BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF010B19

Length=719
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006364007.1|  PREDICTED: leucine-rich repeat receptor-like...    253   6e-74   Solanum tuberosum [potatoes]
ref|XP_004234641.1|  PREDICTED: leucine-rich repeat receptor-like...    252   1e-73   Solanum lycopersicum
ref|XP_009786199.1|  PREDICTED: leucine-rich repeat receptor-like...    249   1e-72   Nicotiana sylvestris
ref|XP_009605676.1|  PREDICTED: leucine-rich repeat receptor-like...    248   5e-72   Nicotiana tomentosiformis
dbj|BAK52390.1|  leucine rich repeat receptor protein kinase CLAV...    246   1e-71   Solanum peruvianum [Peruvian tomato]
ref|XP_009771232.1|  PREDICTED: leucine-rich repeat receptor-like...    246   1e-71   Nicotiana sylvestris
gb|KHN13035.1|  Leucine-rich repeat receptor-like serine/threonin...    243   1e-71   Glycine soja [wild soybean]
dbj|BAK52389.1|  leucine rich repeat receptor protein kinase CLAV...    246   1e-71   Solanum pennellii
ref|NP_001274713.1|  leucine-rich repeat receptor-like serine/thr...    246   2e-71   Solanum lycopersicum
ref|XP_010547579.1|  PREDICTED: leucine-rich repeat receptor-like...    245   4e-71   Tarenaya hassleriana [spider flower]
gb|KHN42601.1|  Leucine-rich repeat receptor-like serine/threonin...    241   8e-71   Glycine soja [wild soybean]
ref|NP_001237715.1|  receptor-like protein kinase 2 precursor           243   1e-70   Glycine max [soybeans]
ref|XP_010105101.1|  Leucine-rich repeat receptor-like serine/thr...    243   2e-70   Morus notabilis
ref|XP_006357743.1|  PREDICTED: leucine-rich repeat receptor-like...    243   2e-70   Solanum tuberosum [potatoes]
ref|XP_010518800.1|  PREDICTED: leucine-rich repeat receptor-like...    243   3e-70   Tarenaya hassleriana [spider flower]
ref|XP_009354585.1|  PREDICTED: leucine-rich repeat receptor-like...    243   3e-70   Pyrus x bretschneideri [bai li]
ref|XP_009375880.1|  PREDICTED: leucine-rich repeat receptor-like...    242   3e-70   Pyrus x bretschneideri [bai li]
ref|XP_008344369.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    242   4e-70   
ref|XP_008354741.1|  PREDICTED: leucine-rich repeat receptor-like...    242   4e-70   
ref|XP_008393812.1|  PREDICTED: leucine-rich repeat receptor-like...    242   5e-70   
ref|NP_001235080.1|  receptor-like protein kinase 3 precursor           241   9e-70   
gb|KHG04200.1|  Leucine-rich repeat receptor-like serine/threonin...    241   1e-69   Gossypium arboreum [tree cotton]
ref|XP_011099433.1|  PREDICTED: leucine-rich repeat receptor-like...    241   1e-69   Sesamum indicum [beniseed]
ref|XP_007047661.1|  Leucine-rich receptor-like protein kinase fa...    240   2e-69   
gb|KDP32143.1|  hypothetical protein JCGZ_12604                         240   2e-69   Jatropha curcas
ref|XP_009613990.1|  PREDICTED: leucine-rich repeat receptor-like...    240   3e-69   Nicotiana tomentosiformis
ref|XP_011073654.1|  PREDICTED: leucine-rich repeat receptor-like...    240   3e-69   Sesamum indicum [beniseed]
ref|XP_002531999.1|  Receptor protein kinase CLAVATA1 precursor, ...    239   3e-69   Ricinus communis
ref|XP_004288299.1|  PREDICTED: leucine-rich repeat receptor-like...    239   4e-69   Fragaria vesca subsp. vesca
emb|CDP02660.1|  unnamed protein product                                239   5e-69   Coffea canephora [robusta coffee]
ref|XP_007156674.1|  hypothetical protein PHAVU_002G007600g             239   6e-69   Phaseolus vulgaris [French bean]
ref|XP_003635561.1|  PREDICTED: leucine-rich repeat receptor-like...    238   8e-69   Vitis vinifera
ref|XP_010683073.1|  PREDICTED: leucine-rich repeat receptor-like...    238   1e-68   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007208421.1|  hypothetical protein PRUPE_ppa000739mg             238   2e-68   Prunus persica
gb|KJB43996.1|  hypothetical protein B456_007G228700                    236   2e-68   Gossypium raimondii
gb|KJB18115.1|  hypothetical protein B456_003G034500                    237   2e-68   Gossypium raimondii
emb|CBI35733.3|  unnamed protein product                                237   2e-68   Vitis vinifera
ref|XP_004509039.1|  PREDICTED: leucine-rich repeat receptor-like...    237   3e-68   Cicer arietinum [garbanzo]
gb|KDO78771.1|  hypothetical protein CISIN_1g001816mg                   237   3e-68   Citrus sinensis [apfelsine]
ref|XP_006466390.1|  PREDICTED: leucine-rich repeat receptor-like...    237   3e-68   Citrus sinensis [apfelsine]
ref|XP_006426178.1|  hypothetical protein CICLE_v10024796mg             237   3e-68   Citrus clementina [clementine]
ref|XP_008237309.1|  PREDICTED: leucine-rich repeat receptor-like...    236   3e-68   
ref|XP_004511796.1|  PREDICTED: leucine-rich repeat receptor-like...    236   7e-68   
gb|KHN47566.1|  Leucine-rich repeat receptor-like serine/threonin...    233   8e-68   Glycine soja [wild soybean]
ref|XP_010271550.1|  PREDICTED: leucine-rich repeat receptor-like...    236   8e-68   Nelumbo nucifera [Indian lotus]
ref|NP_001235065.1|  receptor-like protein kinase 1 precursor           236   8e-68   Glycine max [soybeans]
ref|XP_011021820.1|  PREDICTED: leucine-rich repeat receptor-like...    235   1e-67   Populus euphratica
gb|KJB48795.1|  hypothetical protein B456_008G087500                    234   2e-67   Gossypium raimondii
ref|XP_010268646.1|  PREDICTED: leucine-rich repeat receptor-like...    234   2e-67   Nelumbo nucifera [Indian lotus]
ref|XP_002310320.2|  hypothetical protein POPTR_0007s14500g             234   2e-67   Populus trichocarpa [western balsam poplar]
gb|AIT56194.1|  leucine-rich repeat receptor-like serine/threonin...    234   2e-67   Dimocarpus longan [longan]
gb|KHG03710.1|  Leucine-rich repeat receptor-like serine/threonin...    234   2e-67   Gossypium arboreum [tree cotton]
dbj|BAF01968.1|  receptor protein kinase like protein                   219   3e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006279943.1|  hypothetical protein CARUB_v10025808mg             233   5e-67   Capsella rubella
ref|XP_004143422.1|  PREDICTED: leucine-rich repeat receptor-like...    233   7e-67   Cucumis sativus [cucumbers]
gb|AES94465.2|  LRR receptor-like kinase family protein                 233   8e-67   Medicago truncatula
ref|XP_008441113.1|  PREDICTED: leucine-rich repeat receptor-like...    233   8e-67   Cucumis melo [Oriental melon]
ref|XP_007155783.1|  hypothetical protein PHAVU_003G231400g             232   1e-66   Phaseolus vulgaris [French bean]
ref|XP_010444585.1|  PREDICTED: leucine-rich repeat receptor-like...    232   2e-66   Camelina sativa [gold-of-pleasure]
gb|KFK28239.1|  hypothetical protein AALP_AA8G490400                    231   2e-66   Arabis alpina [alpine rockcress]
ref|XP_008790445.1|  PREDICTED: leucine-rich repeat receptor-like...    231   2e-66   Phoenix dactylifera
ref|NP_001237688.1|  receptor-like protein kinase precursor             231   3e-66   Glycine max [soybeans]
ref|XP_006852730.1|  hypothetical protein AMTR_s00033p00083200          231   3e-66   
ref|XP_006393995.1|  hypothetical protein EUTSA_v10003584mg             231   4e-66   
ref|NP_201371.1|  leucine-rich repeat receptor-like serine/threon...    231   4e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002864974.1|  hypothetical protein ARALYDRAFT_496807             231   5e-66   
ref|XP_010463501.1|  PREDICTED: leucine-rich repeat receptor-like...    230   8e-66   Camelina sativa [gold-of-pleasure]
gb|KHN01704.1|  Leucine-rich repeat receptor-like serine/threonin...    229   8e-66   Glycine soja [wild soybean]
ref|XP_008787754.1|  PREDICTED: leucine-rich repeat receptor-like...    230   9e-66   Phoenix dactylifera
gb|KJB18113.1|  hypothetical protein B456_003G034400                    229   2e-65   Gossypium raimondii
ref|XP_003608587.1|  Receptor-like protein kinase                       229   2e-65   Medicago truncatula
ref|XP_010484412.1|  PREDICTED: leucine-rich repeat receptor-like...    229   2e-65   Camelina sativa [gold-of-pleasure]
emb|CDY45620.1|  BnaCnng13280D                                          228   3e-65   Brassica napus [oilseed rape]
ref|XP_003611507.1|  Receptor-like protein kinase                       229   3e-65   
ref|XP_010936307.1|  PREDICTED: leucine-rich repeat receptor-like...    228   3e-65   
gb|EYU41357.1|  hypothetical protein MIMGU_mgv1a000718mg                228   4e-65   Erythranthe guttata [common monkey flower]
emb|CDY08759.1|  BnaA06g24650D                                          228   4e-65   Brassica napus [oilseed rape]
ref|XP_009150662.1|  PREDICTED: leucine-rich repeat receptor-like...    228   4e-65   Brassica rapa
ref|XP_006650665.1|  PREDICTED: leucine-rich repeat receptor-like...    228   6e-65   Oryza brachyantha
ref|XP_004955422.1|  PREDICTED: leucine-rich repeat receptor-like...    227   8e-65   
ref|XP_008785758.1|  PREDICTED: leucine-rich repeat receptor-like...    225   1e-64   
ref|XP_010939309.1|  PREDICTED: leucine-rich repeat receptor-like...    226   2e-64   Elaeis guineensis
gb|EAY92008.1|  hypothetical protein OsI_13698                          226   2e-64   Oryza sativa Indica Group [Indian rice]
gb|AAP68887.1|  putative receptor-like protein kinase 1                 226   2e-64   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001051418.1|  Os03g0773700                                       225   3e-64   
gb|EEE60014.1|  hypothetical protein OsJ_12761                          225   3e-64   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010023395.1|  PREDICTED: leucine-rich repeat receptor-like...    225   3e-64   
emb|CDY23037.1|  BnaC07g31500D                                          225   5e-64   Brassica napus [oilseed rape]
gb|KCW59634.1|  hypothetical protein EUGRSUZ_H023832                    224   5e-64   Eucalyptus grandis [rose gum]
ref|NP_190536.1|  CLAVATA1-related receptor kinase-like protein         224   6e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002461427.1|  hypothetical protein SORBIDRAFT_02g002450          225   6e-64   Sorghum bicolor [broomcorn]
ref|XP_006290548.1|  hypothetical protein CARUB_v10016631mg             224   8e-64   Capsella rubella
gb|EAZ02682.1|  hypothetical protein OsI_24796                          224   8e-64   Oryza sativa Indica Group [Indian rice]
ref|XP_010943209.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    224   1e-63   
dbj|BAC82955.1|  putative OsLRK1(receptor-type protein kinase)          224   1e-63   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008787359.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    224   1e-63   
emb|CDY02112.1|  BnaA03g40550D                                          223   2e-63   
ref|XP_004981595.1|  PREDICTED: leucine-rich repeat receptor-like...    223   2e-63   Setaria italica
ref|XP_009136515.1|  PREDICTED: leucine-rich repeat receptor-like...    223   2e-63   Brassica rapa
gb|KFK34238.1|  hypothetical protein AALP_AA5G119100                    223   2e-63   Arabis alpina [alpine rockcress]
dbj|BAJ84911.1|  predicted protein                                      223   3e-63   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009399076.1|  PREDICTED: leucine-rich repeat receptor-like...    223   4e-63   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002875982.1|  hypothetical protein ARALYDRAFT_906265             222   5e-63   Arabidopsis lyrata subsp. lyrata
ref|XP_006657429.1|  PREDICTED: leucine-rich repeat receptor-like...    221   6e-63   Oryza brachyantha
gb|ADB85328.1|  putative receptor protein kinase                        219   9e-63   Phyllostachys edulis [kikko-chiku]
ref|XP_009397330.1|  PREDICTED: leucine-rich repeat receptor-like...    221   1e-62   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010941985.1|  PREDICTED: leucine-rich repeat receptor-like...    221   2e-62   Elaeis guineensis
gb|EMS57320.1|  Leucine-rich repeat receptor-like serine/threonin...    219   2e-62   Triticum urartu
ref|XP_006404116.1|  hypothetical protein EUTSA_v10010092mg             220   2e-62   
ref|XP_003558681.1|  PREDICTED: leucine-rich repeat receptor-like...    220   3e-62   Brachypodium distachyon [annual false brome]
ref|XP_010028033.1|  PREDICTED: leucine-rich repeat receptor-like...    220   3e-62   Eucalyptus grandis [rose gum]
ref|XP_003557615.1|  PREDICTED: leucine-rich repeat receptor-like...    219   4e-62   Brachypodium distachyon [annual false brome]
ref|XP_010515326.1|  PREDICTED: leucine-rich repeat receptor-like...    219   4e-62   Camelina sativa [gold-of-pleasure]
gb|AAO26313.1|  receptor-like protein kinase                            213   5e-62   Elaeis guineensis
ref|XP_010503631.1|  PREDICTED: leucine-rich repeat receptor-like...    219   8e-62   Camelina sativa [gold-of-pleasure]
gb|AAY32333.1|  RLK1                                                    218   8e-62   Phyllostachys praecox [zaozhu]
ref|XP_009394785.1|  PREDICTED: leucine-rich repeat receptor-like...    219   9e-62   
gb|EMT14290.1|  Receptor protein kinase CLAVATA1                        218   9e-62   
gb|EPS74129.1|  hypothetical protein M569_00625                         218   1e-61   Genlisea aurea
ref|XP_009396449.1|  PREDICTED: leucine-rich repeat receptor-like...    218   1e-61   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010426489.1|  PREDICTED: leucine-rich repeat receptor-like...    218   1e-61   Camelina sativa [gold-of-pleasure]
ref|XP_009408581.1|  PREDICTED: leucine-rich repeat receptor-like...    217   3e-61   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS67650.1|  Leucine-rich repeat receptor-like serine/threonin...    216   4e-61   Triticum urartu
ref|XP_002466378.1|  hypothetical protein SORBIDRAFT_01g006690          216   7e-61   Sorghum bicolor [broomcorn]
ref|XP_009395647.1|  PREDICTED: leucine-rich repeat receptor-like...    215   1e-60   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAJ89729.1|  predicted protein                                      215   2e-60   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT20446.1|  Receptor protein kinase CLAVATA1                        214   2e-60   
ref|XP_009394620.1|  PREDICTED: leucine-rich repeat receptor-like...    214   5e-60   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008665503.1|  PREDICTED: leucine-rich repeat receptor-like...    214   6e-60   Zea mays [maize]
gb|ACN35202.1|  unknown                                                 201   4e-59   Zea mays [maize]
ref|XP_006649672.1|  PREDICTED: leucine-rich repeat receptor-like...    211   5e-59   Oryza brachyantha
ref|XP_009787949.1|  PREDICTED: leucine-rich repeat receptor-like...    210   1e-58   Nicotiana sylvestris
gb|AAM27467.1|AC099732_4  Putative receptor-like protein kinase         209   3e-58   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001049453.1|  Os03g0228800                                       209   3e-58   
dbj|BAJ99137.1|  predicted protein                                      208   5e-58   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001169902.1|  uncharacterized protein LOC100383797               201   6e-58   
gb|EEC74807.1|  hypothetical protein OsI_10619                          208   8e-58   Oryza sativa Indica Group [Indian rice]
gb|EMT21762.1|  Receptor protein kinase CLAVATA1                        197   9e-58   
gb|EMT15500.1|  hypothetical protein F775_52402                         206   1e-57   
ref|XP_010228930.1|  PREDICTED: leucine-rich repeat receptor-like...    207   1e-57   
gb|ACL54651.1|  unknown                                                 200   2e-57   Zea mays [maize]
ref|XP_004985112.1|  PREDICTED: leucine-rich repeat receptor-like...    205   5e-57   Setaria italica
ref|XP_009603651.1|  PREDICTED: leucine-rich repeat receptor-like...    205   8e-57   Nicotiana tomentosiformis
ref|XP_004230451.1|  PREDICTED: leucine-rich repeat receptor-like...    204   1e-56   Solanum lycopersicum
ref|XP_003592924.1|  Receptor-like protein kinase                       204   1e-56   Medicago truncatula
ref|NP_001145765.1|  uncharacterized protein LOC100279272               202   2e-56   
tpg|DAA44225.1|  TPA: putative leucine-rich repeat receptor-like ...    203   3e-56   
tpg|DAA59489.1|  TPA: putative leucine-rich repeat receptor-like ...    204   3e-56   
ref|XP_006431638.1|  hypothetical protein CICLE_v10000148mg             203   4e-56   
ref|XP_006349327.1|  PREDICTED: leucine-rich repeat receptor-like...    203   4e-56   Solanum tuberosum [potatoes]
ref|XP_009403711.1|  PREDICTED: leucine-rich repeat receptor-like...    202   5e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010912647.1|  PREDICTED: leucine-rich repeat receptor-like...    202   7e-56   Elaeis guineensis
ref|XP_006858565.1|  hypothetical protein AMTR_s00071p00176900          200   1e-55   
gb|AAX96206.1|  Similar to receptor-like protein kinase 3               202   1e-55   Oryza sativa Japonica Group [Japonica rice]
gb|EEC67924.1|  hypothetical protein OsI_35629                          201   2e-55   Oryza sativa Indica Group [Indian rice]
emb|CDO97616.1|  unnamed protein product                                201   2e-55   Coffea canephora [robusta coffee]
ref|XP_003576141.1|  PREDICTED: leucine-rich repeat receptor-like...    201   2e-55   Brachypodium distachyon [annual false brome]
gb|KDO44093.1|  hypothetical protein CISIN_1g001922mg                   201   2e-55   Citrus sinensis [apfelsine]
ref|XP_006492589.1|  PREDICTED: leucine-rich repeat receptor-like...    201   2e-55   Citrus sinensis [apfelsine]
dbj|BAJ90459.1|  predicted protein                                      201   3e-55   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010930574.1|  PREDICTED: leucine-rich repeat receptor-like...    200   4e-55   Elaeis guineensis
ref|XP_009411355.1|  PREDICTED: leucine-rich repeat receptor-like...    200   5e-55   Musa acuminata subsp. malaccensis [pisang utan]
emb|CBI29704.3|  unnamed protein product                                199   7e-55   Vitis vinifera
gb|KDP42443.1|  hypothetical protein JCGZ_00240                         199   1e-54   Jatropha curcas
ref|XP_006859064.1|  hypothetical protein AMTR_s00068p00198250          197   1e-54   
gb|KJB32855.1|  hypothetical protein B456_005G265400                    199   1e-54   Gossypium raimondii
gb|EEE51888.1|  hypothetical protein OsJ_33462                          198   1e-54   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002263291.2|  PREDICTED: leucine-rich repeat receptor-like...    199   1e-54   Vitis vinifera
ref|XP_009355307.1|  PREDICTED: leucine-rich repeat receptor-like...    199   2e-54   Pyrus x bretschneideri [bai li]
ref|XP_007224667.1|  hypothetical protein PRUPE_ppa026134mg             198   2e-54   Prunus persica
ref|XP_010520784.1|  PREDICTED: leucine-rich repeat receptor-like...    198   2e-54   Tarenaya hassleriana [spider flower]
ref|XP_010520783.1|  PREDICTED: leucine-rich repeat receptor-like...    198   2e-54   Tarenaya hassleriana [spider flower]
emb|CAN71863.1|  hypothetical protein VITISV_023530                     197   3e-54   Vitis vinifera
ref|XP_011087678.1|  PREDICTED: leucine-rich repeat receptor-like...    197   3e-54   
ref|XP_007041221.1|  Leucine-rich receptor-like protein kinase fa...    197   3e-54   
gb|EYU26470.1|  hypothetical protein MIMGU_mgv1a019834mg                197   4e-54   Erythranthe guttata [common monkey flower]
ref|XP_008218726.1|  PREDICTED: leucine-rich repeat receptor-like...    197   5e-54   Prunus mume [ume]
ref|XP_008795253.1|  PREDICTED: leucine-rich repeat receptor-like...    197   7e-54   Phoenix dactylifera
ref|XP_008786484.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    196   1e-53   
ref|XP_011092305.1|  PREDICTED: leucine-rich repeat receptor-like...    196   1e-53   Sesamum indicum [beniseed]
ref|XP_004485432.1|  PREDICTED: leucine-rich repeat receptor-like...    196   1e-53   Cicer arietinum [garbanzo]
ref|XP_007040964.1|  Leucine-rich receptor-like protein kinase fa...    196   1e-53   
gb|KHG14208.1|  Leucine-rich repeat receptor-like serine/threonin...    196   1e-53   Gossypium arboreum [tree cotton]
ref|XP_009392568.1|  PREDICTED: leucine-rich repeat receptor-like...    196   1e-53   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002526451.1|  Receptor protein kinase CLAVATA1 precursor, ...    196   2e-53   Ricinus communis
gb|KCW57119.1|  hypothetical protein EUGRSUZ_I02765                     194   2e-53   Eucalyptus grandis [rose gum]
ref|XP_010243895.1|  PREDICTED: leucine-rich repeat receptor-like...    195   3e-53   Nelumbo nucifera [Indian lotus]
gb|KDO77158.1|  hypothetical protein CISIN_1g012213mg                   189   3e-53   Citrus sinensis [apfelsine]
ref|XP_008347921.1|  PREDICTED: leucine-rich repeat receptor-like...    195   3e-53   
ref|XP_002304615.1|  leucine-rich repeat transmembrane protein ki...    195   4e-53   Populus trichocarpa [western balsam poplar]
ref|XP_006385034.1|  hypothetical protein POPTR_0004s23260g             195   4e-53   Populus trichocarpa [western balsam poplar]
ref|XP_008356104.1|  PREDICTED: leucine-rich repeat receptor-like...    194   4e-53   
ref|XP_010687839.1|  PREDICTED: leucine-rich repeat receptor-like...    195   4e-53   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011028346.1|  PREDICTED: leucine-rich repeat receptor-like...    194   5e-53   Populus euphratica
ref|XP_009401113.1|  PREDICTED: leucine-rich repeat receptor-like...    194   6e-53   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009363288.1|  PREDICTED: leucine-rich repeat receptor-like...    194   7e-53   Pyrus x bretschneideri [bai li]
ref|XP_010030176.1|  PREDICTED: leucine-rich repeat receptor-like...    194   7e-53   Eucalyptus grandis [rose gum]
ref|XP_004295533.1|  PREDICTED: leucine-rich repeat receptor-like...    194   8e-53   Fragaria vesca subsp. vesca
gb|AHJ14779.1|  CLAVATA1                                                194   9e-53   Rhododendron ovatum
gb|KJB16198.1|  hypothetical protein B456_002G217000                    192   1e-52   Gossypium raimondii
ref|XP_008339390.1|  PREDICTED: leucine-rich repeat receptor-like...    193   1e-52   
ref|XP_011022287.1|  PREDICTED: leucine-rich repeat receptor-like...    193   1e-52   Populus euphratica
ref|XP_009368577.1|  PREDICTED: leucine-rich repeat receptor-like...    193   2e-52   Pyrus x bretschneideri [bai li]
ref|XP_008349109.1|  PREDICTED: leucine-rich repeat receptor-like...    193   2e-52   Malus domestica [apple tree]
ref|XP_008799579.1|  PREDICTED: leucine-rich repeat receptor-like...    193   2e-52   Phoenix dactylifera
ref|XP_011004294.1|  PREDICTED: leucine-rich repeat receptor-like...    192   2e-52   Populus euphratica
ref|XP_002297907.2|  leucine-rich repeat transmembrane protein ki...    192   2e-52   Populus trichocarpa [western balsam poplar]
ref|XP_006468612.1|  PREDICTED: leucine-rich repeat receptor-like...    192   2e-52   Citrus sinensis [apfelsine]
gb|KCW62729.1|  hypothetical protein EUGRSUZ_G00319                     192   4e-52   Eucalyptus grandis [rose gum]
gb|KHG17337.1|  Leucine-rich repeat receptor-like serine/threonin...    192   4e-52   Gossypium arboreum [tree cotton]
ref|XP_009353760.1|  PREDICTED: leucine-rich repeat receptor-like...    192   4e-52   Pyrus x bretschneideri [bai li]
gb|KJB16199.1|  hypothetical protein B456_002G217000                    192   4e-52   Gossypium raimondii
ref|XP_010065309.1|  PREDICTED: leucine-rich repeat receptor-like...    192   4e-52   Eucalyptus grandis [rose gum]
gb|KDP23869.1|  hypothetical protein JCGZ_27138                         191   5e-52   Jatropha curcas
ref|XP_008793131.1|  PREDICTED: leucine-rich repeat receptor-like...    190   6e-52   
ref|XP_006448558.1|  hypothetical protein CICLE_v10014145mg             191   6e-52   Citrus clementina [clementine]
emb|CDP04113.1|  unnamed protein product                                191   7e-52   Coffea canephora [robusta coffee]
ref|XP_008793129.1|  PREDICTED: leucine-rich repeat receptor-like...    191   7e-52   
ref|XP_010087435.1|  Leucine-rich repeat receptor-like serine/thr...    191   1e-51   Morus notabilis
ref|XP_010918071.1|  PREDICTED: leucine-rich repeat receptor-like...    191   1e-51   Elaeis guineensis
ref|XP_007214567.1|  hypothetical protein PRUPE_ppa000837mg             191   1e-51   Prunus persica
ref|XP_009600411.1|  PREDICTED: leucine-rich repeat receptor-like...    189   3e-51   Nicotiana tomentosiformis
ref|XP_010260843.1|  PREDICTED: leucine-rich repeat receptor-like...    189   3e-51   Nelumbo nucifera [Indian lotus]
gb|KHG23359.1|  Leucine-rich repeat receptor-like serine/threonin...    189   3e-51   Gossypium arboreum [tree cotton]
gb|KJB32927.1|  hypothetical protein B456_005G268400                    189   4e-51   Gossypium raimondii
ref|XP_004491265.1|  PREDICTED: leucine-rich repeat receptor-like...    189   5e-51   Cicer arietinum [garbanzo]
ref|XP_004229499.1|  PREDICTED: leucine-rich repeat receptor-like...    188   7e-51   Solanum lycopersicum
ref|XP_009763204.1|  PREDICTED: leucine-rich repeat receptor-like...    188   7e-51   Nicotiana sylvestris
emb|CDY54567.1|  BnaA08g30460D                                          186   1e-50   Brassica napus [oilseed rape]
ref|XP_004301907.1|  PREDICTED: leucine-rich repeat receptor-like...    188   1e-50   Fragaria vesca subsp. vesca
ref|XP_010924539.1|  PREDICTED: leucine-rich repeat receptor-like...    187   2e-50   Elaeis guineensis
ref|NP_001170600.1|  uncharacterized protein LOC100384637               175   2e-50   
ref|XP_009415746.1|  PREDICTED: leucine-rich repeat receptor-like...    187   3e-50   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX93999.1|  BnaC07g36330D                                          186   3e-50   
emb|CDX98665.1|  BnaA03g44500D                                          186   3e-50   
ref|XP_008225951.1|  PREDICTED: leucine-rich repeat receptor-like...    186   3e-50   Prunus mume [ume]
ref|XP_010094628.1|  Leucine-rich repeat receptor-like serine/thr...    186   3e-50   Morus notabilis
emb|CDY31445.1|  BnaC03g63790D                                          185   3e-50   Brassica napus [oilseed rape]
ref|XP_009108464.1|  PREDICTED: leucine-rich repeat receptor-like...    186   3e-50   Brassica rapa
gb|EPS62062.1|  protein kinase                                          186   4e-50   Genlisea aurea
ref|XP_006413888.1|  hypothetical protein EUTSA_v10024310mg             186   5e-50   Eutrema salsugineum [saltwater cress]
ref|XP_006356981.1|  PREDICTED: leucine-rich repeat receptor-like...    186   5e-50   Solanum tuberosum [potatoes]
ref|XP_002869943.1|  hypothetical protein ARALYDRAFT_492844             186   5e-50   
ref|XP_009137141.1|  PREDICTED: leucine-rich repeat receptor-like...    186   7e-50   Brassica rapa
ref|XP_010439602.1|  PREDICTED: leucine-rich repeat receptor-like...    186   7e-50   Camelina sativa [gold-of-pleasure]
ref|XP_009415217.1|  PREDICTED: leucine-rich repeat receptor-like...    186   7e-50   
ref|XP_010449207.1|  PREDICTED: leucine-rich repeat receptor-like...    186   7e-50   Camelina sativa [gold-of-pleasure]
ref|XP_002264952.1|  PREDICTED: leucine-rich repeat receptor-like...    186   7e-50   Vitis vinifera
gb|ACN59341.1|  leucine-rich repeat receptor-like protein kinase        185   7e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010529317.1|  PREDICTED: leucine-rich repeat receptor-like...    185   9e-50   Tarenaya hassleriana [spider flower]
ref|XP_006283067.1|  hypothetical protein CARUB_v10004060mg             185   9e-50   Capsella rubella
ref|NP_193760.1|  leucine-rich receptor-like protein kinase BAM3        185   9e-50   Arabidopsis thaliana [mouse-ear cress]
gb|KHN28525.1|  Leucine-rich repeat receptor-like serine/threonin...    184   1e-49   Glycine soja [wild soybean]
ref|XP_007146301.1|  hypothetical protein PHAVU_006G029000g             185   2e-49   Phaseolus vulgaris [French bean]
gb|KFK28659.1|  hypothetical protein AALP_AA7G028700                    184   2e-49   Arabis alpina [alpine rockcress]
ref|XP_003617299.1|  Receptor-like protein kinase                       184   3e-49   Medicago truncatula
ref|XP_006602289.1|  PREDICTED: leucine-rich repeat receptor-like...    184   3e-49   Glycine max [soybeans]
ref|XP_003530709.1|  PREDICTED: leucine-rich repeat receptor-like...    183   4e-49   Glycine max [soybeans]
ref|XP_004150938.1|  PREDICTED: leucine-rich repeat receptor-like...    183   5e-49   Cucumis sativus [cucumbers]
ref|XP_002532709.1|  Receptor protein kinase CLAVATA1 precursor, ...    183   7e-49   Ricinus communis
gb|KHM99687.1|  Leucine-rich repeat receptor-like serine/threonin...    180   1e-48   Glycine soja [wild soybean]
ref|XP_003545159.1|  PREDICTED: leucine-rich repeat receptor-like...    181   2e-48   Glycine max [soybeans]
ref|XP_004155230.1|  PREDICTED: leucine-rich repeat receptor-like...    181   2e-48   
ref|XP_009405747.1|  PREDICTED: leucine-rich repeat receptor-like...    181   2e-48   
gb|KHG13927.1|  Leucine-rich repeat receptor-like serine/threonin...    181   2e-48   Gossypium arboreum [tree cotton]
gb|KJB47871.1|  hypothetical protein B456_008G045400                    181   2e-48   Gossypium raimondii
gb|KHN12015.1|  Leucine-rich repeat receptor-like serine/threonin...    178   7e-48   Glycine soja [wild soybean]
gb|KHG24572.1|  Receptor protein kinase CLAVATA1                        180   8e-48   Gossypium arboreum [tree cotton]
ref|XP_004979026.1|  PREDICTED: leucine-rich repeat receptor-like...    180   1e-47   Setaria italica
gb|KJB29653.1|  hypothetical protein B456_005G112100                    179   2e-47   Gossypium raimondii
ref|XP_009133589.1|  PREDICTED: leucine-rich repeat receptor-like...    179   2e-47   Brassica rapa
gb|KEH33614.1|  LRR receptor-like kinase family protein                 179   2e-47   Medicago truncatula
tpg|DAA41870.1|  TPA: putative leucine-rich repeat receptor-like ...    179   3e-47   
ref|XP_006856744.1|  hypothetical protein AMTR_s00055p00012250          177   5e-47   
ref|XP_003518489.2|  PREDICTED: leucine-rich repeat receptor-like...    177   5e-47   
ref|XP_004499483.1|  PREDICTED: leucine-rich repeat receptor-like...    177   5e-47   Cicer arietinum [garbanzo]
ref|XP_009415213.1|  PREDICTED: leucine-rich repeat receptor-like...    177   7e-47   
ref|XP_008221401.1|  PREDICTED: receptor protein kinase CLAVATA1        176   8e-47   
emb|CBI19895.3|  unnamed protein product                                176   9e-47   Vitis vinifera
ref|XP_007225356.1|  hypothetical protein PRUPE_ppa000916mg             176   1e-46   
ref|XP_006300675.1|  hypothetical protein CARUB_v10019714mg             176   1e-46   
gb|KDP36903.1|  hypothetical protein JCGZ_08194                         176   1e-46   
gb|KJB58082.1|  hypothetical protein B456_009G193600                    176   1e-46   
ref|XP_011035001.1|  PREDICTED: receptor protein kinase CLAVATA1-...    176   1e-46   
gb|KHN38370.1|  Leucine-rich repeat receptor-like serine/threonin...    176   2e-46   
gb|KDO84901.1|  hypothetical protein CISIN_1g002010mg                   176   2e-46   
ref|XP_006435205.1|  hypothetical protein CICLE_v10000156mg             176   2e-46   
emb|CBI27382.3|  unnamed protein product                                172   2e-46   
ref|XP_010471715.1|  PREDICTED: receptor protein kinase CLAVATA1 ...    176   2e-46   
ref|XP_010416487.1|  PREDICTED: receptor protein kinase CLAVATA1-...    176   2e-46   
gb|AAX94895.1|  Similar to receptor-like protein kinase                 162   2e-46   
ref|XP_002279563.1|  PREDICTED: receptor protein kinase CLAVATA1        176   3e-46   
ref|XP_008452253.1|  PREDICTED: leucine-rich repeat receptor-like...    175   3e-46   
ref|XP_002307734.1|  receptor protein kinase                            175   4e-46   
emb|CDX87661.1|  BnaA07g32120D                                          175   4e-46   
emb|CDX73202.1|  BnaC06g36500D                                          175   5e-46   
gb|ADD64789.1|  CLAVATA1                                                175   5e-46   
ref|XP_009106236.1|  PREDICTED: receptor protein kinase CLAVATA1        175   5e-46   
ref|XP_004291349.1|  PREDICTED: receptor protein kinase CLAVATA1        174   5e-46   
pir||E96787  protein T4O12.5 [imported] - Arabidopsis thaliana          174   5e-46   
gb|AAB58929.1|  CLV1 receptor kinase                                    174   5e-46   
ref|NP_177710.1|  receptor protein kinase CLAVATA1                      174   5e-46   
ref|XP_008678021.1|  PREDICTED: leucine-rich repeat receptor-like...    175   5e-46   
ref|XP_007017845.1|  Leucine-rich receptor-like protein kinase fa...    174   9e-46   
ref|XP_006473681.1|  PREDICTED: receptor protein kinase CLAVATA1-...    173   1e-45   
emb|CDY62258.1|  BnaCnng39750D                                          172   2e-45   
ref|XP_002889046.1|  hypothetical protein ARALYDRAFT_476729             173   2e-45   
ref|XP_006390268.1|  hypothetical protein EUTSA_v10018069mg             173   2e-45   
ref|XP_008466473.1|  PREDICTED: receptor protein kinase CLAVATA1        173   2e-45   
ref|XP_004136488.1|  PREDICTED: receptor protein kinase CLAVATA1-...    173   2e-45   
gb|AAP49010.1|  CLV1-like receptor kinase                               173   2e-45   
ref|XP_010539846.1|  PREDICTED: receptor protein kinase CLAVATA1        172   4e-45   
ref|XP_008357152.1|  PREDICTED: receptor protein kinase CLAVATA1-...    171   4e-45   
ref|XP_002300697.2|  receptor protein kinase                            172   5e-45   
ref|XP_011045060.1|  PREDICTED: receptor protein kinase CLAVATA1-...    172   5e-45   
gb|KHG26020.1|  Receptor protein kinase CLAVATA1                        172   5e-45   
gb|AAD02501.1|  receptor kinase                                         172   6e-45   
ref|XP_010428620.1|  PREDICTED: receptor protein kinase CLAVATA1-...    172   6e-45   
ref|XP_006342066.1|  PREDICTED: receptor protein kinase CLAVATA1-...    171   8e-45   
ref|XP_008364929.1|  PREDICTED: receptor protein kinase CLAVATA1-...    171   9e-45   
ref|XP_002450588.1|  hypothetical protein SORBIDRAFT_05g007480          171   1e-44   
ref|XP_009334873.1|  PREDICTED: receptor protein kinase CLAVATA1        171   1e-44   
ref|XP_004238370.1|  PREDICTED: receptor protein kinase CLAVATA1        171   1e-44   
ref|XP_011074693.1|  PREDICTED: receptor protein kinase CLAVATA1-...    170   2e-44   
ref|XP_010536408.1|  PREDICTED: receptor protein kinase CLAVATA1-...    170   2e-44   
gb|EYU38789.1|  hypothetical protein MIMGU_mgv1a000850mg                170   2e-44   
ref|XP_002510557.1|  Receptor protein kinase CLAVATA1 precursor, ...    169   3e-44   
ref|XP_010671767.1|  PREDICTED: receptor protein kinase CLAVATA1        169   4e-44   
ref|XP_009592786.1|  PREDICTED: receptor protein kinase CLAVATA1        169   5e-44   
gb|AFY06667.1|  receptor protein kinase CLAVATA1                        169   5e-44   
ref|XP_010069807.1|  PREDICTED: receptor protein kinase CLAVATA1-...    169   6e-44   
ref|NP_001140626.1|  uncharacterized LOC100272700                       161   6e-44   
gb|EYU33270.1|  hypothetical protein MIMGU_mgv1a0010742mg               155   1e-43   
ref|XP_006655663.1|  PREDICTED: leucine-rich repeat receptor-like...    168   1e-43   
ref|XP_009766393.1|  PREDICTED: receptor protein kinase CLAVATA1        168   1e-43   
ref|XP_010110004.1|  Receptor protein kinase CLAVATA1                   167   2e-43   
gb|EEC79804.1|  hypothetical protein OsI_21242                          166   4e-43   
ref|XP_011083584.1|  PREDICTED: receptor protein kinase CLAVATA1        166   5e-43   
ref|NP_001174552.1|  Os05g0595950                                       166   5e-43   
ref|XP_008387933.1|  PREDICTED: receptor protein kinase CLAVATA1        166   9e-43   
ref|XP_010266811.1|  PREDICTED: receptor protein kinase CLAVATA1        165   1e-42   
gb|KCW58273.1|  hypothetical protein EUGRSUZ_H00964                     165   1e-42   
ref|XP_009415664.1|  PREDICTED: leucine-rich repeat receptor-like...    165   1e-42   
ref|XP_010026074.1|  PREDICTED: receptor protein kinase CLAVATA1        165   1e-42   
ref|XP_002441645.1|  hypothetical protein SORBIDRAFT_09g030870          165   2e-42   
gb|KFK42020.1|  hypothetical protein AALP_AA2G201900                    164   3e-42   
dbj|BAI82122.1|  CLV1-like LRR receptor kinase                          164   4e-42   
ref|XP_008647500.1|  PREDICTED: uncharacterized LOC100272700 isof...    162   1e-41   
ref|XP_008647502.1|  PREDICTED: uncharacterized LOC100272700 isof...    162   2e-41   
emb|CAD42335.1|  hypernodulation aberrant root formation protein        161   2e-41   
ref|XP_008808401.1|  PREDICTED: leucine-rich repeat receptor-like...    161   3e-41   
ref|XP_004507478.1|  PREDICTED: LOW QUALITY PROTEIN: receptor pro...    161   3e-41   
ref|XP_009418700.1|  PREDICTED: leucine-rich repeat receptor-like...    160   4e-41   
gb|EPS70741.1|  hypothetical protein M569_04011                         160   5e-41   
ref|XP_010935096.1|  PREDICTED: leucine-rich repeat receptor-like...    160   8e-41   
ref|XP_002965214.1|  hypothetical protein SELMODRAFT_83051              160   9e-41   
ref|XP_002962293.1|  hypothetical protein SELMODRAFT_77558              160   1e-40   
ref|XP_001752668.1|  CLL1B clavata1-like receptor S/T protein kin...    159   1e-40   
ref|XP_008645089.1|  PREDICTED: leucine-rich repeat receptor-like...    159   2e-40   
ref|NP_001058593.1|  Os06g0717200                                       159   2e-40   
emb|CAA61510.1|  leucine-rich repeat/receptor protein kinase            158   3e-40   
emb|CAD42181.1|  serine-threonine protein kinase                        157   7e-40   
gb|EAZ02372.1|  hypothetical protein OsI_24476                          157   8e-40   
dbj|BAC41332.1|  LRR receptor-like kinase                               157   8e-40   
ref|NP_001238004.1|  receptor protein kinase-like protein precursor     157   8e-40   
gb|EMT07441.1|  Receptor protein kinase CLAVATA1                        154   9e-40   
ref|XP_004960969.1|  PREDICTED: leucine-rich repeat receptor-like...    157   1e-39   
gb|EMS49990.1|  Leucine-rich repeat receptor-like serine/threonin...    150   1e-39   
gb|ABE79572.2|  Protein kinase                                          156   1e-39   
gb|KHN25406.1|  Receptor protein kinase CLAVATA1                        156   1e-39   
gb|AAW71475.1|  CLV1-like receptor kinase                               156   2e-39   
ref|XP_010246813.1|  PREDICTED: receptor protein kinase CLAVATA1-...    155   2e-39   
ref|XP_003606988.1|  Receptor protein kinase CLAVATA1                   155   2e-39   
ref|XP_002971751.1|  hypothetical protein SELMODRAFT_172284             155   3e-39   
ref|XP_002991545.1|  hypothetical protein SELMODRAFT_186143             155   3e-39   
ref|XP_006656496.1|  PREDICTED: leucine-rich repeat receptor-like...    155   3e-39   
gb|KHN39812.1|  Receptor protein kinase CLAVATA1                        154   3e-39   
ref|NP_001238576.1|  receptor protein kinase-like protein precursor     155   4e-39   
ref|XP_008808621.1|  PREDICTED: leucine-rich repeat receptor-like...    154   7e-39   
ref|XP_003560328.2|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    154   9e-39   
ref|XP_007131793.1|  hypothetical protein PHAVU_011G042000g             154   9e-39   
ref|XP_002439033.1|  hypothetical protein SORBIDRAFT_10g030270          154   2e-38   
gb|EYU36796.1|  hypothetical protein MIMGU_mgv1a020841mg                153   2e-38   
ref|XP_010941307.1|  PREDICTED: leucine-rich repeat receptor-like...    150   6e-38   
ref|XP_006853709.1|  hypothetical protein AMTR_s00056p00150470          151   6e-38   
dbj|BAJ98758.1|  predicted protein                                      151   1e-37   
ref|XP_008781646.1|  PREDICTED: probable LRR receptor-like serine...    141   2e-37   
gb|AIT55304.1|  nodulation autoregulation receptor kinase               150   3e-37   
ref|XP_004966471.1|  PREDICTED: leucine-rich repeat receptor-like...    149   6e-37   
ref|XP_002985227.1|  hypothetical protein SELMODRAFT_121783             147   2e-36   
ref|XP_002970036.1|  hypothetical protein SELMODRAFT_146738             147   2e-36   
ref|XP_001754727.1|  CLL1A clavata1-like receptor S/T protein kin...    145   9e-36   
gb|KHN07526.1|  Leucine-rich repeat receptor-like serine/threonin...    131   6e-35   
ref|XP_008440463.1|  PREDICTED: leucine-rich repeat receptor-like...    140   8e-34   
ref|XP_004160944.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    139   2e-33   
ref|XP_004143533.1|  PREDICTED: leucine-rich repeat receptor-like...    139   2e-33   
ref|XP_008233100.1|  PREDICTED: receptor protein kinase CLAVATA1-...    139   2e-33   
gb|KCW58271.1|  hypothetical protein EUGRSUZ_H00963                     137   7e-33   
ref|XP_004986996.1|  PREDICTED: leucine-rich repeat receptor-like...    137   8e-33   
ref|XP_002966807.1|  hypothetical protein SELMODRAFT_168561             137   1e-32   
ref|XP_002961203.1|  hypothetical protein SELMODRAFT_164315             137   1e-32   
gb|AGP76288.1|  floral organ number 1                                   126   1e-32   
gb|AGP76279.1|  floral organ number 1                                   125   2e-32   
gb|AGP76284.1|  floral organ number 1                                   125   3e-32   
gb|AGP76283.1|  floral organ number 1                                   125   3e-32   
ref|XP_007213482.1|  hypothetical protein PRUPE_ppa023389mg             135   4e-32   
gb|KJB51410.1|  hypothetical protein B456_008G215400                    133   2e-31   
gb|KJB51409.1|  hypothetical protein B456_008G215400                    133   2e-31   
ref|XP_009374467.1|  PREDICTED: leucine-rich repeat receptor-like...    133   2e-31   
ref|XP_002510975.1|  Receptor protein kinase CLAVATA1 precursor, ...    132   3e-31   
ref|XP_002303493.2|  hypothetical protein POPTR_0003s10680g             132   3e-31   
ref|XP_007038347.1|  Leucine-rich repeat protein kinase family pr...    132   3e-31   
ref|XP_006837283.1|  hypothetical protein AMTR_s00111p00013770          132   4e-31   
ref|XP_009340605.1|  PREDICTED: leucine-rich repeat receptor-like...    132   4e-31   
ref|XP_004240244.1|  PREDICTED: leucine-rich repeat receptor-like...    132   4e-31   
ref|XP_011018348.1|  PREDICTED: leucine-rich repeat receptor-like...    132   6e-31   
ref|XP_004166710.1|  PREDICTED: leucine-rich repeat receptor-like...    131   7e-31   
ref|XP_004146946.1|  PREDICTED: leucine-rich repeat receptor-like...    131   7e-31   
gb|KHF97318.1|  Leucine-rich repeat receptor-like protein kinase TDR    131   7e-31   
ref|XP_010941444.1|  PREDICTED: leucine-rich repeat receptor-like...    130   1e-30   
ref|XP_006490143.1|  PREDICTED: leucine-rich repeat receptor-like...    131   1e-30   
ref|XP_011027952.1|  PREDICTED: leucine-rich repeat receptor-like...    130   1e-30   
gb|KJB07870.1|  hypothetical protein B456_001G049500                    130   1e-30   
ref|XP_008375993.1|  PREDICTED: leucine-rich repeat receptor-like...    130   1e-30   
ref|XP_006355615.1|  PREDICTED: leucine-rich repeat receptor-like...    130   1e-30   
ref|XP_008376399.1|  PREDICTED: leucine-rich repeat receptor-like...    130   1e-30   
gb|KDP22440.1|  hypothetical protein JCGZ_26271                         130   2e-30   
ref|XP_008453906.1|  PREDICTED: leucine-rich repeat receptor-like...    130   2e-30   
ref|XP_009372861.1|  PREDICTED: leucine-rich repeat receptor-like...    130   2e-30   
ref|XP_010264363.1|  PREDICTED: leucine-rich repeat receptor-like...    130   2e-30   
ref|XP_009333803.1|  PREDICTED: receptor protein kinase CLAVATA1-...    130   2e-30   
ref|XP_009370509.1|  PREDICTED: leucine-rich repeat receptor-like...    130   2e-30   
ref|XP_006368235.1|  hypothetical protein POPTR_0001s00820g             130   2e-30   
ref|XP_008234497.1|  PREDICTED: leucine-rich repeat receptor-like...    129   3e-30   
ref|XP_006421630.1|  hypothetical protein CICLE_v10004254mg             129   3e-30   
emb|CBI38662.3|  unnamed protein product                                129   3e-30   
ref|XP_001754607.1|  CLL2 clavata1-like receptor S/T protein kina...    129   3e-30   
ref|XP_007220284.1|  hypothetical protein PRUPE_ppa000681mg             129   4e-30   
ref|XP_008347571.1|  PREDICTED: receptor protein kinase CLAVATA1-...    129   4e-30   
ref|XP_002993327.1|  hypothetical protein SELMODRAFT_187390             129   4e-30   
ref|XP_010943231.1|  PREDICTED: receptor-like protein kinase HAIKU2     129   5e-30   
ref|XP_002268598.2|  PREDICTED: leucine-rich repeat receptor-like...    129   5e-30   
ref|XP_006587703.1|  PREDICTED: leucine-rich repeat receptor-like...    129   6e-30   
gb|KHN15622.1|  Leucine-rich repeat receptor-like serine/threonin...    118   7e-30   
ref|XP_003539668.1|  PREDICTED: leucine-rich repeat receptor-like...    128   1e-29   
ref|XP_010035036.1|  PREDICTED: leucine-rich repeat receptor-like...    128   1e-29   
ref|XP_010258856.1|  PREDICTED: leucine-rich repeat receptor-like...    128   1e-29   
ref|XP_010258857.1|  PREDICTED: leucine-rich repeat receptor-like...    128   1e-29   
ref|XP_010062386.1|  PREDICTED: leucine-rich repeat receptor-like...    128   1e-29   
ref|XP_006852580.1|  hypothetical protein AMTR_s00021p00211960          127   1e-29   
ref|XP_007050157.1|  Leucine-rich repeat receptor-like protein ki...    128   2e-29   
gb|ABF73316.1|  clavata-like receptor                                   127   2e-29   
ref|XP_010536545.1|  PREDICTED: leucine-rich repeat receptor-like...    127   2e-29   
ref|XP_009788025.1|  PREDICTED: leucine-rich repeat receptor-like...    127   3e-29   
gb|KJB60035.1|  hypothetical protein B456_009G286600                    127   3e-29   
ref|XP_002970031.1|  hypothetical protein SELMODRAFT_171048             127   3e-29   
ref|XP_009335176.1|  PREDICTED: probable LRR receptor-like serine...    126   4e-29   
ref|XP_007200794.1|  hypothetical protein PRUPE_ppa024591mg             126   4e-29   
ref|XP_004307799.1|  PREDICTED: leucine-rich repeat receptor-like...    126   4e-29   
ref|XP_008237456.1|  PREDICTED: probable LRR receptor-like serine...    126   4e-29   
gb|KDP24078.1|  hypothetical protein JCGZ_25735                         126   4e-29   
ref|XP_009627806.1|  PREDICTED: probable LRR receptor-like serine...    126   5e-29   
ref|XP_008381896.1|  PREDICTED: probable LRR receptor-like serine...    126   5e-29   
ref|XP_006358242.1|  PREDICTED: leucine-rich repeat receptor-like...    126   5e-29   
ref|XP_009342709.1|  PREDICTED: probable LRR receptor-like serine...    126   5e-29   
ref|XP_009611681.1|  PREDICTED: leucine-rich repeat receptor-like...    126   5e-29   
ref|XP_009768910.1|  PREDICTED: leucine-rich repeat receptor-like...    126   5e-29   
gb|KCW85317.1|  hypothetical protein EUGRSUZ_B02157                     125   6e-29   
gb|KHN09963.1|  Receptor-like protein kinase HSL1                       125   6e-29   
ref|XP_004235172.1|  PREDICTED: leucine-rich repeat receptor-like...    125   6e-29   
ref|NP_001239710.1|  receptor-like protein kinase HSL1-like             125   7e-29   
ref|XP_004505098.1|  PREDICTED: receptor-like protein kinase HSL1...    125   7e-29   
gb|KDP23736.1|  hypothetical protein JCGZ_23569                         125   8e-29   
ref|XP_011076386.1|  PREDICTED: leucine-rich repeat receptor-like...    125   8e-29   
emb|CDP05348.1|  unnamed protein product                                125   8e-29   
ref|XP_009333802.1|  PREDICTED: receptor protein kinase CLAVATA1-...    125   9e-29   
ref|XP_010046357.1|  PREDICTED: leucine-rich repeat receptor-like...    125   9e-29   
gb|KJB29385.1|  hypothetical protein B456_005G097600                    125   9e-29   
ref|XP_003528467.1|  PREDICTED: receptor-like protein kinase HSL1...    125   1e-28   
gb|KHN15495.1|  Receptor-like protein kinase HSL1                       125   1e-28   
ref|XP_001776887.1|  CLL6 clavata1-like receptor S/T protein kina...    125   1e-28   
gb|KCW69145.1|  hypothetical protein EUGRSUZ_F02681                     124   1e-28   
gb|KEH42461.1|  LRR receptor-like kinase family protein                 125   1e-28   
ref|XP_004253264.1|  PREDICTED: probable LRR receptor-like serine...    125   1e-28   
ref|XP_002993050.1|  hypothetical protein SELMODRAFT_136413             125   1e-28   
ref|XP_006383645.1|  leucine-rich repeat transmembrane protein ki...    125   1e-28   
emb|CDY28391.1|  BnaA05g18490D                                          125   1e-28   
ref|XP_011042912.1|  PREDICTED: probable LRR receptor-like serine...    125   1e-28   
ref|XP_010553768.1|  PREDICTED: leucine-rich repeat receptor-like...    125   1e-28   
ref|XP_007159371.1|  hypothetical protein PHAVU_002G232600g             125   1e-28   
ref|XP_011026324.1|  PREDICTED: probable LRR receptor-like serine...    124   2e-28   
ref|XP_004495057.1|  PREDICTED: leucine-rich repeat receptor-like...    124   2e-28   
ref|XP_002302156.2|  hypothetical protein POPTR_0002s06380g             124   2e-28   
ref|XP_009606121.1|  PREDICTED: probable LRR receptor-like serine...    124   2e-28   
ref|XP_009145155.1|  PREDICTED: probable LRR receptor-like serine...    124   2e-28   
ref|XP_008377848.1|  PREDICTED: receptor protein kinase CLAVATA1-...    124   2e-28   
ref|XP_011044836.1|  PREDICTED: probable LRR receptor-like serine...    124   2e-28   
ref|XP_010550315.1|  PREDICTED: leucine-rich repeat receptor-like...    124   2e-28   
ref|XP_010062076.1|  PREDICTED: probable LRR receptor-like serine...    124   2e-28   
ref|XP_009613205.1|  PREDICTED: leucine-rich repeat receptor-like...    124   2e-28   



>ref|XP_006364007.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Solanum tuberosum]
Length=1022

 Score =   253 bits (646),  Expect = 6e-74, Method: Composition-based stats.
 Identities = 128/156 (82%), Positives = 134/156 (86%), Gaps = 8/156 (5%)
 Frame = -2

Query  718   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
             ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR
Sbjct  852   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  911

Query  538   KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
             +MTDGKKEGV+KILD RLSTVP+HE MH+FYVA+LCVEEQAVERPKMREVVQMLTELPK 
Sbjct  912   RMTDGKKEGVLKILDPRLSTVPLHEVMHVFYVAMLCVEEQAVERPKMREVVQMLTELPK-  970

Query  358   PPGTKPEGTTACES-----SALEPPPSTGTSDDAKD  266
             P G K E +T  ES      ALE P  T T  D KD
Sbjct  971   PSGPKTEDSTITESPPSSGPALESP--TSTPGDTKD  1004



>ref|XP_004234641.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Solanum lycopersicum]
Length=1022

 Score =   252 bits (644),  Expect = 1e-73, Method: Composition-based stats.
 Identities = 120/149 (81%), Positives = 133/149 (89%), Gaps = 6/149 (4%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR
Sbjct  852  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  911

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            +MTDGKKEGV+KILD+RLSTVP+HE MH+FYVA+LCVEEQAVERPKMREVVQMLTELP  
Sbjct  912  RMTDGKKEGVLKILDARLSTVPLHEVMHVFYVAMLCVEEQAVERPKMREVVQMLTELP--  969

Query  358  PPGTKPEGTTACESSALEPPPSTGTSDDA  272
                KP G  + +S+  E PPS+G + ++
Sbjct  970  ----KPSGPKSGDSTITESPPSSGPASES  994



>ref|XP_009786199.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nicotiana sylvestris]
Length=1015

 Score =   249 bits (636),  Expect = 1e-72, Method: Composition-based stats.
 Identities = 128/173 (74%), Positives = 139/173 (80%), Gaps = 17/173 (10%)
 Frame = -2

Query  718   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
             ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG+KPVGEFGDGVDIVQWVR
Sbjct  849   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGRKPVGEFGDGVDIVQWVR  908

Query  538   KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
             KMT+GKKEGV+KILD RLSTVP+HE MH+FYVA+LCVEEQAVERPKMREVVQ+LTELP  
Sbjct  909   KMTEGKKEGVLKILDPRLSTVPLHEVMHVFYVAMLCVEEQAVERPKMREVVQILTELP--  966

Query  358   PPGTKPEGTTACESSALEPPPST-----------GTSDDAKDqqqppPDLLSI  233
                  P GT + ES+  E PPS+           G + D      PPPDLLSI
Sbjct  967   ----NPSGTKSGESTITESPPSSAPASELPTSAPGNTKDNHQPPSPPPDLLSI  1015



>ref|XP_009605676.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nicotiana tomentosiformis]
Length=1017

 Score =   248 bits (632),  Expect = 5e-72, Method: Composition-based stats.
 Identities = 134/172 (78%), Positives = 143/172 (83%), Gaps = 13/172 (8%)
 Frame = -2

Query  718   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
             ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR
Sbjct  849   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  908

Query  538   KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
             KMTDGKK+GV+KILD RLSTVP++E MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK 
Sbjct  909   KMTDGKKDGVLKILDPRLSTVPLNEVMHVFYVAMLCVEEQAVERPTMREVVQILTELPK-  967

Query  358   PPGTKPEGTTACES-----SALEPPPSTGTSDDAKD-----qqqppPDLLSI  233
             PPG+K   +T  ES     SALE P  T    D KD      Q PPPDLLSI
Sbjct  968   PPGSKSGDSTVTESPSPSASALESP--TSAPGDTKDHHQPTPQSPPPDLLSI  1017



>dbj|BAK52390.1| leucine rich repeat receptor protein kinase CLAVATA1 [Solanum 
peruvianum]
Length=1015

 Score =   246 bits (629),  Expect = 1e-71, Method: Composition-based stats.
 Identities = 133/172 (77%), Positives = 143/172 (83%), Gaps = 13/172 (8%)
 Frame = -2

Query  718   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
             ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR
Sbjct  847   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  906

Query  538   KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
             KMTDGKK+GV+KILD RLSTVP++E MH+FYVALLCVEEQAVERP MREVVQ+LTELPK 
Sbjct  907   KMTDGKKDGVLKILDPRLSTVPLNEVMHVFYVALLCVEEQAVERPTMREVVQILTELPK-  965

Query  358   PPGTKPEGTTACE-----SSALEPPPSTGTSDDAKD-----qqqppPDLLSI  233
             PPG K + +T  +     +SALE P  T    D KD      Q PPPDLLSI
Sbjct  966   PPGAKSDDSTGTDHSPPSASALESP--TSIPGDTKDHHQPTPQSPPPDLLSI  1015



>ref|XP_009771232.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nicotiana sylvestris]
Length=1019

 Score =   246 bits (629),  Expect = 1e-71, Method: Composition-based stats.
 Identities = 129/171 (75%), Positives = 142/171 (83%), Gaps = 10/171 (6%)
 Frame = -2

Query  718   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
             ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR
Sbjct  850   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  909

Query  538   KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
             KMTDGKK+GV+KILD RLSTVP++E MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK 
Sbjct  910   KMTDGKKDGVLKILDPRLSTVPLNEVMHVFYVAMLCVEEQAVERPTMREVVQILTELPK-  968

Query  358   PPGTKPEGTTACE------SSALEPPPS-TGTSDDAKDqqqpp--PDLLSI  233
             PPG+K   +T  E      +SALE P S +G ++D          PDLLSI
Sbjct  969   PPGSKSGDSTVTELPPPSVASALESPASASGDTNDHHQPTPQSPPPDLLSI  1019



>gb|KHN13035.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Glycine soja]
Length=724

 Score =   243 bits (621),  Expect = 1e-71, Method: Composition-based stats.
 Identities = 126/167 (75%), Positives = 140/167 (84%), Gaps = 7/167 (4%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+KPVGEFGDGVDIVQWVR
Sbjct  560  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRKPVGEFGDGVDIVQWVR  619

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            KMTD  KEGV+K+LD RL +VP+HE MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK 
Sbjct  620  KMTDSNKEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQILTELPK-  678

Query  358  PPGTKPEGTTACESS-----ALEPPPSTGTSDDAKDqqqppPDLLSI  233
            PPG+K    T  ESS     ALE  PS+ + +D    Q PPPDLLSI
Sbjct  679  PPGSKEGDLTITESSLSSSNALE-SPSSASKEDQNPPQSPPPDLLSI  724



>dbj|BAK52389.1| leucine rich repeat receptor protein kinase CLAVATA1 [Solanum 
pennellii]
Length=1016

 Score =   246 bits (628),  Expect = 1e-71, Method: Composition-based stats.
 Identities = 133/172 (77%), Positives = 143/172 (83%), Gaps = 13/172 (8%)
 Frame = -2

Query  718   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
             ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR
Sbjct  848   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  907

Query  538   KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
             KMTDGKK+GV+KILD RLSTVP++E MH+FYVALLCVEEQAVERP MREVVQ+LTELPK 
Sbjct  908   KMTDGKKDGVLKILDPRLSTVPLNEVMHVFYVALLCVEEQAVERPTMREVVQILTELPK-  966

Query  358   PPGTKPEGTTACE-----SSALEPPPSTGTSDDAKD-----qqqppPDLLSI  233
             PPG K + +T  +     +SALE P  T    D KD      Q PPPDLLSI
Sbjct  967   PPGAKSDDSTVTDQSPPSASALESP--TSIPGDTKDHHQPTPQSPPPDLLSI  1016



>ref|NP_001274713.1| leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1-like precursor [Solanum lycopersicum]
 dbj|BAK52388.1| leucine rich repeat receptor protein kinase CLAVATA1 [Solanum 
lycopersicum]
 dbj|BAK52391.1| leucine rich repeat receptor protein kinase CLAVATA1 [Solanum 
lycopersicum]
Length=1016

 Score =   246 bits (628),  Expect = 2e-71, Method: Composition-based stats.
 Identities = 133/172 (77%), Positives = 143/172 (83%), Gaps = 13/172 (8%)
 Frame = -2

Query  718   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
             ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR
Sbjct  848   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  907

Query  538   KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
             KMTDGKK+GV+KILD RLSTVP++E MH+FYVALLCVEEQAVERP MREVVQ+LTELPK 
Sbjct  908   KMTDGKKDGVLKILDPRLSTVPLNEVMHVFYVALLCVEEQAVERPTMREVVQILTELPK-  966

Query  358   PPGTKPEGTTACE-----SSALEPPPSTGTSDDAKD-----qqqppPDLLSI  233
             PPG K + +T  +     +SALE P  T    D KD      Q PPPDLLSI
Sbjct  967   PPGAKSDDSTVTDQSPPSASALESP--TSIPGDTKDHHQPTPQSPPPDLLSI  1016



>ref|XP_010547579.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Tarenaya hassleriana]
Length=1015

 Score =   245 bits (625),  Expect = 4e-71, Method: Composition-based stats.
 Identities = 120/162 (74%), Positives = 134/162 (83%), Gaps = 1/162 (1%)
 Frame = -2

Query  718   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
             ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+KPVGEFGDGVDIVQWVR
Sbjct  855   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRKPVGEFGDGVDIVQWVR  914

Query  538   KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
             KMTD  KE VVK++D RLS+VPI E  H+FYVA+LCVEEQAVERP MREVVQ+L E+PK 
Sbjct  915   KMTDSNKESVVKVIDPRLSSVPIQEVTHVFYVAMLCVEEQAVERPTMREVVQILAEIPKM  974

Query  358   PPGTKPEGTTACESSALEPPPSTGTSDDAKDqqqppPDLLSI  233
             PP +KP+ T   +S A E  P  G  DD  D  + PPDLLSI
Sbjct  975   PP-SKPDPTAGEKSPAHESSPKGGRGDDGNDPGRVPPDLLSI  1015



>gb|KHN42601.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Glycine soja]
Length=724

 Score =   241 bits (615),  Expect = 8e-71, Method: Composition-based stats.
 Identities = 125/167 (75%), Positives = 139/167 (83%), Gaps = 7/167 (4%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+KPVGEFGDGVDIVQWVR
Sbjct  560  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRKPVGEFGDGVDIVQWVR  619

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            KMTD  KEGV+K+LD RL +VP+HE MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK 
Sbjct  620  KMTDSNKEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQILTELPK-  678

Query  358  PPGTKPEGTTACESS-----ALEPPPSTGTSDDAKDqqqppPDLLSI  233
            PP +K    T  ESS     ALE  PS+ + +D    Q PPPDLLSI
Sbjct  679  PPDSKEGNLTITESSLSSSNALE-SPSSASKEDQNPPQSPPPDLLSI  724



>ref|NP_001237715.1| receptor-like protein kinase 2 precursor [Glycine max]
 gb|AAF91323.1|AF244889_1 receptor-like protein kinase 2 [Glycine max]
Length=1012

 Score =   243 bits (621),  Expect = 1e-70, Method: Composition-based stats.
 Identities = 126/167 (75%), Positives = 140/167 (84%), Gaps = 7/167 (4%)
 Frame = -2

Query  718   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
             ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+KPVGEFGDGVDIVQWVR
Sbjct  848   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRKPVGEFGDGVDIVQWVR  907

Query  538   KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
             KMTD  KEGV+K+LD RL +VP+HE MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK 
Sbjct  908   KMTDSNKEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQILTELPK-  966

Query  358   PPGTKPEGTTACESS-----ALEPPPSTGTSDDAKDqqqppPDLLSI  233
             PPG+K    T  ESS     ALE  PS+ + +D    Q PPPDLLSI
Sbjct  967   PPGSKEGDLTITESSLSSSNALE-SPSSASKEDQNPPQSPPPDLLSI  1012



>ref|XP_010105101.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Morus notabilis]
 gb|EXC03886.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Morus notabilis]
Length=1021

 Score =   243 bits (620),  Expect = 2e-70, Method: Composition-based stats.
 Identities = 120/145 (83%), Positives = 128/145 (88%), Gaps = 5/145 (3%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG+KPVGEFGDGVDIVQWVR
Sbjct  851  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGRKPVGEFGDGVDIVQWVR  910

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            KMTD  KEGV+KILD RL +VPIHE MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK 
Sbjct  911  KMTDSNKEGVLKILDPRLPSVPIHEVMHVFYVAMLCVEEQAVERPTMREVVQILTELPK-  969

Query  358  PPGTKP-EGTTACESSALEPPPSTG  287
            PPG+K  + TT  ESS   PPP  G
Sbjct  970  PPGSKQGDSTTITESS---PPPVGG  991



>ref|XP_006357743.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Solanum tuberosum]
Length=1017

 Score =   243 bits (620),  Expect = 2e-70, Method: Composition-based stats.
 Identities = 119/142 (84%), Positives = 128/142 (90%), Gaps = 4/142 (3%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR
Sbjct  848  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  907

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            KMTDGKK+GV+KILD RLSTVP++E MH+FYVALLCVEEQAVERP MREVVQ+LTELPK 
Sbjct  908  KMTDGKKDGVLKILDPRLSTVPLNEVMHVFYVALLCVEEQAVERPTMREVVQILTELPKS  967

Query  358  PPGTKPEGTTACESSALEPPPS  293
             PG K + +T  + S   PPPS
Sbjct  968  -PGAKSDDSTVTDQS---PPPS  985



>ref|XP_010518800.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Tarenaya hassleriana]
Length=1011

 Score =   243 bits (619),  Expect = 3e-70, Method: Composition-based stats.
 Identities = 119/162 (73%), Positives = 134/162 (83%), Gaps = 1/162 (1%)
 Frame = -2

Query  718   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
             ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVV+LEL++G+KPVGEFGDGVDIVQWVR
Sbjct  851   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVILELITGRKPVGEFGDGVDIVQWVR  910

Query  538   KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
             KMTD  KE VVK+LD RLS+VPI+E MH+FYVA+LCVEE AVERP MREVVQ+LTE+PK 
Sbjct  911   KMTDSNKESVVKVLDPRLSSVPINEVMHVFYVAMLCVEELAVERPTMREVVQILTEIPKM  970

Query  358   PPGTKPEGTTACESSALEPPPSTGTSDDAKDqqqppPDLLSI  233
              P  KPE   A +S A +  P  G+  D  D  + PPDLLSI
Sbjct  971   RP-PKPEPNAAEDSPAYQSSPMAGSGKDGNDVSRDPPDLLSI  1011



>ref|XP_009354585.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Pyrus x bretschneideri]
Length=1014

 Score =   243 bits (619),  Expect = 3e-70, Method: Composition-based stats.
 Identities = 129/172 (75%), Positives = 138/172 (80%), Gaps = 13/172 (8%)
 Frame = -2

Query  718   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
             ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG+KPVGEFGDGVDIVQWVR
Sbjct  846   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGRKPVGEFGDGVDIVQWVR  905

Query  538   KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
             KMTD  KEGV+KILD RL +VP+HE MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK 
Sbjct  906   KMTDSNKEGVLKILDPRLPSVPLHEVMHLFYVAMLCVEEQAVERPTMREVVQILTELPKG  965

Query  358   PPGTKPEGTTACESSALEPPPST-------GTSDDAKD---qqqppPDLLSI  233
             P     E +   ESS   PPP+T        TS D KD    Q PPPDLLSI
Sbjct  966   PGSKLVEESAITESS---PPPATTASESQGTTSKDMKDQPPPQSPPPDLLSI  1014



>ref|XP_009375880.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Pyrus x bretschneideri]
Length=1015

 Score =   242 bits (618),  Expect = 3e-70, Method: Composition-based stats.
 Identities = 129/172 (75%), Positives = 138/172 (80%), Gaps = 13/172 (8%)
 Frame = -2

Query  718   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
             ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG+KPVGEFGDGVDIVQWVR
Sbjct  847   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGRKPVGEFGDGVDIVQWVR  906

Query  538   KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
             KMTD  KEGV+KILD RL +VP+HE MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK 
Sbjct  907   KMTDSNKEGVLKILDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQILTELPKA  966

Query  358   PPGTKPEGTTACESSALEPPPST-------GTSDDAKDq---qqppPDLLSI  233
             P     E +   ESS   PPP+T        TS D KDQ   Q P PDLLSI
Sbjct  967   PGSKLVEDSAITESS---PPPATTASESPGTTSKDTKDQPPLQSPQPDLLSI  1015



>ref|XP_008344369.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat receptor-like 
serine/threonine-protein kinase BAM1 [Malus domestica]
Length=1015

 Score =   242 bits (618),  Expect = 4e-70, Method: Composition-based stats.
 Identities = 130/172 (76%), Positives = 139/172 (81%), Gaps = 13/172 (8%)
 Frame = -2

Query  718   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
             ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG+KPVGEFGDGVDIVQWVR
Sbjct  847   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGRKPVGEFGDGVDIVQWVR  906

Query  538   KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
             KMTD  KEGV+KILD RL +VP+HE MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK 
Sbjct  907   KMTDSNKEGVLKILDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQILTELPKA  966

Query  358   PPGTKPEGTTACESSALEPPPST-------GTSDDAKDq---qqppPDLLSI  233
             P     E +   ESS   PPP+T        TS D KDQ   Q PPPDLLSI
Sbjct  967   PGSKLVEDSAITESS---PPPATTASESPGTTSKDTKDQPPLQSPPPDLLSI  1015



>ref|XP_008354741.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Malus domestica]
Length=1015

 Score =   242 bits (618),  Expect = 4e-70, Method: Composition-based stats.
 Identities = 130/172 (76%), Positives = 139/172 (81%), Gaps = 13/172 (8%)
 Frame = -2

Query  718   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
             ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG+KPVGEFGDGVDIVQWVR
Sbjct  847   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGRKPVGEFGDGVDIVQWVR  906

Query  538   KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
             KMTD  KEGV+KILD RL +VP+HE MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK 
Sbjct  907   KMTDSNKEGVLKILDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQILTELPKA  966

Query  358   PPGTKPEGTTACESSALEPPPST-------GTSDDAKDq---qqppPDLLSI  233
             P     E +   ESS   PPP+T        TS D KDQ   Q PPPDLLSI
Sbjct  967   PGSKLVEDSAITESS---PPPATTASESPGTTSKDTKDQPPLQSPPPDLLSI  1015



>ref|XP_008393812.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Malus domestica]
Length=1014

 Score =   242 bits (617),  Expect = 5e-70, Method: Composition-based stats.
 Identities = 127/172 (74%), Positives = 136/172 (79%), Gaps = 13/172 (8%)
 Frame = -2

Query  718   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
             ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG+KPVGEFGDGVDIVQWVR
Sbjct  846   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGRKPVGEFGDGVDIVQWVR  905

Query  538   KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
             KMTD  KEGV+KILD RL +VP+HE MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK 
Sbjct  906   KMTDSNKEGVLKILDPRLXSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQILTELPKG  965

Query  358   PPGTKPEGTTACESSALEPPPSTG-------TSDDAKDqqqppP---DLLSI  233
             P     E +   ESS   PPP+T        TS D KDQ  P     DLLSI
Sbjct  966   PGSKLVEESAITESS---PPPATXASESPGTTSKDTKDQPPPQSLPPDLLSI  1014



>ref|NP_001235080.1| receptor-like protein kinase 3 precursor [Glycine max]
 gb|AAF91324.1|AF244890_1 receptor-like protein kinase 3 [Glycine max]
Length=1012

 Score =   241 bits (615),  Expect = 9e-70, Method: Composition-based stats.
 Identities = 125/167 (75%), Positives = 139/167 (83%), Gaps = 7/167 (4%)
 Frame = -2

Query  718   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
             ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+KPVGEFGDGVDIVQWVR
Sbjct  848   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRKPVGEFGDGVDIVQWVR  907

Query  538   KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
             KMTD  KEGV+K+LD RL +VP+HE MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK 
Sbjct  908   KMTDSNKEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQILTELPK-  966

Query  358   PPGTKPEGTTACESS-----ALEPPPSTGTSDDAKDqqqppPDLLSI  233
             PP +K    T  ESS     ALE  PS+ + +D    Q PPPDLLSI
Sbjct  967   PPDSKEGNLTITESSLSSSNALE-SPSSASKEDQNPPQSPPPDLLSI  1012



>gb|KHG04200.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Gossypium arboreum]
Length=1014

 Score =   241 bits (615),  Expect = 1e-69, Method: Composition-based stats.
 Identities = 118/164 (72%), Positives = 130/164 (79%), Gaps = 4/164 (2%)
 Frame = -2

Query  718   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
             ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV G+KPVGEFGDGVDIVQWVR
Sbjct  853   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVCGRKPVGEFGDGVDIVQWVR  912

Query  538   KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
             KMTD  KEGV+K+LD RL +VP+HE MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK 
Sbjct  913   KMTDSNKEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQILTELPKP  972

Query  358   PPGTKPEGTTACESSALEPPPSTGTSDDAKDqqqppP--DLLSI  233
             P    P     C  + L+PP +T T D  +         DLLSI
Sbjct  973   PNSESPTSPAPC--TTLDPPTTTITKDQQQPPAPKSTPPDLLSI  1014



>ref|XP_011099433.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Sesamum indicum]
Length=1008

 Score =   241 bits (614),  Expect = 1e-69, Method: Composition-based stats.
 Identities = 123/162 (76%), Positives = 136/162 (84%), Gaps = 2/162 (1%)
 Frame = -2

Query  718   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
             ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGVDIVQWVR
Sbjct  849   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGVDIVQWVR  908

Query  538   KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
             KMTDG KEGV+K+LD RL TVP+HE MH+FYVA+LCVEEQAVERP MREV+Q+LTELPK 
Sbjct  909   KMTDGNKEGVLKVLDPRLPTVPLHEVMHVFYVAMLCVEEQAVERPTMREVIQILTELPK-  967

Query  358   PPGTKPEGTTACESSALEPPPSTGTSDDAKDqqqppPDLLSI  233
             P   KP  +T  +SS   P   T T  + +  Q PPPDLLSI
Sbjct  968   PTAAKPGDSTITDSSVDSPATETKTH-NRQASQSPPPDLLSI  1008



>ref|XP_007047661.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
 gb|EOX91818.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
Length=1018

 Score =   240 bits (612),  Expect = 2e-69, Method: Composition-based stats.
 Identities = 118/151 (78%), Positives = 129/151 (85%), Gaps = 6/151 (4%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG+KPVGEFGDGVDIVQWVR
Sbjct  849  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGRKPVGEFGDGVDIVQWVR  908

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            KMTD  KEGV+KILD RL +VP+HE MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK 
Sbjct  909  KMTDSNKEGVLKILDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQILTELPK-  967

Query  358  PPGTKPEGTTACESSALEPPPSTGTSDDAKD  266
            PP +K   +T  ES      PS GTS D+ +
Sbjct  968  PPNSKQGDSTVTESL-----PSPGTSLDSPN  993



>gb|KDP32143.1| hypothetical protein JCGZ_12604 [Jatropha curcas]
Length=1013

 Score =   240 bits (612),  Expect = 2e-69, Method: Composition-based stats.
 Identities = 123/168 (73%), Positives = 136/168 (81%), Gaps = 7/168 (4%)
 Frame = -2

Query  718   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
             ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGVDIVQWVR
Sbjct  847   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGVDIVQWVR  906

Query  538   KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
             KMTD  KEGV+K+LD RL +VP+HE MH+FYVA+LCVEEQA+ERP MREVVQ+LTELPK 
Sbjct  907   KMTDSNKEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQAIERPTMREVVQILTELPK-  965

Query  358   PPGTKPEGTTACESS----ALEPPPSTGTSDDAKDqqqppP--DLLSI  233
             PP +K    T  ESS    A    P+  T+ D KD Q P    DLLSI
Sbjct  966   PPNSKQGDLTVTESSPQSAATLDSPNAATTRDQKDHQSPQSPPDLLSI  1013



>ref|XP_009613990.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nicotiana tomentosiformis]
Length=1019

 Score =   240 bits (612),  Expect = 3e-69, Method: Composition-based stats.
 Identities = 126/170 (74%), Positives = 137/170 (81%), Gaps = 9/170 (5%)
 Frame = -2

Query  718   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
             ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG+KPVGEFGDG+DIVQWVR
Sbjct  851   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGRKPVGEFGDGIDIVQWVR  910

Query  538   KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
             KMT+GKKEGV+KILD RLSTVP+HE +H+FYVA+LCVEEQAVERPKMREVVQ+LTELP  
Sbjct  911   KMTEGKKEGVLKILDPRLSTVPLHEVIHVFYVAMLCVEEQAVERPKMREVVQILTELP-T  969

Query  358   PPGTKPEGTTACESSALEPPPS---TGTSDDAKD-----qqqppPDLLSI  233
             P  TK   +T  ES     P S   T    + KD      Q P PDLLSI
Sbjct  970   PSNTKSGDSTITESLPSSAPASESPTSAPGNTKDNHQPPPQSPQPDLLSI  1019



>ref|XP_011073654.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Sesamum indicum]
Length=1015

 Score =   240 bits (612),  Expect = 3e-69, Method: Composition-based stats.
 Identities = 125/166 (75%), Positives = 135/166 (81%), Gaps = 5/166 (3%)
 Frame = -2

Query  718   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
             ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGVDIVQWVR
Sbjct  851   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGVDIVQWVR  910

Query  538   KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
             KMTDG KEGV+K+LD RL TVP+HE MH+FYVA+LCVEEQAVERP MREVVQ+L+ELPK 
Sbjct  911   KMTDGNKEGVLKVLDPRLPTVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQILSELPK-  969

Query  358   PPGTKPEGTTACES----SALEPPPSTGTSDDAKDqqqppPDLLSI  233
             P G KP      ES    S LE P +   S      Q PPPDLLSI
Sbjct  970   PHGAKPGDPAPTESPPPASILESPATDPESHHPNPPQSPPPDLLSI  1015



>ref|XP_002531999.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
 gb|EEF30398.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
Length=1021

 Score =   239 bits (611),  Expect = 3e-69, Method: Composition-based stats.
 Identities = 126/173 (73%), Positives = 141/173 (82%), Gaps = 14/173 (8%)
 Frame = -2

Query  718   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
             ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGVDIVQWVR
Sbjct  852   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGVDIVQWVR  911

Query  538   KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
             KMTD  KEGV+K+LD RL +VP+HE MH+FYVA+LCVEEQA+ERP MREVVQ+LTELPK 
Sbjct  912   KMTDSNKEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQAIERPTMREVVQILTELPK-  970

Query  358   PPGTKPEGTTACESS-----ALEPPPSTGTSDDAKDqqqpp------PDLLSI  233
             PP +K   +T  ESS     +L+ P +  TS D KD QQP       PDLLSI
Sbjct  971   PPNSKQGDSTVTESSPQSATSLDSPKA--TSKDPKDNQQPALPQSPPPDLLSI  1021



>ref|XP_004288299.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Fragaria vesca subsp. vesca]
Length=1023

 Score =   239 bits (610),  Expect = 4e-69, Method: Composition-based stats.
 Identities = 119/151 (79%), Positives = 130/151 (86%), Gaps = 9/151 (6%)
 Frame = -2

Query  718   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
             ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR
Sbjct  856   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  915

Query  538   KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
             KMTD  KEGV+KILDSRL +VP+HE MH+FYVA+LCVEEQAVERP MREVVQ+LTELP  
Sbjct  916   KMTDSNKEGVLKILDSRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQILTELPI-  974

Query  358   PPGTKP--EGTTACES------SALEPPPST  290
             PPG+K   E TT  +S      +A+E P +T
Sbjct  975   PPGSKQVGETTTVTDSPQQSAITAIESPTTT  1005



>emb|CDP02660.1| unnamed protein product [Coffea canephora]
Length=1017

 Score =   239 bits (609),  Expect = 5e-69, Method: Composition-based stats.
 Identities = 120/157 (76%), Positives = 130/157 (83%), Gaps = 11/157 (7%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG+KPVGEFGDGVDIVQWVR
Sbjct  849  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGRKPVGEFGDGVDIVQWVR  908

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            KMTDG KEGV+KILD RL TVP+HE MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK 
Sbjct  909  KMTDGNKEGVLKILDPRLPTVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQILTELPK-  967

Query  358  PPGTKPEGTTACESSALEPPPS------TGTSDDAKD  266
            P   K   +T  ES    PPP+      + T  D+KD
Sbjct  968  PANGKQGDSTDTES----PPPASTVESPSTTPVDSKD  1000



>ref|XP_007156674.1| hypothetical protein PHAVU_002G007600g [Phaseolus vulgaris]
 gb|ESW28668.1| hypothetical protein PHAVU_002G007600g [Phaseolus vulgaris]
Length=1005

 Score =   239 bits (609),  Expect = 6e-69, Method: Composition-based stats.
 Identities = 123/165 (75%), Positives = 138/165 (84%), Gaps = 5/165 (3%)
 Frame = -2

Query  718   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
             ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+KPVGEFGDGVDIVQW R
Sbjct  843   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRKPVGEFGDGVDIVQWAR  902

Query  538   KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
             KMTD  KE V+K+LD RLS+VP+H+ MH+FYVA+LCVEEQAVERP MREVVQ+LTELP+ 
Sbjct  903   KMTDSNKEEVLKVLDPRLSSVPLHDVMHVFYVAMLCVEEQAVERPTMREVVQILTELPR-  961

Query  358   PPGTKPEGTTA---CESSALEPPPSTGTSDDAKDqqqppPDLLSI  233
             PPG+K E  T      S+ALE  PST + D     Q PPPDLLSI
Sbjct  962   PPGSKQEDLTESSLSSSNALE-SPSTASKDRQNPSQSPPPDLLSI  1005



>ref|XP_003635561.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Vitis vinifera]
Length=1017

 Score =   238 bits (608),  Expect = 8e-69, Method: Composition-based stats.
 Identities = 117/147 (80%), Positives = 127/147 (86%), Gaps = 5/147 (3%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG+KPVGEFGDGVDIVQWVR
Sbjct  850  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGRKPVGEFGDGVDIVQWVR  909

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            KMTD  KEGV+KILD+RL TVP+HE MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK 
Sbjct  910  KMTDSNKEGVLKILDTRLPTVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQILTELPK-  968

Query  358  PPGTKPEGTTACESS----ALEPPPST  290
            PP +K   +   ESS     LE P +T
Sbjct  969  PPSSKQGDSIVTESSPPSCTLESPTTT  995



>ref|XP_010683073.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Beta vulgaris subsp. vulgaris]
Length=1009

 Score =   238 bits (606),  Expect = 1e-68, Method: Composition-based stats.
 Identities = 120/162 (74%), Positives = 134/162 (83%), Gaps = 4/162 (2%)
 Frame = -2

Query  718   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
             ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+KPVGEFGDGVDIVQWVR
Sbjct  852   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELIAGRKPVGEFGDGVDIVQWVR  911

Query  538   KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
             KMTDG KEGV+K+LD RL +VP+HE MH+FYVA+LCVEEQAVERP MREVVQ+L E+PK 
Sbjct  912   KMTDGNKEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQILLEIPK-  970

Query  358   PPGTKPEGTTACESSALEPPPSTGTSDDAKDqqqppPDLLSI  233
             PPGT P+   A   S LE P     +      + PPPDLLSI
Sbjct  971   PPGTTPKQGDA---SPLESPQRPTDAIVGSPTKSPPPDLLSI  1009



>ref|XP_007208421.1| hypothetical protein PRUPE_ppa000739mg [Prunus persica]
 gb|EMJ09620.1| hypothetical protein PRUPE_ppa000739mg [Prunus persica]
Length=1017

 Score =   238 bits (606),  Expect = 2e-68, Method: Composition-based stats.
 Identities = 116/146 (79%), Positives = 127/146 (87%), Gaps = 4/146 (3%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG+KPVGEFGDGVDIVQWVR
Sbjct  846  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGRKPVGEFGDGVDIVQWVR  905

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            KMTD  KEGV+KILD RL +VP+HE MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK 
Sbjct  906  KMTDSNKEGVLKILDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQILTELPK-  964

Query  358  PPGTKPEGTTACESSALEPPPSTGTS  281
             PG+K  G    +S+  E  P +GTS
Sbjct  965  APGSKQGGG---DSAITESFPPSGTS  987



>gb|KJB43996.1| hypothetical protein B456_007G228700 [Gossypium raimondii]
Length=866

 Score =   236 bits (603),  Expect = 2e-68, Method: Composition-based stats.
 Identities = 122/168 (73%), Positives = 138/168 (82%), Gaps = 6/168 (4%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG+KPVGEFGDGVDIVQWVR
Sbjct  699  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGRKPVGEFGDGVDIVQWVR  758

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            K T+  KEGV+KILD RLS+VP++E MH+FYVA+LCVEEQAVERP MREVVQ+LTE+PK 
Sbjct  759  KTTNSNKEGVLKILDPRLSSVPLYEVMHVFYVAMLCVEEQAVERPTMREVVQILTEVPKP  818

Query  358  PPGTKPEG-TTACESSALEPP-----PSTGTSDDAKDqqqppPDLLSI  233
            P   + +G +T  ESS +  P     P    + + KDQ  PPPDLLSI
Sbjct  819  PSSKQQQGDSTITESSPISQPTTLESPRDARTKEPKDQHTPPPDLLSI  866



>gb|KJB18115.1| hypothetical protein B456_003G034500 [Gossypium raimondii]
Length=1014

 Score =   237 bits (605),  Expect = 2e-68, Method: Composition-based stats.
 Identities = 118/164 (72%), Positives = 133/164 (81%), Gaps = 4/164 (2%)
 Frame = -2

Query  718   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
             ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV G+KPVGEFGDGVDIVQWVR
Sbjct  853   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVCGRKPVGEFGDGVDIVQWVR  912

Query  538   KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
             KMTD  KEGV+K+LD RL +VP+HE MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK 
Sbjct  913   KMTDSNKEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQILTELPK-  971

Query  358   PPGTKPEGTTACESSALEPPPSTGTSDDAKDqqqppP--DLLSI  233
             PP ++   T+    + L+PP +T T D  +         DLLSI
Sbjct  972   PPNSEST-TSPAPCTTLDPPTTTITKDQQQPPAPKSTPPDLLSI  1014



>emb|CBI35733.3| unnamed protein product [Vitis vinifera]
Length=948

 Score =   237 bits (604),  Expect = 2e-68, Method: Composition-based stats.
 Identities = 117/147 (80%), Positives = 127/147 (86%), Gaps = 5/147 (3%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG+KPVGEFGDGVDIVQWVR
Sbjct  781  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGRKPVGEFGDGVDIVQWVR  840

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            KMTD  KEGV+KILD+RL TVP+HE MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK 
Sbjct  841  KMTDSNKEGVLKILDTRLPTVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQILTELPK-  899

Query  358  PPGTKPEGTTACESS----ALEPPPST  290
            PP +K   +   ESS     LE P +T
Sbjct  900  PPSSKQGDSIVTESSPPSCTLESPTTT  926



>ref|XP_004509039.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Cicer arietinum]
Length=1005

 Score =   237 bits (604),  Expect = 3e-68, Method: Composition-based stats.
 Identities = 117/162 (72%), Positives = 130/162 (80%), Gaps = 4/162 (2%)
 Frame = -2

Query  718   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
             ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGVDIVQWVR
Sbjct  848   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVAGRKPVGEFGDGVDIVQWVR  907

Query  538   KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
             KMTD  KEGV+K+LD RL +VP+HE MH+FYVA+LCVEEQAVERP MREVVQMLTELPK 
Sbjct  908   KMTDSNKEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQMLTELPKP  967

Query  358   PPGTKPEGTTACESSALEPPPSTGTSDDAKDqqqppPDLLSI  233
             P     E  T      +   PS  +S+  +   + P DLLSI
Sbjct  968   PTSKHVEDLTL----TITESPSLASSNSLESPSKEPKDLLSI  1005



>gb|KDO78771.1| hypothetical protein CISIN_1g001816mg [Citrus sinensis]
Length=1010

 Score =   237 bits (604),  Expect = 3e-68, Method: Composition-based stats.
 Identities = 113/141 (80%), Positives = 125/141 (89%), Gaps = 8/141 (6%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+KPVGEFGDGVDIVQWVR
Sbjct  844  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRKPVGEFGDGVDIVQWVR  903

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            KMTD KKEGV+KILD RL +VP+HE MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK 
Sbjct  904  KMTDSKKEGVLKILDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQILTELPK-  962

Query  358  PPGTK-------PEGTTACES  317
            PP +K       P GTT+ +S
Sbjct  963  PPTSKQGEESLPPSGTTSLDS  983



>ref|XP_006466390.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Citrus sinensis]
Length=1010

 Score =   237 bits (604),  Expect = 3e-68, Method: Composition-based stats.
 Identities = 113/141 (80%), Positives = 125/141 (89%), Gaps = 8/141 (6%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+KPVGEFGDGVDIVQWVR
Sbjct  844  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRKPVGEFGDGVDIVQWVR  903

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            KMTD KKEGV+KILD RL +VP+HE MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK 
Sbjct  904  KMTDSKKEGVLKILDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQILTELPK-  962

Query  358  PPGTK-------PEGTTACES  317
            PP +K       P GTT+ +S
Sbjct  963  PPTSKQGEESLPPSGTTSLDS  983



>ref|XP_006426178.1| hypothetical protein CICLE_v10024796mg [Citrus clementina]
 gb|ESR39418.1| hypothetical protein CICLE_v10024796mg [Citrus clementina]
Length=1012

 Score =   237 bits (604),  Expect = 3e-68, Method: Composition-based stats.
 Identities = 113/141 (80%), Positives = 125/141 (89%), Gaps = 8/141 (6%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+KPVGEFGDGVDIVQWVR
Sbjct  846  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRKPVGEFGDGVDIVQWVR  905

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            KMTD KKEGV+KILD RL +VP+HE MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK 
Sbjct  906  KMTDSKKEGVLKILDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQILTELPK-  964

Query  358  PPGTK-------PEGTTACES  317
            PP +K       P GTT+ +S
Sbjct  965  PPTSKQGEESLPPSGTTSLDS  985



>ref|XP_008237309.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Prunus mume]
Length=968

 Score =   236 bits (603),  Expect = 3e-68, Method: Composition-based stats.
 Identities = 114/147 (78%), Positives = 124/147 (84%), Gaps = 2/147 (1%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG+KPVGEFGDGVDIVQWVR
Sbjct  797  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGRKPVGEFGDGVDIVQWVR  856

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            KMTD  KEGV+KILD RL +VP+HE MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK 
Sbjct  857  KMTDSNKEGVLKILDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQILTELPKA  916

Query  358  PPGTKPEGTTACESSALEPPPSTGTSD  278
            P   +  G +A   S   PP  T  S+
Sbjct  917  PGSKQGGGDSAITESF--PPSGTSASE  941



>ref|XP_004511796.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Cicer arietinum]
Length=1009

 Score =   236 bits (601),  Expect = 7e-68, Method: Composition-based stats.
 Identities = 119/164 (73%), Positives = 133/164 (81%), Gaps = 3/164 (2%)
 Frame = -2

Query  718   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
             ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+KPVGEFGDGVDIVQWVR
Sbjct  847   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRKPVGEFGDGVDIVQWVR  906

Query  538   KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
             KMTD  KEGV+K+LD RLS+VP+HE  H+FYVA+LCVEEQAVERP MREVVQ+LTELP  
Sbjct  907   KMTDSNKEGVLKVLDPRLSSVPLHEVTHVFYVAILCVEEQAVERPTMREVVQILTELP-M  965

Query  358   PPGTKPEGTTACESSALEPPPS--TGTSDDAKDqqqppPDLLSI  233
             PP +K   +T  ESS      S    + D+      PPPDLLSI
Sbjct  966   PPESKQGDSTITESSLSNASESLTAASKDNQHPPPSPPPDLLSI  1009



>gb|KHN47566.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Glycine soja]
Length=725

 Score =   233 bits (595),  Expect = 8e-68, Method: Composition-based stats.
 Identities = 124/166 (75%), Positives = 137/166 (83%), Gaps = 5/166 (3%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGVDIVQWVR
Sbjct  561  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGVDIVQWVR  620

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            KMTD  KEGV+K+LDSRL +VP+HE MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK 
Sbjct  621  KMTDSNKEGVLKVLDSRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQILTELPK-  679

Query  358  PPGTKPEGTTACESSALEPPPSTGTSDDAKD----qqqppPDLLSI  233
            PP +K   T +  SS+      T  S + KD     Q PPPDLLSI
Sbjct  680  PPSSKHAITESSLSSSNSLGSPTTASKEPKDNQHPPQSPPPDLLSI  725



>ref|XP_010271550.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nelumbo nucifera]
Length=1032

 Score =   236 bits (601),  Expect = 8e-68, Method: Composition-based stats.
 Identities = 113/146 (77%), Positives = 125/146 (86%), Gaps = 4/146 (3%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG+KPVGEFGDGVDIVQWVR
Sbjct  853  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGRKPVGEFGDGVDIVQWVR  912

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            KMTD  KEGV+KILD RL +VP+HE MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK 
Sbjct  913  KMTDSNKEGVLKILDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQILTELPK-  971

Query  358  PPGTKPEGTTACESSALEPPPSTGTS  281
            PP +K   +T    + +E  PS   +
Sbjct  972  PPNSKQGDSTI---TTMESSPSLAAA  994



>ref|NP_001235065.1| receptor-like protein kinase 1 precursor [Glycine max]
 gb|AAF91322.1|AF244888_1 receptor-like protein kinase 1 [Glycine max]
Length=1008

 Score =   236 bits (601),  Expect = 8e-68, Method: Composition-based stats.
 Identities = 124/166 (75%), Positives = 137/166 (83%), Gaps = 5/166 (3%)
 Frame = -2

Query  718   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
             ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGVDIVQWVR
Sbjct  844   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGVDIVQWVR  903

Query  538   KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
             KMTD  KEGV+K+LDSRL +VP+HE MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK 
Sbjct  904   KMTDSNKEGVLKVLDSRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQILTELPK-  962

Query  358   PPGTKPEGTTACESSALEPPPSTGTSDDAKD----qqqppPDLLSI  233
             PP +K   T +  SS+      T  S + KD     Q PPPDLLSI
Sbjct  963   PPSSKHAITESSLSSSNSLGSPTTASKEPKDNQHPPQSPPPDLLSI  1008



>ref|XP_011021820.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Populus euphratica]
Length=1020

 Score =   235 bits (599),  Expect = 1e-67, Method: Composition-based stats.
 Identities = 122/169 (72%), Positives = 136/169 (80%), Gaps = 8/169 (5%)
 Frame = -2

Query  718   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
             ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGVDIVQWVR
Sbjct  853   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGVDIVQWVR  912

Query  538   KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
             KMTD  KEGV+K+LD RL +VP+HE MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK 
Sbjct  913   KMTDSIKEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQILTELPKS  972

Query  358   PPG-------TKPEGTTACESSALEPPPSTGTSDDAKDqqqppPDLLSI  233
             P         T+P   +A  ++AL+ P ST        QQ PP DLLSI
Sbjct  973   PSSKQGDSIITEPSPHSAA-TAALDSPSSTAKDVPKDHQQPPPADLLSI  1020



>gb|KJB48795.1| hypothetical protein B456_008G087500 [Gossypium raimondii]
Length=1013

 Score =   234 bits (598),  Expect = 2e-67, Method: Composition-based stats.
 Identities = 123/167 (74%), Positives = 133/167 (80%), Gaps = 8/167 (5%)
 Frame = -2

Query  718   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
             ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG+KPVGEFGDGVDIVQWVR
Sbjct  850   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGRKPVGEFGDGVDIVQWVR  909

Query  538   KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
             KMT+ KKEGV+KILD RL +VP+HE MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK 
Sbjct  910   KMTNSKKEGVLKILDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQILTELPK-  968

Query  358   PPGTKPEGTTACES-----SALEPPPSTGTSDDAKDqqqppPDLLSI  233
                +K    T  ES     S LE P +  T D       P PDLLSI
Sbjct  969   ASDSKQRDPTVTESSHSPTSTLESPNNATTKDPMPQ--SPTPDLLSI  1013



>ref|XP_010268646.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nelumbo nucifera]
Length=1034

 Score =   234 bits (598),  Expect = 2e-67, Method: Composition-based stats.
 Identities = 111/146 (76%), Positives = 124/146 (85%), Gaps = 2/146 (1%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG+KPVGEFGDGVDIVQWVR
Sbjct  850  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGRKPVGEFGDGVDIVQWVR  909

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            KMTD  KEGV+KILD RL +VP+HE MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK 
Sbjct  910  KMTDSNKEGVLKILDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQILTELPKA  969

Query  358  PPGTKPEGTTACESSALEPPPSTGTS  281
            P     +G++A   S+     + G +
Sbjct  970  P--ISKQGSSAMTESSPSAAATAGET  993



>ref|XP_002310320.2| hypothetical protein POPTR_0007s14500g [Populus trichocarpa]
 gb|EEE90770.2| hypothetical protein POPTR_0007s14500g [Populus trichocarpa]
Length=1020

 Score =   234 bits (598),  Expect = 2e-67, Method: Composition-based stats.
 Identities = 122/169 (72%), Positives = 136/169 (80%), Gaps = 8/169 (5%)
 Frame = -2

Query  718   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
             ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGVDIVQWVR
Sbjct  853   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGVDIVQWVR  912

Query  538   KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
             KMTD  KEGV+K+LD RL +VP+HE MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK 
Sbjct  913   KMTDSIKEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQILTELPKS  972

Query  358   PPG-------TKPEGTTACESSALEPPPSTGTSDDAKDqqqppPDLLSI  233
             P         T+P   +A  ++AL+ P ST        QQ PP DLLSI
Sbjct  973   PSSKQGDSVITEPSPHSAA-TAALDSPSSTAKDVPKDHQQPPPADLLSI  1020



>gb|AIT56194.1| leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Dimocarpus longan]
Length=1015

 Score =   234 bits (598),  Expect = 2e-67, Method: Composition-based stats.
 Identities = 114/145 (79%), Positives = 126/145 (87%), Gaps = 4/145 (3%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+KPVGEFGDGVDIVQWVR
Sbjct  845  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRKPVGEFGDGVDIVQWVR  904

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            KMTD   +GV+KILD RL TVP++E MH+FYVALLCVEEQAVERP MREVVQ+LTELPK 
Sbjct  905  KMTDSNVDGVLKILDPRLPTVPLNEVMHVFYVALLCVEEQAVERPTMREVVQILTELPK-  963

Query  358  PPGTKPEGTTACESSALEPPPSTGT  284
            PP +KP  +   ESS   P P+T T
Sbjct  964  PPSSKPADSAIPESS---PSPATTT  985



>gb|KHG03710.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Gossypium arboreum]
 gb|KHG03906.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Gossypium arboreum]
Length=1013

 Score =   234 bits (598),  Expect = 2e-67, Method: Composition-based stats.
 Identities = 121/166 (73%), Positives = 132/166 (80%), Gaps = 6/166 (4%)
 Frame = -2

Query  718   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
             ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG+KPVGEFGDGVDIVQWVR
Sbjct  850   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGRKPVGEFGDGVDIVQWVR  909

Query  538   KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
             KMT+ KKEGV+KILD RL +VP+HE MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK 
Sbjct  910   KMTNSKKEGVLKILDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQILTELPKA  969

Query  358   PPGTKPEGTTACES----SALEPPPSTGTSDDAKDqqqppPDLLSI  233
                 + + T    S    S LE P +  T D       P PDLLSI
Sbjct  970   SDSKQGDPTVTESSHSPTSTLESPNNATTKDPMPQ--SPTPDLLSI  1013



>dbj|BAF01968.1| receptor protein kinase like protein [Arabidopsis thaliana]
Length=243

 Score =   219 bits (558),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 120/146 (82%), Gaps = 4/146 (3%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++GKKPVGEFGDGVDIVQWVR
Sbjct  89   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGKKPVGEFGDGVDIVQWVR  148

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
             MTD  K+ V+K++D RLS+VP+HE  H+FYVALLCVEEQAVERP MREVVQ+LTE+PK 
Sbjct  149  SMTDSNKDCVLKVIDLRLSSVPVHEVTHVFYVALLCVEEQAVERPTMREVVQILTEIPKI  208

Query  358  PPGTKPEGTTACESSALEPPPSTGTS  281
            P   +     A ES   E  P+   S
Sbjct  209  PLSKQ----QAAESDVTEKAPAINES  230



>ref|XP_006279943.1| hypothetical protein CARUB_v10025808mg [Capsella rubella]
 gb|EOA12841.1| hypothetical protein CARUB_v10025808mg [Capsella rubella]
Length=1004

 Score =   233 bits (595),  Expect = 5e-67, Method: Composition-based stats.
 Identities = 108/139 (78%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGVDIVQWVR
Sbjct  853  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGVDIVQWVR  912

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            KMTD  KE V+K+LD RLS++PIHE  H+FYVA+LCVEEQAVERP MREVVQ+LTE+PK 
Sbjct  913  KMTDSNKESVLKVLDPRLSSIPIHEVTHVFYVAMLCVEEQAVERPTMREVVQILTEIPKL  972

Query  358  PPGTKPEGTTACESSALEP  302
            PP      T +   S L P
Sbjct  973  PPSKDQTTTESTPESELSP  991



>ref|XP_004143422.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Cucumis sativus]
 ref|XP_004163335.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Cucumis sativus]
 gb|KGN48657.1| hypothetical protein Csa_6G497080 [Cucumis sativus]
Length=1019

 Score =   233 bits (594),  Expect = 7e-67, Method: Composition-based stats.
 Identities = 124/171 (73%), Positives = 140/171 (82%), Gaps = 10/171 (6%)
 Frame = -2

Query  718   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
             ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG+KPVGEFGDGVDIVQWVR
Sbjct  850   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGRKPVGEFGDGVDIVQWVR  909

Query  538   KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
             KMTD  KE VVKILD RLS+VP+HE MH+FYVA+LCVEEQAVERP MREV+Q+L+E+P Q
Sbjct  910   KMTDSNKEEVVKILDPRLSSVPLHEVMHVFYVAMLCVEEQAVERPTMREVIQILSEIP-Q  968

Query  358   PPGTKPEGTTAC--------ESSALEPPPSTGTSDDAK-DqqqppPDLLSI  233
             PP +K  G +           ++A    P+TGT +  +  QQQPPPDLLSI
Sbjct  969   PPSSKQGGDSTLPNSSPPPPPTAADLDLPTTGTKNKKEHQQQQPPPDLLSI  1019



>gb|AES94465.2| LRR receptor-like kinase family protein [Medicago truncatula]
Length=1014

 Score =   233 bits (594),  Expect = 8e-67, Method: Composition-based stats.
 Identities = 123/167 (74%), Positives = 136/167 (81%), Gaps = 7/167 (4%)
 Frame = -2

Query  718   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
             ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGVDIVQWVR
Sbjct  850   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGVDIVQWVR  909

Query  538   KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
             KMTD  KEGV+K+LD RLS+VP+ E MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK 
Sbjct  910   KMTDSNKEGVLKVLDPRLSSVPLQEVMHVFYVAILCVEEQAVERPTMREVVQILTELPKS  969

Query  358   PPGTKPEGTTACESS-----ALEPPPSTGTSDDAKDqqqppPDLLSI  233
                +K   +T  ESS     ALE  P+  + D     Q PPPDLLSI
Sbjct  970   TE-SKLGDSTITESSLSSSNALE-SPTAASKDHQHPPQSPPPDLLSI  1014



>ref|XP_008441113.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1, partial [Cucumis melo]
Length=977

 Score =   233 bits (593),  Expect = 8e-67, Method: Composition-based stats.
 Identities = 124/171 (73%), Positives = 140/171 (82%), Gaps = 10/171 (6%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG+KPVGEFGDGVDIVQWVR
Sbjct  808  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGRKPVGEFGDGVDIVQWVR  867

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            KMTD  KE VVKILD RLS+VP+HE MH+FYVA+LCVEEQAVERP MREV+Q+L+E+P Q
Sbjct  868  KMTDSNKEEVVKILDPRLSSVPLHEVMHVFYVAMLCVEEQAVERPTMREVIQILSEIP-Q  926

Query  358  PPGTKPEGTTAC--------ESSALEPPPSTGTSDDAK-DqqqppPDLLSI  233
            PP +K  G +           ++A    P+TGT +  +  QQQPPPDLLSI
Sbjct  927  PPSSKQGGDSTLPNSSPPPPPTAADLDLPTTGTKNKKEHQQQQPPPDLLSI  977



>ref|XP_007155783.1| hypothetical protein PHAVU_003G231400g [Phaseolus vulgaris]
 gb|ESW27777.1| hypothetical protein PHAVU_003G231400g [Phaseolus vulgaris]
Length=1018

 Score =   232 bits (592),  Expect = 1e-66, Method: Composition-based stats.
 Identities = 121/169 (72%), Positives = 134/169 (79%), Gaps = 8/169 (5%)
 Frame = -2

Query  718   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
             ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGVDIVQWVR
Sbjct  851   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGVDIVQWVR  910

Query  538   KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
             KMTD  KEGV+K+LD RL +VP+HE MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK 
Sbjct  911   KMTDSNKEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQILTELPKS  970

Query  358   PPGTKPEGTTACESS-----ALEPPPSTGTS--DDAKDqqqppPDLLSI  233
                +K    T  ESS     +LE P +      D+    Q  PPDLLSI
Sbjct  971   -ASSKQGDLTITESSLPSSNSLESPTTASMEPKDNQHLPQSSPPDLLSI  1018



>ref|XP_010444585.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Camelina sativa]
Length=1006

 Score =   232 bits (591),  Expect = 2e-66, Method: Composition-based stats.
 Identities = 107/139 (77%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGVDIVQWVR
Sbjct  853  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGVDIVQWVR  912

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            KMTD  KE V+K+LD RLS++PIHE  H+FYVA+LCVEEQAVERP MREVVQ+LTE+PK 
Sbjct  913  KMTDSNKESVLKVLDPRLSSIPIHEVTHVFYVAMLCVEEQAVERPTMREVVQILTEIPKL  972

Query  358  PPGTKPEGTTACESSALEP  302
            PP      T +   + L P
Sbjct  973  PPSKDQPTTESTPENELSP  991



>gb|KFK28239.1| hypothetical protein AALP_AA8G490400 [Arabis alpina]
Length=1002

 Score =   231 bits (590),  Expect = 2e-66, Method: Composition-based stats.
 Identities = 109/147 (74%), Positives = 123/147 (84%), Gaps = 1/147 (1%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGVDIVQWVR
Sbjct  853  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGVDIVQWVR  912

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            KMTD  KE V+K+LD R+S++PIHE  H+FYVA+LCVEEQAVERP MREVVQ+LTE+PK 
Sbjct  913  KMTDSNKESVLKVLDPRMSSIPIHEVTHVFYVAMLCVEEQAVERPTMREVVQILTEIPKM  972

Query  358  PPGTKPEGTTACESSALEPPPSTGTSD  278
            PP +K + TT         P + G  D
Sbjct  973  PP-SKEQSTTELTGVEKSTPENEGPPD  998



>ref|XP_008790445.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Phoenix dactylifera]
Length=1019

 Score =   231 bits (590),  Expect = 2e-66, Method: Composition-based stats.
 Identities = 121/162 (75%), Positives = 137/162 (85%), Gaps = 5/162 (3%)
 Frame = -2

Query  718   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
             ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGVDIVQWVR
Sbjct  863   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGVDIVQWVR  922

Query  538   KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
             KMTD KKEGVV +LD RL +VP+HEAMH+FYVA+LCVEEQ++ERP MREVVQ+LTELP+ 
Sbjct  923   KMTDSKKEGVVIVLDPRLPSVPLHEAMHVFYVAMLCVEEQSIERPTMREVVQILTELPRP  982

Query  358   PPGTKPEGTTACESSALEPPPSTGTSDDAKDqqqppPDLLSI  233
             PP  + EG    E S   PPP+ G +   + + QP PDLLSI
Sbjct  983   PP-NQGEG----EDSPPPPPPAGGETPMKESKPQPQPDLLSI  1019



>ref|NP_001237688.1| receptor-like protein kinase precursor [Glycine max]
 gb|ACM89563.1| receptor-like protein kinase [Glycine max]
Length=1010

 Score =   231 bits (590),  Expect = 3e-66, Method: Composition-based stats.
 Identities = 107/125 (86%), Positives = 117/125 (94%), Gaps = 1/125 (1%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGVDIVQWVR
Sbjct  844  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGVDIVQWVR  903

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            KMTD  KEGV+K+LD RL +VP+HE MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK 
Sbjct  904  KMTDSNKEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQILTELPK-  962

Query  358  PPGTK  344
            PP +K
Sbjct  963  PPSSK  967



>ref|XP_006852730.1| hypothetical protein AMTR_s00033p00083200 [Amborella trichopoda]
 gb|ERN14197.1| hypothetical protein AMTR_s00033p00083200 [Amborella trichopoda]
Length=1017

 Score =   231 bits (589),  Expect = 3e-66, Method: Composition-based stats.
 Identities = 121/169 (72%), Positives = 136/169 (80%), Gaps = 7/169 (4%)
 Frame = -2

Query  718   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
             ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+KPVGEFGDGVDIVQWVR
Sbjct  849   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRKPVGEFGDGVDIVQWVR  908

Query  538   KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
             KMTD KKEGV+ ILD RL TVP+HEAMH+FYVA+LCVEEQ+VERP MREVVQ+LT+LPK 
Sbjct  909   KMTDSKKEGVLNILDPRLPTVPLHEAMHVFYVAMLCVEEQSVERPTMREVVQILTDLPKP  968

Query  358   P----PGTKPEGTTACESSALEPP-PSTGTSDDAKD--qqqppPDLLSI  233
             P    P T+  G      ++ EP  P+ G  +       Q PPPDLLSI
Sbjct  969   PEQPSPTTQKHGGIGGGDASPEPNGPNVGVKEQQGQLPPQSPPPDLLSI  1017



>ref|XP_006393995.1| hypothetical protein EUTSA_v10003584mg [Eutrema salsugineum]
 gb|ESQ31281.1| hypothetical protein EUTSA_v10003584mg [Eutrema salsugineum]
Length=1007

 Score =   231 bits (588),  Expect = 4e-66, Method: Composition-based stats.
 Identities = 113/152 (74%), Positives = 123/152 (81%), Gaps = 5/152 (3%)
 Frame = -2

Query  718   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
             ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGVDIVQWVR
Sbjct  852   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGVDIVQWVR  911

Query  538   KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
             KMTD  KE V+K+LD RLS++PIHE  H+FYVA+LCVEEQAVERP MREVVQ+LTE+PK 
Sbjct  912   KMTDSNKESVLKVLDPRLSSIPIHEVTHVFYVAMLCVEEQAVERPTMREVVQILTEIPKM  971

Query  358   PPGTKPEGT--TACESSALE---PPPSTGTSD  278
             PP      T  T  E S  E    P S G  D
Sbjct  972   PPLKDQPATELTGVEKSTAENELSPKSGGPPD  1003



>ref|NP_201371.1| leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Arabidopsis thaliana]
 ref|NP_001190624.1| leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Arabidopsis thaliana]
 sp|O49545.1|BAME1_ARATH RecName: Full=Leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1; AltName: Full=Protein BARELY ANY MERISTEM 
1; Flags: Precursor [Arabidopsis thaliana]
 emb|CAA16688.1| receptor protein kinase - like protein [Arabidopsis thaliana]
 dbj|BAB10677.1| receptor protein kinase-like protein [Arabidopsis thaliana]
 gb|AAM20665.1| receptor protein kinase-like protein [Arabidopsis thaliana]
 gb|AAP68249.1| At5g65700 [Arabidopsis thaliana]
 dbj|BAE98627.1| receptor protein kinase like protein [Arabidopsis thaliana]
 gb|ACN59407.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED98091.1| CLAVATA1-related receptor kinase-like protein [Arabidopsis thaliana]
 gb|AED98092.1| CLAVATA1-related receptor kinase-like protein [Arabidopsis thaliana]
Length=1003

 Score =   231 bits (588),  Expect = 4e-66, Method: Composition-based stats.
 Identities = 108/148 (73%), Positives = 121/148 (82%), Gaps = 0/148 (0%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGVDIVQWVR
Sbjct  852  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGVDIVQWVR  911

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            KMTD  K+ V+K+LD RLS++PIHE  H+FYVA+LCVEEQAVERP MREVVQ+LTE+PK 
Sbjct  912  KMTDSNKDSVLKVLDPRLSSIPIHEVTHVFYVAMLCVEEQAVERPTMREVVQILTEIPKL  971

Query  358  PPGTKPEGTTACESSALEPPPSTGTSDD  275
            PP      T +   S L P     +  D
Sbjct  972  PPSKDQPMTESAPESELSPKSGVQSPPD  999



>ref|XP_002864974.1| hypothetical protein ARALYDRAFT_496807 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41233.1| hypothetical protein ARALYDRAFT_496807 [Arabidopsis lyrata subsp. 
lyrata]
Length=1003

 Score =   231 bits (588),  Expect = 5e-66, Method: Composition-based stats.
 Identities = 107/139 (77%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGVDIVQWVR
Sbjct  852  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGVDIVQWVR  911

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            KMTD  KE V+K+LD RLS++PIHE  H+FYVA+LCVEEQAVERP MREVVQ+LTE+PK 
Sbjct  912  KMTDSNKESVLKVLDPRLSSIPIHEVTHVFYVAMLCVEEQAVERPTMREVVQILTEIPKL  971

Query  358  PPGTKPEGTTACESSALEP  302
            PP      T +   + L P
Sbjct  972  PPPKDQPTTESTPENELSP  990



>ref|XP_010463501.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Camelina sativa]
Length=1006

 Score =   230 bits (586),  Expect = 8e-66, Method: Composition-based stats.
 Identities = 106/139 (76%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGVDIVQWVR
Sbjct  853  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGVDIVQWVR  912

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            KMTD  KE V+K+LD RLS++PIHE  H+FYVA+LCVEEQAVERP MREVVQ+LTE+PK 
Sbjct  913  KMTDSNKESVLKVLDPRLSSIPIHEVTHVFYVAMLCVEEQAVERPTMREVVQILTEIPKL  972

Query  358  PPGTKPEGTTACESSALEP  302
            PP      T +   + + P
Sbjct  973  PPSKDQPTTESTPENEVSP  991



>gb|KHN01704.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Glycine soja]
Length=854

 Score =   229 bits (584),  Expect = 8e-66, Method: Composition-based stats.
 Identities = 107/125 (86%), Positives = 117/125 (94%), Gaps = 1/125 (1%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGVDIVQWVR
Sbjct  688  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGVDIVQWVR  747

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            KMTD  KEGV+K+LD RL +VP+HE MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK 
Sbjct  748  KMTDSNKEGVLKVLDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQILTELPK-  806

Query  358  PPGTK  344
            PP +K
Sbjct  807  PPSSK  811



>ref|XP_008787754.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Phoenix dactylifera]
Length=990

 Score =   230 bits (586),  Expect = 9e-66, Method: Composition-based stats.
 Identities = 117/165 (71%), Positives = 129/165 (78%), Gaps = 3/165 (2%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQW+R
Sbjct  826  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWMR  885

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            KMTD  KE V  ILD RLSTVP+H+ MH+FYVA+LCVEEQ+VERP MREVVQ+L+ELP+ 
Sbjct  886  KMTDSNKEAVTNILDPRLSTVPLHDVMHVFYVAMLCVEEQSVERPTMREVVQILSELPRP  945

Query  358  PPGTKPEGTTACESSALEPPPSTGTSDDAKDqqqppP---DLLSI  233
             P    + +   ES A  P PS  T    + Q  P     DLLSI
Sbjct  946  TPKPGEDSSNDEESEAPAPVPSAETPSKEQQQPAPRSPPPDLLSI  990



>gb|KJB18113.1| hypothetical protein B456_003G034400 [Gossypium raimondii]
 gb|KJB18114.1| hypothetical protein B456_003G034400 [Gossypium raimondii]
Length=1026

 Score =   229 bits (584),  Expect = 2e-65, Method: Composition-based stats.
 Identities = 122/175 (70%), Positives = 134/175 (77%), Gaps = 14/175 (8%)
 Frame = -2

Query  718   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
             ECMSA+AGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV G+KPVGEFGDGVDIVQWVR
Sbjct  853   ECMSAVAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVCGRKPVGEFGDGVDIVQWVR  912

Query  538   KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
             KMTD  KE V+K+LD RL +VP+ E MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK 
Sbjct  913   KMTDSSKESVLKVLDPRLPSVPLQEVMHVFYVAMLCVEEQAVERPTMREVVQILTELPK-  971

Query  358   PPGTKPEGTTACESSALEPP------PSTGTSDDAKDqq-------qppPDLLSI  233
             PP +K   TT  E      P      P+T  + D KDQQ         PPDLLSI
Sbjct  972   PPNSKEGDTTINEPPTSPSPDTTLDSPTTTITKDPKDQQQQPPAPKSTPPDLLSI  1026



>ref|XP_003608587.1| Receptor-like protein kinase [Medicago truncatula]
 gb|AES90784.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=1005

 Score =   229 bits (583),  Expect = 2e-65, Method: Composition-based stats.
 Identities = 107/125 (86%), Positives = 117/125 (94%), Gaps = 1/125 (1%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGVDIVQWVR
Sbjct  847  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVAGRKPVGEFGDGVDIVQWVR  906

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            KMTD  KEGV+K+LD RL +VP++E MH+FYVA+LCVEEQAVERP MREVVQMLTELPK 
Sbjct  907  KMTDSNKEGVLKVLDPRLPSVPLNEVMHVFYVAMLCVEEQAVERPTMREVVQMLTELPK-  965

Query  358  PPGTK  344
            PP +K
Sbjct  966  PPSSK  970



>ref|XP_010484412.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Camelina sativa]
Length=1005

 Score =   229 bits (583),  Expect = 2e-65, Method: Composition-based stats.
 Identities = 106/139 (76%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGVDIVQWVR
Sbjct  853  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGVDIVQWVR  912

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            KMTD  KE V+K+LD RLS++PIHE  H+FYVA+LCVEEQAVERP MREVVQ+LTE+PK 
Sbjct  913  KMTDSNKESVLKVLDPRLSSIPIHEVTHVFYVAMLCVEEQAVERPTMREVVQILTEIPKS  972

Query  358  PPGTKPEGTTACESSALEP  302
             P      T +   + L P
Sbjct  973  LPSKDQPTTESTPENELSP  991



>emb|CDY45620.1| BnaCnng13280D [Brassica napus]
Length=973

 Score =   228 bits (582),  Expect = 3e-65, Method: Composition-based stats.
 Identities = 104/129 (81%), Positives = 115/129 (89%), Gaps = 0/129 (0%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGVDIVQWVR
Sbjct  823  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGVDIVQWVR  882

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            KMTD  K+ V+K+LD RLS++PIHE  H+FYVA+LCVEEQAVERP MREVVQ+LTE+PK 
Sbjct  883  KMTDSNKDSVLKVLDPRLSSIPIHEVTHVFYVAMLCVEEQAVERPTMREVVQILTEVPKM  942

Query  358  PPGTKPEGT  332
            PP      T
Sbjct  943  PPSKDQPAT  951



>ref|XP_003611507.1| Receptor-like protein kinase [Medicago truncatula]
Length=1109

 Score =   229 bits (584),  Expect = 3e-65, Method: Composition-based stats.
 Identities = 116/153 (76%), Positives = 127/153 (83%), Gaps = 8/153 (5%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGVDIVQWVR
Sbjct  850  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGVDIVQWVR  909

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            KMTD  KEGV+K+LD RLS+VP+ E MH+FYVA+LCVEEQAVERP MREVVQ+LTELPK 
Sbjct  910  KMTDSNKEGVLKVLDPRLSSVPLQEVMHVFYVAILCVEEQAVERPTMREVVQILTELPKS  969

Query  358  PPGTKPEGTTACESS-----ALEPPPSTGTSDD  275
               +K   +T  ESS     ALE P  T  S D
Sbjct  970  TE-SKLGDSTITESSLSSSNALESP--TAASKD  999



>ref|XP_010936307.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Elaeis guineensis]
Length=1007

 Score =   228 bits (582),  Expect = 3e-65, Method: Composition-based stats.
 Identities = 103/121 (85%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGVDIVQWVR
Sbjct  861  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGVDIVQWVR  920

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            KMTD KKEGV+ +LD RL +VP+HEAMH+FYVA+LCVEEQ++ERP MREVVQ+LTELP+ 
Sbjct  921  KMTDSKKEGVLSVLDPRLPSVPLHEAMHVFYVAMLCVEEQSIERPTMREVVQILTELPRP  980

Query  358  P  356
            P
Sbjct  981  P  981



>gb|EYU41357.1| hypothetical protein MIMGU_mgv1a000718mg [Erythranthe guttata]
Length=1006

 Score =   228 bits (581),  Expect = 4e-65, Method: Composition-based stats.
 Identities = 107/141 (76%), Positives = 115/141 (82%), Gaps = 0/141 (0%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGVDIVQWVR
Sbjct  860  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGVDIVQWVR  919

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            KMT+G K+G VK+LD RL  VP+HE  H+FYVA+LCVEEQAVERP MREVVQMLTELP  
Sbjct  920  KMTEGNKQGAVKVLDPRLERVPLHEVTHVFYVAMLCVEEQAVERPTMREVVQMLTELPGD  979

Query  358  PPGTKPEGTTACESSALEPPP  296
                   G    E     PPP
Sbjct  980  SGSEVKLGHQEQEMPISSPPP  1000



>emb|CDY08759.1| BnaA06g24650D [Brassica napus]
Length=971

 Score =   228 bits (581),  Expect = 4e-65, Method: Composition-based stats.
 Identities = 104/129 (81%), Positives = 115/129 (89%), Gaps = 0/129 (0%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGVDIVQWVR
Sbjct  821  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGVDIVQWVR  880

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            KMTD  K+ V+K+LD RLS++PIHE  H+FYVA+LCVEEQAVERP MREVVQ+LTE+PK 
Sbjct  881  KMTDSNKDSVLKVLDPRLSSIPIHEVTHVFYVAMLCVEEQAVERPTMREVVQILTEVPKM  940

Query  358  PPGTKPEGT  332
            PP      T
Sbjct  941  PPSKDQPAT  949



>ref|XP_009150662.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Brassica rapa]
Length=997

 Score =   228 bits (581),  Expect = 4e-65, Method: Composition-based stats.
 Identities = 104/129 (81%), Positives = 115/129 (89%), Gaps = 0/129 (0%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGVDIVQWVR
Sbjct  847  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGVDIVQWVR  906

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            KMTD  K+ V+K+LD RLS++PIHE  H+FYVA+LCVEEQAVERP MREVVQ+LTE+PK 
Sbjct  907  KMTDSNKDSVLKVLDPRLSSIPIHEVTHVFYVAMLCVEEQAVERPTMREVVQILTEVPKM  966

Query  358  PPGTKPEGT  332
            PP      T
Sbjct  967  PPSKDQAAT  975



>ref|XP_006650665.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Oryza brachyantha]
Length=1021

 Score =   228 bits (580),  Expect = 6e-65, Method: Composition-based stats.
 Identities = 112/157 (71%), Positives = 126/157 (80%), Gaps = 6/157 (4%)
 Frame = -2

Query  718   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
             ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGVDIV WVR
Sbjct  846   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGVDIVHWVR  905

Query  538   KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
              MTD  KE V+K+LD RLSTVP+HE MH+FYVALLC+EEQ+V+RP MREVVQ+L+ELPK 
Sbjct  906   MMTDSNKEQVMKVLDPRLSTVPLHEVMHIFYVALLCIEEQSVQRPTMREVVQILSELPKL  965

Query  358   PPGTKPEGTTACESSALEPP---PS---TGTSDDAKD  266
              P      + A + SA  PP   PS      + DAKD
Sbjct  966   APRQGEVLSHAVDGSASNPPAPVPSGSAKAPTGDAKD  1002



>ref|XP_004955422.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Setaria italica]
Length=1030

 Score =   227 bits (579),  Expect = 8e-65, Method: Composition-based stats.
 Identities = 110/155 (71%), Positives = 127/155 (82%), Gaps = 4/155 (3%)
 Frame = -2

Query  718   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
             +CMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+GKKPVGEFGDGVDIVQWV+
Sbjct  855   QCMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGKKPVGEFGDGVDIVQWVK  914

Query  538   KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
              MTD  KE V+KI+D RLSTVP+HE MH+FYVALLCVEEQ+V+RP MREVVQML+ELPK 
Sbjct  915   TMTDSNKEQVIKIMDPRLSTVPVHEVMHIFYVALLCVEEQSVQRPTMREVVQMLSELPKP  974

Query  358   PPGTKPEGTTACESSALEPPPSTGT----SDDAKD  266
                   E  +  + +A  PP S  +    +D+AK+
Sbjct  975   TSRQGDELPSGDDGAAPNPPVSADSVEALNDEAKE  1009



>ref|XP_008785758.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1, partial [Phoenix dactylifera]
Length=782

 Score =   225 bits (574),  Expect = 1e-64, Method: Composition-based stats.
 Identities = 104/122 (85%), Positives = 115/122 (94%), Gaps = 0/122 (0%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGVDIVQWVR
Sbjct  624  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGVDIVQWVR  683

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            ++TD  KEGV+KILD RLS+VP+HEAMH+FYVA+LCVEEQ+VERP  REVVQ+LTELP  
Sbjct  684  EVTDSSKEGVLKILDPRLSSVPLHEAMHVFYVAMLCVEEQSVERPTTREVVQILTELPGP  743

Query  358  PP  353
            PP
Sbjct  744  PP  745



>ref|XP_010939309.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Elaeis guineensis]
Length=1020

 Score =   226 bits (576),  Expect = 2e-64, Method: Composition-based stats.
 Identities = 103/121 (85%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGVDIVQWVR
Sbjct  862  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGVDIVQWVR  921

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            K+TD  KEG++KI+D RLS+VP+HEAMH+FYVA+LCVEEQ+VERP MREVVQ+LTELP  
Sbjct  922  KVTDTNKEGILKIIDPRLSSVPLHEAMHVFYVAMLCVEEQSVERPTMREVVQILTELPGT  981

Query  358  P  356
            P
Sbjct  982  P  982



>gb|EAY92008.1| hypothetical protein OsI_13698 [Oryza sativa Indica Group]
Length=1029

 Score =   226 bits (576),  Expect = 2e-64, Method: Composition-based stats.
 Identities = 112/157 (71%), Positives = 126/157 (80%), Gaps = 6/157 (4%)
 Frame = -2

Query  718   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
             ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGVDIVQWVR
Sbjct  854   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGVDIVQWVR  913

Query  538   KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
              MTD  KE V+K+LD RLSTVP+HE MH+FYVALLC+EEQ+V+RP MREVVQ+L+ELPK 
Sbjct  914   MMTDSNKEQVMKVLDPRLSTVPLHEVMHVFYVALLCIEEQSVQRPTMREVVQILSELPKL  973

Query  358   PPGTKPEGTTACESSALEPP---PS---TGTSDDAKD  266
              P      + A +  A  PP   PS      + DAKD
Sbjct  974   APRQGEVLSHAVDGFASNPPAPVPSGSAEALTGDAKD  1010



>gb|AAP68887.1| putative receptor-like protein kinase 1 [Oryza sativa Japonica 
Group]
 gb|ABF99107.1| Receptor protein kinase CLAVATA1 precursor, putative, expressed 
[Oryza sativa Japonica Group]
Length=1029

 Score =   226 bits (576),  Expect = 2e-64, Method: Composition-based stats.
 Identities = 112/157 (71%), Positives = 126/157 (80%), Gaps = 6/157 (4%)
 Frame = -2

Query  718   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
             ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGVDIVQWVR
Sbjct  854   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGVDIVQWVR  913

Query  538   KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
              MTD  KE V+K+LD RLSTVP+HE MH+FYVALLC+EEQ+V+RP MREVVQ+L+ELPK 
Sbjct  914   MMTDSNKEQVMKVLDPRLSTVPLHEVMHVFYVALLCIEEQSVQRPTMREVVQILSELPKL  973

Query  358   PPGTKPEGTTACESSALEPP---PS---TGTSDDAKD  266
              P      + A +  A  PP   PS      + DAKD
Sbjct  974   APRQGEVLSHAVDGFASNPPAPVPSGSAEALTGDAKD  1010



>ref|NP_001051418.1| Os03g0773700 [Oryza sativa Japonica Group]
 dbj|BAF13332.1| Os03g0773700, partial [Oryza sativa Japonica Group]
Length=885

 Score =   225 bits (573),  Expect = 3e-64, Method: Composition-based stats.
 Identities = 112/157 (71%), Positives = 126/157 (80%), Gaps = 6/157 (4%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGVDIVQWVR
Sbjct  710  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGVDIVQWVR  769

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
             MTD  KE V+K+LD RLSTVP+HE MH+FYVALLC+EEQ+V+RP MREVVQ+L+ELPK 
Sbjct  770  MMTDSNKEQVMKVLDPRLSTVPLHEVMHVFYVALLCIEEQSVQRPTMREVVQILSELPKL  829

Query  358  PPGTKPEGTTACESSALEPP---PS---TGTSDDAKD  266
             P      + A +  A  PP   PS      + DAKD
Sbjct  830  APRQGEVLSHAVDGFASNPPAPVPSGSAEALTGDAKD  866



>gb|EEE60014.1| hypothetical protein OsJ_12761 [Oryza sativa Japonica Group]
Length=979

 Score =   225 bits (574),  Expect = 3e-64, Method: Composition-based stats.
 Identities = 112/157 (71%), Positives = 126/157 (80%), Gaps = 6/157 (4%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGVDIVQWVR
Sbjct  804  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGVDIVQWVR  863

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
             MTD  KE V+K+LD RLSTVP+HE MH+FYVALLC+EEQ+V+RP MREVVQ+L+ELPK 
Sbjct  864  MMTDSNKEQVMKVLDPRLSTVPLHEVMHVFYVALLCIEEQSVQRPTMREVVQILSELPKL  923

Query  358  PPGTKPEGTTACESSALEPP---PS---TGTSDDAKD  266
             P      + A +  A  PP   PS      + DAKD
Sbjct  924  APRQGEVLSHAVDGFASNPPAPVPSGSAEALTGDAKD  960



>ref|XP_010023395.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1, partial [Eucalyptus grandis]
Length=875

 Score =   225 bits (573),  Expect = 3e-64, Method: Composition-based stats.
 Identities = 111/155 (72%), Positives = 125/155 (81%), Gaps = 5/155 (3%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG+KPVGEFGDGVDIVQW+R
Sbjct  704  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGRKPVGEFGDGVDIVQWMR  763

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            KMT+  KE V KILD RL  VP+HEAMH+FYVA+LCVEEQAVERP MREVVQ+LTE P+ 
Sbjct  764  KMTNSNKEEVQKILDPRLPAVPLHEAMHVFYVAMLCVEEQAVERPTMREVVQILTERPR-  822

Query  358  PPGTKPEGTTACESSALEPP----PSTGTSDDAKD  266
            PPG+    +    + +L P      S  T+ D K+
Sbjct  823  PPGSAKGDSVVVVAQSLPPQGLALESLATTKDGKE  857



>emb|CDY23037.1| BnaC07g31500D [Brassica napus]
Length=967

 Score =   225 bits (573),  Expect = 5e-64, Method: Composition-based stats.
 Identities = 107/142 (75%), Positives = 118/142 (83%), Gaps = 4/142 (3%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGVDIVQWVR
Sbjct  822  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGVDIVQWVR  881

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
             MTD  KE V+K++D RLS+VP+HE  H+FYVALLCVEEQAV RP MREVVQ+LTELPK 
Sbjct  882  SMTDSNKECVLKVIDHRLSSVPVHEVTHVFYVALLCVEEQAVARPTMREVVQILTELPKI  941

Query  358  PPGTKPEGTTACESSALEPPPS  293
            P   +     A ES   E  P+
Sbjct  942  PLSKQ----LAVESDVTEKSPA  959



>gb|KCW59634.1| hypothetical protein EUGRSUZ_H023832 [Eucalyptus grandis]
Length=871

 Score =   224 bits (571),  Expect = 5e-64, Method: Composition-based stats.
 Identities = 111/155 (72%), Positives = 125/155 (81%), Gaps = 5/155 (3%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSG+KPVGEFGDGVDIVQW+R
Sbjct  700  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGRKPVGEFGDGVDIVQWMR  759

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            KMT+  KE V KILD RL  VP+HEAMH+FYVA+LCVEEQAVERP MREVVQ+LTE P+ 
Sbjct  760  KMTNSNKEEVQKILDPRLPAVPLHEAMHVFYVAMLCVEEQAVERPTMREVVQILTERPR-  818

Query  358  PPGTKPEGTTACESSALEPP----PSTGTSDDAKD  266
            PPG+    +    + +L P      S  T+ D K+
Sbjct  819  PPGSAKGDSVVVVAQSLPPQGLALESLATTKDGKE  853



>ref|NP_190536.1| CLAVATA1-related receptor kinase-like protein [Arabidopsis thaliana]
 sp|Q9M2Z1.1|BAME2_ARATH RecName: Full=Leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2; AltName: Full=Protein BARELY ANY MERISTEM 
2; Flags: Precursor [Arabidopsis thaliana]
 emb|CAB66905.1| receptor protein kinase-like protein [Arabidopsis thaliana]
 gb|AAO64138.1| putative leucine-rich repeat transmembrane protein kinase [Arabidopsis 
thaliana]
 gb|AAP04098.1| putative leucine-rich repeat transmembrane protein kinase [Arabidopsis 
thaliana]
 dbj|BAF00510.1| receptor protein kinase like protein [Arabidopsis thaliana]
 gb|ACN59331.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE78574.1| CLAVATA1-related receptor kinase-like protein [Arabidopsis thaliana]
Length=1002

 Score =   224 bits (572),  Expect = 6e-64, Method: Composition-based stats.
 Identities = 107/146 (73%), Positives = 120/146 (82%), Gaps = 4/146 (3%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++GKKPVGEFGDGVDIVQWVR
Sbjct  848  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGKKPVGEFGDGVDIVQWVR  907

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
             MTD  K+ V+K++D RLS+VP+HE  H+FYVALLCVEEQAVERP MREVVQ+LTE+PK 
Sbjct  908  SMTDSNKDCVLKVIDLRLSSVPVHEVTHVFYVALLCVEEQAVERPTMREVVQILTEIPKI  967

Query  358  PPGTKPEGTTACESSALEPPPSTGTS  281
            P   +     A ES   E  P+   S
Sbjct  968  PLSKQ----QAAESDVTEKAPAINES  989



>ref|XP_002461427.1| hypothetical protein SORBIDRAFT_02g002450 [Sorghum bicolor]
 gb|EER97948.1| hypothetical protein SORBIDRAFT_02g002450 [Sorghum bicolor]
Length=1031

 Score =   225 bits (573),  Expect = 6e-64, Method: Composition-based stats.
 Identities = 106/138 (77%), Positives = 119/138 (86%), Gaps = 7/138 (5%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            +CMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+GKKPVGEFGDGVDIVQWV+
Sbjct  855  QCMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGKKPVGEFGDGVDIVQWVK  914

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK-  362
             MTD  KE V+KI+D RLSTVP+HE MH+FYVALLCVEEQ+V+RP MREVVQML+ELPK 
Sbjct  915  TMTDANKEQVIKIMDPRLSTVPVHEVMHVFYVALLCVEEQSVQRPTMREVVQMLSELPKP  974

Query  361  ------QPPGTKPEGTTA  326
                  +PP    +G+ A
Sbjct  975  AARQGDEPPSVDDDGSAA  992



>ref|XP_006290548.1| hypothetical protein CARUB_v10016631mg [Capsella rubella]
 gb|EOA23446.1| hypothetical protein CARUB_v10016631mg [Capsella rubella]
Length=997

 Score =   224 bits (571),  Expect = 8e-64, Method: Composition-based stats.
 Identities = 107/151 (71%), Positives = 122/151 (81%), Gaps = 3/151 (2%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++GKKPVGEFGDGVDIVQWVR
Sbjct  843  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGKKPVGEFGDGVDIVQWVR  902

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
             MTD  K+ V+K++D RLS+VP+HE  H+FYVALLCVEEQAVERP MREVVQ+LTE+PK 
Sbjct  903  SMTDSNKDCVLKVIDLRLSSVPVHEVTHVFYVALLCVEEQAVERPTMREVVQILTEIPKL  962

Query  358  PPGTKPEGTTACESSAL---EPPPSTGTSDD  275
            P   + E  +     A    E  P +G+  D
Sbjct  963  PLSKQQETESDVTEKAPRMNESSPDSGSPPD  993



>gb|EAZ02682.1| hypothetical protein OsI_24796 [Oryza sativa Indica Group]
Length=1023

 Score =   224 bits (572),  Expect = 8e-64, Method: Composition-based stats.
 Identities = 112/156 (72%), Positives = 128/156 (82%), Gaps = 9/156 (6%)
 Frame = -2

Query  718   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
             ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++GKKPVGEFGDGVDIVQWV+
Sbjct  853   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGKKPVGEFGDGVDIVQWVK  912

Query  538   KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
              MTD  KE V+KILD RLSTVP+HE MH+FYVALLCVEEQ+V+RP MREVVQ+L+ELPK 
Sbjct  913   TMTDSNKEHVIKILDPRLSTVPVHEVMHVFYVALLCVEEQSVQRPTMREVVQILSELPK-  971

Query  358   PPGTK-----PEGTTACESSALEPPPSTGTSDDAKD  266
              P +K     P G  A   S L  P  +  +++AK+
Sbjct  972   -PTSKQGEEPPSGEGAV--SDLVVPAESAEANEAKE  1004



>ref|XP_010943209.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat receptor-like 
serine/threonine-protein kinase BAM1 [Elaeis guineensis]
Length=995

 Score =   224 bits (570),  Expect = 1e-63, Method: Composition-based stats.
 Identities = 120/170 (71%), Positives = 135/170 (79%), Gaps = 8/170 (5%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQW+R
Sbjct  826  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWMR  885

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            KMTD  K+ V  ILD RLS+VP+H+ MH+FYVA+LCVEEQ+VERP MREVVQ+L+ELP+ 
Sbjct  886  KMTDSNKQAVTNILDPRLSSVPLHDVMHVFYVAMLCVEEQSVERPTMREVVQILSELPRP  945

Query  358  PPGTKPEGTTACESS-ALEPPPSTGT-SDDAKDqqqppP------DLLSI  233
             P    E ++  E S A  P PS  T S + K+QQQ P       DLLSI
Sbjct  946  TPKPGEEDSSNNEESGAPAPVPSAETPSKETKEQQQQPARQSPPPDLLSI  995



>dbj|BAC82955.1| putative OsLRK1(receptor-type protein kinase) [Oryza sativa Japonica 
Group]
 dbj|BAD30615.1| putative OsLRK1(receptor-type protein kinase) [Oryza sativa Japonica 
Group]
 gb|EAZ38608.1| hypothetical protein OsJ_22997 [Oryza sativa Japonica Group]
 dbj|BAH01666.1| unnamed protein product [Oryza sativa Japonica Group]
Length=1023

 Score =   224 bits (570),  Expect = 1e-63, Method: Composition-based stats.
 Identities = 108/153 (71%), Positives = 127/153 (83%), Gaps = 3/153 (2%)
 Frame = -2

Query  718   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
             ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++GKKPVGEFGDGVDIVQWV+
Sbjct  853   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGKKPVGEFGDGVDIVQWVK  912

Query  538   KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
              MTD  KE V+KILD RLSTVP+HE MH+FYVALLCVEEQ+V+RP MREVVQ+L+ELPK 
Sbjct  913   TMTDSNKEHVIKILDPRLSTVPVHEVMHVFYVALLCVEEQSVQRPTMREVVQILSELPK-  971

Query  358   PPGTKPEGTTACESSALE--PPPSTGTSDDAKD  266
             P   + E   + E +  +   P  +  +++AK+
Sbjct  972   PTSKQGEEPPSGEGAVFDLVVPAESAEANEAKE  1004



>ref|XP_008787359.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat receptor-like 
serine/threonine-protein kinase BAM1, partial [Phoenix 
dactylifera]
Length=1004

 Score =   224 bits (570),  Expect = 1e-63, Method: Composition-based stats.
 Identities = 101/123 (82%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL+SG+KPVGEFGDGVDIVQWVR
Sbjct  853  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELISGRKPVGEFGDGVDIVQWVR  912

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            KMTD  +E V +ILD RLSTVP+HE +H+F+VA+LCVEEQ+VERP MREVVQ+L E PK 
Sbjct  913  KMTDSNREAVTEILDPRLSTVPLHEVLHVFHVAMLCVEEQSVERPTMREVVQILAEFPKP  972

Query  358  PPG  350
             PG
Sbjct  973  KPG  975



>emb|CDY02112.1| BnaA03g40550D [Brassica napus]
Length=969

 Score =   223 bits (569),  Expect = 2e-63, Method: Composition-based stats.
 Identities = 106/147 (72%), Positives = 119/147 (81%), Gaps = 4/147 (3%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGVDIVQWVR
Sbjct  823  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGVDIVQWVR  882

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
             MTD  KE V+K++D RLS+VP+HE  H+FYVA+LCVEEQAV RP MREVVQ+LTE+PK 
Sbjct  883  SMTDSNKECVLKVIDHRLSSVPVHEVTHVFYVAMLCVEEQAVARPTMREVVQILTEVPKI  942

Query  358  PPGTKPEGTTACESSALEPPPSTGTSD  278
            P   +     A ES   E  P+    D
Sbjct  943  PLSEQ----LAVESDVTEKSPAVDEED  965



>ref|XP_004981595.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Setaria italica]
Length=1029

 Score =   223 bits (569),  Expect = 2e-63, Method: Composition-based stats.
 Identities = 109/150 (73%), Positives = 123/150 (82%), Gaps = 1/150 (1%)
 Frame = -2

Query  718   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
             ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGVDIVQW +
Sbjct  854   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGVDIVQWAK  913

Query  538   KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
              MTD  KE V+KILD RLSTVP+HE MH+FYVALLC EEQ+V+RP MREVVQ+L+ELPK 
Sbjct  914   MMTDSSKEQVMKILDPRLSTVPLHEIMHVFYVALLCTEEQSVQRPTMREVVQILSELPKP  973

Query  358   PPGTKPEGTTACESSALEP-PPSTGTSDDA  272
                   E   AC+ SA  P  P+   S++A
Sbjct  974   STKQGEEVPNACDGSASGPLHPAPAGSNEA  1003



>ref|XP_009136515.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Brassica rapa]
Length=993

 Score =   223 bits (568),  Expect = 2e-63, Method: Composition-based stats.
 Identities = 106/147 (72%), Positives = 119/147 (81%), Gaps = 4/147 (3%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGVDIVQWVR
Sbjct  847  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGVDIVQWVR  906

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
             MTD  KE V+K++D RLS+VP+HE  H+FYVA+LCVEEQAV RP MREVVQ+LTE+PK 
Sbjct  907  SMTDSNKECVLKVIDHRLSSVPVHEVTHVFYVAMLCVEEQAVARPMMREVVQILTEVPKI  966

Query  358  PPGTKPEGTTACESSALEPPPSTGTSD  278
            P   +     A ES   E  P+    D
Sbjct  967  PLSEQ----LAVESDVTEKSPAVDEED  989



>gb|KFK34238.1| hypothetical protein AALP_AA5G119100 [Arabis alpina]
Length=998

 Score =   223 bits (568),  Expect = 2e-63, Method: Composition-based stats.
 Identities = 106/142 (75%), Positives = 119/142 (84%), Gaps = 4/142 (3%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVL+EL++G+KPVGEFGDGVDIVQWVR
Sbjct  844  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLMELITGRKPVGEFGDGVDIVQWVR  903

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
             MTD  KE V+K++D RLS+VPIHE  H+FYVALLCVEEQAVERP MREVVQ+LTE+PK 
Sbjct  904  SMTDSNKECVLKVIDLRLSSVPIHEVTHVFYVALLCVEEQAVERPTMREVVQILTEIPK-  962

Query  358  PPGTKPEGTTACESSALEPPPS  293
                 P    A ES+  E  P+
Sbjct  963  ---ILPTKQHAAESNVTEISPA  981



>dbj|BAJ84911.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96166.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1020

 Score =   223 bits (567),  Expect = 3e-63, Method: Composition-based stats.
 Identities = 105/146 (72%), Positives = 122/146 (84%), Gaps = 3/146 (2%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++GKKPVGEFGDGVDIV W++
Sbjct  848  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGKKPVGEFGDGVDIVHWIK  907

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK-  362
              TD KKE V+KI+D RLSTVP+HE MH+FYVALLCVEEQ+V+RP MREVVQ+L+ELPK 
Sbjct  908  MTTDSKKEQVIKIMDPRLSTVPVHEVMHVFYVALLCVEEQSVQRPTMREVVQILSELPKP  967

Query  361  --QPPGTKPEGTTACESSALEPPPST  290
              +  G +  G++  +   L  PP T
Sbjct  968  IAKQGGEQLTGSSDGDEPGLSGPPET  993



>ref|XP_009399076.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1021

 Score =   223 bits (567),  Expect = 4e-63, Method: Composition-based stats.
 Identities = 109/147 (74%), Positives = 120/147 (82%), Gaps = 1/147 (1%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGVDIVQWVR
Sbjct  851  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGVDIVQWVR  910

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            KMT   KE V KILD RL T PIHE MH+FYVA+LCVEEQ+V RP MREVVQMLTELP  
Sbjct  911  KMTGSDKENVAKILDPRLPTAPIHEVMHVFYVAMLCVEEQSVGRPTMREVVQMLTELPI-  969

Query  358  PPGTKPEGTTACESSALEPPPSTGTSD  278
            P   + E +++   +A  PPP   + D
Sbjct  970  PSLKQGEDSSSGNVTAQPPPPIVASVD  996



>ref|XP_002875982.1| hypothetical protein ARALYDRAFT_906265 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52241.1| hypothetical protein ARALYDRAFT_906265 [Arabidopsis lyrata subsp. 
lyrata]
Length=1001

 Score =   222 bits (566),  Expect = 5e-63, Method: Composition-based stats.
 Identities = 107/146 (73%), Positives = 120/146 (82%), Gaps = 4/146 (3%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++GKKPVGEFGDGVDIVQWVR
Sbjct  847  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGKKPVGEFGDGVDIVQWVR  906

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
             MTD  K+ V+K++D RLS+VP+HE  H+FYVALLCVEEQAVERP MREVVQ+LTE+PK 
Sbjct  907  SMTDSNKDCVLKVIDLRLSSVPVHEVTHVFYVALLCVEEQAVERPTMREVVQILTEIPKI  966

Query  358  PPGTKPEGTTACESSALEPPPSTGTS  281
            P   +     A ES   E  P+   S
Sbjct  967  PLLKQ----QAAESDVSEKAPAMNES  988



>ref|XP_006657429.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Oryza brachyantha]
Length=864

 Score =   221 bits (563),  Expect = 6e-63, Method: Composition-based stats.
 Identities = 110/156 (71%), Positives = 127/156 (81%), Gaps = 9/156 (6%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++GKKPVGEFGDGVDIVQWV+
Sbjct  689  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGKKPVGEFGDGVDIVQWVK  748

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
             MTD  KE V+KILD RLSTVP+HE MH+FYVALLCVEEQ+++RP MREVVQ+L+ELPK 
Sbjct  749  TMTDSNKEQVIKILDPRLSTVPVHEVMHVFYVALLCVEEQSMQRPTMREVVQILSELPK-  807

Query  358  PPGTK-----PEGTTACESSALEPPPSTGTSDDAKD  266
             P +K     P G  A     L  P  +  +++AK+
Sbjct  808  -PASKQGEEPPSGEGAVPD--LVVPAESAEANEAKE  840



>gb|ADB85328.1| putative receptor protein kinase [Phyllostachys edulis]
Length=743

 Score =   219 bits (559),  Expect = 9e-63, Method: Composition-based stats.
 Identities = 107/150 (71%), Positives = 123/150 (82%), Gaps = 1/150 (1%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGVDIVQWVR
Sbjct  569  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGVDIVQWVR  628

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
             MTD  KE V+ I D RLSTVP+HE MH+FYVALLCVEEQ+V+RP MREVVQ+L++LPK 
Sbjct  629  MMTDSNKEQVMMIRDPRLSTVPLHEVMHVFYVALLCVEEQSVQRPTMREVVQILSDLPKP  688

Query  358  PPGTKPEGTTACESSAL-EPPPSTGTSDDA  272
             P    + + + + SA   P P+   S +A
Sbjct  689  APKQGEDLSLSGDGSASNSPAPAPSGSAEA  718



>ref|XP_009397330.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1023

 Score =   221 bits (563),  Expect = 1e-62, Method: Composition-based stats.
 Identities = 103/121 (85%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGVDIVQWVR
Sbjct  853  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGVDIVQWVR  912

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            K+T   KE V KILD RL T+P+HEAMH+FYVA+LCVEEQ+VERP MREVVQ+LTELPK 
Sbjct  913  KVTGSNKEEVTKILDPRLPTLPVHEAMHVFYVAMLCVEEQSVERPTMREVVQILTELPKP  972

Query  358  P  356
            P
Sbjct  973  P  973



>ref|XP_010941985.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Elaeis guineensis]
Length=1024

 Score =   221 bits (563),  Expect = 2e-62, Method: Composition-based stats.
 Identities = 107/151 (71%), Positives = 121/151 (80%), Gaps = 3/151 (2%)
 Frame = -2

Query  718   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
             ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL+SG+KPVGEFGDGVDIVQWVR
Sbjct  853   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELISGRKPVGEFGDGVDIVQWVR  912

Query  538   KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
             KMTD  KE V +ILD RLSTVP+ E +H+F+VA+LCVEEQ+VERP MREVVQ+L E PK 
Sbjct  913   KMTDSNKEAVSEILDPRLSTVPLQEVIHVFHVAMLCVEEQSVERPTMREVVQILAEFPKP  972

Query  358   PPG---TKPEGTTACESSALEPPPSTGTSDD  275
              PG   +  EG+       +E   S  T +D
Sbjct  973   KPGEDSSANEGSVPPPPVPVEETSSKETKED  1003



>gb|EMS57320.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Triticum urartu]
Length=788

 Score =   219 bits (559),  Expect = 2e-62, Method: Composition-based stats.
 Identities = 108/156 (69%), Positives = 126/156 (81%), Gaps = 5/156 (3%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++GKKPVGEFGDGVDIV W++
Sbjct  613  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGKKPVGEFGDGVDIVHWIK  672

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
             MTD K+E V+KI+D RLSTVP+HE MH+FYVALLCVEEQ+V+RP MREVVQ+L+ELPK 
Sbjct  673  MMTDSKREQVIKIMDPRLSTVPVHEVMHVFYVALLCVEEQSVQRPTMREVVQILSELPKP  732

Query  358  PPGTKPEGTTAC----ESSALEPPPSTG-TSDDAKD  266
                  E  T      ES  + PP +    +D+AK+
Sbjct  733  TTKHGEEQLTGSGDGDESGPVGPPETVEPATDEAKE  768



>ref|XP_006404116.1| hypothetical protein EUTSA_v10010092mg [Eutrema salsugineum]
 gb|ESQ45569.1| hypothetical protein EUTSA_v10010092mg [Eutrema salsugineum]
Length=1009

 Score =   220 bits (561),  Expect = 2e-62, Method: Composition-based stats.
 Identities = 105/146 (72%), Positives = 120/146 (82%), Gaps = 3/146 (2%)
 Frame = -2

Query  718   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
             ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+KPVGEFGDGVDIVQWVR
Sbjct  860   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRKPVGEFGDGVDIVQWVR  919

Query  538   KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
              MTD  K+ V+K++D RLS+VPIHE  H+FYVA+LCVEE+AVERP MREVVQ+LTE+PK 
Sbjct  920   GMTDSNKDCVLKVIDLRLSSVPIHEVTHVFYVAMLCVEERAVERPTMREVVQILTEIPKI  979

Query  358   PPGTKPEGTTACESSALEPPPSTGTS  281
             P   +     A ES   E  P+   S
Sbjct  980   PISKQ---KAAAESDVTEKSPAMNES  1002



>ref|XP_003558681.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Brachypodium distachyon]
Length=1027

 Score =   220 bits (561),  Expect = 3e-62, Method: Composition-based stats.
 Identities = 101/119 (85%), Positives = 112/119 (94%), Gaps = 0/119 (0%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGVDIVQWV+
Sbjct  853  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGVDIVQWVK  912

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK  362
             MTD  KE V+KILD RLSTVP+HE MH+FYVALLC+EEQ+V+RP MREVVQ+L+ELPK
Sbjct  913  MMTDSNKEQVMKILDPRLSTVPLHEVMHVFYVALLCIEEQSVQRPTMREVVQILSELPK  971



>ref|XP_010028033.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Eucalyptus grandis]
 gb|KCW54695.1| hypothetical protein EUGRSUZ_I00635 [Eucalyptus grandis]
Length=1023

 Score =   220 bits (560),  Expect = 3e-62, Method: Composition-based stats.
 Identities = 109/140 (78%), Positives = 118/140 (84%), Gaps = 4/140 (3%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGVDIVQWVR
Sbjct  862  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGVDIVQWVR  921

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            KMT+  KE V  ILD RL+TVP+HEAMH+FYVA+LCVEEQAVERP MREVVQ+LTE PK 
Sbjct  922  KMTNSNKEEVQLILDPRLNTVPLHEAMHLFYVAMLCVEEQAVERPTMREVVQILTEFPKP  981

Query  358  PPGTKPEGTTACESSALEPP  299
                + E  T    S LE P
Sbjct  982  CNVKQDEPLT----SPLESP  997



>ref|XP_003557615.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Brachypodium distachyon]
Length=1019

 Score =   219 bits (559),  Expect = 4e-62, Method: Composition-based stats.
 Identities = 104/139 (75%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++GKKPVGEFGDGVDIVQW++
Sbjct  848  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGKKPVGEFGDGVDIVQWIK  907

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
             MTD  KE V+KI+D RLSTVP+HE MH+FYVALLCVEEQ+V+RP MREVVQ+L+E PK 
Sbjct  908  MMTDSSKERVIKIMDPRLSTVPVHEVMHVFYVALLCVEEQSVQRPTMREVVQILSEPPKL  967

Query  358  PPGTKPEGTTACESSALEP  302
             P    E   + E   L+P
Sbjct  968  IPKQGEELPGSGEGDELDP  986



>ref|XP_010515326.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Camelina sativa]
Length=1000

 Score =   219 bits (559),  Expect = 4e-62, Method: Composition-based stats.
 Identities = 104/149 (70%), Positives = 120/149 (81%), Gaps = 3/149 (2%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+KPVGEFG GVDIVQWVR
Sbjct  846  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRKPVGEFGAGVDIVQWVR  905

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
             MTD  K+ V+K++D RLS+VP+HE  H+FYVALLCVEEQAVERP MREVVQ+L E+PK 
Sbjct  906  SMTDSNKDCVLKVIDLRLSSVPVHEVTHVFYVALLCVEEQAVERPTMREVVQILAEIPKM  965

Query  358  PPGTKPEGTTACESSALEPPPSTGTSDDA  272
            P   + E  +     A   PP   +S D+
Sbjct  966  PLTKQLETESDVTEKA---PPMNDSSPDS  991



>gb|AAO26313.1| receptor-like protein kinase, partial [Elaeis guineensis]
Length=481

 Score =   213 bits (542),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 101/121 (83%), Positives = 114/121 (94%), Gaps = 1/121 (1%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            EC+SAIAGSYGYIAPEYA TLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGVDIVQWVR
Sbjct  324  ECISAIAGSYGYIAPEYA-TLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGVDIVQWVR  382

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            K+TD  KEG++KI+D RLS+VP+HEAMH+FYVA+LCVEEQ+VERP MREVVQ+LTELP  
Sbjct  383  KVTDTNKEGILKIIDPRLSSVPLHEAMHVFYVAMLCVEEQSVERPTMREVVQILTELPGT  442

Query  358  P  356
            P
Sbjct  443  P  443



>ref|XP_010503631.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Camelina sativa]
Length=999

 Score =   219 bits (557),  Expect = 8e-62, Method: Composition-based stats.
 Identities = 104/146 (71%), Positives = 118/146 (81%), Gaps = 4/146 (3%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+KPVGEFG GVDIVQWVR
Sbjct  845  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRKPVGEFGAGVDIVQWVR  904

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
             MTD  K+ V+K++D RLS+VP+HE  H+FYVALLCVEEQAVERP MREVVQ+L E+PK 
Sbjct  905  SMTDSNKDCVLKVIDLRLSSVPVHEVTHVFYVALLCVEEQAVERPTMREVVQILAEIPKM  964

Query  358  PPGTKPEGTTACESSALEPPPSTGTS  281
            P   + E     ES   E  P+   S
Sbjct  965  PLTKQLE----TESDVTEKAPAMNES  986



>gb|AAY32333.1| RLK1 [Phyllostachys praecox]
Length=804

 Score =   218 bits (554),  Expect = 8e-62, Method: Composition-based stats.
 Identities = 105/155 (68%), Positives = 124/155 (80%), Gaps = 4/155 (3%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++GKKPV EFGDGVDIV WV+
Sbjct  632  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGKKPVWEFGDGVDIVHWVK  691

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
             MTD  KE V+KILD RLSTVP+HE MH+FYVALLCVEEQ+V+RP MREVVQ+L+ELP  
Sbjct  692  MMTDLNKEQVIKILDPRLSTVPVHEVMHVFYVALLCVEEQSVQRPTMREVVQILSELPSP  751

Query  358  PPGTKPEGTTACESSALEPPPST----GTSDDAKD  266
                  E  +  + +A +PP +       +++AK+
Sbjct  752  TSKQGEEFPSGGDGAASDPPAAAESVEAVTNEAKE  786



>ref|XP_009394785.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1006

 Score =   219 bits (557),  Expect = 9e-62, Method: Composition-based stats.
 Identities = 105/138 (76%), Positives = 119/138 (86%), Gaps = 4/138 (3%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGVDIVQWVR
Sbjct  858  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGVDIVQWVR  917

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            +MTD  KEGV+KILD RL TVP+ E MH+FYVA+LCVEEQ+V RP MREVVQ+LT+LP+ 
Sbjct  918  RMTDSSKEGVLKILDHRLPTVPLDEVMHVFYVAMLCVEEQSVGRPTMREVVQILTDLPR-  976

Query  358  PPGTKPEGTTACESSALE  305
            P  T+ +    CE+   E
Sbjct  977  PATTQADD---CEAPIRE  991



>gb|EMT14290.1| Receptor protein kinase CLAVATA1 [Aegilops tauschii]
Length=895

 Score =   218 bits (555),  Expect = 9e-62, Method: Composition-based stats.
 Identities = 107/156 (69%), Positives = 125/156 (80%), Gaps = 5/156 (3%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++GKKPVGEFGDGVDIV W++
Sbjct  720  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGKKPVGEFGDGVDIVHWIK  779

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
             MT  K+E V+KI+D RLSTVP+HE MH+FYVALLCVEEQ+V+RP MREVVQ+L+ELPK 
Sbjct  780  MMTGSKREQVIKIMDPRLSTVPVHEVMHVFYVALLCVEEQSVQRPTMREVVQILSELPKP  839

Query  358  PPGTKPEGTTAC----ESSALEPPPSTG-TSDDAKD  266
                  E  T      ES  + PP +    +D+AK+
Sbjct  840  TTKHGEEQLTGSGDGDESGPVGPPETVEPATDEAKE  875



>gb|EPS74129.1| hypothetical protein M569_00625, partial [Genlisea aurea]
Length=970

 Score =   218 bits (555),  Expect = 1e-61, Method: Composition-based stats.
 Identities = 102/118 (86%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGVDIVQWVR
Sbjct  853  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGVDIVQWVR  912

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELP  365
            K+T G KE V+KI+DSRLST PI E  H+FYVA+LCVEEQAVERP MREVVQ+LTELP
Sbjct  913  KITGGNKEEVMKIVDSRLSTPPIEEVTHVFYVAMLCVEEQAVERPTMREVVQILTELP  970



>ref|XP_009396449.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1006

 Score =   218 bits (556),  Expect = 1e-61, Method: Composition-based stats.
 Identities = 104/143 (73%), Positives = 119/143 (83%), Gaps = 2/143 (1%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFG+GVDIVQWVR
Sbjct  857  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGEGVDIVQWVR  916

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK-  362
            +MT   KEGV++I+D RL TVP+ E MH+FYVA+LCVEEQ+VERP MREVVQ+LT+LP  
Sbjct  917  RMTGCNKEGVLEIVDPRLPTVPLDEVMHVFYVAMLCVEEQSVERPTMREVVQILTDLPNP  976

Query  361  -QPPGTKPEGTTACESSALEPPP  296
             +  G   E  T  +  A E PP
Sbjct  977  ARKQGEDREAATKEQQQAAEKPP  999



>ref|XP_010426489.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Camelina sativa]
Length=1000

 Score =   218 bits (555),  Expect = 1e-61, Method: Composition-based stats.
 Identities = 110/161 (68%), Positives = 126/161 (78%), Gaps = 7/161 (4%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+KPVGEFG GVDIVQWVR
Sbjct  846  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRKPVGEFGAGVDIVQWVR  905

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
             MTD  K+ V+K++D RLS+VP+HE  H+FYVALLCVEEQAVERP MREVVQ+L E+PK 
Sbjct  906  SMTDSNKDCVLKVIDLRLSSVPVHEVTHVFYVALLCVEEQAVERPTMREVVQILAEIPKM  965

Query  358  PPGTKPEGTTACESSALEPPPSTGTSDDAKDqqqppPDLLS  236
            P   + E     ES   E  P   T +++      PPDLLS
Sbjct  966  PLTKQLE----TESDVTEKAP---TMNESSPDSGSPPDLLS  999



>ref|XP_009408581.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1016

 Score =   217 bits (553),  Expect = 3e-61, Method: Composition-based stats.
 Identities = 113/166 (68%), Positives = 124/166 (75%), Gaps = 6/166 (4%)
 Frame = -2

Query  718   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
             ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGVDIVQWVR
Sbjct  853   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGVDIVQWVR  912

Query  538   KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
             ++T  KK  V KILD RL TVP+HE MH+F VA+LCVEEQ+VERP MREVVQ+LTELPK 
Sbjct  913   EVTGLKKGEVTKILDPRLPTVPLHEVMHVFCVAMLCVEEQSVERPTMREVVQILTELPKP  972

Query  358   PPGTKPEGTTACESSALEPP----PSTGTSDDAKDqqqppPDLLSI  233
             PP  K  G T      +  P    P T            P DLLS+
Sbjct  973   PP--KQGGDTPTPRGDVSAPRYIIPETREQQQQPASDSLPSDLLSM  1016



>gb|EMS67650.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Triticum urartu]
Length=868

 Score =   216 bits (550),  Expect = 4e-61, Method: Composition-based stats.
 Identities = 109/163 (67%), Positives = 123/163 (75%), Gaps = 17/163 (10%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGVDIVQWV+
Sbjct  689  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGVDIVQWVK  748

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
             MT   KE V+KILD RLSTVP+HE MH+FYVALLC EE +V+RP MREVVQ+L+ELPK 
Sbjct  749  MMTGPNKEQVMKILDPRLSTVPVHEVMHVFYVALLCTEEHSVQRPTMREVVQILSELPKP  808

Query  358  P------------PGTKPEGTTACESSALEPPPSTGTSDDAKD  266
                          G  PE  T   +S+ + P     + DAKD
Sbjct  809  AANQGDGEEELPLSGEGPESNTPAPTSSTDAP-----TGDAKD  846



>ref|XP_002466378.1| hypothetical protein SORBIDRAFT_01g006690 [Sorghum bicolor]
 gb|EER93376.1| hypothetical protein SORBIDRAFT_01g006690 [Sorghum bicolor]
Length=1030

 Score =   216 bits (551),  Expect = 7e-61, Method: Composition-based stats.
 Identities = 106/146 (73%), Positives = 117/146 (80%), Gaps = 7/146 (5%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGVDIVQW +
Sbjct  856  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGVDIVQWAK  915

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
             MT+  KE V+KILD RLSTVP+ E MH+FYVALLC EEQ+V+RP MREVVQ+L+ELPK 
Sbjct  916  MMTNSSKEQVMKILDPRLSTVPLQEVMHVFYVALLCTEEQSVQRPTMREVVQILSELPK-  974

Query  358  PPGTK-----PEGTTACESSALEPPP  296
             P  K     P       SS L P P
Sbjct  975  -PANKQGEDVPNSGDGSASSPLHPAP  999



>ref|XP_009395647.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1004

 Score =   215 bits (548),  Expect = 1e-60, Method: Composition-based stats.
 Identities = 106/146 (73%), Positives = 119/146 (82%), Gaps = 8/146 (5%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLELV+G+KPVGEFG+GVDIVQWVR
Sbjct  857  ECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELVTGRKPVGEFGEGVDIVQWVR  916

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            KMTD  KEG +KILD RL T P  EAMH+FYVA LCV+EQ+VERP MREVVQ+LT+ PKQ
Sbjct  917  KMTDSNKEGALKILDPRLPTAPPDEAMHVFYVATLCVQEQSVERPTMREVVQILTDPPKQ  976

Query  358  -----PPGTKPEGTTACESSALEPPP  296
                  P  + E   A +S+   PPP
Sbjct  977  GEDRETPIKEAEQQQAAQST---PPP  999



>dbj|BAJ89729.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1030

 Score =   215 bits (548),  Expect = 2e-60, Method: Composition-based stats.
 Identities = 107/153 (70%), Positives = 122/153 (80%), Gaps = 5/153 (3%)
 Frame = -2

Query  718   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
             ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGVDIVQWV+
Sbjct  853   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGVDIVQWVK  912

Query  538   KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
              MT   KE V+KILD RLSTVP+HE MH+FYVALLC EE +V+RP MREVVQ+L+ELPK 
Sbjct  913   MMTGPSKEQVMKILDPRLSTVPVHEVMHVFYVALLCTEEHSVQRPTMREVVQILSELPK-  971

Query  358   PPGTKPEGTTACESSA----LEPPPSTGTSDDA  272
             P  ++ +G      S       PP  T +S +A
Sbjct  972   PAASQGDGEEELPLSGDGPESNPPAPTSSSTEA  1004



>gb|EMT20446.1| Receptor protein kinase CLAVATA1 [Aegilops tauschii]
Length=866

 Score =   214 bits (545),  Expect = 2e-60, Method: Composition-based stats.
 Identities = 105/149 (70%), Positives = 120/149 (81%), Gaps = 2/149 (1%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGVDIVQWV+
Sbjct  689  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGVDIVQWVK  748

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
             MT   KE V+KILD RLSTVP+HE MH+FYVALLC EE +V+RP MREVVQ+L+ELPK 
Sbjct  749  MMTGPNKEQVMKILDPRLSTVPVHEVMHVFYVALLCTEEHSVQRPTMREVVQILSELPKP  808

Query  358  PP--GTKPEGTTACESSALEPPPSTGTSD  278
                G + E   + E     PP  T +++
Sbjct  809  AANQGDEEELPLSGEGPESNPPAPTSSTE  837



>ref|XP_009394620.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1003

 Score =   214 bits (544),  Expect = 5e-60, Method: Composition-based stats.
 Identities = 107/147 (73%), Positives = 120/147 (82%), Gaps = 9/147 (6%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSA+AGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+GKKPVGE GDGVDIVQWVR
Sbjct  855  ECMSAVAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGKKPVGELGDGVDIVQWVR  914

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK-  362
            + TD KKEGV++ILD RL TVP+ EAMH+FYVA+LCVEEQ+VERP MREVVQ+L + PK 
Sbjct  915  ETTDSKKEGVLQILDRRLPTVPLDEAMHVFYVAMLCVEEQSVERPTMREVVQILMDRPKG  974

Query  361  ---QPP--GTKPEGTTACESSALEPPP  296
                 P    K +   A E+S   PPP
Sbjct  975  HGCDAPIKEVKEQQQRAAENS---PPP  998



>ref|XP_008665503.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Zea mays]
 tpg|DAA51666.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=1034

 Score =   214 bits (544),  Expect = 6e-60, Method: Composition-based stats.
 Identities = 100/125 (80%), Positives = 112/125 (90%), Gaps = 1/125 (1%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGVDIVQW +
Sbjct  850  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGVDIVQWAK  909

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
              T+  KE V+K+LD RLSTVP+HE  H+FYVALLC EEQ+V+RP MREVVQ+L+ELPK 
Sbjct  910  MTTNSNKEQVMKVLDPRLSTVPLHEVTHVFYVALLCTEEQSVQRPTMREVVQILSELPK-  968

Query  358  PPGTK  344
            PP TK
Sbjct  969  PPSTK  973



>gb|ACN35202.1| unknown [Zea mays]
Length=320

 Score =   201 bits (511),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 98/120 (82%), Positives = 107/120 (89%), Gaps = 1/120 (1%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            +CMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+GKKPVGEFGDGVDIV WVR
Sbjct  140  QCMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGKKPVGEFGDGVDIVHWVR  199

Query  538  KMTDG-KKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK  362
              T G  KE VVK++D RLS+VP+HE  H+F VALLCVEEQ+V+RP MREVVQML ELPK
Sbjct  200  STTAGASKEQVVKVMDPRLSSVPVHEVAHVFCVALLCVEEQSVQRPTMREVVQMLGELPK  259



>ref|XP_006649672.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Oryza brachyantha]
Length=1001

 Score =   211 bits (537),  Expect = 5e-59, Method: Composition-based stats.
 Identities = 111/173 (64%), Positives = 123/173 (71%), Gaps = 20/173 (12%)
 Frame = -2

Query  718   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
             ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+KPVGEFGDGVDIVQWVR
Sbjct  838   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELIAGRKPVGEFGDGVDIVQWVR  897

Query  538   KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELP--  365
              +T   KEGV KI D RLSTVP+HE  H+FYVA+LCV EQ+VERP MREVVQ+LT+LP  
Sbjct  898   MVTGSSKEGVTKIADPRLSTVPLHELTHVFYVAMLCVAEQSVERPTMREVVQILTDLPGT  957

Query  364   ---------KQPPGTKPEGTTACESSALEPPPSTGTSDDAKDqqqppPDLLSI  233
                         PG K +GTT          P      D   +  P  DLLSI
Sbjct  958   AATPMDDAASHGPG-KDQGTTT--------SPEKPQQQDGSRESPPQQDLLSI  1001



>ref|XP_009787949.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Nicotiana sylvestris]
Length=1000

 Score =   210 bits (534),  Expect = 1e-58, Method: Composition-based stats.
 Identities = 90/130 (69%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G++PVGEFGDGVDIVQW +
Sbjct  847  ECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELITGRRPVGEFGDGVDIVQWSK  906

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            ++T+ K+E V  I+D RL+TVP  EAMH+F+VA+LC++E +VERP MREV+QML+E P+Q
Sbjct  907  RVTNCKREQVTHIVDPRLTTVPEDEAMHLFFVAMLCIQENSVERPTMREVIQMLSEFPRQ  966

Query  358  PPGTKPEGTT  329
             P  +P  ++
Sbjct  967  SPEYQPSSSS  976



>gb|AAM27467.1|AC099732_4 Putative receptor-like protein kinase [Oryza sativa Japonica 
Group]
Length=1001

 Score =   209 bits (531),  Expect = 3e-58, Method: Composition-based stats.
 Identities = 104/162 (64%), Positives = 120/162 (74%), Gaps = 1/162 (1%)
 Frame = -2

Query  718   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
             ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+KPVGEFGDGVDIV WVR
Sbjct  841   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELIAGRKPVGEFGDGVDIVHWVR  900

Query  538   KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
              +T   KEGV KI D RLSTVP+HE  H+FYVA+LCV EQ+VERP MREVVQ+LT+LP  
Sbjct  901   MVTGSSKEGVTKIADPRLSTVPLHELTHVFYVAMLCVAEQSVERPTMREVVQILTDLPGT  960

Query  358   PPGTKPEGTTACESSALEPPPSTGTSDDAKDqqqppPDLLSI  233
                T  +  +       +        D +++   P  DLLSI
Sbjct  961   AAATAMDAPSHGSGKEQDRSAEMQQQDGSRE-SPPQQDLLSI  1001



>ref|NP_001049453.1| Os03g0228800 [Oryza sativa Japonica Group]
 gb|ABF94768.1| Receptor protein kinase CLAVATA1 precursor, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF11367.1| Os03g0228800 [Oryza sativa Japonica Group]
 gb|EEE58640.1| hypothetical protein OsJ_10012 [Oryza sativa Japonica Group]
Length=1007

 Score =   209 bits (531),  Expect = 3e-58, Method: Composition-based stats.
 Identities = 104/162 (64%), Positives = 120/162 (74%), Gaps = 1/162 (1%)
 Frame = -2

Query  718   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
             ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+KPVGEFGDGVDIV WVR
Sbjct  847   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELIAGRKPVGEFGDGVDIVHWVR  906

Query  538   KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
              +T   KEGV KI D RLSTVP+HE  H+FYVA+LCV EQ+VERP MREVVQ+LT+LP  
Sbjct  907   MVTGSSKEGVTKIADPRLSTVPLHELTHVFYVAMLCVAEQSVERPTMREVVQILTDLPGT  966

Query  358   PPGTKPEGTTACESSALEPPPSTGTSDDAKDqqqppPDLLSI  233
                T  +  +       +        D +++   P  DLLSI
Sbjct  967   AAATAMDAPSHGSGKEQDRSAEMQQQDGSRE-SPPQQDLLSI  1007



>dbj|BAJ99137.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1004

 Score =   208 bits (530),  Expect = 5e-58, Method: Composition-based stats.
 Identities = 109/165 (66%), Positives = 120/165 (73%), Gaps = 13/165 (8%)
 Frame = -2

Query  718   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
             ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGVDIVQWVR
Sbjct  850   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGVDIVQWVR  909

Query  538   KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELP--  365
               T   KEGV+KI D RLSTVPI E  H+FYVA+LCV EQ+VERP MREVVQ+L ++P  
Sbjct  910   MATGSTKEGVMKIADPRLSTVPIQELTHVFYVAMLCVAEQSVERPTMREVVQILADMPGA  969

Query  364   -KQPPGTKPEGTTACESSALEPPPSTGTSDDAKDqqqppPDLLSI  233
                  GT+ E T   E    +     GT D          DLLSI
Sbjct  970   TSMTVGTRSEATVEVEEEHQD-----GTQDSP-----AQQDLLSI  1004



>ref|NP_001169902.1| uncharacterized protein LOC100383797 [Zea mays]
 gb|ACN27138.1| unknown [Zea mays]
Length=459

 Score =   201 bits (512),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 98/120 (82%), Positives = 107/120 (89%), Gaps = 1/120 (1%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            +CMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+GKKPVGEFGDGVDIV WVR
Sbjct  279  QCMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGKKPVGEFGDGVDIVHWVR  338

Query  538  KMTDG-KKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK  362
              T G  KE VVK++D RLS+VP+HE  H+F VALLCVEEQ+V+RP MREVVQML ELPK
Sbjct  339  STTAGASKEQVVKVMDPRLSSVPVHEVAHVFCVALLCVEEQSVQRPTMREVVQMLGELPK  398



>gb|EEC74807.1| hypothetical protein OsI_10619 [Oryza sativa Indica Group]
Length=1010

 Score =   208 bits (529),  Expect = 8e-58, Method: Composition-based stats.
 Identities = 96/118 (81%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+KPVGEFGDGVDIV WVR
Sbjct  845  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELIAGRKPVGEFGDGVDIVHWVR  904

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELP  365
             +T   KEGV KI D RLSTVP+HE  H+FYVA+LCV EQ+VERP MREVVQ+LT+LP
Sbjct  905  MVTGSSKEGVTKIADPRLSTVPLHELTHVFYVAMLCVAEQSVERPTMREVVQILTDLP  962



>gb|EMT21762.1| Receptor protein kinase CLAVATA1 [Aegilops tauschii]
Length=313

 Score =   197 bits (501),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSA+AGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLELV+G++PVG+FG+GVDIVQW +
Sbjct  166  ECMSAVAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELVTGRRPVGDFGEGVDIVQWAK  225

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            ++TDG++E V K++D RLSTVP+ E  H+F+V++LCV+E +VERP MREVVQML+E P+ 
Sbjct  226  RVTDGRRESVPKVVDRRLSTVPMDEVSHLFFVSMLCVQENSVERPTMREVVQMLSEFPRH  285



>gb|EMT15500.1| hypothetical protein F775_52402 [Aegilops tauschii]
Length=811

 Score =   206 bits (524),  Expect = 1e-57, Method: Composition-based stats.
 Identities = 108/165 (65%), Positives = 123/165 (75%), Gaps = 11/165 (7%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFGDGVDIVQWVR
Sbjct  655  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGDGVDIVQWVR  714

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
              T   KEGV+KI D RLSTVPI E  H+FYVA+LCV EQ+VERP MREVVQ+L ++P  
Sbjct  715  TATGSSKEGVMKIADPRLSTVPIQELTHVFYVAMLCVAEQSVERPTMREVVQILADMPGA  774

Query  358  PPGTKPEGTTACESSALEPPPSTGTSDDAKD---qqqppPDLLSI  233
               T   GTT  E++        G  ++ +D   +     DLLSI
Sbjct  775  TSMTA--GTTRVEATV------EGEDEEHQDGPQESPAQQDLLSI  811



>ref|XP_010228930.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Brachypodium distachyon]
Length=1008

 Score =   207 bits (527),  Expect = 1e-57, Method: Composition-based stats.
 Identities = 103/140 (74%), Positives = 114/140 (81%), Gaps = 11/140 (8%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+KPVGEFGDGVDIVQWVR
Sbjct  849  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELIAGRKPVGEFGDGVDIVQWVR  908

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
             +    KEGV+KI D RLSTVPI E  H+FYVA+LCV EQ+VERP MREVVQ+LT+LP  
Sbjct  909  MVAGSTKEGVMKIADPRLSTVPIQELTHVFYVAMLCVAEQSVERPTMREVVQILTDLP--  966

Query  358  PPGTKPEGTTACESSALEPP  299
                   GTT   S +L PP
Sbjct  967  -------GTTT--SMSLPPP  977



>gb|ACL54651.1| unknown [Zea mays]
Length=441

 Score =   200 bits (508),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+KPVGEFGDGVDIV WVR
Sbjct  278  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELIAGRKPVGEFGDGVDIVHWVR  337

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
             +T   KEGV+KI D RLSTVP++E  H+FYVA+LCV EQ+VERP MREVVQ+L ++P  
Sbjct  338  TVTGSSKEGVMKIADPRLSTVPLYELTHVFYVAMLCVAEQSVERPTMREVVQILADMPGS  397

Query  358  PPGT  347
               T
Sbjct  398  TSTT  401



>ref|XP_004985112.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2-like [Setaria italica]
Length=998

 Score =   205 bits (522),  Expect = 5e-57, Method: Composition-based stats.
 Identities = 105/164 (64%), Positives = 122/164 (74%), Gaps = 5/164 (3%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+KPVGEFGDGVDIVQWVR
Sbjct  838  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRKPVGEFGDGVDIVQWVR  897

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
             +T   KEGV+KI D RLSTVP++E  H+FYVA+LCV EQ+VERP MREVVQ+L ++P  
Sbjct  898  MVTGSSKEGVMKIADPRLSTVPLYELTHVFYVAMLCVAEQSVERPTMREVVQILADMPGS  957

Query  358  PPGT--KPEGTTACESSALEPPPSTGTSDDAKDqqqppPDLLSI  233
               +   P      E ++ E PP      +      P  DLLSI
Sbjct  958  TSTSIDAPLVIEPKEDASSEKPPR---QQEGPHDSPPQQDLLSI  998



>ref|XP_009603651.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Nicotiana tomentosiformis]
Length=1000

 Score =   205 bits (521),  Expect = 8e-57, Method: Composition-based stats.
 Identities = 89/130 (68%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G++PVGEFGDGVDIVQW +
Sbjct  847  ECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELITGRRPVGEFGDGVDIVQWSK  906

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            ++T+ K+E V  I+D RL+TVP  EAMH+F+VA+L ++E +VERP MREV+QML+E P+Q
Sbjct  907  RVTNCKREQVRHIVDPRLTTVPEDEAMHLFFVAMLSIQENSVERPTMREVIQMLSEFPRQ  966

Query  358  PPGTKPEGTT  329
             P  +P  ++
Sbjct  967  SPEYQPSSSS  976



>ref|XP_004230451.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Solanum lycopersicum]
Length=995

 Score =   204 bits (520),  Expect = 1e-56, Method: Composition-based stats.
 Identities = 86/122 (70%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSA+AGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G++PVGEFGDGVDIVQW +
Sbjct  840  ECMSAVAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELITGRRPVGEFGDGVDIVQWSK  899

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            K+T+ K+E V  I+D RL++VP  EAMH+F++++LC++E +VERP MREV+QML+E P+Q
Sbjct  900  KVTNCKREQVTHIVDPRLTSVPQDEAMHLFFISMLCIQENSVERPTMREVIQMLSEFPRQ  959

Query  358  PP  353
             P
Sbjct  960  SP  961



>ref|XP_003592924.1| Receptor-like protein kinase [Medicago truncatula]
 gb|AES63175.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=1007

 Score =   204 bits (519),  Expect = 1e-56, Method: Composition-based stats.
 Identities = 88/120 (73%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMS+IAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G+KPVG+FG+GVD+VQW +
Sbjct  845  ECMSSIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELLTGRKPVGDFGEGVDLVQWCK  904

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            K T+G++E VV I+DSRL  VP  EAMHMF++A+LC+EE +V+RP MREVVQML+E P+Q
Sbjct  905  KATNGRREEVVNIIDSRLMVVPKEEAMHMFFIAMLCLEENSVQRPTMREVVQMLSEFPRQ  964



>ref|NP_001145765.1| uncharacterized protein LOC100279272 [Zea mays]
 gb|ACL52548.1| unknown [Zea mays]
Length=771

 Score =   202 bits (515),  Expect = 2e-56, Method: Composition-based stats.
 Identities = 93/118 (79%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+KPVGEFGDGVDIV WVR
Sbjct  608  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELIAGRKPVGEFGDGVDIVHWVR  667

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELP  365
             +T   KEGV+KI D RLSTVP++E  H+FYVA+LCV EQ+VERP MREVVQ+L ++P
Sbjct  668  TVTGSSKEGVMKIADPRLSTVPLYELTHVFYVAMLCVAEQSVERPTMREVVQILADMP  725



>tpg|DAA44225.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=1002

 Score =   203 bits (517),  Expect = 3e-56, Method: Composition-based stats.
 Identities = 93/118 (79%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+KPVGEFGDGVDIV WVR
Sbjct  839  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELIAGRKPVGEFGDGVDIVHWVR  898

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELP  365
             +T   KEGV+KI D RLSTVP++E  H+FYVA+LCV EQ+VERP MREVVQ+L ++P
Sbjct  899  TVTGSSKEGVMKIADPRLSTVPLYELTHVFYVAMLCVAEQSVERPTMREVVQILADMP  956



>tpg|DAA59489.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=1037

 Score =   204 bits (518),  Expect = 3e-56, Method: Composition-based stats.
 Identities = 98/120 (82%), Positives = 107/120 (89%), Gaps = 1/120 (1%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            +CMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+GKKPVGEFGDGVDIV WVR
Sbjct  857  QCMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGKKPVGEFGDGVDIVHWVR  916

Query  538  KMTDG-KKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK  362
              T G  KE VVK++D RLS+VP+HE  H+F VALLCVEEQ+V+RP MREVVQML ELPK
Sbjct  917  STTAGASKEQVVKVMDPRLSSVPVHEVAHVFCVALLCVEEQSVQRPTMREVVQMLGELPK  976



>ref|XP_006431638.1| hypothetical protein CICLE_v10000148mg [Citrus clementina]
 gb|ESR44878.1| hypothetical protein CICLE_v10000148mg [Citrus clementina]
Length=997

 Score =   203 bits (516),  Expect = 4e-56, Method: Composition-based stats.
 Identities = 87/120 (73%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G++PVG+FGDGVDIVQW +
Sbjct  847  ECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELLTGRRPVGDFGDGVDIVQWSK  906

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            + T+G+KE  + ILD RLSTVP  EAMH+ +VA+LC++E ++ERP+MREVVQML+E P+ 
Sbjct  907  RATNGRKEEFLSILDPRLSTVPKEEAMHLLFVAMLCIQENSIERPRMREVVQMLSEFPRH  966



>ref|XP_006349327.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3-like [Solanum tuberosum]
Length=999

 Score =   203 bits (516),  Expect = 4e-56, Method: Composition-based stats.
 Identities = 86/120 (72%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSA+AGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G++PVGEFGDGVDIVQW +
Sbjct  844  ECMSAVAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELITGRRPVGEFGDGVDIVQWSK  903

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            K+T+ K+E V  I+D RL+TVP  EAMH+F++++LC++E +VERP MREV+QML+E P+Q
Sbjct  904  KVTNCKREQVTHIVDPRLTTVPEDEAMHLFFISMLCIQENSVERPTMREVIQMLSEFPRQ  963



>ref|XP_009403711.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Musa acuminata subsp. malaccensis]
 ref|XP_009403712.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Musa acuminata subsp. malaccensis]
 ref|XP_009403713.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Musa acuminata subsp. malaccensis]
Length=995

 Score =   202 bits (515),  Expect = 5e-56, Method: Composition-based stats.
 Identities = 94/139 (68%), Positives = 113/139 (81%), Gaps = 3/139 (2%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            E MSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G++PVGEFGDGVDIVQW +
Sbjct  841  ESMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRRPVGEFGDGVDIVQWAK  900

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            ++TD  ++ V  I D RLSTVPI E MH+F+VA+LCV+E +VERP MREVVQML+E P  
Sbjct  901  RVTDCSRDNVAAIADPRLSTVPIAEVMHVFFVAMLCVQENSVERPTMREVVQMLSEFPHH  960

Query  358  PPGTKPEGTTAC---ESSA  311
             P +    ++A    ESS+
Sbjct  961  VPESHSPSSSATALKESSS  979



>ref|XP_010912647.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Elaeis guineensis]
Length=992

 Score =   202 bits (514),  Expect = 7e-56, Method: Composition-based stats.
 Identities = 88/131 (67%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G++PVGEFG+GVDIVQW +
Sbjct  840  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRRPVGEFGEGVDIVQWAK  899

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            ++T+  K  V KI+DSRLSTVPI+E MH+F++ +LC+ E ++ERP MREVVQML+E P  
Sbjct  900  RITNCDKNNVAKIVDSRLSTVPINEVMHVFFITMLCIHENSIERPTMREVVQMLSEFPHH  959

Query  358  PPGTKPEGTTA  326
                +   ++A
Sbjct  960  ASEDQSPSSSA  970



>ref|XP_006858565.1| hypothetical protein AMTR_s00071p00176900 [Amborella trichopoda]
 gb|ERN20032.1| hypothetical protein AMTR_s00071p00176900 [Amborella trichopoda]
Length=803

 Score =   200 bits (509),  Expect = 1e-55, Method: Composition-based stats.
 Identities = 89/128 (70%), Positives = 107/128 (84%), Gaps = 2/128 (2%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMS IAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G +PVG+FGDGVDIVQW +
Sbjct  624  ECMSVIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGHRPVGDFGDGVDIVQWAK  683

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTEL--P  365
            + T G +  V  ILDSRL+ VP+ E+MH+F++A+LCV+E ++ERP MREVVQML+E   P
Sbjct  684  RTTGGDRRKVTLILDSRLNQVPLEESMHLFFIAMLCVQENSIERPTMREVVQMLSEFPNP  743

Query  364  KQPPGTKP  341
            K P  T P
Sbjct  744  KPPSQTSP  751



>gb|AAX96206.1| Similar to receptor-like protein kinase 3 [Oryza sativa Japonica 
Group]
 gb|ABA92267.1| Leucine Rich Repeat family protein, expressed [Oryza sativa Japonica 
Group]
Length=1061

 Score =   202 bits (514),  Expect = 1e-55, Method: Composition-based stats.
 Identities = 90/144 (63%), Positives = 118/144 (82%), Gaps = 4/144 (3%)
 Frame = -2

Query  718   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
             ECMSA+AGSYGYIAPEYAYTL+VDEKSDVYS+GVVLLEL++G++PVG+FG+GVDIVQW +
Sbjct  907   ECMSAVAGSYGYIAPEYAYTLRVDEKSDVYSYGVVLLELITGRRPVGDFGEGVDIVQWTK  966

Query  538   KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK-  362
             ++TDG++E V +I+D R+STVP+ E  H+F+V++LCV+E +VERP MREVVQML+E P+ 
Sbjct  967   RVTDGRRESVHRIIDRRISTVPMDEVAHIFFVSMLCVQENSVERPTMREVVQMLSEFPRH  1026

Query  361   ---QPPGTKPEGTTACESSALEPP  299
                QP  +     T  ESS  + P
Sbjct  1027  GSDQPSPSSSAPETGEESSPEKEP  1050



>gb|EEC67924.1| hypothetical protein OsI_35629 [Oryza sativa Indica Group]
Length=1035

 Score =   201 bits (512),  Expect = 2e-55, Method: Composition-based stats.
 Identities = 90/144 (63%), Positives = 118/144 (82%), Gaps = 4/144 (3%)
 Frame = -2

Query  718   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
             ECMSA+AGSYGYIAPEYAYTL+VDEKSDVYS+GVVLLEL++G++PVG+FG+GVDIVQW +
Sbjct  881   ECMSAVAGSYGYIAPEYAYTLRVDEKSDVYSYGVVLLELITGRRPVGDFGEGVDIVQWTK  940

Query  538   KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK-  362
             ++TDG++E V +I+D R+STVP+ E  H+F+V++LCV+E +VERP MREVVQML+E P+ 
Sbjct  941   RVTDGRRESVHRIVDRRISTVPMDEVAHIFFVSMLCVQENSVERPTMREVVQMLSEFPRH  1000

Query  361   ---QPPGTKPEGTTACESSALEPP  299
                QP  +     T  ESS  + P
Sbjct  1001  GSDQPSPSSSAPETGEESSPEKEP  1024



>emb|CDO97616.1| unnamed protein product [Coffea canephora]
Length=1001

 Score =   201 bits (511),  Expect = 2e-55, Method: Composition-based stats.
 Identities = 92/131 (70%), Positives = 112/131 (85%), Gaps = 1/131 (1%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G++PVG+FG+GVDIVQW R
Sbjct  842  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRRPVGDFGEGVDIVQWAR  901

Query  538  KMTDGKKEGVVKILDSRLST-VPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK  362
            + T+ ++E V  I+D RLST VP  EAMH+F++A+LCV+E +VERP MREVVQML+E P+
Sbjct  902  RATNCRREEVDGIVDPRLSTAVPKDEAMHLFFIAMLCVQENSVERPTMREVVQMLSEFPR  961

Query  361  QPPGTKPEGTT  329
            Q   T P+  T
Sbjct  962  QFSSTPPDYRT  972



>ref|XP_003576141.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Brachypodium distachyon]
Length=1043

 Score =   201 bits (512),  Expect = 2e-55, Method: Composition-based stats.
 Identities = 86/120 (72%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = -2

Query  718   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
             ECMSA+AGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLELV+G++PVG+FG+GVDIVQW +
Sbjct  891   ECMSAVAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELVTGRRPVGDFGEGVDIVQWAK  950

Query  538   KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
             ++TDG++EGV K++D RLSTV + E  H+F+V++LCV+E +VERP MREVVQML+E P+ 
Sbjct  951   RVTDGRREGVPKVVDRRLSTVAMDEVAHLFFVSMLCVQENSVERPTMREVVQMLSEFPRH  1010



>gb|KDO44093.1| hypothetical protein CISIN_1g001922mg [Citrus sinensis]
Length=995

 Score =   201 bits (510),  Expect = 2e-55, Method: Composition-based stats.
 Identities = 86/120 (72%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G++PVG+FGDGVDIVQW +
Sbjct  845  ECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELLTGRRPVGDFGDGVDIVQWSK  904

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            + T+G+KE  + ILD RLS VP  EAMH+ +VA+LC++E ++ERP+MREVVQML+E P+ 
Sbjct  905  RATNGRKEEFLSILDPRLSMVPKEEAMHLLFVAMLCIQENSIERPRMREVVQMLSEFPRH  964



>ref|XP_006492589.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Citrus sinensis]
Length=995

 Score =   201 bits (510),  Expect = 2e-55, Method: Composition-based stats.
 Identities = 86/120 (72%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G++PVG+FGDGVDIVQW +
Sbjct  845  ECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELLTGRRPVGDFGDGVDIVQWSK  904

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            + T+G+KE  + ILD RLS VP  EAMH+ +VA+LC++E ++ERP+MREVVQML+E P+ 
Sbjct  905  RATNGRKEEFLSILDPRLSMVPKEEAMHLLFVAMLCIQENSIERPRMREVVQMLSEFPRH  964



>dbj|BAJ90459.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ98621.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1024

 Score =   201 bits (510),  Expect = 3e-55, Method: Composition-based stats.
 Identities = 86/120 (72%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSA+AGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLELV+G++PVG+FG+GVDIVQW +
Sbjct  872  ECMSAVAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELVTGRRPVGDFGEGVDIVQWAK  931

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            ++TDG++E V K++D RLSTVP+ E  H+F+V++LCV+E +VERP MREVVQML+E P+ 
Sbjct  932  RVTDGRRESVPKVVDRRLSTVPMDEVSHLFFVSMLCVQENSVERPTMREVVQMLSEFPRH  991



>ref|XP_010930574.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Elaeis guineensis]
Length=994

 Score =   200 bits (509),  Expect = 4e-55, Method: Composition-based stats.
 Identities = 87/117 (74%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSA+AGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G++PVGEFG+GVDIVQW +
Sbjct  841  ECMSAVAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRRPVGEFGNGVDIVQWAK  900

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTEL  368
            ++T+  ++ V  I+DSRLSTVPI+E MH+F+VA+LCV+E +VERP MREVVQML+E 
Sbjct  901  RITNCNRDNVATIIDSRLSTVPINEVMHVFFVAMLCVQENSVERPTMREVVQMLSEF  957



>ref|XP_009411355.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1009

 Score =   200 bits (508),  Expect = 5e-55, Method: Composition-based stats.
 Identities = 102/154 (66%), Positives = 118/154 (77%), Gaps = 17/154 (11%)
 Frame = -2

Query  718   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
             ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G+KPVGEFG+GVDIVQWVR
Sbjct  855   ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPVGEFGEGVDIVQWVR  914

Query  538   KMTD--GKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELP  365
             KMT+    + GV +I+D RL TVP+ EA+H+F+VA+LCVEEQ+VERP MREVVQ+L + P
Sbjct  915   KMTECGSNRGGVPQIVDPRLPTVPMDEAVHVFHVAMLCVEEQSVERPTMREVVQILMDAP  974

Query  364   KQPPGTKPEGTTACESSALE-----------PPP  296
             K      PE    CE+   E           PPP
Sbjct  975   K----AAPEQGDDCEAPTKEAKEHQQPAQTSPPP  1004



>emb|CBI29704.3| unnamed protein product [Vitis vinifera]
Length=895

 Score =   199 bits (505),  Expect = 7e-55, Method: Composition-based stats.
 Identities = 86/130 (66%), Positives = 111/130 (85%), Gaps = 0/130 (0%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G++PVG+FG+GVDIVQW +
Sbjct  763  ECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELITGRRPVGDFGEGVDIVQWAK  822

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            + T+  KE V++I+D RL+T+P +EA H+F++ALLC+EE +VERP MREVVQML+E  + 
Sbjct  823  RTTNCCKENVIRIVDPRLATIPRNEATHLFFIALLCIEENSVERPTMREVVQMLSESHRN  882

Query  358  PPGTKPEGTT  329
             P  K   ++
Sbjct  883  SPDNKTSSSS  892



>gb|KDP42443.1| hypothetical protein JCGZ_00240 [Jatropha curcas]
Length=995

 Score =   199 bits (506),  Expect = 1e-54, Method: Composition-based stats.
 Identities = 84/122 (69%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G++PVG+FG+GVDIVQW R
Sbjct  842  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELLTGRRPVGDFGEGVDIVQWSR  901

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            ++T  ++E V++++D RL+ VP  EAMH+F++A+LC +E ++ERP MREVVQML+E P+ 
Sbjct  902  RVTSNRREDVMQVVDRRLTMVPKDEAMHLFFIAMLCSQENSIERPTMREVVQMLSEFPRH  961

Query  358  PP  353
             P
Sbjct  962  SP  963



>ref|XP_006859064.1| hypothetical protein AMTR_s00068p00198250 [Amborella trichopoda]
 gb|ERN20531.1| hypothetical protein AMTR_s00068p00198250 [Amborella trichopoda]
Length=737

 Score =   197 bits (501),  Expect = 1e-54, Method: Composition-based stats.
 Identities = 88/116 (76%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVL+EL++G++PVGEFGDGVDIVQW +
Sbjct  603  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLVELITGRRPVGEFGDGVDIVQWAK  662

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTE  371
              T   KEGV +ILDSRL  +PI EA H+F+VA+LCV+EQ+VERP MREVV ML +
Sbjct  663  STTSACKEGVFEILDSRLKDIPIEEAKHVFFVAMLCVQEQSVERPTMREVVHMLQQ  718



>gb|KJB32855.1| hypothetical protein B456_005G265400 [Gossypium raimondii]
Length=992

 Score =   199 bits (505),  Expect = 1e-54, Method: Composition-based stats.
 Identities = 86/122 (70%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+KPVGEFG+G+DIV W +
Sbjct  845  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRKPVGEFGEGIDIVHWTK  904

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
             +T+ +K  V  I+D RL+TVP  EAMH+ ++A+LCV+E ++ERP MREVVQML+E P+Q
Sbjct  905  LVTNCRKAEVTSIVDPRLTTVPKDEAMHLLFIAMLCVQENSIERPTMREVVQMLSEFPRQ  964

Query  358  PP  353
             P
Sbjct  965  SP  966



>gb|EEE51888.1| hypothetical protein OsJ_33462 [Oryza sativa Japonica Group]
Length=881

 Score =   198 bits (503),  Expect = 1e-54, Method: Composition-based stats.
 Identities = 90/144 (63%), Positives = 118/144 (82%), Gaps = 4/144 (3%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSA+AGSYGYIAPEYAYTL+VDEKSDVYS+GVVLLEL++G++PVG+FG+GVDIVQW +
Sbjct  727  ECMSAVAGSYGYIAPEYAYTLRVDEKSDVYSYGVVLLELITGRRPVGDFGEGVDIVQWTK  786

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK-  362
            ++TDG++E V +I+D R+STVP+ E  H+F+V++LCV+E +VERP MREVVQML+E P+ 
Sbjct  787  RVTDGRRESVHRIIDRRISTVPMDEVAHIFFVSMLCVQENSVERPTMREVVQMLSEFPRH  846

Query  361  ---QPPGTKPEGTTACESSALEPP  299
               QP  +     T  ESS  + P
Sbjct  847  GSDQPSPSSSAPETGEESSPEKEP  870



>ref|XP_002263291.2| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Vitis vinifera]
Length=976

 Score =   199 bits (505),  Expect = 1e-54, Method: Composition-based stats.
 Identities = 86/130 (66%), Positives = 111/130 (85%), Gaps = 0/130 (0%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G++PVG+FG+GVDIVQW +
Sbjct  844  ECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELITGRRPVGDFGEGVDIVQWAK  903

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            + T+  KE V++I+D RL+T+P +EA H+F++ALLC+EE +VERP MREVVQML+E  + 
Sbjct  904  RTTNCCKENVIRIVDPRLATIPRNEATHLFFIALLCIEENSVERPTMREVVQMLSESHRN  963

Query  358  PPGTKPEGTT  329
             P  K   ++
Sbjct  964  SPDNKTSSSS  973



>ref|XP_009355307.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Pyrus x bretschneideri]
Length=999

 Score =   199 bits (505),  Expect = 2e-54, Method: Composition-based stats.
 Identities = 88/123 (72%), Positives = 108/123 (88%), Gaps = 1/123 (1%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G++PVGEFG+GVDIVQW +
Sbjct  844  ECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELLTGRRPVGEFGEGVDIVQWSK  903

Query  538  KMTDGKKEGVVKILDSRLS-TVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK  362
            K T+ +KE V  I+D RL+ +VP  EAMHMF++A+LC++E +VERP MREVVQML+E P+
Sbjct  904  KATNCRKEDVANIVDHRLTISVPKDEAMHMFFIAMLCIQENSVERPTMREVVQMLSEFPR  963

Query  361  QPP  353
              P
Sbjct  964  HTP  966



>ref|XP_007224667.1| hypothetical protein PRUPE_ppa026134mg [Prunus persica]
 gb|EMJ25866.1| hypothetical protein PRUPE_ppa026134mg [Prunus persica]
Length=998

 Score =   198 bits (504),  Expect = 2e-54, Method: Composition-based stats.
 Identities = 88/123 (72%), Positives = 108/123 (88%), Gaps = 1/123 (1%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G++PVGEFG+GVDIVQW +
Sbjct  843  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELLTGRRPVGEFGEGVDIVQWSK  902

Query  538  KMTDGKKEGVVKILDSRLS-TVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK  362
            K T+ +KE V  I+D RL+ +VP  EAMH+F++A+LC++E +VERP MREVVQML+E P+
Sbjct  903  KATNCRKEDVTSIVDPRLAISVPKDEAMHLFFIAMLCIQEHSVERPTMREVVQMLSEFPR  962

Query  361  QPP  353
              P
Sbjct  963  HSP  965



>ref|XP_010520784.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 isoform X2 [Tarenaya hassleriana]
Length=958

 Score =   198 bits (503),  Expect = 2e-54, Method: Composition-based stats.
 Identities = 95/155 (61%), Positives = 117/155 (75%), Gaps = 18/155 (12%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            +CMSAIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLELV+G++PVG+FG+GVDIVQWV+
Sbjct  809  QCMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELVTGRRPVGDFGEGVDIVQWVK  868

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
             +T  +KE V+ ++D RLS VP  EA H+ +VA+LCVEE +VERP MREVVQML E P  
Sbjct  869  TVTRRRKEEVMLVVDHRLSNVPRQEAAHLLFVAMLCVEENSVERPSMREVVQMLLEFP--  926

Query  358  PPGTKPEGTTACESSALEPPPST-----GTSDDAK  269
                +PE       +   PPP+      G ++DAK
Sbjct  927  ----RPE-------TPFSPPPAVHSPCKGVTNDAK  950



>ref|XP_010520783.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 isoform X1 [Tarenaya hassleriana]
Length=994

 Score =   198 bits (503),  Expect = 2e-54, Method: Composition-based stats.
 Identities = 95/155 (61%), Positives = 117/155 (75%), Gaps = 18/155 (12%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            +CMSAIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLELV+G++PVG+FG+GVDIVQWV+
Sbjct  845  QCMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELVTGRRPVGDFGEGVDIVQWVK  904

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
             +T  +KE V+ ++D RLS VP  EA H+ +VA+LCVEE +VERP MREVVQML E P  
Sbjct  905  TVTRRRKEEVMLVVDHRLSNVPRQEAAHLLFVAMLCVEENSVERPSMREVVQMLLEFP--  962

Query  358  PPGTKPEGTTACESSALEPPPST-----GTSDDAK  269
                +PE       +   PPP+      G ++DAK
Sbjct  963  ----RPE-------TPFSPPPAVHSPCKGVTNDAK  986



>emb|CAN71863.1| hypothetical protein VITISV_023530 [Vitis vinifera]
Length=954

 Score =   197 bits (501),  Expect = 3e-54, Method: Composition-based stats.
 Identities = 86/130 (66%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G++PVG+FG+GVDIVQW +
Sbjct  822  ECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELITGRRPVGDFGEGVDIVQWAK  881

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            + T+  KE V+ I+D RL+T+P +EA H+F++ALLC+EE +VERP MREVVQML+E  + 
Sbjct  882  RTTNCCKENVIXIVDPRLATIPRNEATHLFFIALLCIEENSVERPTMREVVQMLSESHRN  941

Query  358  PPGTKPEGTT  329
             P  K   ++
Sbjct  942  SPDNKTSSSS  951



>ref|XP_011087678.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Sesamum indicum]
Length=992

 Score =   197 bits (502),  Expect = 3e-54, Method: Composition-based stats.
 Identities = 88/122 (72%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            +CMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELV+G +PVG FG+GVDIVQW+R
Sbjct  842  QCMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVTGHRPVGGFGEGVDIVQWIR  901

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
              T+  +E V +I+D RL+ VP  EAMH+F+VA+LCV+E  VERP MREVVQML+E P++
Sbjct  902  CSTNCNREEVTRIIDPRLTVVPKDEAMHLFFVAMLCVQENCVERPTMREVVQMLSEFPRR  961

Query  358  PP  353
             P
Sbjct  962  SP  963



>ref|XP_007041221.1| Leucine-rich receptor-like protein kinase family protein, putative 
[Theobroma cacao]
 gb|EOX97052.1| Leucine-rich receptor-like protein kinase family protein, putative 
[Theobroma cacao]
Length=988

 Score =   197 bits (502),  Expect = 3e-54, Method: Composition-based stats.
 Identities = 82/122 (67%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTL+VDEKSDVYSFGVV+LEL++G++PVG+FG+GVDIV W +
Sbjct  841  ECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVILELITGRRPVGDFGEGVDIVHWAK  900

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            ++T+ ++E V++I+D RL+TVP  EAMH+ ++A+LCV+E ++ERP MREVVQML+E P+ 
Sbjct  901  RVTNCRREEVMRIVDPRLTTVPKDEAMHLLFIAMLCVQENSIERPTMREVVQMLSEFPRH  960

Query  358  PP  353
             P
Sbjct  961  SP  962



>gb|EYU26470.1| hypothetical protein MIMGU_mgv1a019834mg [Erythranthe guttata]
Length=1001

 Score =   197 bits (502),  Expect = 4e-54, Method: Composition-based stats.
 Identities = 86/119 (72%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            +CMSAIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLELV+G++PVGEFG+GVDIVQWVR
Sbjct  846  QCMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELVTGRRPVGEFGEGVDIVQWVR  905

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK  362
              T+ ++E V +I+D R++  P  EAMH+F+VA+LCV+E +VERP MREVVQML+E P+
Sbjct  906  CSTNCRREDVTRIIDPRITVAPKDEAMHLFFVAMLCVQENSVERPTMREVVQMLSEFPR  964



>ref|XP_008218726.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Prunus mume]
Length=982

 Score =   197 bits (501),  Expect = 5e-54, Method: Composition-based stats.
 Identities = 88/123 (72%), Positives = 107/123 (87%), Gaps = 1/123 (1%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G++PVGEFG+GVDIVQW +
Sbjct  827  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELLTGRRPVGEFGEGVDIVQWSK  886

Query  538  KMTDGKKEGVVKILDSRLS-TVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK  362
            K T+ +KE V  I+D RL+ +VP  EAMH+F++A LC++E +VERP MREVVQML+E P+
Sbjct  887  KATNCRKEDVTSIVDPRLAISVPKDEAMHLFFIATLCIQEHSVERPTMREVVQMLSEFPR  946

Query  361  QPP  353
              P
Sbjct  947  HSP  949



>ref|XP_008795253.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Phoenix dactylifera]
Length=992

 Score =   197 bits (500),  Expect = 7e-54, Method: Composition-based stats.
 Identities = 86/131 (66%), Positives = 106/131 (81%), Gaps = 0/131 (0%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G++PVGEFGDGVDIV W +
Sbjct  840  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRRPVGEFGDGVDIVHWAK  899

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            K+T+  K    +I+DSRL  VPI+E MH+F++A+LC  E ++ERP MREVVQML+E P  
Sbjct  900  KITNCDKNNASRIVDSRLGAVPINEVMHIFFIAMLCTHENSIERPTMREVVQMLSEFPHH  959

Query  358  PPGTKPEGTTA  326
                +   ++A
Sbjct  960  ASEDQSPSSSA  970



>ref|XP_008786484.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat receptor-like 
serine/threonine-protein kinase BAM1 [Phoenix dactylifera]
Length=995

 Score =   196 bits (499),  Expect = 1e-53, Method: Composition-based stats.
 Identities = 84/118 (71%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSA+AGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G++PVGEFG+GVDIVQW +
Sbjct  841  ECMSAVAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRRPVGEFGNGVDIVQWAK  900

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELP  365
            ++T+  ++ V  I+DSRLST+PI+E MH+F++A+LC+ E +VERP MREVV ML+E P
Sbjct  901  RITNCSRDNVATIVDSRLSTMPINEVMHVFFIAMLCIXENSVERPTMREVVLMLSEFP  958



>ref|XP_011092305.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Sesamum indicum]
Length=1004

 Score =   196 bits (499),  Expect = 1e-53, Method: Composition-based stats.
 Identities = 87/123 (71%), Positives = 108/123 (88%), Gaps = 1/123 (1%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVG-EFGDGVDIVQWV  542
            +CMSAIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G++PVG EFG+GVDIVQW 
Sbjct  854  QCMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELITGRRPVGGEFGEGVDIVQWT  913

Query  541  RKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK  362
            +  TD ++E V +ILD RL+ VP  EAMH+F+VA+LC++E +VERP MREVVQML+E P+
Sbjct  914  KCSTDCRREEVSRILDPRLAVVPKDEAMHLFFVAMLCIQENSVERPTMREVVQMLSEFPR  973

Query  361  QPP  353
            + P
Sbjct  974  RSP  976



>ref|XP_004485432.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3-like [Cicer arietinum]
Length=987

 Score =   196 bits (498),  Expect = 1e-53, Method: Composition-based stats.
 Identities = 87/121 (72%), Positives = 106/121 (88%), Gaps = 1/121 (1%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMS+IAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++GKKPVG+FG+GVD+VQW +
Sbjct  847  ECMSSIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELITGKKPVGDFGEGVDLVQWCK  906

Query  538  KMTD-GKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK  362
            K T+ G++E V  I+DSRL  VP  E MHMF++A+LC+EE +V+RP MREVVQML+E P 
Sbjct  907  KSTNGGRREDVFNIVDSRLVVVPKEEVMHMFFIAMLCLEENSVQRPTMREVVQMLSEFPP  966

Query  361  Q  359
            Q
Sbjct  967  Q  967



>ref|XP_007040964.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
 gb|EOX96795.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
Length=986

 Score =   196 bits (498),  Expect = 1e-53, Method: Composition-based stats.
 Identities = 90/122 (74%), Positives = 107/122 (88%), Gaps = 2/122 (2%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DGVDIVQWV  542
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G++PVG+FG +G+DIVQW 
Sbjct  860  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRRPVGDFGEEGLDIVQWT  919

Query  541  RKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK  362
            ++ T+  KEGVVKILD R S +P+ EAM +F+VA+LCVEE +VERP MREVVQML +  K
Sbjct  920  KRQTNWNKEGVVKILDQRASNIPVEEAMQVFFVAMLCVEEHSVERPTMREVVQMLAQ-AK  978

Query  361  QP  356
            QP
Sbjct  979  QP  980



>gb|KHG14208.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Gossypium arboreum]
Length=992

 Score =   196 bits (498),  Expect = 1e-53, Method: Composition-based stats.
 Identities = 85/122 (70%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+KPVGEFG+G+DIV W +
Sbjct  845  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRKPVGEFGEGIDIVHWTK  904

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
             +T+ +   V  I+D RL+TVP  EAMH+ ++A+LCV+E ++ERP MREVVQML+E P+Q
Sbjct  905  LVTNCRIAEVTNIVDPRLTTVPKDEAMHLLFIAMLCVQENSIERPTMREVVQMLSEFPRQ  964

Query  358  PP  353
             P
Sbjct  965  SP  966



>ref|XP_009392568.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 isoform X1 [Musa acuminata subsp. malaccensis]
Length=1040

 Score =   196 bits (498),  Expect = 1e-53, Method: Composition-based stats.
 Identities = 86/118 (73%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G++PVG+FGDGVDIVQWV+
Sbjct  874  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRRPVGDFGDGVDIVQWVK  933

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELP  365
            + T  ++E    I+D RLS+VP  E MH+F+V++LCV+E +VERP MREVVQML+E P
Sbjct  934  RATACRRENAASIVDCRLSSVPTDEVMHVFFVSMLCVQENSVERPTMREVVQMLSEFP  991



>ref|XP_002526451.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
 gb|EEF35946.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
Length=996

 Score =   196 bits (497),  Expect = 2e-53, Method: Composition-based stats.
 Identities = 85/120 (71%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G++PVG+FGDGVDIVQW +
Sbjct  843  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELLTGRRPVGDFGDGVDIVQWSK  902

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            ++T+ +KE V+ I+DSRL+ VP  E MH+F++ALLC +E ++ERP MREVVQML+E  + 
Sbjct  903  RVTNNRKEDVLNIIDSRLTMVPKDEVMHLFFIALLCSQENSIERPTMREVVQMLSEFHRH  962



>gb|KCW57119.1| hypothetical protein EUGRSUZ_I02765 [Eucalyptus grandis]
Length=760

 Score =   194 bits (493),  Expect = 2e-53, Method: Composition-based stats.
 Identities = 85/122 (70%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G++PVG+FG+GVDIVQW +
Sbjct  606  ECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELLTGRRPVGDFGEGVDIVQWSK  665

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            KMT  +KE V  I+D +L  VP  EA H+F++A+LCV++ +VERP MREVVQML+E P+ 
Sbjct  666  KMTGCRKEEVTCIVDPKLKAVPKDEATHLFFIAMLCVQDNSVERPTMREVVQMLSEYPRH  725

Query  358  PP  353
             P
Sbjct  726  SP  727



>ref|XP_010243895.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 isoform X1 [Nelumbo nucifera]
 ref|XP_010243896.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 isoform X2 [Nelumbo nucifera]
 ref|XP_010243898.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 isoform X3 [Nelumbo nucifera]
Length=991

 Score =   195 bits (496),  Expect = 3e-53, Method: Composition-based stats.
 Identities = 85/117 (73%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G++PVG+F +GVDIVQW +
Sbjct  840  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRRPVGDFEEGVDIVQWAK  899

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTEL  368
            + T+ +KE V++I+D RL+ VPI EAMH+F++A+LCV+E +VERP MREVVQML+E 
Sbjct  900  RSTNCRKEEVIRIIDPRLTGVPIDEAMHVFFIAMLCVQENSVERPTMREVVQMLSEF  956



>gb|KDO77158.1| hypothetical protein CISIN_1g012213mg [Citrus sinensis]
Length=468

 Score =   189 bits (481),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 105/125 (84%), Gaps = 3/125 (2%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DGVDIVQWV  542
            ECMSA+AGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G++PVG+FG +G+DIVQW 
Sbjct  342  ECMSAVAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRRPVGDFGEEGLDIVQWT  401

Query  541  RKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK  362
            +  T+  KEGVVKILD RLS  P+ EAM +F+VA+LCV+E  VERP MREVVQML +   
Sbjct  402  KMQTNSSKEGVVKILDQRLSNTPLSEAMQVFFVAMLCVQEHGVERPTMREVVQMLAQ--A  459

Query  361  QPPGT  347
            Q P T
Sbjct  460  QKPNT  464



>ref|XP_008347921.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Malus domestica]
Length=999

 Score =   195 bits (495),  Expect = 3e-53, Method: Composition-based stats.
 Identities = 87/119 (73%), Positives = 106/119 (89%), Gaps = 1/119 (1%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G++PVGEFG+GVDIVQW +
Sbjct  844  ECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELLTGRRPVGEFGEGVDIVQWSK  903

Query  538  KMTDGKKEGVVKILDSRLS-TVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELP  365
            K T+ +KE V  I+D RL+ +VP  EAMHMF++A+LC++E +VERP MREVVQML+E P
Sbjct  904  KATNCRKEXVANIVDHRLTISVPKDEAMHMFFIAMLCIQENSVERPTMREVVQMLSEFP  962



>ref|XP_002304615.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE79594.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=988

 Score =   195 bits (495),  Expect = 4e-53, Method: Composition-based stats.
 Identities = 90/122 (74%), Positives = 107/122 (88%), Gaps = 2/122 (2%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DGVDIVQWV  542
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G++PVG+FG +G+DIVQW 
Sbjct  862  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRRPVGDFGEEGLDIVQWT  921

Query  541  RKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK  362
            +  T   KEGVVKILD RL+ +P+ EAM +F+VA+LCV+EQ+VERP MREVVQML +  K
Sbjct  922  KTQTKSSKEGVVKILDQRLTDIPLIEAMQVFFVAMLCVQEQSVERPTMREVVQMLAQ-AK  980

Query  361  QP  356
            QP
Sbjct  981  QP  982



>ref|XP_006385034.1| hypothetical protein POPTR_0004s23260g [Populus trichocarpa]
 gb|ERP62831.1| hypothetical protein POPTR_0004s23260g [Populus trichocarpa]
Length=1001

 Score =   195 bits (495),  Expect = 4e-53, Method: Composition-based stats.
 Identities = 85/127 (67%), Positives = 108/127 (85%), Gaps = 3/127 (2%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            +CMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G++PVG+FGDGVDIVQW +
Sbjct  842  QCMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELLTGRRPVGDFGDGVDIVQWSK  901

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            + T+ +KE  + I+D RL+ VP  EAMH+F++A+LC +E ++ERP MREVVQML+E P+ 
Sbjct  902  RATNSRKEDAMHIVDPRLTMVPKDEAMHLFFIAMLCSQENSIERPTMREVVQMLSEFPRH  961

Query  358  PPGTKPE  338
               T P+
Sbjct  962  ---TSPD  965



>ref|XP_008356104.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Malus domestica]
Length=987

 Score =   194 bits (494),  Expect = 4e-53, Method: Composition-based stats.
 Identities = 90/122 (74%), Positives = 108/122 (89%), Gaps = 2/122 (2%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DGVDIVQWV  542
            ECMSAIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G++PVG FG +G+DIVQW 
Sbjct  861  ECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELITGRRPVGGFGEEGMDIVQWT  920

Query  541  RKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK  362
            +  T+ +KEGV+KILD RL TVP+ EAM +F+VA+LCV+EQ+VERP MREVVQML +  K
Sbjct  921  KIQTNSQKEGVIKILDKRLDTVPMDEAMQVFFVAVLCVQEQSVERPTMREVVQMLAQ-AK  979

Query  361  QP  356
            QP
Sbjct  980  QP  981



>ref|XP_010687839.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Beta vulgaris subsp. vulgaris]
Length=1010

 Score =   195 bits (495),  Expect = 4e-53, Method: Composition-based stats.
 Identities = 88/123 (72%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G++PVG+FG+GVDIVQW R
Sbjct  856  ECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELLTGRRPVGDFGEGVDIVQWSR  915

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
              T+ +KE V  ILDSRL+ VP  EAMH+F+VA+LC +E ++ERP MREVVQML+E P  
Sbjct  916  VQTNCRKETVPIILDSRLTAVPQDEAMHLFFVAMLCTQENSIERPTMREVVQMLSEYPYH  975

Query  358  PPG  350
              G
Sbjct  976  AMG  978



>ref|XP_011028346.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Populus euphratica]
Length=1001

 Score =   194 bits (494),  Expect = 5e-53, Method: Composition-based stats.
 Identities = 85/127 (67%), Positives = 108/127 (85%), Gaps = 3/127 (2%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            +CMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G++PVG+FGDGVDIVQW +
Sbjct  842  QCMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELLTGRRPVGDFGDGVDIVQWSK  901

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            + T+ +KE  + I+D RL+ VP  EAMH+F++A+LC +E ++ERP MREVVQML+E P+ 
Sbjct  902  RATNSRKEDAMHIVDPRLTMVPKAEAMHLFFIAMLCSQENSIERPTMREVVQMLSEFPRH  961

Query  358  PPGTKPE  338
               T P+
Sbjct  962  ---TSPD  965



>ref|XP_009401113.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=987

 Score =   194 bits (493),  Expect = 6e-53, Method: Composition-based stats.
 Identities = 91/150 (61%), Positives = 110/150 (73%), Gaps = 13/150 (9%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            E MSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G++PVG FGDGVDIVQW +
Sbjct  838  ETMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRRPVGGFGDGVDIVQWAK  897

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
             +T   ++    I+D RLSTVP+ E MH+F+VA+LCV+E +VERP MREVVQML+E P  
Sbjct  898  SVTSCSRDNAAAIVDPRLSTVPVDELMHVFFVAMLCVQENSVERPTMREVVQMLSEFPHH  957

Query  358  PPGTKPEGTTACESSALEPPPSTGTSDDAK  269
             P               + P S+ T+ D K
Sbjct  958  VPEN-------------QSPSSSSTARDKK  974



>ref|XP_009363288.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Pyrus x bretschneideri]
Length=987

 Score =   194 bits (492),  Expect = 7e-53, Method: Composition-based stats.
 Identities = 90/122 (74%), Positives = 107/122 (88%), Gaps = 2/122 (2%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DGVDIVQWV  542
            ECMSAIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G++PVG FG +G+DIVQW 
Sbjct  861  ECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELITGRRPVGGFGEEGMDIVQWT  920

Query  541  RKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK  362
            +  T+ +KEGV+KILD RL  VP+ EAM +F+VA+LCVEEQ+VERP MREVVQML +  K
Sbjct  921  KIQTNSQKEGVIKILDKRLDAVPMDEAMQVFFVAVLCVEEQSVERPTMREVVQMLAQ-AK  979

Query  361  QP  356
            QP
Sbjct  980  QP  981



>ref|XP_010030176.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Eucalyptus grandis]
Length=994

 Score =   194 bits (493),  Expect = 7e-53, Method: Composition-based stats.
 Identities = 85/122 (70%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G++PVG+FG+GVDIVQW +
Sbjct  840  ECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELLTGRRPVGDFGEGVDIVQWSK  899

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            KMT  +KE V  I+D +L  VP  EA H+F++A+LCV++ +VERP MREVVQML+E P+ 
Sbjct  900  KMTGCRKEEVTCIVDPKLKAVPKDEATHLFFIAMLCVQDNSVERPTMREVVQMLSEYPRH  959

Query  358  PP  353
             P
Sbjct  960  SP  961



>ref|XP_004295533.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Fragaria vesca subsp. vesca]
Length=982

 Score =   194 bits (492),  Expect = 8e-53, Method: Composition-based stats.
 Identities = 89/122 (73%), Positives = 107/122 (88%), Gaps = 2/122 (2%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DGVDIVQWV  542
            ECMSAIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G++PVG FG +G+DIVQW 
Sbjct  856  ECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELITGRRPVGGFGEEGMDIVQWT  915

Query  541  RKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK  362
            +  TD +KEGV+KILD RL +VP+ EAM +F+VA+LCV+E +VERP MREVVQML +  K
Sbjct  916  KLQTDSRKEGVIKILDQRLGSVPLDEAMQVFFVAVLCVQEHSVERPTMREVVQMLAQ-AK  974

Query  361  QP  356
            QP
Sbjct  975  QP  976



>gb|AHJ14779.1| CLAVATA1 [Rhododendron ovatum]
Length=992

 Score =   194 bits (492),  Expect = 9e-53, Method: Composition-based stats.
 Identities = 90/122 (74%), Positives = 106/122 (87%), Gaps = 2/122 (2%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DGVDIVQWV  542
            ECMSAIAGSYGYIAPEYAYTLKVDE+SDVYSFGVVLLEL++G++PVG+FG DG+DIVQW 
Sbjct  866  ECMSAIAGSYGYIAPEYAYTLKVDERSDVYSFGVVLLELITGRRPVGDFGEDGMDIVQWT  925

Query  541  RKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK  362
            +  T+  KEGVVKILD RL  VP+ EAM +F+VA+LCV+E +VERP MREVVQML +  K
Sbjct  926  KIKTNWSKEGVVKILDERLKNVPVDEAMQVFFVAMLCVQEHSVERPTMREVVQMLAQ-AK  984

Query  361  QP  356
            QP
Sbjct  985  QP  986



>gb|KJB16198.1| hypothetical protein B456_002G217000 [Gossypium raimondii]
Length=770

 Score =   192 bits (487),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 82/120 (68%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLE+++G+KPVGEFG+GVDIVQW +
Sbjct  633  ECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLEMITGRKPVGEFGEGVDIVQWAK  692

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            + T+ ++E V  I+D RL++VP  EAMH+ ++A+LCV+E ++ERP MREVVQML+E  + 
Sbjct  693  RSTNCRREEVSNIVDRRLTSVPKDEAMHLLFIAMLCVQENSIERPTMREVVQMLSEFARH  752



>ref|XP_008339390.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Malus domestica]
Length=999

 Score =   193 bits (491),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 85/121 (70%), Positives = 107/121 (88%), Gaps = 1/121 (1%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            +CMSAIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G++PVGEFG+GVDIVQW +
Sbjct  844  QCMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELLTGRRPVGEFGEGVDIVQWSK  903

Query  538  KMTDGKKEGVVKILDSRLS-TVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK  362
            K T+ +KE V  I+D RL+ ++P  EAMHMF++A+LC++E +VERP MREVVQML+E P+
Sbjct  904  KATNCRKEDVTNIVDHRLTVSLPKDEAMHMFFIAMLCIQENSVERPTMREVVQMLSEFPR  963

Query  361  Q  359
             
Sbjct  964  H  964



>ref|XP_011022287.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Populus euphratica]
Length=988

 Score =   193 bits (490),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 90/122 (74%), Positives = 106/122 (87%), Gaps = 2/122 (2%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DGVDIVQWV  542
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G++PVG+FG +G+DIVQW 
Sbjct  862  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRRPVGDFGEEGLDIVQWT  921

Query  541  RKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK  362
            +  T   KEGVVKILD RL  +P+ EAM +F+VA+LCV+EQ+VERP MREVVQML +  K
Sbjct  922  KTQTKSSKEGVVKILDQRLIDIPLIEAMQVFFVAMLCVQEQSVERPTMREVVQMLAQ-AK  980

Query  361  QP  356
            QP
Sbjct  981  QP  982



>ref|XP_009368577.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Pyrus x bretschneideri]
Length=987

 Score =   193 bits (490),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 89/122 (73%), Positives = 107/122 (88%), Gaps = 2/122 (2%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DGVDIVQWV  542
            ECMSA+AGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G++PVG FG +G+DIVQW 
Sbjct  861  ECMSAVAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRRPVGGFGEEGMDIVQWT  920

Query  541  RKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK  362
            +  T+ +KEGV+KILD RL TVP+ EAM +F+VA+LCV+E +VERP MREVVQML +  K
Sbjct  921  KIQTNSQKEGVIKILDKRLDTVPMDEAMQVFFVAVLCVQEHSVERPTMREVVQMLAQ-AK  979

Query  361  QP  356
            QP
Sbjct  980  QP  981



>ref|XP_008349109.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Malus domestica]
Length=987

 Score =   193 bits (490),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 89/122 (73%), Positives = 107/122 (88%), Gaps = 2/122 (2%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DGVDIVQWV  542
            ECMSA+AGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G++PVG FG +G+DIVQW 
Sbjct  861  ECMSAVAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRRPVGGFGEEGMDIVQWT  920

Query  541  RKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK  362
            +  T+ +KEGV+KILD RL TVP+ EAM +F+VA+LCV+E +VERP MREVVQML +  K
Sbjct  921  KIQTNSQKEGVIKILDKRLDTVPMDEAMQVFFVAVLCVQEHSVERPTMREVVQMLAQ-AK  979

Query  361  QP  356
            QP
Sbjct  980  QP  981



>ref|XP_008799579.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Phoenix dactylifera]
Length=984

 Score =   193 bits (490),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 92/124 (74%), Positives = 106/124 (85%), Gaps = 2/124 (2%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DGVDIVQWV  542
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G++PVG+FG +G+DIVQW 
Sbjct  858  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRRPVGDFGEEGLDIVQWA  917

Query  541  RKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK  362
            R  T+  KEGVVKILD RL   P+ EAM +F+V +LCV+EQ+VERP MREVVQML E  K
Sbjct  918  RMNTNWSKEGVVKILDPRLINFPLEEAMQVFFVGMLCVQEQSVERPTMREVVQML-EQTK  976

Query  361  QPPG  350
            QP G
Sbjct  977  QPFG  980



>ref|XP_011004294.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 isoform X1 [Populus euphratica]
Length=988

 Score =   192 bits (489),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 90/122 (74%), Positives = 106/122 (87%), Gaps = 2/122 (2%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DGVDIVQWV  542
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G++PVG+FG +G+DIVQW 
Sbjct  862  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRRPVGDFGEEGLDIVQWT  921

Query  541  RKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK  362
            +  T   KEGVVKILD  L+ +P+ EAM +F+VA+LCV+EQ+VERP MREVVQML E  K
Sbjct  922  KTQTKSSKEGVVKILDQGLTDIPLIEAMQVFFVAMLCVQEQSVERPTMREVVQMLAE-AK  980

Query  361  QP  356
            QP
Sbjct  981  QP  982



>ref|XP_002297907.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE82712.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=988

 Score =   192 bits (489),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 90/122 (74%), Positives = 106/122 (87%), Gaps = 2/122 (2%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DGVDIVQWV  542
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G++PVG+FG +G+DIVQW 
Sbjct  862  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRRPVGDFGEEGLDIVQWT  921

Query  541  RKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK  362
            +  T   KEGVVKILD  L+ +P+ EAM +F+VA+LCV+EQ+VERP MREVVQML E  K
Sbjct  922  KTQTKSSKEGVVKILDQGLTDIPLIEAMQVFFVAMLCVQEQSVERPTMREVVQMLAE-AK  980

Query  361  QP  356
            QP
Sbjct  981  QP  982



>ref|XP_006468612.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3-like isoform X1 [Citrus sinensis]
Length=987

 Score =   192 bits (489),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 89/125 (71%), Positives = 105/125 (84%), Gaps = 3/125 (2%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DGVDIVQWV  542
            ECMSA+AGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G++PVG+FG +G+DIVQW 
Sbjct  861  ECMSAVAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRRPVGDFGEEGLDIVQWT  920

Query  541  RKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK  362
            +  T+  KEGVVKILD RLS  P+ EAM +F+VA+LCV+E  VERP MREVVQML +   
Sbjct  921  KMQTNSSKEGVVKILDQRLSNTPLSEAMQVFFVAMLCVQEHGVERPTMREVVQMLAQ--A  978

Query  361  QPPGT  347
            Q P T
Sbjct  979  QKPNT  983



>gb|KCW62729.1| hypothetical protein EUGRSUZ_G00319 [Eucalyptus grandis]
Length=958

 Score =   192 bits (487),  Expect = 4e-52, Method: Composition-based stats.
 Identities = 84/123 (68%), Positives = 104/123 (85%), Gaps = 1/123 (1%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMS IAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G++PVG+FGDGVDIVQW +
Sbjct  812  ECMSVIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELLTGRRPVGDFGDGVDIVQWTK  871

Query  538  -KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK  362
               T+ ++E   +++D RLS VP  EA H+F+VA+LCV+E + ERP MREVVQML+E P+
Sbjct  872  IATTNWRREEATRVVDPRLSLVPKDEATHVFFVAMLCVQENSTERPTMREVVQMLSEFPR  931

Query  361  QPP  353
             PP
Sbjct  932  HPP  934



>gb|KHG17337.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Gossypium arboreum]
Length=1006

 Score =   192 bits (487),  Expect = 4e-52, Method: Composition-based stats.
 Identities = 82/120 (68%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLE+++G+KPVGEFG+GVDIVQW +
Sbjct  869  ECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLEMITGRKPVGEFGEGVDIVQWAK  928

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            + T+ ++E V  I+D RL++VP  EAMH+ ++A+LCV+E ++ERP MREVVQML+E  + 
Sbjct  929  RSTNCRREEVSNIVDRRLTSVPKDEAMHLLFIAMLCVQENSIERPTMREVVQMLSEFARH  988



>ref|XP_009353760.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Pyrus x bretschneideri]
Length=999

 Score =   192 bits (487),  Expect = 4e-52, Method: Composition-based stats.
 Identities = 84/121 (69%), Positives = 106/121 (88%), Gaps = 1/121 (1%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            +CMSAIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G++PVGEFG+GVDIVQW +
Sbjct  844  QCMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELLTGRRPVGEFGEGVDIVQWSK  903

Query  538  KMTDGKKEGVVKILDSRLS-TVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK  362
            K T+ +KE V  I+D RL+ ++P  E MHMF++A+LC++E +VERP MREVVQML+E P+
Sbjct  904  KATNCRKEDVTNIVDHRLTISLPKDEVMHMFFIAMLCIQENSVERPTMREVVQMLSEFPR  963

Query  361  Q  359
             
Sbjct  964  H  964



>gb|KJB16199.1| hypothetical protein B456_002G217000 [Gossypium raimondii]
Length=1007

 Score =   192 bits (487),  Expect = 4e-52, Method: Composition-based stats.
 Identities = 82/120 (68%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLE+++G+KPVGEFG+GVDIVQW +
Sbjct  870  ECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLEMITGRKPVGEFGEGVDIVQWAK  929

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            + T+ ++E V  I+D RL++VP  EAMH+ ++A+LCV+E ++ERP MREVVQML+E  + 
Sbjct  930  RSTNCRREEVSNIVDRRLTSVPKDEAMHLLFIAMLCVQENSIERPTMREVVQMLSEFARH  989



>ref|XP_010065309.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Eucalyptus grandis]
Length=990

 Score =   192 bits (487),  Expect = 4e-52, Method: Composition-based stats.
 Identities = 84/123 (68%), Positives = 104/123 (85%), Gaps = 1/123 (1%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMS IAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G++PVG+FGDGVDIVQW +
Sbjct  844  ECMSVIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELLTGRRPVGDFGDGVDIVQWTK  903

Query  538  -KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK  362
               T+ ++E   +++D RLS VP  EA H+F+VA+LCV+E + ERP MREVVQML+E P+
Sbjct  904  IATTNWRREEATRVVDPRLSLVPKDEATHVFFVAMLCVQENSTERPTMREVVQMLSEFPR  963

Query  361  QPP  353
             PP
Sbjct  964  HPP  966



>gb|KDP23869.1| hypothetical protein JCGZ_27138 [Jatropha curcas]
Length=989

 Score =   191 bits (486),  Expect = 5e-52, Method: Composition-based stats.
 Identities = 91/122 (75%), Positives = 106/122 (87%), Gaps = 2/122 (2%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DGVDIVQWV  542
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G++PVG FG +G+DIVQW 
Sbjct  863  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELLTGRRPVGGFGEEGLDIVQWT  922

Query  541  RKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK  362
            +  T+  KE VVKILD RLS +P+ EAM +F+VA+LCV+EQ+VERP MREVVQML E  K
Sbjct  923  KIQTNSSKERVVKILDQRLSEIPLIEAMQVFFVAMLCVQEQSVERPTMREVVQMLAE-AK  981

Query  361  QP  356
            QP
Sbjct  982  QP  983



>ref|XP_008793131.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 isoform X2 [Phoenix dactylifera]
Length=813

 Score =   190 bits (482),  Expect = 6e-52, Method: Composition-based stats.
 Identities = 88/117 (75%), Positives = 103/117 (88%), Gaps = 1/117 (1%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DGVDIVQWV  542
            ECMSAIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G+KPVG+FG +G+DIVQW 
Sbjct  687  ECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELITGRKPVGDFGEEGLDIVQWA  746

Query  541  RKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTE  371
            R  T+  KEGVVKILD RL  VP+ EAM +F+V +LCV+EQ+VERP MREVVQML +
Sbjct  747  RMNTNWSKEGVVKILDPRLINVPLEEAMQVFFVGMLCVQEQSVERPTMREVVQMLEQ  803



>ref|XP_006448558.1| hypothetical protein CICLE_v10014145mg [Citrus clementina]
 gb|ESR61798.1| hypothetical protein CICLE_v10014145mg [Citrus clementina]
Length=987

 Score =   191 bits (486),  Expect = 6e-52, Method: Composition-based stats.
 Identities = 89/125 (71%), Positives = 104/125 (83%), Gaps = 3/125 (2%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DGVDIVQWV  542
            ECMSA+AGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G++PVG+FG +G+DIVQW 
Sbjct  861  ECMSAVAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRRPVGDFGEEGLDIVQWT  920

Query  541  RKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK  362
            +  T+  KEGVVKILD RLS  P+ EAM +F+VA LCV+E  VERP MREVVQML +   
Sbjct  921  KMQTNSSKEGVVKILDQRLSNTPLSEAMQVFFVATLCVQEHGVERPTMREVVQMLAQ--A  978

Query  361  QPPGT  347
            Q P T
Sbjct  979  QKPNT  983



>emb|CDP04113.1| unnamed protein product [Coffea canephora]
Length=987

 Score =   191 bits (485),  Expect = 7e-52, Method: Composition-based stats.
 Identities = 89/122 (73%), Positives = 105/122 (86%), Gaps = 2/122 (2%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DGVDIVQWV  542
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G++PVG FG +G+DIVQW 
Sbjct  861  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRRPVGNFGEEGLDIVQWA  920

Query  541  RKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK  362
               T+  KEGVVKILD RL  VP++EAM +F+VA+LCV+E ++ERP MREVVQML +  K
Sbjct  921  NIQTNWSKEGVVKILDERLKNVPLNEAMQVFFVAMLCVQEHSIERPTMREVVQMLAQ-AK  979

Query  361  QP  356
            QP
Sbjct  980  QP  981



>ref|XP_008793129.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 isoform X1 [Phoenix dactylifera]
Length=988

 Score =   191 bits (485),  Expect = 7e-52, Method: Composition-based stats.
 Identities = 88/117 (75%), Positives = 103/117 (88%), Gaps = 1/117 (1%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DGVDIVQWV  542
            ECMSAIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G+KPVG+FG +G+DIVQW 
Sbjct  862  ECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELITGRKPVGDFGEEGLDIVQWA  921

Query  541  RKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTE  371
            R  T+  KEGVVKILD RL  VP+ EAM +F+V +LCV+EQ+VERP MREVVQML +
Sbjct  922  RMNTNWSKEGVVKILDPRLINVPLEEAMQVFFVGMLCVQEQSVERPTMREVVQMLEQ  978



>ref|XP_010087435.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM2 [Morus notabilis]
 gb|EXB29045.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM2 [Morus notabilis]
Length=1014

 Score =   191 bits (485),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 88/128 (69%), Positives = 107/128 (84%), Gaps = 8/128 (6%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G++PVGEFG+GVDIVQW +
Sbjct  853  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELLTGRRPVGEFGEGVDIVQWCK  912

Query  538  KMTDGKKEGVVKILDSRLST--------VPIHEAMHMFYVALLCVEEQAVERPKMREVVQ  383
            K T+ ++E V++I+D RL T        VP  EAMH+F++A LCV+E +VERP MREVVQ
Sbjct  913  KATNCRREDVLQIVDRRLMTTSTTANYNVPKEEAMHLFFIATLCVQENSVERPTMREVVQ  972

Query  382  MLTELPKQ  359
            ML+EL + 
Sbjct  973  MLSELTRH  980



>ref|XP_010918071.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Elaeis guineensis]
Length=984

 Score =   191 bits (484),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 87/117 (74%), Positives = 103/117 (88%), Gaps = 1/117 (1%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DGVDIVQWV  542
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G++PVG+FG +G+DIVQW 
Sbjct  858  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRRPVGDFGEEGLDIVQWA  917

Query  541  RKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTE  371
            R  T+  KEGVVKILD RL  VP+ EAM +F+V +LC++EQ+VERP MREVVQML +
Sbjct  918  RMNTNWSKEGVVKILDPRLINVPLEEAMQVFFVGMLCIQEQSVERPTMREVVQMLEQ  974



>ref|XP_007214567.1| hypothetical protein PRUPE_ppa000837mg [Prunus persica]
 gb|EMJ15766.1| hypothetical protein PRUPE_ppa000837mg [Prunus persica]
Length=986

 Score =   191 bits (484),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 89/122 (73%), Positives = 107/122 (88%), Gaps = 2/122 (2%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DGVDIVQWV  542
            ECMSAIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G++PVG FG +G+DIVQW 
Sbjct  860  ECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELITGRRPVGGFGEEGLDIVQWT  919

Query  541  RKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK  362
            +  T+  KEGV+KILD RL +VP+ EAM +F+VA+LCV+EQ+VERP MREVVQML +  K
Sbjct  920  KIQTNLLKEGVIKILDKRLDSVPLDEAMQVFFVAVLCVQEQSVERPTMREVVQMLAQ-AK  978

Query  361  QP  356
            QP
Sbjct  979  QP  980



>ref|XP_009600411.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Nicotiana tomentosiformis]
Length=964

 Score =   189 bits (481),  Expect = 3e-51, Method: Composition-based stats.
 Identities = 89/122 (73%), Positives = 105/122 (86%), Gaps = 2/122 (2%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DGVDIVQWV  542
            ECMSAIAGSYGYIAPEYAYTLK+DEKSDVYS+GVVLLEL++G++PVG FG +GVDIVQW 
Sbjct  838  ECMSAIAGSYGYIAPEYAYTLKIDEKSDVYSYGVVLLELITGRRPVGNFGEEGVDIVQWA  897

Query  541  RKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK  362
            ++ T+  KEGVVKILD RL  V   EAM +F+VA+LCVEE +VERP MREVVQML++  K
Sbjct  898  KRETNWSKEGVVKILDERLKNVATAEAMQVFFVAMLCVEEYSVERPTMREVVQMLSQ-AK  956

Query  361  QP  356
            QP
Sbjct  957  QP  958



>ref|XP_010260843.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Nelumbo nucifera]
 ref|XP_010260847.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Nelumbo nucifera]
Length=1006

 Score =   189 bits (481),  Expect = 3e-51, Method: Composition-based stats.
 Identities = 87/122 (71%), Positives = 106/122 (87%), Gaps = 2/122 (2%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DGVDIVQWV  542
            ECMSAIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G++PVG+FG +G+DIVQW 
Sbjct  880  ECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELITGRRPVGDFGEEGLDIVQWT  939

Query  541  RKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK  362
            +  T+  KEGV+KILD RL+ VP+ EAM +F+V +LCV+E +VERP MREVVQML +  K
Sbjct  940  KMNTNWNKEGVMKILDERLTNVPLDEAMQVFFVGMLCVQEHSVERPTMREVVQMLVQ-AK  998

Query  361  QP  356
            QP
Sbjct  999  QP  1000



>gb|KHG23359.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM3 [Gossypium arboreum]
Length=995

 Score =   189 bits (481),  Expect = 3e-51, Method: Composition-based stats.
 Identities = 91/123 (74%), Positives = 107/123 (87%), Gaps = 3/123 (2%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DGVDIVQWV  542
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G++PVG+FG +G+DIVQW 
Sbjct  868  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRRPVGDFGEEGLDIVQWS  927

Query  541  RKMTDGKKEGVVKILDSRLS-TVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELP  365
            ++ T  KKEGVVKILD R+S T+P  E M +F+VA+LCVEE +VERP MREVVQML +  
Sbjct  928  KRETKLKKEGVVKILDHRVSNTIPKEEVMQVFFVAMLCVEEHSVERPTMREVVQMLAQ-A  986

Query  364  KQP  356
            KQP
Sbjct  987  KQP  989



>gb|KJB32927.1| hypothetical protein B456_005G268400 [Gossypium raimondii]
Length=995

 Score =   189 bits (480),  Expect = 4e-51, Method: Composition-based stats.
 Identities = 91/123 (74%), Positives = 107/123 (87%), Gaps = 3/123 (2%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DGVDIVQWV  542
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G++PVG+FG +G+DIVQW 
Sbjct  868  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRRPVGDFGEEGLDIVQWS  927

Query  541  RKMTDGKKEGVVKILDSRLS-TVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELP  365
            ++ T  KKEGVVKILD R+S T+P  E M +F+VA+LCVEE +VERP MREVVQML +  
Sbjct  928  KRETKLKKEGVVKILDHRVSNTIPEEEVMQVFFVAMLCVEEHSVERPTMREVVQMLAQ-A  986

Query  364  KQP  356
            KQP
Sbjct  987  KQP  989



>ref|XP_004491265.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3-like [Cicer arietinum]
Length=976

 Score =   189 bits (479),  Expect = 5e-51, Method: Composition-based stats.
 Identities = 87/122 (71%), Positives = 105/122 (86%), Gaps = 2/122 (2%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DGVDIVQWV  542
            ECMS+I GSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G++PVG+FG +G+DIVQW 
Sbjct  851  ECMSSIVGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELLTGRRPVGDFGEEGIDIVQWT  910

Query  541  RKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK  362
            +  TD  KE VVKILD RL  +P+ EAM +F+VA+LCV+EQ+VERP MREVV+ML +  K
Sbjct  911  KLQTDWNKEKVVKILDGRLHHIPLDEAMQLFFVAMLCVQEQSVERPTMREVVEMLAQ-AK  969

Query  361  QP  356
            QP
Sbjct  970  QP  971



>ref|XP_004229499.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Solanum lycopersicum]
Length=960

 Score =   188 bits (478),  Expect = 7e-51, Method: Composition-based stats.
 Identities = 89/122 (73%), Positives = 104/122 (85%), Gaps = 2/122 (2%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DGVDIVQWV  542
            ECMSAIAGSYGYIAPEYAYTLK+DEKSDVYSFGVVLLEL++G++PVG FG +G+DIVQW 
Sbjct  834  ECMSAIAGSYGYIAPEYAYTLKIDEKSDVYSFGVVLLELITGRRPVGNFGEEGMDIVQWA  893

Query  541  RKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK  362
            +  T   KEGVVKILD RL  V I EAM +F+VA+LCVEE ++ERP MREVVQML++  K
Sbjct  894  KTETKWSKEGVVKILDERLKNVAIVEAMQVFFVAMLCVEEYSIERPTMREVVQMLSQ-AK  952

Query  361  QP  356
            QP
Sbjct  953  QP  954



>ref|XP_009763204.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Nicotiana sylvestris]
Length=958

 Score =   188 bits (477),  Expect = 7e-51, Method: Composition-based stats.
 Identities = 88/122 (72%), Positives = 105/122 (86%), Gaps = 2/122 (2%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DGVDIVQWV  542
            ECMSAIAGSYGYIAPEYAYTLK+DEKSDVYS+GVVLLEL++G++PVG FG +G+DIVQW 
Sbjct  832  ECMSAIAGSYGYIAPEYAYTLKIDEKSDVYSYGVVLLELITGRRPVGNFGEEGLDIVQWA  891

Query  541  RKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK  362
            ++ T+  KEGVVKILD RL  V   EAM +F+VA+LCVEE +VERP MREVVQML++  K
Sbjct  892  KRETNWSKEGVVKILDERLKNVATAEAMQVFFVAMLCVEEYSVERPTMREVVQMLSQ-AK  950

Query  361  QP  356
            QP
Sbjct  951  QP  952



>emb|CDY54567.1| BnaA08g30460D [Brassica napus]
Length=844

 Score =   186 bits (473),  Expect = 1e-50, Method: Composition-based stats.
 Identities = 84/122 (69%), Positives = 107/122 (88%), Gaps = 2/122 (2%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DGVDIVQWV  542
            ECMS++AGSYGYIAPEYAYTL++DEKSDVYSFGVVLLEL++G+KPV +FG +G+DIVQW 
Sbjct  721  ECMSSVAGSYGYIAPEYAYTLRIDEKSDVYSFGVVLLELITGRKPVDKFGEEGIDIVQWS  780

Query  541  RKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK  362
            +  T+  K+GVVKI+D RLS VP+ EAM +F+VA+LCV+E +VERP MREVVQM+++  K
Sbjct  781  KIQTNCNKQGVVKIIDQRLSNVPLGEAMELFFVAMLCVQEHSVERPTMREVVQMISQ-AK  839

Query  361  QP  356
            QP
Sbjct  840  QP  841



>ref|XP_004301907.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Fragaria vesca subsp. vesca]
Length=1011

 Score =   188 bits (477),  Expect = 1e-50, Method: Composition-based stats.
 Identities = 82/120 (68%), Positives = 106/120 (88%), Gaps = 1/120 (1%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            +CMSAIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G++PVGEFG+G+DIVQW +
Sbjct  857  QCMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELLTGRRPVGEFGEGIDIVQWSK  916

Query  538  KMTDGKKEGVVKILDSRLS-TVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK  362
            K+T+ +K+    I+D RL+ +VP  EAMH+F++A+ CV+E +VERP MREVVQML+E P+
Sbjct  917  KVTNCRKQDAADIVDPRLAISVPKDEAMHLFFIAMHCVQENSVERPTMREVVQMLSEFPR  976



>ref|XP_010924539.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Elaeis guineensis]
Length=986

 Score =   187 bits (475),  Expect = 2e-50, Method: Composition-based stats.
 Identities = 85/117 (73%), Positives = 102/117 (87%), Gaps = 1/117 (1%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DGVDIVQWV  542
            ECMSA+AGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G++PVG+FG +G+DIVQW 
Sbjct  860  ECMSAVAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELITGRRPVGDFGEEGLDIVQWA  919

Query  541  RKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTE  371
            R  T+  KEGVVKILD RL  VP+ EAM +F+V +LCV+E +VERP MREVVQML +
Sbjct  920  RMNTNWSKEGVVKILDPRLIDVPLEEAMQVFFVGMLCVQEHSVERPTMREVVQMLEQ  976



>ref|NP_001170600.1| uncharacterized protein LOC100384637 [Zea mays]
 gb|ACR34174.1| unknown [Zea mays]
Length=206

 Score =   175 bits (443),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 101/121 (83%), Gaps = 1/121 (1%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            E MSA+AGSYGYIAPEYAYTL+VDEKSDVYS+GVVLLEL++G++PVG+FG+GVDIVQW +
Sbjct  38   ESMSAVAGSYGYIAPEYAYTLRVDEKSDVYSYGVVLLELITGRRPVGDFGEGVDIVQWAK  97

Query  538  KMTDGKKEGVVKILDSRL-STVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK  362
            + T G++E V  I+D RL    P  E  H+F+V++LCV++ +VERP MREVVQML ELP+
Sbjct  98   RATAGRREAVPGIVDRRLVGGAPADEVAHLFFVSMLCVQDNSVERPTMREVVQMLAELPR  157

Query  361  Q  359
             
Sbjct  158  H  158



>ref|XP_009415746.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Musa acuminata subsp. malaccensis]
Length=978

 Score =   187 bits (474),  Expect = 3e-50, Method: Composition-based stats.
 Identities = 86/117 (74%), Positives = 102/117 (87%), Gaps = 1/117 (1%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DGVDIVQWV  542
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYS+GVVLLEL++GK+PVG+ G +G+DIVQW 
Sbjct  852  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSYGVVLLELITGKRPVGDLGEEGLDIVQWA  911

Query  541  RKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTE  371
            R  T+  KEGVV I+D RL  VP+ EAM +F+VA+LCV+E +VERPKMREVVQML +
Sbjct  912  RMNTNWHKEGVVNIMDRRLIDVPMEEAMQVFFVAMLCVQEHSVERPKMREVVQMLEQ  968



>emb|CDX93999.1| BnaC07g36330D [Brassica napus]
Length=844

 Score =   186 bits (471),  Expect = 3e-50, Method: Composition-based stats.
 Identities = 83/122 (68%), Positives = 107/122 (88%), Gaps = 2/122 (2%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DGVDIVQWV  542
            ECMS++AGSYGYIAPEYAYTL++DEKSDVYSFGVVLLEL++G+KPV +FG +G+DIVQW 
Sbjct  721  ECMSSVAGSYGYIAPEYAYTLRIDEKSDVYSFGVVLLELITGRKPVDKFGEEGIDIVQWS  780

Query  541  RKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK  362
            +  T+  ++GVVKI+D RLS VP+ EAM +F+VA+LCV+E +VERP MREVVQM+++  K
Sbjct  781  KIQTNCNRQGVVKIIDQRLSNVPLGEAMELFFVAMLCVQEHSVERPTMREVVQMISQ-AK  839

Query  361  QP  356
            QP
Sbjct  840  QP  841



>emb|CDX98665.1| BnaA03g44500D [Brassica napus]
Length=844

 Score =   186 bits (471),  Expect = 3e-50, Method: Composition-based stats.
 Identities = 83/122 (68%), Positives = 107/122 (88%), Gaps = 2/122 (2%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DGVDIVQWV  542
            ECMS++AGSYGYIAPEYAYTL++DEKSDVYSFGVVLLEL++G+KPV +FG +G+DIVQW 
Sbjct  721  ECMSSVAGSYGYIAPEYAYTLRIDEKSDVYSFGVVLLELITGRKPVDKFGEEGIDIVQWS  780

Query  541  RKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK  362
            +  T+  ++GVVKI+D RLS VP+ EAM +F+VA+LCV+E +VERP MREVVQM+++  K
Sbjct  781  KIQTNCNRQGVVKIIDQRLSNVPLGEAMELFFVAMLCVQEHSVERPTMREVVQMISQ-AK  839

Query  361  QP  356
            QP
Sbjct  840  QP  841



>ref|XP_008225951.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Prunus mume]
Length=986

 Score =   186 bits (473),  Expect = 3e-50, Method: Composition-based stats.
 Identities = 85/117 (73%), Positives = 103/117 (88%), Gaps = 1/117 (1%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DGVDIVQWV  542
            ECMSAIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G++PVG FG +G+DIVQW 
Sbjct  860  ECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELITGRRPVGGFGEEGLDIVQWT  919

Query  541  RKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTE  371
            +  T+  KEGV+KILD RL +VP+ EAM +F+VA+LC +EQ+VERP MREVVQML +
Sbjct  920  KIQTNLLKEGVIKILDKRLDSVPLDEAMQVFFVAVLCAQEQSVERPTMREVVQMLAQ  976



>ref|XP_010094628.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM3 [Morus notabilis]
 gb|EXB56447.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM3 [Morus notabilis]
Length=998

 Score =   186 bits (473),  Expect = 3e-50, Method: Composition-based stats.
 Identities = 91/133 (68%), Positives = 108/133 (81%), Gaps = 13/133 (10%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DGVDIVQWV  542
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G+KPVG+FG +G+DIVQW 
Sbjct  861  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRKPVGDFGEEGMDIVQWT  920

Query  541  RKMTDGKKEGVVKILDSRLST-----------VPIHEAMHMFYVALLCVEEQAVERPKMR  395
            +  T+  KEGVVKILD RL +           VPI +AM +F+VA+LCV+EQ+VERP MR
Sbjct  921  KINTESSKEGVVKILDERLMSNNINNNNNNDDVPIEQAMQVFFVAMLCVQEQSVERPTMR  980

Query  394  EVVQMLTELPKQP  356
            +VVQML +  KQP
Sbjct  981  DVVQMLAQ-AKQP  992



>emb|CDY31445.1| BnaC03g63790D [Brassica napus]
Length=844

 Score =   185 bits (470),  Expect = 3e-50, Method: Composition-based stats.
 Identities = 83/122 (68%), Positives = 107/122 (88%), Gaps = 2/122 (2%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DGVDIVQWV  542
            ECMS++AGSYGYIAPEYAYTL++DEKSDVYSFGVVLLEL++G+KPV +FG +G+DIVQW 
Sbjct  721  ECMSSVAGSYGYIAPEYAYTLRIDEKSDVYSFGVVLLELITGRKPVDKFGEEGIDIVQWS  780

Query  541  RKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK  362
            +  T+  K+GVVKI+D RLS VP+ EAM +F++A+LCV+E +VERP MREVVQM+++  K
Sbjct  781  KIQTNCNKQGVVKIIDQRLSNVPLGEAMELFFLAMLCVQEHSVERPTMREVVQMISQ-AK  839

Query  361  QP  356
            QP
Sbjct  840  QP  841



>ref|XP_009108464.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Brassica rapa]
Length=995

 Score =   186 bits (473),  Expect = 3e-50, Method: Composition-based stats.
 Identities = 84/122 (69%), Positives = 107/122 (88%), Gaps = 2/122 (2%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DGVDIVQWV  542
            ECMS++AGSYGYIAPEYAYTL++DEKSDVYSFGVVLLEL++G+KPV +FG +G+DIVQW 
Sbjct  872  ECMSSVAGSYGYIAPEYAYTLRIDEKSDVYSFGVVLLELITGRKPVDKFGEEGIDIVQWS  931

Query  541  RKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK  362
            +  T+  K+GVVKI+D RLS VP+ EAM +F+VA+LCV+E +VERP MREVVQM+++  K
Sbjct  932  KIQTNCNKQGVVKIIDQRLSNVPLGEAMELFFVAMLCVQEHSVERPTMREVVQMISQ-AK  990

Query  361  QP  356
            QP
Sbjct  991  QP  992



>gb|EPS62062.1| protein kinase, partial [Genlisea aurea]
Length=979

 Score =   186 bits (473),  Expect = 4e-50, Method: Composition-based stats.
 Identities = 80/120 (67%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFGDGVDIVQWVR  539
            +CMSA+AGSYGYIAPEYAYTLKVDEKSDVYS+GVVLLEL++G + VGEFG+GVDIVQW R
Sbjct  840  QCMSAVAGSYGYIAPEYAYTLKVDEKSDVYSYGVVLLELITGHRAVGEFGEGVDIVQWTR  899

Query  538  KMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPKQ  359
            + T+ +   V +ILD RLS VP  EAMH+ ++++LCV++ +V+RP MREVVQML+E P++
Sbjct  900  RSTNCRTAEVTRILDPRLSVVPKDEAMHLLFISMLCVDDNSVQRPTMREVVQMLSEFPRK  959



>ref|XP_006413888.1| hypothetical protein EUTSA_v10024310mg [Eutrema salsugineum]
 gb|ESQ55341.1| hypothetical protein EUTSA_v10024310mg [Eutrema salsugineum]
Length=996

 Score =   186 bits (472),  Expect = 5e-50, Method: Composition-based stats.
 Identities = 84/122 (69%), Positives = 107/122 (88%), Gaps = 2/122 (2%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DGVDIVQWV  542
            ECMS+IAGSYGYIAPEYAYTL++DEKSDVYSFGVVLLEL++G+KPV +FG +G+DIVQW 
Sbjct  873  ECMSSIAGSYGYIAPEYAYTLRIDEKSDVYSFGVVLLELITGRKPVDKFGEEGIDIVQWS  932

Query  541  RKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK  362
            +  T+  ++GVVKI+D RLS VP+ EAM +F+VA+LCV+E +VERP MREVVQM+++  K
Sbjct  933  KIQTNCNRQGVVKIIDQRLSNVPLGEAMELFFVAMLCVQEHSVERPTMREVVQMISQ-AK  991

Query  361  QP  356
            QP
Sbjct  992  QP  993



>ref|XP_006356981.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3-like [Solanum tuberosum]
Length=960

 Score =   186 bits (471),  Expect = 5e-50, Method: Composition-based stats.
 Identities = 88/122 (72%), Positives = 104/122 (85%), Gaps = 2/122 (2%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DGVDIVQWV  542
            ECMSAIAGSYGYIAPEYAYTLK+DEKSDVYSFGVVLLEL++G++PVG FG +G+DIVQW 
Sbjct  834  ECMSAIAGSYGYIAPEYAYTLKIDEKSDVYSFGVVLLELITGRRPVGNFGEEGMDIVQWA  893

Query  541  RKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK  362
            +  T+  KE VVKILD RL  V I EAM +F+VA+LCVEE ++ERP MREVVQML++  K
Sbjct  894  KTETNWSKEEVVKILDERLKNVAIVEAMQVFFVAMLCVEEYSIERPTMREVVQMLSQ-AK  952

Query  361  QP  356
            QP
Sbjct  953  QP  954



>ref|XP_002869943.1| hypothetical protein ARALYDRAFT_492844 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46202.1| hypothetical protein ARALYDRAFT_492844 [Arabidopsis lyrata subsp. 
lyrata]
Length=992

 Score =   186 bits (472),  Expect = 5e-50, Method: Composition-based stats.
 Identities = 83/122 (68%), Positives = 106/122 (87%), Gaps = 2/122 (2%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DGVDIVQWV  542
            ECMS+IAGSYGYIAPEYAYTL++DEKSDVYSFGVVLLEL++G+KPV  FG +G+DIVQW 
Sbjct  869  ECMSSIAGSYGYIAPEYAYTLRIDEKSDVYSFGVVLLELITGRKPVDNFGEEGIDIVQWS  928

Query  541  RKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK  362
            +  T+  ++GVVKI+D RLS +P+ EAM +F+VA+LCV+E +VERP MREVVQM+++  K
Sbjct  929  KIQTNCNRQGVVKIIDQRLSNIPLEEAMELFFVAMLCVQEHSVERPTMREVVQMISQ-AK  987

Query  361  QP  356
            QP
Sbjct  988  QP  989



>ref|XP_009137141.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Brassica rapa]
Length=967

 Score =   186 bits (471),  Expect = 7e-50, Method: Composition-based stats.
 Identities = 83/122 (68%), Positives = 107/122 (88%), Gaps = 2/122 (2%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DGVDIVQWV  542
            ECMS++AGSYGYIAPEYAYTL++DEKSDVYSFGVVLLEL++G+KPV +FG +G+DIVQW 
Sbjct  844  ECMSSVAGSYGYIAPEYAYTLRIDEKSDVYSFGVVLLELITGRKPVDKFGEEGIDIVQWS  903

Query  541  RKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK  362
            +  T+  ++GVVKI+D RLS VP+ EAM +F+VA+LCV+E +VERP MREVVQM+++  K
Sbjct  904  KIQTNCNRQGVVKIIDQRLSNVPLGEAMELFFVAMLCVQEHSVERPTMREVVQMISQ-AK  962

Query  361  QP  356
            QP
Sbjct  963  QP  964



>ref|XP_010439602.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Camelina sativa]
Length=997

 Score =   186 bits (471),  Expect = 7e-50, Method: Composition-based stats.
 Identities = 84/122 (69%), Positives = 106/122 (87%), Gaps = 2/122 (2%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DGVDIVQWV  542
            ECMS+IAGSYGYIAPEYAYTL++DEKSDVYSFGVVLLEL++G+KPV  FG +G+DIVQW 
Sbjct  874  ECMSSIAGSYGYIAPEYAYTLRIDEKSDVYSFGVVLLELITGRKPVDNFGEEGIDIVQWS  933

Query  541  RKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK  362
            +  T+  ++GVVKI+D RLS VP+ EAM +F+VA+LCV+E +VERP MREVVQM+++  K
Sbjct  934  KIQTNCNRQGVVKIIDQRLSNVPLGEAMELFFVAMLCVQEHSVERPTMREVVQMISQ-AK  992

Query  361  QP  356
            QP
Sbjct  993  QP  994



>ref|XP_009415217.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 isoform X2 [Musa acuminata subsp. malaccensis]
Length=995

 Score =   186 bits (471),  Expect = 7e-50, Method: Composition-based stats.
 Identities = 85/117 (73%), Positives = 102/117 (87%), Gaps = 1/117 (1%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DGVDIVQWV  542
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G++PVG+FG +G+D+VQW 
Sbjct  869  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRRPVGDFGEEGLDLVQWT  928

Query  541  RKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTE  371
            R  T+  KEGVV+ILD  LS VP+ EA  +F+VA+LCV+E +VERP MREVVQML +
Sbjct  929  RMSTNWSKEGVVRILDPWLSNVPLEEATQVFFVAMLCVQEHSVERPTMREVVQMLEQ  985



>ref|XP_010449207.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Camelina sativa]
Length=998

 Score =   186 bits (471),  Expect = 7e-50, Method: Composition-based stats.
 Identities = 84/122 (69%), Positives = 106/122 (87%), Gaps = 2/122 (2%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DGVDIVQWV  542
            ECMS+IAGSYGYIAPEYAYTL++DEKSDVYSFGVVLLEL++G+KPV  FG +G+DIVQW 
Sbjct  875  ECMSSIAGSYGYIAPEYAYTLRIDEKSDVYSFGVVLLELITGRKPVDNFGEEGIDIVQWS  934

Query  541  RKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK  362
            +  T+  ++GVVKI+D RLS VP+ EAM +F+VA+LCV+E +VERP MREVVQM+++  K
Sbjct  935  KIQTNCNRQGVVKIIDQRLSNVPLGEAMELFFVAMLCVQEHSVERPTMREVVQMISQ-AK  993

Query  361  QP  356
            QP
Sbjct  994  QP  995



>ref|XP_002264952.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Vitis vinifera]
Length=988

 Score =   186 bits (471),  Expect = 7e-50, Method: Composition-based stats.
 Identities = 88/122 (72%), Positives = 103/122 (84%), Gaps = 2/122 (2%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DGVDIVQWV  542
            ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLEL++G++PVG FG +G+DIVQW 
Sbjct  862  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGRRPVGGFGEEGLDIVQWS  921

Query  541  RKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK  362
            +  T+  KEGVVKILD RL  VP  EA+  F+VA+LCV+E +VERP MREV+QML +  K
Sbjct  922  KIQTNWSKEGVVKILDERLRNVPEDEAIQTFFVAMLCVQEHSVERPTMREVIQMLAQ-AK  980

Query  361  QP  356
            QP
Sbjct  981  QP  982



>gb|ACN59341.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
Length=963

 Score =   185 bits (470),  Expect = 7e-50, Method: Composition-based stats.
 Identities = 83/122 (68%), Positives = 106/122 (87%), Gaps = 2/122 (2%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DGVDIVQWV  542
            ECMS+IAGSYGYIAPEYAYTL++DEKSDVYSFGVVLLEL++G+KPV  FG +G+DIVQW 
Sbjct  840  ECMSSIAGSYGYIAPEYAYTLRIDEKSDVYSFGVVLLELITGRKPVDNFGEEGIDIVQWS  899

Query  541  RKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK  362
            +  T+  ++GVVKI+D RLS +P+ EAM +F+VA+LCV+E +VERP MREVVQM+++  K
Sbjct  900  KIQTNCNRQGVVKIIDQRLSNIPLAEAMELFFVAMLCVQEHSVERPTMREVVQMISQ-AK  958

Query  361  QP  356
            QP
Sbjct  959  QP  960



>ref|XP_010529317.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Tarenaya hassleriana]
Length=999

 Score =   185 bits (470),  Expect = 9e-50, Method: Composition-based stats.
 Identities = 86/122 (70%), Positives = 105/122 (86%), Gaps = 2/122 (2%)
 Frame = -2

Query  718  ECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELVSGKKPVGEFG-DGVDIVQWV  542
            ECMSAIAGSYGYIAPEYAYTL+VDEKSDVYSFGVVLLEL++G+KPV  FG +G+DIVQW 
Sbjct  873  ECMSAIAGSYGYIAPEYAYTLRVDEKSDVYSFGVVLLELITGRKPVDNFGEEGLDIVQWA  932

Query  541  RKMTDGKKEGVVKILDSRLSTVPIHEAMHMFYVALLCVEEQAVERPKMREVVQMLTELPK  362
            +  T+  K+GVVKILD RLS  P+ EA  +F+VA+LCV+EQ+VERP MREVVQM+++  +
Sbjct  933  KIQTNCDKQGVVKILDQRLSNPPLEEATQVFFVAMLCVQEQSVERPTMREVVQMISQ-AR  991

Query  361  QP  356
            QP
Sbjct  992  QP  993



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1260188911410