNAHAFMKK  129

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IPEVH+ EE  L  ASALRN++N    +LR IA GRDLK FLMV+ GLWIIS+VG+
Sbjct  130  SPPKIPEVHVKEEHFLLIASALRNELNQAFVILRSIALGRDLKKFLMVVVGLWIISVVGN  189

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
              +FLTL YI  V+LHTVP+LYEK+ED+VD  AEK + ELKK Y VFD KVLSKIP   L
Sbjct  190  WFNFLTLVYICFVVLHTVPMLYEKHEDKVDPVAEKTLKELKKHYMVFDEKVLSKIPLASL  249

Query  193  KDK  185
            K K
Sbjct  250  KAK  252



>ref|XP_009349323.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=259

 Score =   225 bits (573),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 124/185 (67%), Positives = 146/185 (79%), Gaps = 1/185 (1%)
 Frame = -1

Query  736  QADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIK  557
             ADVFLWRNKK+S GVLGGAT +W+LFE+L+YHLLT V H LI  LA+LFLWSNA +FI 
Sbjct  75   SADVFLWRNKKVSGGVLGGATVVWVLFELLQYHLLTLVAHILIATLAILFLWSNAHTFIH  134

Query  556  KSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVG  377
            K+ P IPEV +PEEP LQ AS LR  +N   A+L  IASG+DLK FL VI GLW++S+VG
Sbjct  135  KTPPRIPEVRLPEEPFLQVASELRVVINCSFALLHSIASGKDLKKFLAVIAGLWVLSVVG  194

Query  376  SCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGP  197
              C+FLTLFYI+ VLLHTVP +YEKYED++D  AEK   E KKQY VFDAKVLSKIP G 
Sbjct  195  KWCNFLTLFYISFVLLHTVPFIYEKYEDKIDPLAEKVTIEFKKQYDVFDAKVLSKIPCG-  253

Query  196  LKDKK  182
            LK+K+
Sbjct  254  LKNKR  258



>ref|XP_006284372.1| hypothetical protein CARUB_v10005543mg [Capsella rubella]
 gb|EOA17270.1| hypothetical protein CARUB_v10005543mg [Capsella rubella]
Length=257

 Score =   224 bits (572),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 129/188 (69%), Positives = 152/188 (81%), Gaps = 4/188 (2%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+FLWRNKK+S GV G  TA W+LFE++EYH LT +CH  + ALA LFLWSNA +FI K
Sbjct  69   ADIFLWRNKKVSGGVFGAITASWVLFELIEYHFLTFLCHFAMAALAALFLWSNACTFIHK  128

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            + PHIPEVHIPE+PVLQ  S LR ++N    VLR+IASGRDLK F++VI GLWI+SI+GS
Sbjct  129  ATPHIPEVHIPEDPVLQLVSGLRIEINRGFTVLRNIASGRDLKKFILVIAGLWILSILGS  188

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----AKVLSKIP  206
            CC+FLTLFYIA VLL T+PV+YEKYED+VDAF EKAM E+KKQYAV D    +KVLSKIP
Sbjct  189  CCNFLTLFYIATVLLFTIPVIYEKYEDKVDAFGEKAMKEIKKQYAVLDEKVLSKVLSKIP  248

Query  205  RGPLKDKK  182
            RG L  KK
Sbjct  249  RGALNKKK  256



>ref|XP_009104316.1| PREDICTED: reticulon-like protein B6 [Brassica rapa]
 emb|CDY53913.1| BnaA07g38210D [Brassica napus]
Length=254

 Score =   224 bits (571),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 118/183 (64%), Positives = 142/183 (78%), Gaps = 0/183 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWR+KK+S  VLG ATAIW+LFE++EYH L+ VCH LI +LA +FLWSNA +F+KK
Sbjct  70   ADVFLWRDKKLSAAVLGVATAIWVLFELVEYHFLSLVCHILIFSLAAMFLWSNAHAFMKK  129

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IPE+ + EE  L  ASALRN++N    +LR IA GRDLK FLMV+ GLWIIS+VG+
Sbjct  130  SPPKIPEIQVKEEHFLLIASALRNELNQAFVILRSIALGRDLKKFLMVVVGLWIISVVGN  189

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
              +FLTL YI  V+LHTVP+LYEK+ED+VD  AEK + ELKK Y VFD KVLSKIP   L
Sbjct  190  WFNFLTLVYICFVVLHTVPMLYEKHEDKVDPVAEKTLKELKKHYMVFDEKVLSKIPLASL  249

Query  193  KDK  185
            K K
Sbjct  250  KAK  252



>ref|XP_009112901.1| PREDICTED: reticulon-like protein B3 [Brassica rapa]
Length=251

 Score =   224 bits (570),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 125/188 (66%), Positives = 146/188 (78%), Gaps = 4/188 (2%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+FLWRNKK+S GVLG AT  WILFE+L+Y+LLT   H  ILALAVLFLWS+A++FI K
Sbjct  63   ADIFLWRNKKVSGGVLGAATLSWILFELLQYNLLTLFGHVSILALAVLFLWSSATTFIHK  122

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
              PHIPEVHIPEE  LQ AS LR ++N    +LR+IA GR+LK FLMV+ GLW++S VGS
Sbjct  123  KPPHIPEVHIPEEVALQLASGLRIEINRGFTILRNIALGRELKKFLMVVAGLWVLSKVGS  182

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----AKVLSKIP  206
             C+FLTL YIA VLL TVPV YEKYED+VD F EKAM E+KKQYAV D    +KV+SKIP
Sbjct  183  SCNFLTLIYIATVLLFTVPVFYEKYEDKVDHFGEKAMKEIKKQYAVLDEKVLSKVMSKIP  242

Query  205  RGPLKDKK  182
            RG    KK
Sbjct  243  RGAFNKKK  250



>emb|CDY42012.1| BnaC04g00900D [Brassica napus]
Length=251

 Score =   223 bits (569),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 121/181 (67%), Positives = 145/181 (80%), Gaps = 0/181 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWR+KK+S  VLG ATAIW+LFE++EYHLL+ +CH  ILAL  LFLWSNA +FIKK
Sbjct  67   ADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHVSILALGGLFLWSNAHTFIKK  126

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IPE+H+PEEP L  AS+LRN++N    +LR IA GRDLK FLM++ GLWIIS+VG+
Sbjct  127  SPPQIPEIHVPEEPFLLIASSLRNELNQGFVILRSIALGRDLKKFLMIVVGLWIISVVGN  186

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
             C+FLTL YI  VLLHTVP++YEK+ED+VD FAEKA  EL K Y VFD KV+SKIP   L
Sbjct  187  WCNFLTLVYICFVLLHTVPMMYEKHEDKVDPFAEKAFKELHKHYLVFDEKVVSKIPIASL  246

Query  193  K  191
            K
Sbjct  247  K  247



>ref|XP_006302727.1| hypothetical protein CARUB_v10020840mg [Capsella rubella]
 gb|EOA35625.1| hypothetical protein CARUB_v10020840mg [Capsella rubella]
Length=253

 Score =   223 bits (569),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 125/182 (69%), Positives = 145/182 (80%), Gaps = 4/182 (2%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+FLWRNKK+S GVLG AT  WILFE+LEY+LLT   H  IL LAVLFLWS+A++FI K
Sbjct  64   ADIFLWRNKKVSGGVLGAATVSWILFELLEYNLLTLFGHISILTLAVLFLWSSATTFIHK  123

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            + PHIPEVHIPEE VLQ AS LR ++N     LRDIASGRDLK FL+VI GLW++S VGS
Sbjct  124  TPPHIPEVHIPEEVVLQLASGLRIEINRGFTALRDIASGRDLKKFLLVIAGLWVLSKVGS  183

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----AKVLSKIP  206
             C+FLTL YIA VLL T+PVLYEKYED+VD F EKAM E+KKQY  FD    +KV+SKIP
Sbjct  184  SCNFLTLIYIATVLLFTIPVLYEKYEDKVDDFGEKAMREIKKQYVEFDVKVLSKVMSKIP  243

Query  205  RG  200
            +G
Sbjct  244  KG  245



>gb|KFK40472.1| hypothetical protein AALP_AA2G000200 [Arabis alpina]
Length=254

 Score =   223 bits (569),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 127/189 (67%), Positives = 149/189 (79%), Gaps = 4/189 (2%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+FLWRNKK+S GVLG AT  WILFE+LEY+LLT   H  ILALAVLFLWS+A++FI K
Sbjct  66   ADIFLWRNKKVSGGVLGAATISWILFELLEYNLLTLFGHVSILALAVLFLWSSATTFIHK  125

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            + PHIPE+HIPE+ VL+ AS LR ++N    VLR IA GRDLK FLMV+ GLW++SI+GS
Sbjct  126  TPPHIPEIHIPEKIVLELASGLRIEINRGFTVLRHIALGRDLKKFLMVVAGLWVLSILGS  185

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----AKVLSKIP  206
             C FLTL YIA V+L TVPVLYEKYED+VD F EKAM E+KKQYAV D    +KV+SKIP
Sbjct  186  SCTFLTLVYIATVILFTVPVLYEKYEDKVDDFGEKAMKEIKKQYAVLDEKVLSKVMSKIP  245

Query  205  RGPLKDKKL  179
             G L  KKL
Sbjct  246  IGALMKKKL  254



>ref|XP_006656127.1| PREDICTED: reticulon-like protein B2-like [Oryza brachyantha]
Length=262

 Score =   223 bits (569),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 142/184 (77%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADV LW++KK S  V+GGAT IWILFEVL+YHLLT + H +I ALA+LFLWS A++FIKK
Sbjct  77   ADVLLWKDKKTSAVVIGGATVIWILFEVLDYHLLTLLSHVMIGALAILFLWSKATTFIKK  136

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IP V IPE+  +  + ALRND+N  L + R+IA G DLK FL VI  LW++S VGS
Sbjct  137  SPPDIPVVQIPEDVAVNVSRALRNDINRALHLFREIALGHDLKKFLGVIVALWVLSEVGS  196

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            CCDFLTL Y+AV++LHTVP+LY+KY+D+VD FA +A  E  K Y V DAKVLSKIPRGP 
Sbjct  197  CCDFLTLIYVAVLMLHTVPILYDKYQDKVDHFAGRAHSEACKHYEVLDAKVLSKIPRGPS  256

Query  193  KDKK  182
            K KK
Sbjct  257  KPKK  260



>ref|XP_009395750.1| PREDICTED: reticulon-like protein B2 [Musa acuminata subsp. malaccensis]
Length=253

 Score =   223 bits (568),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 118/185 (64%), Positives = 137/185 (74%), Gaps = 0/185 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWRNKK+S    G  TAIW+ FE++EYHL+T VCHGLIL+LA++FLW NA++FI K
Sbjct  68   ADVFLWRNKKVSASTFGAVTAIWVFFELMEYHLITLVCHGLILSLAIIFLWCNATTFISK  127

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S PH+PEV I E+  L    +LR  +N  L  LRDIASGRDLK FL     LW++SI+ +
Sbjct  128  SRPHVPEVSISEDLALNVVLSLRYVINRGLVALRDIASGRDLKKFLAAAAALWVLSIIAN  187

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            CC FL LFYIA V L+TVPVLYEKYED VDAFAEKA  E KK Y V   K LSKIP GPL
Sbjct  188  CCSFLMLFYIAFVALYTVPVLYEKYEDRVDAFAEKAEAEFKKHYVVIHVKYLSKIPMGPL  247

Query  193  KDKKL  179
            KDKK 
Sbjct  248  KDKKF  252



>gb|ACG32549.1| seed maturation protein [Zea mays]
Length=254

 Score =   223 bits (568),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 124/184 (67%), Positives = 153/184 (83%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+FLWRNK+IS GVL GATA W+LFEV++YHLLT +CH LIL LA+LFLWSNA++FI K
Sbjct  69   ADLFLWRNKRISGGVLAGATAFWLLFEVMDYHLLTLLCHCLILTLAILFLWSNATTFINK  128

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P+IPEV IP++  + FA +LR ++N   A LR+I  G DLK FL+VI GLWI+S++GS
Sbjct  129  SPPNIPEVKIPDDLAVNFARSLRYEINRGFATLREIGQGHDLKKFLIVIAGLWILSVLGS  188

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            CC+FLTL YI  ++L+TVPVLYEK+ED+VDAF EKAM ELKK YA+FD K LSKIP+GPL
Sbjct  189  CCNFLTLSYIVFMVLYTVPVLYEKHEDKVDAFGEKAMVELKKYYAIFDEKCLSKIPKGPL  248

Query  193  KDKK  182
            KDKK
Sbjct  249  KDKK  252



>ref|XP_002880222.1| reticulon family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56481.1| reticulon family protein [Arabidopsis lyrata subsp. lyrata]
Length=255

 Score =   223 bits (568),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 119/183 (65%), Positives = 145/183 (79%), Gaps = 0/183 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADVFLWR+KK+S  VLG ATAIW+LFE++EYHLL+ +CH  ILAL  LFLWSN  +FI K
Sbjct  69   ADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHISILALGGLFLWSNVHTFINK  128

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            ++P IPE+H+PEE  L  AS+LRN++N    +LR IA GRDLK FLMV+ GLWIIS+VG+
Sbjct  129  ASPQIPEIHVPEEAFLVIASSLRNELNQAFVILRSIALGRDLKKFLMVVVGLWIISVVGN  188

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
             C+FLTL Y   V+LHTVP+LYEK+ED+VD  AEKA+ EL+KQY VFD KVLSKIP   L
Sbjct  189  WCNFLTLVYFCFVILHTVPMLYEKHEDKVDPLAEKALKELQKQYVVFDEKVLSKIPIASL  248

Query  193  KDK  185
            K K
Sbjct  249  KAK  251



>ref|NP_001046501.1| Os02g0265900 [Oryza sativa Japonica Group]
 dbj|BAD27895.1| putative 24 kDa seed maturation protein [Oryza sativa Japonica 
Group]
 dbj|BAF08415.1| Os02g0265900 [Oryza sativa Japonica Group]
 gb|EAZ22509.1| hypothetical protein OsJ_06173 [Oryza sativa Japonica Group]
 dbj|BAG96495.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87213.1| unnamed protein product [Oryza sativa Japonica Group]
Length=230

 Score =   222 bits (565),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 143/184 (78%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADV LW++KKIS  V+GGAT +W+LFEV++YH LT + H LI  LA+LFLWS A+ FIKK
Sbjct  45   ADVLLWKDKKISAAVIGGATVLWVLFEVVDYHFLTLISHVLIGVLAILFLWSKATIFIKK  104

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P+IPEV I E+  +  A ALR D+N  L +LR+I+ G DL  FL VI  LWI+S +GS
Sbjct  105  SPPNIPEVKISEDLAVNVALALRTDINQALHLLREISLGHDLMKFLGVIVALWILSEIGS  164

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
             CDFLTLFY+AV++LHTVP+LY KY+D+VD FA KA  EL +QY+V DAKVLSKIPRGP 
Sbjct  165  LCDFLTLFYVAVLMLHTVPILYHKYQDKVDHFAGKAHVELSRQYSVLDAKVLSKIPRGPA  224

Query  193  KDKK  182
            KDKK
Sbjct  225  KDKK  228



>ref|XP_010671578.1| PREDICTED: reticulon-like protein B4 [Beta vulgaris subsp. vulgaris]
Length=286

 Score =   224 bits (570),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 149/187 (80%), Gaps = 0/187 (0%)
 Frame = -1

Query  736  QADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIK  557
             ADV LWRNKKIS   LG AT IW LFE+LEYHLLT +CH LI  LAVLFLWSNAS+FI 
Sbjct  100  PADVLLWRNKKISASALGVATVIWFLFELLEYHLLTLLCHILIFTLAVLFLWSNASAFIH  159

Query  556  KSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVG  377
            K+ P IP+VHIP+  +L+F S LR ++N  L+VLRDIASG++LK F  VI GLW++S+VG
Sbjct  160  KAPPRIPDVHIPDNALLEFISVLRFEINRALSVLRDIASGKELKKFFGVIAGLWVVSVVG  219

Query  376  SCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGP  197
            S  +FLTL Y+  VLLHTVPVLYEKYED VDAFAEKA  ELKKQYAV D K LSKIPRGP
Sbjct  220  SWFNFLTLVYLLFVLLHTVPVLYEKYEDHVDAFAEKAAIELKKQYAVADEKFLSKIPRGP  279

Query  196  LKDKKLA  176
            LKDKK A
Sbjct  280  LKDKKSA  286



>ref|XP_010441324.1| PREDICTED: reticulon-like protein B4 [Camelina sativa]
Length=257

 Score =   223 bits (567),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 127/188 (68%), Positives = 150/188 (80%), Gaps = 4/188 (2%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+FLWRNKK+S GV G  TA W+LFE++EY  LT +CH  + ALA LFLWSNA +FI K
Sbjct  69   ADIFLWRNKKVSGGVFGAITASWVLFELIEYRFLTFLCHFAMAALAALFLWSNACTFIHK  128

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IPEVHIPE+PVLQ  S LR ++N    VLR+IASGRDLK F++VI GLW++SI+GS
Sbjct  129  STPRIPEVHIPEDPVLQLVSGLRIEINRGFTVLRNIASGRDLKKFILVIAGLWVLSIIGS  188

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----AKVLSKIP  206
            CC+FLTLFYIA VLL T+PV+YEKYED+VDAF EKAM E+KKQYAV D    +KVLSKIP
Sbjct  189  CCNFLTLFYIATVLLFTIPVVYEKYEDKVDAFGEKAMKEIKKQYAVLDDKVFSKVLSKIP  248

Query  205  RGPLKDKK  182
            RG L  KK
Sbjct  249  RGALNKKK  256



>ref|XP_010436110.1| PREDICTED: reticulon-like protein B4 [Camelina sativa]
Length=257

 Score =   223 bits (567),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 127/188 (68%), Positives = 151/188 (80%), Gaps = 4/188 (2%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+FLWRNKK+S GV G  TA W+LFE++EYH LT +CH  + ALA LFLWSNA +FI K
Sbjct  69   ADIFLWRNKKVSGGVFGAITASWVLFELIEYHFLTFLCHFAMAALAALFLWSNACTFIHK  128

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            + PH+PEVHIPE+PVLQ  S LR ++N    VLR+IASGRDLK F++VI GLW +SI+GS
Sbjct  129  ATPHLPEVHIPEDPVLQLVSGLRIEINRGFTVLRNIASGRDLKKFILVIAGLWALSIIGS  188

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFD----AKVLSKIP  206
            CC+FLTLFYIA VLL T+PV+YEKYED+VDAF EKAM E+KKQYAV D    +KVLSKIP
Sbjct  189  CCNFLTLFYIATVLLFTIPVVYEKYEDKVDAFGEKAMKEIKKQYAVLDEKVLSKVLSKIP  248

Query  205  RGPLKDKK  182
            RG L  KK
Sbjct  249  RGALNKKK  256



>ref|XP_002441411.1| hypothetical protein SORBIDRAFT_09g026210 [Sorghum bicolor]
 gb|EES19841.1| hypothetical protein SORBIDRAFT_09g026210 [Sorghum bicolor]
Length=255

 Score =   222 bits (566),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 125/184 (68%), Positives = 153/184 (83%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            AD+FLWRNK+IS GVL GATAIW+LFEV++YHLLT +CH LIL LA+LFLWSNA++FI K
Sbjct  70   ADLFLWRNKRISGGVLAGATAIWLLFEVMDYHLLTLLCHCLILTLAILFLWSNATTFINK  129

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P+IPEV IPE+  +  A +LR ++N   A LR+I  G DLK FL+VI GLWI+S++GS
Sbjct  130  SPPNIPEVKIPEDLAVNVARSLRYEINRGFATLREIGQGHDLKKFLIVIAGLWILSVLGS  189

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            CC+FLTL YI  ++L+TVPVLYEK+ED+VDAF EKAM ELKK YA+FD K LSKIP+GPL
Sbjct  190  CCNFLTLSYIVFMVLYTVPVLYEKHEDKVDAFGEKAMVELKKYYAIFDEKCLSKIPKGPL  249

Query  193  KDKK  182
            KDKK
Sbjct  250  KDKK  253



>ref|XP_004308034.1| PREDICTED: reticulon-like protein B2 [Fragaria vesca subsp. vesca]
Length=275

 Score =   223 bits (567),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 119/184 (65%), Positives = 143/184 (78%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADV LWR+KK S  VLG AT +WI FE LEYHL+T  CH +IL LAV FLWSN SSFI K
Sbjct  90   ADVLLWRDKKESASVLGAATVLWIFFECLEYHLITLFCHIMILFLAVFFLWSNGSSFINK  149

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            + P IP+V IPE+ VL  ASALR ++N    VLR+IASGRDLK FL VI  LWI+S++G 
Sbjct  150  APPEIPKVQIPEKCVLDIASALRIELNKGFHVLREIASGRDLKTFLGVIAVLWIVSVIGK  209

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            C  FLTLFY+  VLLH+ P++YEK+ED++DA AEKA  E KKQYAVF+ KVLSKIP+GP+
Sbjct  210  CFSFLTLFYLTFVLLHSAPLIYEKHEDQIDAVAEKAWIEFKKQYAVFNEKVLSKIPKGPV  269

Query  193  KDKK  182
            K+KK
Sbjct  270  KEKK  273



>ref|NP_001057713.1| Os06g0503400 [Oryza sativa Japonica Group]
 dbj|BAD45275.1| putative 24 kDa seed maturation protein [Oryza sativa Japonica 
Group]
 dbj|BAF19627.1| Os06g0503400 [Oryza sativa Japonica Group]
 dbj|BAG93532.1| unnamed protein product [Oryza sativa Japonica Group]
Length=265

 Score =   222 bits (566),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 143/184 (78%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADV LW++KK S  V+GGAT IWILFEVL+YHLLT + H +I ALA+LFLWS A++FIKK
Sbjct  81   ADVLLWKDKKTSAVVIGGATVIWILFEVLDYHLLTLLSHVMIGALAILFLWSKATTFIKK  140

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IP V IPE+  +  + ALR+D+N  L + R+IA G DLK FL VI  LW++S VGS
Sbjct  141  SPPDIPVVQIPEDVAVNVSRALRSDINRALHLFREIALGHDLKKFLGVIVALWVLSEVGS  200

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
            CCDFLTL Y+AV++LHTVP+LY+KY+D+VD FA +A  E  K Y V DAKVLSKIPRGP+
Sbjct  201  CCDFLTLIYVAVLMLHTVPILYDKYQDKVDHFAGRAHSEACKHYEVLDAKVLSKIPRGPV  260

Query  193  KDKK  182
            K KK
Sbjct  261  KPKK  264



>gb|EPS71452.1| hypothetical protein M569_03311 [Genlisea aurea]
Length=242

 Score =   221 bits (562),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 144/184 (78%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADV LWRNK +S+GV+GGATAIWILF+VLEYH LT V H LIL L + F+WSN S+F+KK
Sbjct  57   ADVLLWRNKNVSLGVIGGATAIWILFDVLEYHFLTLVSHALILGLVIFFVWSNGSTFLKK  116

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P IP+V IPE+PVL+F S  R ++N   + LRDIASG+DLK FL++I  LW +S++GS
Sbjct  117  SPPRIPQVIIPEKPVLEFVSDARIEINRAFSSLRDIASGKDLKKFLLLIVVLWALSVLGS  176

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
              DFL+L Y+  V L T+P  YEKYEDE+D+FA  A  ELKKQYA FDAKVLSKIPRG L
Sbjct  177  LFDFLSLVYLTTVSLLTLPSFYEKYEDEIDSFAHGAAAELKKQYAAFDAKVLSKIPRGLL  236

Query  193  KDKK  182
            +++K
Sbjct  237  QNRK  240



>gb|EAY85291.1| hypothetical protein OsI_06662 [Oryza sativa Indica Group]
Length=230

 Score =   220 bits (561),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 115/184 (63%), Positives = 142/184 (77%), Gaps = 0/184 (0%)
 Frame = -1

Query  733  ADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIKK  554
            ADV LW++KKIS  V+GGAT +W+LFEV++YH LT + H LI  LA+LFLWS A+ FIKK
Sbjct  45   ADVLLWKDKKISAAVIGGATVLWVLFEVVDYHFLTLISHVLIGVLAILFLWSKATIFIKK  104

Query  553  SAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVGS  374
            S P+IPEV I E+  +  A ALR D+N  L +LR+I+ G DL  FL VI  LWI+S +GS
Sbjct  105  SPPNIPEVKISEDLAVNVALALRTDINQALHLLREISLGHDLMKFLGVIVALWILSEIGS  164

Query  373  CCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGPL  194
             CDFLTLFY+AV++LHTVP+ Y KY+D+VD FA KA  EL +QY+V DAKVLSKIPRGP 
Sbjct  165  LCDFLTLFYVAVLMLHTVPIFYHKYQDKVDHFAGKAHVELSRQYSVLDAKVLSKIPRGPA  224

Query  193  KDKK  182
            KDKK
Sbjct  225  KDKK  228



>ref|XP_007135152.1| hypothetical protein PHAVU_010G105400g [Phaseolus vulgaris]
 gb|ESW07146.1| hypothetical protein PHAVU_010G105400g [Phaseolus vulgaris]
Length=255

 Score =   221 bits (563),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 132/187 (71%), Positives = 148/187 (79%), Gaps = 0/187 (0%)
 Frame = -1

Query  736  QADVFLWRNKKISVGVLGGATAIWILFEVLEYHLLTAVCHGLILALAVLFLWSNASSFIK  557
             ADV LWRNKKIS  VL  ATA+WI FE+LEYHLLT V H LIL LAVLFLWSNA +FI 
Sbjct  69   PADVLLWRNKKISASVLSVATAVWIFFELLEYHLLTLVGHILILLLAVLFLWSNAHTFIH  128

Query  556  KSAphipevhipeepVLQFASALRNDVNHCLAVLRDIASGRDLKMFLMVITGLWIISIVG  377
            K+ P IP VH+PEEP LQFASAL  ++N   A L  I SGRDLK FL+VI G WI+SIVG
Sbjct  129  KAPPRIPVVHLPEEPFLQFASALTIEINRGFAALHAIGSGRDLKTFLVVIVGTWILSIVG  188

Query  376  SCCDFLTLFYIAVVLLHTVPVLYEKYEDEVDAFAEKAMHELKKQYAVFDAKVLSKIPRGP  197
            S  +F+TLFYI  VLLHTVPVLY+KYED++D  AEKA+ E KKQYAVFD KVLSKIP+GP
Sbjct  189  SWVNFMTLFYIVFVLLHTVPVLYDKYEDKIDPLAEKALIEFKKQYAVFDEKVLSKIPKGP  248

Query  196  LKDKKLA  176
            LK KKLA
Sbjct  249  LKYKKLA  255



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1340626501500