BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF010B06

Length=357
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAS65426.1|  Kunitz-type trypsin inhibitor                         66.6    1e-11   Ipomoea batatas [batate]
ref|XP_009768914.1|  PREDICTED: defensin-like protein isoform X1      60.8    1e-09   Nicotiana sylvestris
ref|XP_009768915.1|  PREDICTED: defensin-like protein isoform X2      60.8    1e-09   Nicotiana sylvestris
ref|XP_009413079.1|  PREDICTED: defensin Ec-AMP-D2 {ECO:0000303|P...  60.5    2e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009614667.1|  PREDICTED: defensin-like protein                 60.1    2e-09   Nicotiana tomentosiformis
gb|AGC82207.1|  defensin                                              59.3    4e-09   Persea americana var. drymifolia [Mexican avocado]
ref|XP_009593292.1|  PREDICTED: defensin-like protein P322            59.3    5e-09   Nicotiana tomentosiformis
ref|XP_003628979.1|  Defensin                                         59.3    5e-09   Medicago truncatula
gb|KJB30731.1|  hypothetical protein B456_005G157500                  58.9    6e-09   Gossypium raimondii
ref|XP_002274353.1|  PREDICTED: defensin Ec-AMP-D2                    58.9    6e-09   Vitis vinifera
ref|XP_011070574.1|  PREDICTED: defensin J1-2-like                    58.5    8e-09   Sesamum indicum [beniseed]
ref|NP_001048853.1|  Os03g0130300                                     58.2    1e-08   
ref|XP_003562142.1|  PREDICTED: defensin Ec-AMP-D1-like               57.8    2e-08   Brachypodium distachyon [annual false brome]
ref|XP_006359486.1|  PREDICTED: defensin-like protein-like            57.0    3e-08   Solanum tuberosum [potatoes]
ref|XP_002459603.1|  hypothetical protein SORBIDRAFT_02g007390        56.6    4e-08   Sorghum bicolor [broomcorn]
ref|XP_004297786.1|  PREDICTED: defensin Ec-AMP-D2-like               56.6    4e-08   Fragaria vesca subsp. vesca
gb|ACN93800.1|  defensin precursor                                    56.6    5e-08   Vigna unguiculata
ref|XP_009769844.1|  PREDICTED: defensin-like protein P322            56.2    6e-08   Nicotiana sylvestris
gb|AAL15885.1|AF417297_1  putative gamma-thionin                      55.8    8e-08   Castanea sativa
ref|XP_009800136.1|  PREDICTED: defensin J1-2-like                    55.8    8e-08   Nicotiana sylvestris
ref|XP_007223891.1|  hypothetical protein PRUPE_ppa014246mg           55.8    9e-08   Prunus persica
ref|XP_010671291.1|  PREDICTED: defensin Ec-AMP-D2-like               55.8    1e-07   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009604566.1|  PREDICTED: defensin J1-2-like                    55.5    1e-07   Nicotiana tomentosiformis
ref|XP_009599356.1|  PREDICTED: defensin-like protein                 55.5    1e-07   Nicotiana tomentosiformis
ref|XP_007156391.1|  hypothetical protein PHAVU_003G282500g           55.5    1e-07   Phaseolus vulgaris [French bean]
ref|XP_009614488.1|  PREDICTED: defensin J1-2-like                    55.5    1e-07   Nicotiana tomentosiformis
ref|XP_009610211.1|  PREDICTED: defensin J1-2                         55.5    1e-07   Nicotiana tomentosiformis
gb|KDP32807.1|  hypothetical protein JCGZ_12099                       55.5    1e-07   Jatropha curcas
ref|XP_004151187.1|  PREDICTED: defensin J1-2-like                    55.1    1e-07   Cucumis sativus [cucumbers]
ref|XP_002459605.1|  hypothetical protein SORBIDRAFT_02g007410        55.1    1e-07   Sorghum bicolor [broomcorn]
emb|CDP10468.1|  unnamed protein product                              55.1    1e-07   Coffea canephora [robusta coffee]
dbj|BAK07043.1|  predicted protein                                    55.8    1e-07   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KGN49760.1|  hypothetical protein Csa_5G114570                     55.1    1e-07   Cucumis sativus [cucumbers]
gb|EMS65297.1|  Defensin SD2                                          55.1    2e-07   Triticum urartu
gb|AFM82500.1|  defensin                                              55.1    2e-07   Nicotiana tabacum [American tobacco]
sp|Q40901.1|DEF_PETIN  RecName: Full=Defensin-like protein; AltNa...  55.1    2e-07   Petunia integrifolia [violet-flowered petunia]
ref|XP_003628977.1|  Defensin                                         55.1    2e-07   Medicago truncatula
ref|XP_010250779.1|  PREDICTED: defensin Ec-AMP-D2-like               55.1    2e-07   Nelumbo nucifera [Indian lotus]
ref|XP_008466730.1|  PREDICTED: defensin J1-2-like                    55.1    2e-07   
gb|AIA67012.1|  defensin                                              55.1    2e-07   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006367122.1|  PREDICTED: defensin J1-2-like                    54.7    2e-07   
gb|KJB11873.1|  hypothetical protein B456_002G043900                  54.7    2e-07   Gossypium raimondii
ref|XP_008437687.1|  PREDICTED: defensin J1-2-like                    54.7    2e-07   
gb|EYU30124.1|  hypothetical protein MIMGU_mgv1a017438mg              54.7    2e-07   Erythranthe guttata [common monkey flower]
ref|XP_006649329.1|  PREDICTED: defensin J1-2-like                    54.7    2e-07   
ref|XP_004242748.1|  PREDICTED: defensin-like protein                 54.7    3e-07   
sp|Q43413.1|DEF1_CAPAN  RecName: Full=Defensin J1-1; Flags: Precu...  54.3    3e-07   Capsicum annuum
ref|XP_009784025.1|  PREDICTED: defensin J1-2                         54.3    3e-07   Nicotiana sylvestris
ref|XP_003629332.1|  Defensin                                         54.3    3e-07   
ref|XP_002468581.1|  hypothetical protein SORBIDRAFT_01g048380        54.3    3e-07   Sorghum bicolor [broomcorn]
dbj|BAK07823.1|  predicted protein                                    54.7    3e-07   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009593293.1|  PREDICTED: defensin-like protein P322            53.9    4e-07   Nicotiana tomentosiformis
ref|XP_004509603.1|  PREDICTED: defensin-like protein-like            53.9    4e-07   Cicer arietinum [garbanzo]
sp|O65740.1|DEF2_CAPAN  RecName: Full=Defensin J1-2; Flags: Precu...  53.9    4e-07   Capsicum annuum
ref|XP_004297787.1|  PREDICTED: defensin Ec-AMP-D2-like               53.9    4e-07   Fragaria vesca subsp. vesca
gb|AAL85480.1|  defensin protein 1                                    53.9    4e-07   Prunus persica
gb|AIT42153.1|  defensin-like protein                                 53.9    4e-07   Solanum tuberosum [potatoes]
ref|XP_009802655.1|  PREDICTED: defensin-like protein                 53.9    5e-07   Nicotiana sylvestris
gb|ACJ26760.1|  protease inhibitor-related protein                    53.9    5e-07   Solanum tuberosum [potatoes]
gb|AIT42150.1|  defensin-like protein                                 53.5    5e-07   Solanum tuberosum [potatoes]
ref|XP_008389118.1|  PREDICTED: defensin-like protein 1               53.9    5e-07   
gb|AFW90621.1|  protease inhibitor-related protein                    53.9    5e-07   Solanum tuberosum [potatoes]
ref|XP_003630421.1|  Defensin                                         53.5    5e-07   Medicago truncatula
gb|KHN23780.1|  Defensin SD2                                          53.5    6e-07   Glycine soja [wild soybean]
gb|EMS65298.1|  Defensin-like protein 1                               53.5    7e-07   Triticum urartu
ref|NP_001234987.1|  protease inhibitor precursor                     53.1    7e-07   
ref|XP_010910081.1|  PREDICTED: defensin Ec-AMP-D2-like               53.1    7e-07   Elaeis guineensis
ref|XP_006367978.1|  PREDICTED: defensin-like protein P322-like       53.1    8e-07   
ref|XP_004509606.1|  PREDICTED: defensin J1-2-like                    53.1    8e-07   
gb|AIT42148.1|  defensin-like protein                                 53.1    9e-07   Solanum tuberosum [potatoes]
gb|ADB02899.1|  gamma-thionin PPT precursor defensin 1-like protein   53.1    9e-07   Jatropha curcas
ref|XP_006367121.1|  PREDICTED: defensin J1-2-like                    52.8    1e-06   Solanum tuberosum [potatoes]
gb|AIT42147.1|  defensin-like protein                                 52.8    1e-06   Solanum tuberosum [potatoes]
gb|AHA50470.1|  defensin-like protein 1                               52.8    1e-06   Citrullus lanatus [wild melon]
gb|AIT42152.1|  defensin-like protein                                 52.8    1e-06   Solanum tuberosum [potatoes]
ref|XP_010228361.1|  PREDICTED: defensin Tk-AMP-D1.1-like             52.8    1e-06   Brachypodium distachyon [annual false brome]
ref|XP_004242750.1|  PREDICTED: defensin-like protein P322            52.8    1e-06   
gb|AAL35366.1|AF442388_1  defensin protein precursor                  52.8    1e-06   Capsicum annuum
gb|KHN06998.1|  Defensin-like protein                                 52.8    1e-06   Glycine soja [wild soybean]
gb|AIA67010.1|  defensin                                              52.8    1e-06   Triticum aestivum [Canadian hard winter wheat]
gb|ABS72000.1|  putative defensin protein 1                           52.0    2e-06   Olea europaea
gb|EMT03365.1|  Defensin-like protein 1                               52.4    2e-06   
ref|XP_002459604.1|  hypothetical protein SORBIDRAFT_02g007400        52.4    2e-06   Sorghum bicolor [broomcorn]
gb|ACM50880.1|  defensin                                              51.6    2e-06   Capsicum frutescens [bird pepper]
ref|NP_001052199.1|  Os04g0189400                                     52.8    2e-06   
ref|XP_009351645.1|  PREDICTED: defensin Ec-AMP-D2-like               52.0    2e-06   Pyrus x bretschneideri [bai li]
ref|XP_003630422.1|  Defensin                                         52.0    2e-06   Medicago truncatula
gb|KJB12908.1|  hypothetical protein B456_002G043800                  52.4    2e-06   Gossypium raimondii
gb|AFK44299.1|  unknown                                               52.0    2e-06   Lotus japonicus
dbj|BAA95697.1|  thionin like protein                                 52.0    2e-06   Nicotiana tabacum [American tobacco]
ref|XP_009354384.1|  PREDICTED: defensin Ec-AMP-D2-like               52.0    2e-06   Pyrus x bretschneideri [bai li]
gb|AHA50471.1|  defensin-like protein 4                               51.6    2e-06   Citrullus lanatus [wild melon]
ref|XP_008340514.1|  PREDICTED: defensin Ec-AMP-D2-like               51.6    2e-06   Malus domestica [apple tree]
gb|EEC76838.1|  hypothetical protein OsI_14993                        51.2    3e-06   Oryza sativa Indica Group [Indian rice]
gb|AAS13434.1|  defensin                                              50.8    3e-06   Nicotiana attenuata
ref|XP_009769843.1|  PREDICTED: defensin-like protein P322            51.2    4e-06   Nicotiana sylvestris
gb|AAP80654.1|AF479035_1  proteinase inhibitor Rgpi9                  51.2    4e-06   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004985852.1|  PREDICTED: defensin SD2-like                     51.2    4e-06   Setaria italica
ref|XP_011084089.1|  PREDICTED: defensin Ec-AMP-D2-like               51.2    4e-06   Sesamum indicum [beniseed]
ref|XP_002886566.1|  protease inhibitor II                            51.2    4e-06   Arabidopsis lyrata subsp. lyrata
gb|EMT03364.1|  Defensin SD2                                          51.2    4e-06   
ref|XP_009351646.1|  PREDICTED: defensin Ec-AMP-D2-like               51.2    4e-06   Pyrus x bretschneideri [bai li]
gb|ADK87340.1|  defensin                                              51.2    4e-06   Pyrus pyrifolia [sha li]
ref|XP_010088525.1|  Defensin-like protein 2                          50.8    5e-06   Morus notabilis
ref|XP_007045353.1|  Defensin-like protein isoform 1                  50.8    5e-06   
ref|XP_007045354.1|  Defensin-like protein isoform 2                  50.8    5e-06   
gb|AFJ04517.1|  low-molecular-weight cysteine-rich 69                 50.8    6e-06   Vernicia fordii [tung oil tree]
ref|XP_010043884.1|  PREDICTED: defensin Ec-AMP-D2-like               50.8    6e-06   Eucalyptus grandis [rose gum]
gb|AHA50473.1|  defensin-like protein 6                               50.8    6e-06   Citrullus lanatus [wild melon]
ref|XP_006395808.1|  hypothetical protein EUTSA_v10005229mg           50.4    6e-06   Eutrema salsugineum [saltwater cress]
gb|EMT11359.1|  Defensin-like protein P322                            50.4    6e-06   
sp|P20346.1|DF322_SOLTU  RecName: Full=Defensin-like protein P322...  50.4    7e-06   Solanum tuberosum [potatoes]
gb|KHG09995.1|  Defensin-like protein 1                               50.4    7e-06   Gossypium arboreum [tree cotton]
ref|XP_009397593.1|  PREDICTED: defensin Ec-AMP-D1 {ECO:0000303|P...  50.4    7e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008349481.1|  PREDICTED: defensin Ec-AMP-D2-like               50.4    7e-06   
gb|ACV84379.1|  defensin precursor                                    50.4    7e-06   Triticum aestivum [Canadian hard winter wheat]
gb|AIT42149.1|  defensin-like protein                                 50.1    9e-06   Solanum tuberosum [potatoes]
ref|XP_006585876.1|  PREDICTED: defensin-like protein-like            50.8    1e-05   Glycine max [soybeans]
gb|EAY86781.1|  hypothetical protein OsI_08161                        53.1    1e-05   Oryza sativa Indica Group [Indian rice]
ref|XP_003628978.1|  Defensin                                         49.7    1e-05   Medicago truncatula
gb|ABA81896.1|  putative defensin                                     49.7    1e-05   Aquilegia formosa
ref|XP_007204040.1|  hypothetical protein PRUPE_ppa021088mg           49.7    1e-05   
sp|P81571.1|DEFD2_SPIOL  RecName: Full=Defensin D2; AltName: Full...  48.9    2e-05   Spinacia oleracea
ref|XP_006395809.1|  hypothetical protein EUTSA_v10005228mg           49.7    2e-05   Eutrema salsugineum [saltwater cress]
gb|ACM90159.1|  low-molecular-weight cysteine-rich 69                 49.3    2e-05   Jatropha curcas
ref|XP_008793609.1|  PREDICTED: defensin Ec-AMP-D1-like isoform X1    49.3    2e-05   Phoenix dactylifera
gb|AHA50472.1|  defensin-like protein 5                               49.3    2e-05   Citrullus lanatus [wild melon]
ref|XP_008793610.1|  PREDICTED: defensin Ec-AMP-D1-like isoform X2    49.3    2e-05   Phoenix dactylifera
ref|XP_010908980.1|  PREDICTED: defensin Ec-AMP-D1-like               49.3    2e-05   Elaeis guineensis
gb|AAL14240.1|  proteinase inhibitor                                  48.9    2e-05   Musa acuminata AAA Group [Cavendish banana]
ref|XP_010064921.1|  PREDICTED: uncharacterized protein LOC104452094  50.1    2e-05   
ref|XP_004242747.1|  PREDICTED: defensin-like protein                 49.3    2e-05   
gb|ABA86586.1|  putative defensin 1                                   49.3    2e-05   Aquilegia formosa
sp|P82659.1|DFSD2_HELAN  RecName: Full=Defensin SD2; AltName: Ful...  49.3    2e-05   Helianthus annuus
ref|XP_010270777.1|  PREDICTED: defensin-like protein                 49.3    2e-05   Nelumbo nucifera [Indian lotus]
ref|XP_010319372.1|  PREDICTED: defensin Ec-AMP-D2-like               48.9    2e-05   Solanum lycopersicum
emb|CAA65045.1|  defensin                                             48.9    2e-05   Capsicum annuum
ref|XP_002513261.1|  8.4 kDa sulfur-rich protein precursor, putative  48.9    2e-05   
ref|XP_008340513.1|  PREDICTED: defensin-like protein 1               49.3    2e-05   
ref|XP_008389119.1|  PREDICTED: defensin Ec-AMP-D2-like               48.9    3e-05   Malus domestica [apple tree]
gb|AGT51228.1|  defensin                                              48.9    3e-05   Brassica napus [oilseed rape]
gb|ACB32234.1|  gamma-thionin/defensin                                48.9    3e-05   Solanum chacoense
ref|XP_004509602.1|  PREDICTED: defensin-1-like                       48.9    3e-05   Cicer arietinum [garbanzo]
emb|CDY48618.1|  BnaC09g20670D                                        48.9    3e-05   Brassica napus [oilseed rape]
ref|XP_009792224.1|  PREDICTED: defensin-like protein P322            48.9    3e-05   Nicotiana sylvestris
ref|XP_009351647.1|  PREDICTED: defensin-like protein 1               48.9    3e-05   
gb|ABW99097.1|  defensin                                              48.5    3e-05   Capsicum chinense [bonnet pepper]
dbj|BAB64929.1|  defensin-like protein                                48.9    3e-05   Pyrus pyrifolia [sha li]
ref|XP_008389117.1|  PREDICTED: defensin Tk-AMP-D1.1-like             48.9    3e-05   
gb|AAA91049.1|  protease inhibitor II                                 48.5    3e-05   Brassica rapa
ref|XP_006359485.1|  PREDICTED: defensin-like protein-like            48.5    3e-05   Solanum tuberosum [potatoes]
gb|ACS96442.1|  defensin                                              48.5    3e-05   Jatropha curcas
ref|XP_010513972.1|  PREDICTED: defensin-like protein 2               48.5    3e-05   Camelina sativa [gold-of-pleasure]
ref|NP_176302.2|  defensin-like protein                               48.5    4e-05   Arabidopsis thaliana [mouse-ear cress]
gb|ADQ43197.1|  unknown                                               48.5    4e-05   Schrenkiella parvula
gb|ABO36641.1|  defensin protein                                      48.1    4e-05   Solanum pimpinellifolium [currant tomato]
gb|ABK28445.1|  unknown                                               48.1    4e-05   Arabidopsis thaliana [mouse-ear cress]
gb|ABO36637.1|  defensin protein                                      48.1    4e-05   Solanum lycopersicum
gb|KCW70075.1|  hypothetical protein EUGRSUZ_F03380                   48.1    4e-05   Eucalyptus grandis [rose gum]
ref|XP_006359487.1|  PREDICTED: defensin-like protein-like            48.1    5e-05   Solanum tuberosum [potatoes]
ref|NP_001234872.1|  gamma-thionin precursor                          48.1    5e-05   
gb|KJB75524.1|  hypothetical protein B456_012G045400                  48.1    5e-05   Gossypium raimondii
ref|XP_010260874.1|  PREDICTED: defensin D2-like                      48.1    5e-05   
gb|KJB11914.1|  hypothetical protein B456_002G029700                  48.1    5e-05   Gossypium raimondii
gb|KJB11913.1|  hypothetical protein B456_002G029700                  48.1    5e-05   Gossypium raimondii
gb|ABA86589.1|  putative defensin 1                                   47.8    5e-05   Aquilegia pyrenaica
gb|AFD01290.1|  defensin 3                                            48.1    6e-05   Pinus sylvestris [Scotch pine]
gb|AAG51654.1|AC018908_20  unknown protein; 87272-87105               47.4    6e-05   Arabidopsis thaliana [mouse-ear cress]
gb|ABK23404.1|  unknown                                               48.1    6e-05   Picea sitchensis
gb|AFE88173.1|  g-thionin                                             47.8    6e-05   Panax ginseng [Asiatic ginseng]
ref|XP_009357110.1|  PREDICTED: defensin Ec-AMP-D1-like               47.8    6e-05   
ref|XP_011462172.1|  PREDICTED: uncharacterized protein LOC105350880  48.5    6e-05   Fragaria vesca subsp. vesca
gb|AAM62652.1|  protease inhibitor II                                 47.8    6e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007159918.1|  hypothetical protein PHAVU_002G278600g           47.8    6e-05   Phaseolus vulgaris [French bean]
ref|XP_007226630.1|  hypothetical protein PRUPE_ppa022845mg           47.8    6e-05   Prunus persica
emb|CDP10467.1|  unnamed protein product                              48.1    7e-05   Coffea canephora [robusta coffee]
ref|XP_006292136.1|  hypothetical protein CARUB_v10018340mg           47.8    7e-05   Capsella rubella
gb|EMT03363.1|  hypothetical protein F775_43918                       47.8    7e-05   
ref|XP_010502227.1|  PREDICTED: defensin-like protein 2               47.8    7e-05   Camelina sativa [gold-of-pleasure]
ref|XP_008340512.1|  PREDICTED: defensin-like protein 1               47.8    8e-05   Malus domestica [apple tree]
ref|NP_178319.1|  defensin-like protein 2                             47.4    8e-05   Arabidopsis thaliana [mouse-ear cress]
gb|AIA66989.1|  defensin                                              47.8    8e-05   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009101273.1|  PREDICTED: defensin-like protein 2               47.4    8e-05   Brassica rapa
ref|XP_010229304.1|  PREDICTED: defensin Tk-AMP-D1.1-like             47.4    8e-05   
ref|XP_006292781.1|  hypothetical protein CARUB_v10019030mg           47.4    9e-05   Capsella rubella
gb|ACV84384.1|  defensin precursor                                    47.4    9e-05   Triticum turgidum subsp. durum
ref|NP_178320.1|  defensin-like protein 4                             47.4    9e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011099999.1|  PREDICTED: defensin Ec-AMP-D2-like               47.4    9e-05   Sesamum indicum [beniseed]
dbj|BAD25113.1|  hypothetical protein                                 47.4    9e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007159919.1|  hypothetical protein PHAVU_002G278700g           47.0    1e-04   Phaseolus vulgaris [French bean]
ref|NP_001148158.1|  LOC100281766 precursor                           47.4    1e-04   
ref|XP_008240819.1|  PREDICTED: defensin Ec-AMP-D1-like               47.4    1e-04   Prunus mume [ume]
ref|XP_006420697.1|  hypothetical protein CICLE_v10006362mg           47.0    1e-04   Citrus clementina [clementine]
emb|CAH58740.1|  defensin                                             47.0    1e-04   Plantago major [cart-track plant]
ref|NP_178321.1|  defensin-like protein 1                             47.0    1e-04   Arabidopsis thaliana [mouse-ear cress]
gb|ADK91098.1|  PCP17C2                                               46.6    1e-04   Arabidopsis halleri
ref|XP_007203287.1|  hypothetical protein PRUPE_ppa025677mg           47.0    1e-04   Prunus persica
ref|XP_011086331.1|  PREDICTED: putative defensin-like protein 3      47.4    2e-04   Sesamum indicum [beniseed]
gb|ABA86587.1|  putative defensin 1                                   46.6    2e-04   Aquilegia chrysantha
ref|XP_007137817.1|  hypothetical protein PHAVU_009G158100g           47.4    2e-04   Phaseolus vulgaris [French bean]
gb|AGT51229.1|  defensin                                              46.6    2e-04   Brassica napus [oilseed rape]
ref|XP_002875115.1|  hypothetical protein ARALYDRAFT_484136           46.6    2e-04   
ref|XP_007202934.1|  hypothetical protein PRUPE_ppa016748mg           46.6    2e-04   Prunus persica
ref|XP_007202863.1|  hypothetical protein PRUPE_ppa015550mg           46.6    2e-04   Prunus persica
ref|NP_001047493.1|  Os02g0629800                                     46.6    2e-04   
gb|ACV84381.1|  defensin precursor                                    46.6    2e-04   Triticum turgidum subsp. durum
ref|XP_009114206.1|  PREDICTED: defensin-like protein 1               46.2    2e-04   Brassica rapa
ref|XP_003526900.1|  PREDICTED: defensin-like protein 6-like          46.2    2e-04   Glycine max [soybeans]
gb|ABK25062.1|  unknown                                               46.2    2e-04   Picea sitchensis
ref|XP_009129168.1|  PREDICTED: defensin-like protein 1               46.2    2e-04   Brassica rapa
emb|CAA62761.1|  putative gamma-thionin protein                       46.2    2e-04   Picea abies
ref|XP_002325734.2|  defensin-like family protein                     46.2    2e-04   
ref|XP_006301968.1|  hypothetical protein CARUB_v10022448mg           45.8    2e-04   Capsella rubella
ref|XP_010038383.1|  PREDICTED: uncharacterized protein LOC104426904  48.1    2e-04   
ref|XP_008360020.1|  PREDICTED: defensin-like protein 2               46.2    2e-04   
gb|AIA67013.1|  defensin                                              45.8    3e-04   Triticum aestivum [Canadian hard winter wheat]
gb|ABK93231.1|  unknown                                               45.8    3e-04   Populus trichocarpa [western balsam poplar]
dbj|BAD25507.1|  hypothetical protein                                 46.2    3e-04   Oryza sativa Japonica Group [Japonica rice]
gb|AAR84643.1|  defensin                                              45.8    3e-04   Picea glauca
ref|XP_010513973.1|  PREDICTED: defensin-like protein 1               45.8    3e-04   Camelina sativa [gold-of-pleasure]
ref|XP_004509604.1|  PREDICTED: defensin-like protein P322-like       45.8    3e-04   Cicer arietinum [garbanzo]
ref|XP_006392063.1|  hypothetical protein EUTSA_v10023787mg           45.4    4e-04   Eutrema salsugineum [saltwater cress]
ref|XP_004503912.1|  PREDICTED: defensin-like protein-like            45.4    4e-04   
ref|XP_002325735.1|  hypothetical protein POPTR_0019s00770g           45.4    4e-04   Populus trichocarpa [western balsam poplar]
ref|XP_003599384.1|  Defensin                                         45.4    4e-04   
ref|XP_007156390.1|  hypothetical protein PHAVU_003G282400g           45.4    4e-04   Phaseolus vulgaris [French bean]
gb|ADQ43196.1|  unknown                                               45.1    5e-04   Schrenkiella parvula
gb|AFK47422.1|  unknown                                               45.1    5e-04   Lotus japonicus
gb|AIA67014.1|  defensin                                              45.1    5e-04   Triticum aestivum [Canadian hard winter wheat]
ref|XP_007226225.1|  hypothetical protein PRUPE_ppa016594mg           45.1    5e-04   
gb|KEH35661.1|  Defensin                                              45.1    6e-04   Medicago truncatula
gb|EPS67569.1|  gamma-thionin                                         44.7    6e-04   Genlisea aurea
ref|NP_001172824.1|  Os02g0172500                                     45.1    6e-04   
ref|XP_006647552.1|  PREDICTED: defensin-like protein P322-like       45.1    6e-04   Oryza brachyantha
gb|EMT00351.1|  Defensin-like protein                                 44.7    7e-04   
gb|AIC35288.1|  defensin 4                                            44.7    7e-04   Pinus sylvestris [Scotch pine]
ref|XP_010495961.1|  PREDICTED: defensin-like protein 1               44.7    7e-04   Camelina sativa [gold-of-pleasure]
dbj|BAK06284.1|  predicted protein                                    45.1    7e-04   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AGT51227.1|  defensin                                              44.7    8e-04   Brassica napus [oilseed rape]
gb|KFK26328.1|  hypothetical protein AALP_AA8G233400                  44.7    8e-04   Arabis alpina [alpine rockcress]
ref|XP_007033927.1|  Scorpion toxin-like knottin superfamily protein  45.4    8e-04   
gb|EMS49334.1|  Defensin-like protein                                 44.7    8e-04   Triticum urartu
gb|EMT18782.1|  Defensin-like protein                                 47.4    9e-04   
ref|XP_003575412.1|  PREDICTED: defensin Tm-AMP-D1.2-like             44.3    0.001   Brachypodium distachyon [annual false brome]
ref|XP_004986852.1|  PREDICTED: defensin SD2-like                     44.7    0.001   
ref|XP_011001251.1|  PREDICTED: defensin-like protein 1               44.3    0.001   Populus euphratica



>gb|AAS65426.1| Kunitz-type trypsin inhibitor [Ipomoea batatas]
Length=80

 Score = 66.6 bits (161),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 38/66 (58%), Gaps = 0/66 (0%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
            VMLFM  E G   I+VAEA  CE  S KFKG C R   C ++C TE    G C+G R RC
Sbjct  15   VMLFMATELGTNRIMVAEARMCESASSKFKGPCSRDSNCATVCHTEGFTGGDCKGFRRRC  74

Query  115  MCIKNC  98
             C K C
Sbjct  75   FCTKPC  80



>ref|XP_009768914.1| PREDICTED: defensin-like protein isoform X1 [Nicotiana sylvestris]
Length=80

 Score = 60.8 bits (146),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 44/66 (67%), Gaps = 2/66 (3%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
            +++F   E G   I+VAEA  CE  S +FKG+C  ++ C S+C TE   DG+C+G+R RC
Sbjct  17   MVVFATEEMG--PIMVAEARNCESQSQRFKGVCVSNRNCASVCNTEGFPDGKCKGLRRRC  74

Query  115  MCIKNC  98
             C++NC
Sbjct  75   FCLRNC  80



>ref|XP_009768915.1| PREDICTED: defensin-like protein isoform X2 [Nicotiana sylvestris]
Length=79

 Score = 60.8 bits (146),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 43/66 (65%), Gaps = 2/66 (3%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
            +M+    E G   I+VAEA  CE  S +FKG+C  ++ C S+C TE   DG+C+G+R RC
Sbjct  16   LMVVFATEMG--PIMVAEARNCESQSQRFKGVCVSNRNCASVCNTEGFPDGKCKGLRRRC  73

Query  115  MCIKNC  98
             C++NC
Sbjct  74   FCLRNC  79



>ref|XP_009413079.1| PREDICTED: defensin Ec-AMP-D2 {ECO:0000303|PubMed:18625284}-like 
[Musa acuminata subsp. malaccensis]
Length=81

 Score = 60.5 bits (145),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 39/66 (59%), Gaps = 0/66 (0%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
            V+LF+        +   EA KCE  S KFKGLC R+  C ++C+TE    G CRG+R RC
Sbjct  12   VLLFLLLITSDMGMTSVEARKCESASHKFKGLCFRASNCANVCKTEGFHGGHCRGLRRRC  71

Query  115  MCIKNC  98
             C K+C
Sbjct  72   FCTKHC  77



>ref|XP_009614667.1| PREDICTED: defensin-like protein [Nicotiana tomentosiformis]
Length=75

 Score = 60.1 bits (144),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 43/66 (65%), Gaps = 2/66 (3%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
            +M+    E G   ++VAEA  CE  S +FKG+C  ++ C S+C TE   DG+C+G+R RC
Sbjct  12   LMVVFATEMG--PVMVAEARNCESQSERFKGVCVSNRNCASVCNTEGFPDGKCKGLRRRC  69

Query  115  MCIKNC  98
             C++NC
Sbjct  70   FCLRNC  75



>gb|AGC82207.1| defensin [Persea americana var. drymifolia]
Length=78

 Score = 59.3 bits (142),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = -3

Query  247  AEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
             EA  CE PS  F GLC RS  C S+C  E   DG+C+G+R RCMC+K C
Sbjct  29   VEAATCETPSKHFNGLCIRSSNCASVCHGEHFTDGRCQGVRRRCMCLKPC  78



>ref|XP_009593292.1| PREDICTED: defensin-like protein P322 [Nicotiana tomentosiformis]
Length=78

 Score = 59.3 bits (142),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 39/66 (59%), Gaps = 2/66 (3%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
             +LFM  E G  TI  AEA  CE  S +F+GLC R K C ++C TE    G CRG+R RC
Sbjct  15   AILFMATEMGPMTI--AEARHCESQSQRFRGLCVREKNCAAVCETEGFSGGDCRGLRRRC  72

Query  115  MCIKNC  98
             C + C
Sbjct  73   FCTRPC  78



>ref|XP_003628979.1| Defensin [Medicago truncatula]
 ref|XP_003636616.1| Defensin [Medicago truncatula]
 gb|AET03455.1| Defensin MtDef4.4 [Medicago truncatula]
Length=78

 Score = 59.3 bits (142),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 36/65 (55%), Gaps = 2/65 (3%)
 Frame = -3

Query  292  MLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCM  113
            +L +  E G   I+VAEA  CE PS  FKGLC     C S+C+TE    G C G R RC 
Sbjct  16   LLLVATEMG--PIMVAEARTCETPSNNFKGLCVSDTNCASVCQTEGFPGGHCEGFRQRCF  73

Query  112  CIKNC  98
            C K C
Sbjct  74   CTKPC  78



>gb|KJB30731.1| hypothetical protein B456_005G157500 [Gossypium raimondii]
Length=77

 Score = 58.9 bits (141),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 40/66 (61%), Gaps = 3/66 (5%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
            ++L +  E G  T+   E  KCE PS KFKG+C     C ++C+TE   DG+C G R RC
Sbjct  14   LLLVLLAEMGPTTV---EGRKCESPSHKFKGMCMNRDNCATVCQTEGYEDGKCEGFRRRC  70

Query  115  MCIKNC  98
            +CIK C
Sbjct  71   ICIKPC  76



>ref|XP_002274353.1| PREDICTED: defensin Ec-AMP-D2 [Vitis vinifera]
 emb|CBI27507.3| unnamed protein product [Vitis vinifera]
Length=77

 Score = 58.9 bits (141),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 39/66 (59%), Gaps = 3/66 (5%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
            ++LFM  E G    +VAEA  CE  S +FKG C R   C ++C+TE    G CRG R RC
Sbjct  15   ILLFMATEMG---PMVAEARTCESQSHRFKGTCVRQSNCAAVCQTEGFHGGNCRGFRRRC  71

Query  115  MCIKNC  98
             C K+C
Sbjct  72   FCTKHC  77



>ref|XP_011070574.1| PREDICTED: defensin J1-2-like [Sesamum indicum]
Length=74

 Score = 58.5 bits (140),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 39/66 (59%), Gaps = 4/66 (6%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
            VML +    G    +VAEA KCE  S +FKG+C R   C ++C+TE    G CRG R RC
Sbjct  13   VMLMLVFSTG----MVAEARKCESQSHRFKGICLRKANCAAVCQTEGFHSGHCRGFRGRC  68

Query  115  MCIKNC  98
             C K+C
Sbjct  69   FCTKHC  74



>ref|NP_001048853.1| Os03g0130300 [Oryza sativa Japonica Group]
 gb|AAB17095.1| proteinase inhibitor [Oryza sativa Indica Group]
 gb|AAC00503.1| proteinase inhibitor [Oryza sativa Indica Group]
 dbj|BAA85411.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ABF93798.1| Gamma-thionin PPT precursor, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF10767.1| Os03g0130300 [Oryza sativa Japonica Group]
 dbj|BAH00191.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74445.1| hypothetical protein OsI_09847 [Oryza sativa Indica Group]
 gb|EEE58270.1| hypothetical protein OsJ_09283 [Oryza sativa Japonica Group]
Length=81

 Score = 58.2 bits (139),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = -3

Query  256  ILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            ++VAEA  CE  S +FKG C R   C S+C TE   DG C G+R RCMC K C
Sbjct  28   VMVAEARTCESQSHRFKGPCARKANCASVCNTEGFPDGYCHGVRRRCMCTKPC  80



>ref|XP_003562142.1| PREDICTED: defensin Ec-AMP-D1-like [Brachypodium distachyon]
Length=81

 Score = 57.8 bits (138),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = -3

Query  256  ILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            ++VAEA  CE  S +F+G C R+  CR++C+TE   DG+CRG R RC C+  C
Sbjct  27   MMVAEARTCESRSHRFRGPCMRASNCRNVCKTEGFQDGKCRGFRRRCFCVSQC  79



>ref|XP_006359486.1| PREDICTED: defensin-like protein-like [Solanum tuberosum]
Length=78

 Score = 57.0 bits (136),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 37/66 (56%), Gaps = 2/66 (3%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
             ML +  E G  T+  AEA  CE  S +FKG C R   C ++C+TE    G CRG R RC
Sbjct  15   AMLLLSSEMG--TMSSAEARTCESQSNRFKGTCVRDSNCATVCQTEGFIGGNCRGFRRRC  72

Query  115  MCIKNC  98
             C +NC
Sbjct  73   FCTRNC  78



>ref|XP_002459603.1| hypothetical protein SORBIDRAFT_02g007390 [Sorghum bicolor]
 gb|EER96124.1| hypothetical protein SORBIDRAFT_02g007390 [Sorghum bicolor]
Length=79

 Score = 56.6 bits (135),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = -3

Query  256  ILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            + +A A KCE PS +F+G C R   C ++CRTE    G+C+G+R RC C K+C
Sbjct  27   VTMALARKCESPSHRFQGPCSRDANCATVCRTEGFTGGKCKGLRHRCFCTKDC  79



>ref|XP_004297786.1| PREDICTED: defensin Ec-AMP-D2-like [Fragaria vesca subsp. vesca]
Length=79

 Score = 56.6 bits (135),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = -3

Query  253  LVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            +VAEA  CE  S KFKG C R   C S+C+TE    G CRG+R RC C K+C
Sbjct  28   MVAEARTCETLSHKFKGTCLRESNCASVCQTEGFTGGDCRGLRRRCFCTKHC  79



>gb|ACN93800.1| defensin precursor [Vigna unguiculata]
Length=78

 Score = 56.6 bits (135),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 38/66 (58%), Gaps = 2/66 (3%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
            ++L +  E G    +VAEA  CE  S +FKG C     C S+CRTE    G CRG R RC
Sbjct  15   LLLLVATEMG--PTMVAEARTCESQSHRFKGPCVSDTNCASVCRTERFSGGHCRGFRRRC  72

Query  115  MCIKNC  98
            +C K+C
Sbjct  73   LCTKHC  78



>ref|XP_009769844.1| PREDICTED: defensin-like protein P322 [Nicotiana sylvestris]
Length=78

 Score = 56.2 bits (134),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 38/66 (58%), Gaps = 2/66 (3%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
             ML M  E G  TI  AEA +CE  S +F+G C R K C ++C TE    G CRG+R RC
Sbjct  15   AMLVMATEMGPMTI--AEARRCESKSQRFRGPCVREKNCAAVCETEGFSGGDCRGLRRRC  72

Query  115  MCIKNC  98
             C + C
Sbjct  73   FCTRPC  78



>gb|AAL15885.1|AF417297_1 putative gamma-thionin [Castanea sativa]
Length=78

 Score = 55.8 bits (133),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = -3

Query  253  LVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            +VAEA  CE  S +FKG C R   C S+C+TE    GQCRG R RC C K+C
Sbjct  27   MVAEARTCESQSHRFKGPCVRKSNCASVCQTEGFHGGQCRGFRRRCFCTKHC  78



>ref|XP_009800136.1| PREDICTED: defensin J1-2-like [Nicotiana sylvestris]
Length=77

 Score = 55.8 bits (133),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 38/66 (58%), Gaps = 3/66 (5%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
            +ML    E G    +VA+A  CE  S +FKG C R   C ++C+TE    G CRGIR RC
Sbjct  15   LMLVFATEMG---TMVADARTCESQSHRFKGPCVRKSNCAAVCQTEGFHAGHCRGIRRRC  71

Query  115  MCIKNC  98
             C K+C
Sbjct  72   FCTKHC  77



>ref|XP_007223891.1| hypothetical protein PRUPE_ppa014246mg [Prunus persica]
 ref|XP_008220985.1| PREDICTED: defensin Ec-AMP-D2-like [Prunus mume]
 gb|EMJ25090.1| hypothetical protein PRUPE_ppa014246mg [Prunus persica]
Length=78

 Score = 55.8 bits (133),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 35/66 (53%), Gaps = 0/66 (0%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
            V   +    G    +VAEA  CE  S +FKG C  +  C S+C+TE    G CRG R RC
Sbjct  13   VFFLLLAAAGMMGPMVAEARTCESQSNRFKGTCVSTSNCASVCQTEGFPGGHCRGFRRRC  72

Query  115  MCIKNC  98
             C K+C
Sbjct  73   FCTKHC  78



>ref|XP_010671291.1| PREDICTED: defensin Ec-AMP-D2-like [Beta vulgaris subsp. vulgaris]
Length=78

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = -3

Query  250  VAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            VAEA  CE  S +FKG+CGR   C ++C+ E    G CRG R RC C K+C
Sbjct  28   VAEARTCETRSHRFKGICGRKANCAAVCQAEGFQGGHCRGFRRRCFCTKHC  78



>ref|XP_009604566.1| PREDICTED: defensin J1-2-like [Nicotiana tomentosiformis]
Length=77

 Score = 55.5 bits (132),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 37/66 (56%), Gaps = 3/66 (5%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
            +ML    E G    +VAEA  CE  S +FKG C R   C ++C+TE    G CRG R RC
Sbjct  15   LMLIFATEMG---TMVAEARTCESQSHRFKGPCVRKSNCAAVCQTEGFHGGHCRGFRRRC  71

Query  115  MCIKNC  98
             C K+C
Sbjct  72   FCTKHC  77



>ref|XP_009599356.1| PREDICTED: defensin-like protein [Nicotiana tomentosiformis]
Length=75

 Score = 55.5 bits (132),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 36/66 (55%), Gaps = 2/66 (3%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
             ML +  E G+ +   AEA  CE  S +F G C R   C SIC+TE    G CRG R RC
Sbjct  12   AMLLLATEMGQMS--SAEARTCESQSHRFHGTCVRDSNCASICQTEGFIGGNCRGFRRRC  69

Query  115  MCIKNC  98
             C +NC
Sbjct  70   FCTRNC  75



>ref|XP_007156391.1| hypothetical protein PHAVU_003G282500g [Phaseolus vulgaris]
 gb|ADR30067.1| defensin D2 [Phaseolus vulgaris]
 gb|ESW28385.1| hypothetical protein PHAVU_003G282500g [Phaseolus vulgaris]
Length=78

 Score = 55.5 bits (132),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 37/66 (56%), Gaps = 2/66 (3%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
            ++L +  E G    +VAEA  CE  S +FKG C     C S+CRTE    G CRG R RC
Sbjct  15   LLLLLATEMGPR--MVAEARTCESQSHRFKGPCVSDTNCASVCRTERFSGGHCRGFRRRC  72

Query  115  MCIKNC  98
             C K+C
Sbjct  73   FCTKHC  78



>ref|XP_009614488.1| PREDICTED: defensin J1-2-like [Nicotiana tomentosiformis]
Length=77

 Score = 55.5 bits (132),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 37/66 (56%), Gaps = 3/66 (5%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
            +ML    E G    +VAEA  CE  S +FKG C R   C ++C+TE    G CRG R RC
Sbjct  15   LMLVFATEMG---TMVAEARTCESQSHRFKGPCVRKSNCAAVCQTEGFHGGHCRGFRRRC  71

Query  115  MCIKNC  98
             C K+C
Sbjct  72   FCTKHC  77



>ref|XP_009610211.1| PREDICTED: defensin J1-2 [Nicotiana tomentosiformis]
Length=77

 Score = 55.5 bits (132),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 36/66 (55%), Gaps = 3/66 (5%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
            +ML    E G    +VAEA  CE  S +FKGLC     C S+C TE    G CRG R RC
Sbjct  15   LMLVFATEMGP---MVAEARTCESQSHRFKGLCFSKSNCASVCHTEGFYGGHCRGFRRRC  71

Query  115  MCIKNC  98
             C ++C
Sbjct  72   FCTRHC  77



>gb|KDP32807.1| hypothetical protein JCGZ_12099 [Jatropha curcas]
Length=77

 Score = 55.5 bits (132),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = -3

Query  253  LVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            +VAEA  CE  S +FKG+C R+  C +IC+TE    G CRG+R RC C K+C
Sbjct  26   MVAEARTCESLSHRFKGICVRNSNCAAICQTEGFQGGHCRGLRRRCFCTKHC  77



>ref|XP_004151187.1| PREDICTED: defensin J1-2-like [Cucumis sativus]
 ref|XP_004171498.1| PREDICTED: defensin J1-2-like [Cucumis sativus]
Length=74

 Score = 55.1 bits (131),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = -3

Query  253  LVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            +VAEA  CE PS  FKGLC     C +IC+TE    G CRG R RC C K+C
Sbjct  22   MVAEARVCESPSHNFKGLCFSDTNCGNICKTEGFSGGVCRGFRRRCFCTKHC  73



>ref|XP_002459605.1| hypothetical protein SORBIDRAFT_02g007410 [Sorghum bicolor]
 gb|EER96126.1| hypothetical protein SORBIDRAFT_02g007410 [Sorghum bicolor]
Length=78

 Score = 55.1 bits (131),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = -3

Query  256  ILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            I +A A KCE PS KF+G C R   C S+C TE    G+C+G+R RC C ++C
Sbjct  26   ITMALARKCESPSLKFRGPCSRDANCASVCLTEGFTGGECKGLRHRCFCTRDC  78



>emb|CDP10468.1| unnamed protein product [Coffea canephora]
Length=78

 Score = 55.1 bits (131),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 38/66 (58%), Gaps = 2/66 (3%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
            +MLFM  E     + VAEA  CE  S +FKG C R   C ++C+TE    GQC G+R RC
Sbjct  15   LMLFMSTEMD--PVRVAEARTCESLSHRFKGTCVRGSNCAAVCQTEGFPGGQCSGLRRRC  72

Query  115  MCIKNC  98
             C K C
Sbjct  73   FCSKPC  78



>dbj|BAK07043.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=104

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -3

Query  256  ILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC*F  92
            + VAEA +CE PS  F+G C R   C ++CRTE    G CRG+R RC C  +C +
Sbjct  50   VAVAEARRCESPSHMFRGPCVRGHNCANVCRTEGFPGGNCRGLRRRCFCTTHCRY  104



>gb|KGN49760.1| hypothetical protein Csa_5G114570 [Cucumis sativus]
Length=74

 Score = 55.1 bits (131),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 31/52 (60%), Gaps = 0/52 (0%)
 Frame = -3

Query  253  LVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            +V EA  CE PS +FKGLC     C  +C+TE    G CRG R RC C K+C
Sbjct  22   MVTEARTCESPSHRFKGLCFSKNNCGHVCKTEGFHGGHCRGFRRRCFCTKHC  73



>gb|EMS65297.1| Defensin SD2 [Triticum urartu]
 gb|AIA67005.1| defensin [Triticum aestivum]
Length=78

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = -3

Query  256  ILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            + VAEA +CE  S +F GLC R   C ++CRTE   DG+CRG R RC C  +C
Sbjct  25   VAVAEARRCESLSHRFAGLCLRGHNCANVCRTEGFPDGKCRGARRRCFCTTHC  77



>gb|AFM82500.1| defensin [Nicotiana tabacum]
Length=77

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 36/66 (55%), Gaps = 3/66 (5%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
            +ML    E G    +VAEA  CE  S +FKGLC     C S+C TE    G CRG R RC
Sbjct  15   MMLVFATEMGP---MVAEARTCESQSHRFKGLCFSKSNCASVCHTEGFYGGHCRGFRRRC  71

Query  115  MCIKNC  98
             C ++C
Sbjct  72   FCTRHC  77



>sp|Q40901.1|DEF_PETIN RecName: Full=Defensin-like protein; AltName: Full=Gamma-thionin 
homolog PPT; Flags: Precursor [Petunia integrifolia]
 gb|AAA64740.1| gamma-thionin homolog [Petunia integrifolia subsp. inflata]
Length=78

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 35/66 (53%), Gaps = 2/66 (3%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
             MLF+  E G  T   AEA  CE  S +F G C R   C S+C+TE    G CR  R RC
Sbjct  15   AMLFLSTEMGPMT--SAEARTCESQSHRFHGTCVRESNCASVCQTEGFIGGNCRAFRRRC  72

Query  115  MCIKNC  98
             C +NC
Sbjct  73   FCTRNC  78



>ref|XP_003628977.1| Defensin [Medicago truncatula]
 ref|XP_003636614.1| Defensin [Medicago truncatula]
 gb|AET03453.1| Defensin MtDef4.2 [Medicago truncatula]
 gb|AFK35827.1| unknown [Medicago truncatula]
Length=76

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 34/66 (52%), Gaps = 0/66 (0%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
            + +F+         +VAEA  CE  S KFKG C     C S+C+TE    G CRG R RC
Sbjct  11   IFVFLLLLVATGPSMVAEARTCESQSHKFKGPCASDHNCASVCQTERFSGGHCRGFRRRC  70

Query  115  MCIKNC  98
             C  +C
Sbjct  71   FCTTHC  76



>ref|XP_010250779.1| PREDICTED: defensin Ec-AMP-D2-like [Nelumbo nucifera]
Length=78

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 38/66 (58%), Gaps = 1/66 (2%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
            V+LF+    G     VAEA  CE  S +FKG+C R   C ++C+TE    G CRG R RC
Sbjct  13   VVLFLLTATGMGP-KVAEARTCESQSHRFKGICVRKSNCAAVCQTEGFHGGHCRGFRRRC  71

Query  115  MCIKNC  98
             C K+C
Sbjct  72   FCTKHC  77



>ref|XP_008466730.1| PREDICTED: defensin J1-2-like [Cucumis melo]
Length=74

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 31/52 (60%), Gaps = 0/52 (0%)
 Frame = -3

Query  253  LVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            +V EA  CE PS +FKGLC     C  +C+TE    G CRG R RC C K+C
Sbjct  22   MVTEARTCESPSHRFKGLCFSKNNCGHVCKTEGFHGGHCRGFRRRCFCTKHC  73



>gb|AIA67012.1| defensin [Triticum aestivum]
Length=82

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = -3

Query  256  ILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            ++VAEA  CE  S +F+G C R   C ++CRTE   DG+CRG R RC C  +C
Sbjct  28   VMVAEARTCESRSHRFRGPCVRRSNCANVCRTEGFSDGKCRGFRRRCFCTTHC  80



>ref|XP_006367122.1| PREDICTED: defensin J1-2-like [Solanum tuberosum]
Length=71

 Score = 54.7 bits (130),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 30/51 (59%), Gaps = 0/51 (0%)
 Frame = -3

Query  250  VAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
              EA  CE PS +FKGLC  +  CR +C TE    G C G+R RC+C K C
Sbjct  21   TVEAKTCESPSRRFKGLCFNTWKCRFVCSTERFSSGHCNGLRHRCICTKQC  71



>gb|KJB11873.1| hypothetical protein B456_002G043900 [Gossypium raimondii]
 gb|KJB11875.1| hypothetical protein B456_002G044100 [Gossypium raimondii]
Length=75

 Score = 54.7 bits (130),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 35/53 (66%), Gaps = 1/53 (2%)
 Frame = -3

Query  253  LVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXD-GQCRGIRFRCMCIKNC  98
            + AEA  CEV SGKFKG+C  S  C S+C++E   D G C+G R RC+C K C
Sbjct  23   MSAEAKTCEVESGKFKGMCMSSTNCASVCKSEPGFDGGHCQGFRRRCLCTKPC  75



>ref|XP_008437687.1| PREDICTED: defensin J1-2-like [Cucumis melo]
Length=77

 Score = 54.7 bits (130),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = -3

Query  253  LVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            +VAEA  CE PS  FKGLC     C +IC+TE    G CRG R RC C K+C
Sbjct  25   MVAEARVCESPSHNFKGLCFSDTNCGNICKTEGFSGGLCRGFRRRCFCTKHC  76



>gb|EYU30124.1| hypothetical protein MIMGU_mgv1a017438mg [Erythranthe guttata]
Length=75

 Score = 54.7 bits (130),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 35/55 (64%), Gaps = 1/55 (2%)
 Frame = -3

Query  259  TILVAEAGK-CEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            T +VAEA + CE  S +FKG+C R   C ++C+TE    G CRG R RC C K+C
Sbjct  21   TGMVAEATRTCEAKSHRFKGICARKANCAAVCQTEGFHGGHCRGFRRRCFCTKHC  75



>ref|XP_006649329.1| PREDICTED: defensin J1-2-like [Oryza brachyantha]
Length=80

 Score = 54.7 bits (130),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 32/53 (60%), Gaps = 0/53 (0%)
 Frame = -3

Query  256  ILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            ++VAEA  CE  S +F G+C RS  C S+C TE    G CRG R RC C K C
Sbjct  28   VMVAEARTCESQSHRFNGVCVRSSNCASVCSTEGFTGGHCRGFRRRCFCTKPC  80



>ref|XP_004242748.1| PREDICTED: defensin-like protein [Solanum lycopersicum]
 gb|ABO36638.1| defensin protein [Solanum lycopersicum]
 gb|ABO36642.1| defensin protein [Solanum pimpinellifolium]
Length=79

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 36/66 (55%), Gaps = 2/66 (3%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
            ++L +  E G   I  AEA  CE  S  FKG C R   C ++C+TE    G CRG R RC
Sbjct  16   MLLLLSTEMG--PISSAEARTCESQSNSFKGTCVRDSNCATVCQTEGFIGGNCRGFRRRC  73

Query  115  MCIKNC  98
             C +NC
Sbjct  74   FCTRNC  79



>sp|Q43413.1|DEF1_CAPAN RecName: Full=Defensin J1-1; Flags: Precursor [Capsicum annuum]
 gb|AAM09502.1|AF488780_1 gamma thionin [Capsicum annuum]
 emb|CAA64653.1| gamma-thionin [Capsicum annuum]
 gb|ACB30365.1| defensin [Capsicum annuum]
Length=75

 Score = 54.3 bits (129),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 36/64 (56%), Gaps = 0/64 (0%)
 Frame = -3

Query  289  LFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMC  110
            +F+       T ++AEA  CE  SG FKGLC  S+ C ++CR E   DG C G R +C C
Sbjct  11   IFLMMLLVFATDMMAEAKICEALSGNFKGLCLSSRDCGNVCRREGFTDGSCIGFRLQCFC  70

Query  109  IKNC  98
             K C
Sbjct  71   TKPC  74



>ref|XP_009784025.1| PREDICTED: defensin J1-2 [Nicotiana sylvestris]
Length=77

 Score = 54.3 bits (129),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 36/66 (55%), Gaps = 3/66 (5%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
            +ML    E G    +VAEA  CE  S +FKGLC     C S+C TE    G CRG R RC
Sbjct  15   LMLVFANEMGP---MVAEARTCESQSHRFKGLCISKSNCASVCHTEGFNGGHCRGFRRRC  71

Query  115  MCIKNC  98
             C ++C
Sbjct  72   FCTRHC  77



>ref|XP_003629332.1| Defensin [Medicago truncatula]
 gb|AET03808.1| Defensin MtDef4.5 [Medicago truncatula]
Length=81

 Score = 54.3 bits (129),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 39/66 (59%), Gaps = 2/66 (3%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
            +++ +  E G  +I+V EA KC   S  FKGLC   + C ++C TE   DG+CRG R RC
Sbjct  15   LLVLVATEMG--SIMVVEARKCLSQSHSFKGLCLSDQNCATVCLTEGFTDGRCRGFRQRC  72

Query  115  MCIKNC  98
             C K C
Sbjct  73   FCSKPC  78



>ref|XP_002468581.1| hypothetical protein SORBIDRAFT_01g048380 [Sorghum bicolor]
 gb|EER95579.1| hypothetical protein SORBIDRAFT_01g048380 [Sorghum bicolor]
Length=80

 Score = 54.3 bits (129),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = -3

Query  259  TILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
             + VAEA  C+  S +F+G C R + C ++CRTE   DG+CRG R RC C+ +C
Sbjct  25   AVAVAEARTCQSQSHRFRGPCVRRENCANVCRTEGFPDGKCRGFRRRCFCLTHC  78



>dbj|BAK07823.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=105

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = -3

Query  256  ILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            ++VAEA  CE  S +F+G C R   C ++C+TE   DG+CRG R RC C  +C
Sbjct  51   VMVAEARTCESRSHRFRGPCVRRSNCANVCKTEGFPDGKCRGFRRRCFCTTHC  103



>ref|XP_009593293.1| PREDICTED: defensin-like protein P322 [Nicotiana tomentosiformis]
Length=78

 Score = 53.9 bits (128),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 35/66 (53%), Gaps = 2/66 (3%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
             +L M  E G  TI  AEA  CE  S +FKG C R   C ++C TE    G CRG R RC
Sbjct  15   ALLVMATEMGPMTI--AEARTCESQSHRFKGPCSRDSNCATVCLTEGFSGGDCRGFRRRC  72

Query  115  MCIKNC  98
             C + C
Sbjct  73   FCTRPC  78



>ref|XP_004509603.1| PREDICTED: defensin-like protein-like [Cicer arietinum]
Length=78

 Score = 53.9 bits (128),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 35/66 (53%), Gaps = 0/66 (0%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
            V+  +        I+VAEA  CE  S  FKGLC R   C  +C+TE    GQC+G R RC
Sbjct  13   VIFLLLVATEMRPIMVAEARTCESLSYSFKGLCVRDHNCAVVCQTEGFTGGQCKGFRRRC  72

Query  115  MCIKNC  98
             C K C
Sbjct  73   FCNKPC  78



>sp|O65740.1|DEF2_CAPAN RecName: Full=Defensin J1-2; Flags: Precursor [Capsicum annuum]
 emb|CAA65046.1| unnamed protein product [Capsicum annuum]
Length=74

 Score = 53.9 bits (128),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = -3

Query  259  TILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            T +VAEA  CE  S +FKGLC     C S+C TE    G CRG R RC C ++C
Sbjct  21   TGMVAEARTCESQSHRFKGLCFSKSNCGSVCHTEGFNGGHCRGFRRRCFCTRHC  74



>ref|XP_004297787.1| PREDICTED: defensin Ec-AMP-D2-like [Fragaria vesca subsp. vesca]
Length=79

 Score = 53.9 bits (128),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = -3

Query  253  LVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            +VAEA  CE  S KFKG C     C S+C+TE    G CRG+R RC C K+C
Sbjct  28   MVAEARTCESLSHKFKGTCLSETNCASVCKTEGFSGGDCRGLRRRCFCTKHC  79



>gb|AAL85480.1| defensin protein 1 [Prunus persica]
Length=79

 Score = 53.9 bits (128),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = -3

Query  253  LVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            +VAEA  CE  S +FKG C  +  C S+C+TE    G CRG R RC C K+C
Sbjct  28   MVAEARTCESQSNRFKGTCVSTSNCASVCQTEGFPGGHCRGFRRRCFCTKHC  79



>gb|AIT42153.1| defensin-like protein [Solanum tuberosum]
Length=78

 Score = 53.9 bits (128),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 34/66 (52%), Gaps = 2/66 (3%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
             ML M  E G   + + EA  CE  S +FKG C   K C S+C TE    G CRG R RC
Sbjct  15   AMLVMSTEMG--PMRIVEARHCESLSHRFKGPCASDKNCASVCETERFSGGNCRGFRRRC  72

Query  115  MCIKNC  98
             C K C
Sbjct  73   FCTKPC  78



>ref|XP_009802655.1| PREDICTED: defensin-like protein [Nicotiana sylvestris]
Length=75

 Score = 53.9 bits (128),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 36/66 (55%), Gaps = 2/66 (3%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
             ML +  E G   +  AEA  CE  S +F G C R   C S+C+TE    G CRG+R RC
Sbjct  12   AMLLLATEMG--PMSSAEARTCESQSHRFHGTCVRGSNCASVCQTEGFIGGNCRGLRRRC  69

Query  115  MCIKNC  98
             C +NC
Sbjct  70   FCTRNC  75



>gb|ACJ26760.1| protease inhibitor-related protein [Solanum tuberosum]
Length=78

 Score = 53.9 bits (128),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 34/66 (52%), Gaps = 2/66 (3%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
             ML M  E G   + +AEA  CE  S +FKG C R   C S+C TE    G C G R RC
Sbjct  15   AMLVMATEMG--PMRIAEARHCESLSHRFKGPCTRDSNCASVCETERFSGGNCHGFRRRC  72

Query  115  MCIKNC  98
             C K C
Sbjct  73   FCTKPC  78



>gb|AIT42150.1| defensin-like protein [Solanum tuberosum]
Length=63

 Score = 53.5 bits (127),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 34/65 (52%), Gaps = 2/65 (3%)
 Frame = -3

Query  292  MLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCM  113
            ML M  E G   + + EA  CE  S +FKG C   K C S+C TE    G CRG R RC 
Sbjct  1    MLVMSTEMG--PMRIVEARHCESLSHRFKGPCASDKNCASVCETERFSGGNCRGFRRRCF  58

Query  112  CIKNC  98
            C K C
Sbjct  59   CTKPC  63



>ref|XP_008389118.1| PREDICTED: defensin-like protein 1 [Malus domestica]
Length=87

 Score = 53.9 bits (128),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 33/62 (53%), Gaps = 0/62 (0%)
 Frame = -3

Query  283  MXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIK  104
            M  E    +  V E   CE  SGKFKGLC  S  C+  C+ E    G+CRG R RCMC K
Sbjct  26   MGVEARSKSSKVVEERTCEAASGKFKGLCFSSNNCKHTCKREQFTGGKCRGFRRRCMCNK  85

Query  103  NC  98
             C
Sbjct  86   KC  87



>gb|AFW90621.1| protease inhibitor-related protein [Solanum tuberosum]
 gb|AIT42151.1| defensin-like protein [Solanum tuberosum]
Length=78

 Score = 53.9 bits (128),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 34/66 (52%), Gaps = 2/66 (3%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
             ML M  E G   + +AEA  CE  S +FKG C R   C S+C TE    G C G R RC
Sbjct  15   AMLVMATEMG--PMRIAEARNCESLSHRFKGPCTRDSNCASVCETERFSGGNCHGFRRRC  72

Query  115  MCIKNC  98
             C K C
Sbjct  73   FCTKPC  78



>ref|XP_003630421.1| Defensin [Medicago truncatula]
 gb|AET04897.1| Defensin MtDef4.6 [Medicago truncatula]
Length=74

 Score = 53.5 bits (127),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 30/54 (56%), Gaps = 0/54 (0%)
 Frame = -3

Query  259  TILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
             +  AE  +CE  S KFKG C R   C S+CR E    G CRG R RC C +NC
Sbjct  21   AVKTAEGRRCESKSHKFKGPCSRDSNCASVCRGEGFTGGDCRGFRRRCFCTRNC  74



>gb|KHN23780.1| Defensin SD2 [Glycine soja]
Length=79

 Score = 53.5 bits (127),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 31/52 (60%), Gaps = 0/52 (0%)
 Frame = -3

Query  253  LVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            +VAEA  CE  S +FKG C     C S+CRTE    G CRG R RC C K+C
Sbjct  28   MVAEARTCESQSHRFKGPCLSDTNCGSVCRTERFTGGHCRGFRRRCFCTKHC  79



>gb|EMS65298.1| Defensin-like protein 1 [Triticum urartu]
Length=82

 Score = 53.5 bits (127),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = -3

Query  256  ILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            ++VAEA  CE  S +F+G C R   C ++C+TE   DG+CRG R RC C  +C
Sbjct  28   VMVAEARTCESRSHRFRGPCVRRSNCANVCKTEGFPDGKCRGFRRRCFCTTHC  80



>ref|NP_001234987.1| protease inhibitor precursor [Glycine max]
 gb|AAC97524.1| protease inhibitor [Glycine max]
Length=79

 Score = 53.1 bits (126),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 35/66 (53%), Gaps = 0/66 (0%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
            ++L +         +VAEA  CE  S +FKG C     C S+CRTE    G CRG R RC
Sbjct  14   LLLLLVATEMMGPTMVAEARTCESQSHRFKGPCLSDTNCGSVCRTERFTGGHCRGFRRRC  73

Query  115  MCIKNC  98
             C K+C
Sbjct  74   FCTKHC  79



>ref|XP_010910081.1| PREDICTED: defensin Ec-AMP-D2-like [Elaeis guineensis]
Length=77

 Score = 53.1 bits (126),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 37/66 (56%), Gaps = 0/66 (0%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
            ++L +         ++ EA  CE  S KFKG C R+  C ++C+TE    G+CRG R RC
Sbjct  12   LLLVLIVVASEMATMMVEARTCESQSHKFKGPCLRASNCANVCKTEGFHGGKCRGFRRRC  71

Query  115  MCIKNC  98
             C K+C
Sbjct  72   FCTKHC  77



>ref|XP_006367978.1| PREDICTED: defensin-like protein P322-like [Solanum tuberosum]
Length=79

 Score = 53.1 bits (126),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 36/66 (55%), Gaps = 2/66 (3%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
             ML M  + G   I+  EA  CE PS +FKG C   + C S+C TE    G CRG+R RC
Sbjct  15   AMLVMDTKMGPMRII--EARICESPSQRFKGPCLTDRNCASVCETEGFTGGDCRGLRRRC  72

Query  115  MCIKNC  98
             C K C
Sbjct  73   FCTKEC  78



>ref|XP_004509606.1| PREDICTED: defensin J1-2-like [Cicer arietinum]
Length=74

 Score = 53.1 bits (126),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = -3

Query  259  TILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            T +VAEA  CE  S KFKG C   + C S+C+TE    G CRG R RC C  +C
Sbjct  21   TEMVAEARTCESKSQKFKGACVSDRNCASVCQTERFPGGHCRGFRRRCFCTTHC  74



>gb|AIT42148.1| defensin-like protein [Solanum tuberosum]
Length=78

 Score = 53.1 bits (126),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 34/66 (52%), Gaps = 2/66 (3%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
             M+ M  E G   + +AEA  CE  S +FKG C R   C S+C TE    G C G R RC
Sbjct  15   AMIVMATEMG--PMRIAEARNCESLSHRFKGPCTRDSNCASVCETERFSGGNCHGFRRRC  72

Query  115  MCIKNC  98
             C K C
Sbjct  73   FCTKPC  78



>gb|ADB02899.1| gamma-thionin PPT precursor defensin 1-like protein [Jatropha 
curcas]
Length=92

 Score = 53.1 bits (126),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = -3

Query  253  LVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            +VAEA  CE  S +FKG+C R+  C +IC+TE    G CRG+R RC C   C
Sbjct  26   MVAEARTCESLSHRFKGICVRNSNCAAICQTEGFQGGHCRGLRRRCFCTMYC  77



>ref|XP_006367121.1| PREDICTED: defensin J1-2-like [Solanum tuberosum]
Length=74

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = -3

Query  259  TILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            T ++AEA  CE  S +FKGLC     C S+C TE    G CRG R RC C ++C
Sbjct  21   TGMIAEARTCESQSRRFKGLCFSKSNCGSVCHTEGFSGGHCRGFRRRCFCTRHC  74



>gb|AIT42147.1| defensin-like protein [Solanum tuberosum]
Length=78

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 34/66 (52%), Gaps = 2/66 (3%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
             M+ M  E G   I+  EA  CE  S +FKG C   K C S+C TE    G CRG R RC
Sbjct  15   AMIVMATEMGPMRIV--EARHCESLSHRFKGPCASDKNCASVCETERFSGGNCRGFRRRC  72

Query  115  MCIKNC  98
             C K C
Sbjct  73   FCTKPC  78



>gb|AHA50470.1| defensin-like protein 1 [Citrullus lanatus]
Length=74

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 30/52 (58%), Gaps = 0/52 (0%)
 Frame = -3

Query  253  LVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            +V +A  CE PS  FKGLC     C  +C+TE    G CRG R RC C K+C
Sbjct  22   MVTDARTCESPSRHFKGLCFSKNNCGHVCKTEGFHGGHCRGFRRRCFCTKHC  73



>gb|AIT42152.1| defensin-like protein [Solanum tuberosum]
Length=78

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 34/66 (52%), Gaps = 2/66 (3%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
             ML M  E G   + + EA  CE  S +FKG C   + C S+C TE    G CRG R RC
Sbjct  15   AMLVMATEMG--PMRIVEARHCESLSHRFKGPCASDRNCASVCETERFSGGNCRGFRRRC  72

Query  115  MCIKNC  98
             C K C
Sbjct  73   FCTKPC  78



>ref|XP_010228361.1| PREDICTED: defensin Tk-AMP-D1.1-like [Brachypodium distachyon]
Length=76

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 32/56 (57%), Gaps = 0/56 (0%)
 Frame = -3

Query  265  RXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            R  + VA A +C  PS KF G+C R   C +I  TE    G+C GIR RC C KNC
Sbjct  21   RTLVQVALARECGSPSHKFHGMCTRDSNCANIWLTEGFKTGKCVGIRHRCFCYKNC  76



>ref|XP_004242750.1| PREDICTED: defensin-like protein P322 [Solanum lycopersicum]
 gb|ABO36643.1| defensin protein [Solanum pimpinellifolium]
Length=78

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 34/66 (52%), Gaps = 2/66 (3%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
             ML M  E G   I+  EA  CE  S +FKG C   K C S+C TE    G CRG R RC
Sbjct  15   AMLVMATEMGPTRIV--EARHCESLSHRFKGPCVSDKNCASVCETERFSGGNCRGFRRRC  72

Query  115  MCIKNC  98
             C K C
Sbjct  73   FCTKPC  78



>gb|AAL35366.1|AF442388_1 defensin protein precursor [Capsicum annuum]
 gb|AAR90845.1| defensin precursor [Capsicum annuum]
Length=78

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 35/66 (53%), Gaps = 2/66 (3%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
             ML M  E G   I+  EA  CE  S +FKG+C     C S+C+TE    G CRG R RC
Sbjct  15   AMLVMATEMGPMRIV--EARTCESQSHRFKGVCASETNCASVCQTEGFSGGDCRGFRRRC  72

Query  115  MCIKNC  98
             C + C
Sbjct  73   FCTRPC  78



>gb|KHN06998.1| Defensin-like protein [Glycine soja]
Length=84

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 35/66 (53%), Gaps = 2/66 (3%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
            ++L +  E G    +VAEA  CE  S +FKG C     C S+CRTE    G CRG   RC
Sbjct  15   LLLLIATEMG--PTMVAEARTCESQSHRFKGPCLSDTNCGSVCRTEGFSGGHCRGFSRRC  72

Query  115  MCIKNC  98
             C K C
Sbjct  73   FCTKEC  78



>gb|AIA67010.1| defensin [Triticum aestivum]
Length=84

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = -3

Query  256  ILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            + VAEA  CE  S +F+G C R + C ++C+TE    G+CRG R RC C  +C
Sbjct  30   VAVAEARTCEAKSHRFRGPCVRHRNCANVCKTEGFPGGKCRGFRHRCFCTTHC  82



>gb|ABS72000.1| putative defensin protein 1 [Olea europaea]
Length=56

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = -3

Query  256  ILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            ++VA+A  CE  S +FKG C     C ++C+TE   DG CRG R RC C K+C
Sbjct  4    LMVADARTCESQSHRFKGSCVSKSNCAAVCQTEGFPDGYCRGFRRRCFCSKHC  56



>gb|EMT03365.1| Defensin-like protein 1 [Aegilops tauschii]
Length=82

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = -3

Query  256  ILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            + VAEA  CE  S +F+G C R + C ++C+TE    G+CRG R RC C  +C
Sbjct  28   VAVAEARTCEAKSHRFRGPCVRHRNCANVCKTEGFPGGKCRGFRHRCFCTTHC  80



>ref|XP_002459604.1| hypothetical protein SORBIDRAFT_02g007400 [Sorghum bicolor]
 gb|EER96125.1| hypothetical protein SORBIDRAFT_02g007400 [Sorghum bicolor]
Length=78

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = -3

Query  256  ILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            + VA A KC+  S KFKG C R + C ++C TE    G+CRG+R RC C ++C
Sbjct  26   VTVALARKCQSKSFKFKGPCSRDENCATVCLTEGFTSGKCRGLRRRCFCTRDC  78



>gb|ACM50880.1| defensin [Capsicum frutescens]
Length=53

 Score = 51.6 bits (122),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 31/52 (60%), Gaps = 0/52 (0%)
 Frame = -3

Query  253  LVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            ++AEA  CE  SG FKGLC  S+ C  +CR E   DG C G R +C C K C
Sbjct  1    MMAEAKICEALSGNFKGLCLSSRNCGKVCRREGFTDGSCIGFRLQCFCTKPC  52



>ref|NP_001052199.1| Os04g0189400 [Oryza sativa Japonica Group]
 dbj|BAF14113.1| Os04g0189400 [Oryza sativa Japonica Group]
 dbj|BAG92412.1| unnamed protein product [Oryza sativa Japonica Group]
Length=111

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = -3

Query  250  VAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
             A+A +CE PS +FKG+C     C ++C TE    G+C G R RCMC K+C
Sbjct  61   AAQARECETPSNEFKGICMMVANCANVCLTEGFSGGKCSGFRRRCMCTKDC  111



>ref|XP_009351645.1| PREDICTED: defensin Ec-AMP-D2-like [Pyrus x bretschneideri]
Length=78

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 34/66 (52%), Gaps = 0/66 (0%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
            V + +    G    ++AE   CE  S KFKG C     C ++C+TE    G C GIR RC
Sbjct  13   VFVLLLVATGMMGPMLAEGRTCEAHSRKFKGHCHSKSNCATVCQTEGFQGGHCHGIRRRC  72

Query  115  MCIKNC  98
             C K+C
Sbjct  73   FCTKHC  78



>ref|XP_003630422.1| Defensin [Medicago truncatula]
 gb|AET04898.1| Defensin MtDef4.7 [Medicago truncatula]
Length=74

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 34/65 (52%), Gaps = 1/65 (2%)
 Frame = -3

Query  292  MLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCM  113
            MLF+        +  AE  +CE  S KFKG C     C S+CR E    G CRG+R RC 
Sbjct  11   MLFLVL-AADVAVKTAEGRRCESQSHKFKGPCVSDSNCGSVCRGEGFIGGDCRGVRHRCF  69

Query  112  CIKNC  98
            C +NC
Sbjct  70   CTRNC  74



>gb|KJB12908.1| hypothetical protein B456_002G043800 [Gossypium raimondii]
Length=107

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 34/53 (64%), Gaps = 1/53 (2%)
 Frame = -3

Query  253  LVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXD-GQCRGIRFRCMCIKNC  98
            + AEA  CE  SGKFKG+C  S  C S+C++E   D G C+G R +C+C K C
Sbjct  55   MSAEAKTCETQSGKFKGMCMSSTNCASVCKSEPGFDGGHCQGFRRQCVCTKPC  107



>gb|AFK44299.1| unknown [Lotus japonicus]
Length=78

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 35/66 (53%), Gaps = 2/66 (3%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
            ++L +  E G    +VAEA  CE  S +FKG C     C S+C  E    G CRG R RC
Sbjct  15   LLLLVATEMG--PTMVAEARDCESQSHRFKGPCVSDTNCASVCHGEKFSGGHCRGFRRRC  72

Query  115  MCIKNC  98
             C K+C
Sbjct  73   FCTKHC  78



>dbj|BAA95697.1| thionin like protein [Nicotiana tabacum]
Length=78

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 34/66 (52%), Gaps = 2/66 (3%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
             +L    E G  TI  AEA  CE  S +FKG C R   C ++C TE    G CRG R RC
Sbjct  15   ALLVTATEMGPMTI--AEARTCESQSHRFKGPCSRDSNCATVCLTEGFSGGDCRGFRRRC  72

Query  115  MCIKNC  98
             C + C
Sbjct  73   FCTRPC  78



>ref|XP_009354384.1| PREDICTED: defensin Ec-AMP-D2-like [Pyrus x bretschneideri]
Length=78

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 34/66 (52%), Gaps = 0/66 (0%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
            V + +    G    ++AE   CE  S KFKG C     C S+C+TE    G CRG R RC
Sbjct  13   VFVLLLVATGMMGPMLAEGRTCEAHSRKFKGTCLGKSNCASVCQTEGFHGGHCRGFRRRC  72

Query  115  MCIKNC  98
             C K+C
Sbjct  73   FCTKHC  78



>gb|AHA50471.1| defensin-like protein 4 [Citrullus lanatus]
Length=75

 Score = 51.6 bits (122),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 31/52 (60%), Gaps = 0/52 (0%)
 Frame = -3

Query  253  LVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            +V EA  CE  S  FKGLC  S  C +IC+TE    G CRG R RC C K+C
Sbjct  23   IVVEARVCESLSHSFKGLCFSSTNCGNICKTEGFTGGHCRGFRRRCFCTKHC  74



>ref|XP_008340514.1| PREDICTED: defensin Ec-AMP-D2-like [Malus domestica]
Length=78

 Score = 51.6 bits (122),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 34/66 (52%), Gaps = 0/66 (0%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
            V + +    G    L+AE   CE  S KFKG C     C S+C+TE    G CRG R RC
Sbjct  13   VFVLLLVATGMMGPLLAEGRTCESQSRKFKGTCLSKTNCASVCQTEGFPGGNCRGFRRRC  72

Query  115  MCIKNC  98
             C K+C
Sbjct  73   FCTKHC  78



>gb|EEC76838.1| hypothetical protein OsI_14993 [Oryza sativa Indica Group]
 gb|EEE60570.1| hypothetical protein OsJ_13935 [Oryza sativa Japonica Group]
Length=72

 Score = 51.2 bits (121),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = -3

Query  250  VAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
             A+A +CE PS +FKG+C     C ++C TE    G+C G R RCMC K+C
Sbjct  22   AAQARECETPSNEFKGICMMVANCANVCLTEGFSGGKCSGFRRRCMCTKDC  72



>gb|AAS13434.1| defensin [Nicotiana attenuata]
Length=52

 Score = 50.8 bits (120),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 31/52 (60%), Gaps = 0/52 (0%)
 Frame = -3

Query  253  LVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            +VAEA  CE  S +F+GLC     C S+C TE    G CRG R RC C ++C
Sbjct  1    MVAEARTCESQSRRFRGLCFSKSNCGSVCHTEGFNGGHCRGFRRRCFCTRHC  52



>ref|XP_009769843.1| PREDICTED: defensin-like protein P322 [Nicotiana sylvestris]
 gb|AFM82499.1| defensin [Nicotiana tabacum]
Length=78

 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 33/62 (53%), Gaps = 2/62 (3%)
 Frame = -3

Query  283  MXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIK  104
            M  E G  TI  AEA  CE  S +FKG C R   C ++C TE    G CRG R RC C +
Sbjct  19   MATEMGPMTI--AEARTCESQSHRFKGPCSRDSNCATVCLTEGFSGGDCRGFRRRCFCTR  76

Query  103  NC  98
             C
Sbjct  77   PC  78



>gb|AAP80654.1|AF479035_1 proteinase inhibitor Rgpi9, partial [Triticum aestivum]
Length=90

 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 32/53 (60%), Gaps = 0/53 (0%)
 Frame = -3

Query  256  ILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            + VAEA KCE  S +F GLC R   C ++CRTE    G+CRG   RC C  +C
Sbjct  37   VAVAEARKCESLSHRFAGLCLRGHNCANVCRTEGFPGGKCRGASRRCFCTTHC  89



>ref|XP_004985852.1| PREDICTED: defensin SD2-like [Setaria italica]
Length=81

 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = -3

Query  256  ILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            + VAEA  C   S KF+G C R   C ++CRTE   DG+CRG+R RC C  +C
Sbjct  27   VGVAEARTCLSQSHKFRGPCVRRANCANVCRTEGFPDGKCRGLRRRCFCTTHC  79



>ref|XP_011084089.1| PREDICTED: defensin Ec-AMP-D2-like [Sesamum indicum]
Length=74

 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 30/52 (58%), Gaps = 0/52 (0%)
 Frame = -3

Query  253  LVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            +V EA  CE  S +FKG C  S  C S+C TE    G CRG R RC C K+C
Sbjct  23   MVGEARTCESLSHRFKGACVSSTNCASVCHTEGFPGGNCRGFRRRCFCTKHC  74



>ref|XP_002886566.1| protease inhibitor II [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62825.1| protease inhibitor II [Arabidopsis lyrata subsp. lyrata]
Length=76

 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 34/66 (52%), Gaps = 1/66 (2%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
            ++LFM    G   + V EA  CE  S  F G C  S  C ++C  E   DG CRG R RC
Sbjct  12   LLLFMILATGIGPVTV-EARTCETSSNLFNGPCLSSSNCANVCHNEGFSDGDCRGFRRRC  70

Query  115  MCIKNC  98
            +C + C
Sbjct  71   LCTRPC  76



>gb|EMT03364.1| Defensin SD2 [Aegilops tauschii]
 gb|AIA67006.1| defensin [Triticum aestivum]
Length=81

 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 32/53 (60%), Gaps = 0/53 (0%)
 Frame = -3

Query  256  ILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            + VAEA KCE  S +F GLC R   C ++CRTE    G+CRG   RC C  +C
Sbjct  28   VAVAEARKCESLSHRFAGLCLRGHNCANVCRTEGFPGGKCRGASRRCFCTTHC  80



>ref|XP_009351646.1| PREDICTED: defensin Ec-AMP-D2-like [Pyrus x bretschneideri]
Length=78

 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 34/66 (52%), Gaps = 0/66 (0%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
            V + +    G    ++AE   CE  S KFKG C     C S+C+TE    G CRG R RC
Sbjct  13   VFVLLLVATGMMGPMLAEGRTCESQSRKFKGACLSRSNCASVCQTEGFPGGHCRGFRRRC  72

Query  115  MCIKNC  98
             C K+C
Sbjct  73   FCTKHC  78



>gb|ADK87340.1| defensin [Pyrus pyrifolia]
 gb|AGC00408.1| defensin 1 [Pyrus pyrifolia]
Length=78

 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 34/66 (52%), Gaps = 0/66 (0%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
            V + +    G    ++AE   CE  S KFKG C     C S+C+TE    G CRG R RC
Sbjct  13   VFVLLLVATGMMGPMLAEGRTCESQSRKFKGACLSRSNCASVCQTEGFPGGHCRGFRRRC  72

Query  115  MCIKNC  98
             C K+C
Sbjct  73   FCTKHC  78



>ref|XP_010088525.1| Defensin-like protein 2 [Morus notabilis]
 gb|EXB36442.1| Defensin-like protein 2 [Morus notabilis]
Length=76

 Score = 50.8 bits (120),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = -3

Query  250  VAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            VA+A  C+  S +FKG C R+  C +ICRTE    G C+G R RC C K+C
Sbjct  26   VADARTCQSASHRFKGTCVRNSNCANICRTEGFQGGNCQGFRRRCFCTKHC  76



>ref|XP_007045353.1| Defensin-like protein isoform 1 [Theobroma cacao]
 gb|EOY01185.1| Defensin-like protein isoform 1 [Theobroma cacao]
Length=78

 Score = 50.8 bits (120),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 30/51 (59%), Gaps = 0/51 (0%)
 Frame = -3

Query  250  VAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
             AEA  C+  S +FKG+C R   C ++C+TE    G CRG   RC C K+C
Sbjct  28   AAEARTCQSQSHRFKGMCMRKSNCAAVCQTEGFHSGHCRGFHRRCFCTKHC  78



>ref|XP_007045354.1| Defensin-like protein isoform 2 [Theobroma cacao]
 gb|EOY01186.1| Defensin-like protein isoform 2 [Theobroma cacao]
Length=77

 Score = 50.8 bits (120),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 30/51 (59%), Gaps = 0/51 (0%)
 Frame = -3

Query  250  VAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
             AEA  C+  S +FKG+C R   C ++C+TE    G CRG   RC C K+C
Sbjct  27   AAEARTCQSQSHRFKGMCMRKSNCAAVCQTEGFHSGHCRGFHRRCFCTKHC  77



>gb|AFJ04517.1| low-molecular-weight cysteine-rich 69 [Vernicia fordii]
Length=73

 Score = 50.8 bits (120),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 30/51 (59%), Gaps = 0/51 (0%)
 Frame = -3

Query  250  VAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            + EA  CE  S KFKG C     C S+C+TE    G CRG+R RC C +NC
Sbjct  23   MTEARTCESQSHKFKGTCLSETNCASVCKTEGFTGGDCRGLRRRCFCTRNC  73



>ref|XP_010043884.1| PREDICTED: defensin Ec-AMP-D2-like [Eucalyptus grandis]
 gb|KCW85903.1| hypothetical protein EUGRSUZ_B02620 [Eucalyptus grandis]
Length=77

 Score = 50.8 bits (120),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 30/52 (58%), Gaps = 0/52 (0%)
 Frame = -3

Query  253  LVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            +V EA  CE  S +FKG C     C S+C+TE    G CRG R RC C K+C
Sbjct  26   MVVEARTCESQSQRFKGACVSKTNCASVCQTEGFHGGHCRGFRRRCFCTKHC  77



>gb|AHA50473.1| defensin-like protein 6 [Citrullus lanatus]
Length=74

 Score = 50.8 bits (120),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 31/52 (60%), Gaps = 0/52 (0%)
 Frame = -3

Query  253  LVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            +V EA  CE  S  FKGLC  S  C +IC+TE    G CRG R RC C K+C
Sbjct  22   IVVEARVCESLSHSFKGLCFSSTNCGNICKTEGFTGGVCRGFRRRCFCTKHC  73



>ref|XP_006395808.1| hypothetical protein EUTSA_v10005229mg [Eutrema salsugineum]
 gb|ACQ90607.1| defensin-like protein [Eutrema halophilum]
 gb|ESQ33094.1| hypothetical protein EUTSA_v10005229mg [Eutrema salsugineum]
Length=77

 Score = 50.4 bits (119),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 35/65 (54%), Gaps = 3/65 (5%)
 Frame = -3

Query  292  MLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCM  113
            M+F+    G  T+   EA KCE  S +FKG C     C+++C  E    G CRG R RC 
Sbjct  16   MIFVATGMGPVTV---EARKCESKSHRFKGKCLSETNCKNVCHNEGFTGGNCRGFRRRCF  72

Query  112  CIKNC  98
            C +NC
Sbjct  73   CTRNC  77



>gb|EMT11359.1| Defensin-like protein P322 [Aegilops tauschii]
Length=76

 Score = 50.4 bits (119),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = -3

Query  259  TILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
             + VA A +C  PS KFKGLC     C S+C TE    G+C GIR RC+C + C
Sbjct  23   AVQVALARECTSPSHKFKGLCVSDTNCASVCLTERFPGGKCDGIRQRCLCTEKC  76



>sp|P20346.1|DF322_SOLTU RecName: Full=Defensin-like protein P322; AltName: Full=Probable 
protease inhibitor P322; Flags: Precursor [Solanum tuberosum]
 emb|CAA31577.1| unnamed protein product [Solanum tuberosum]
Length=74

 Score = 50.4 bits (119),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 28/51 (55%), Gaps = 0/51 (0%)
 Frame = -3

Query  250  VAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            +AEA  CE  S +FKG C R   C S+C TE    G C G R RC C K C
Sbjct  24   IAEARHCESLSHRFKGPCTRDSNCASVCETERFSGGNCHGFRRRCFCTKPC  74



>gb|KHG09995.1| Defensin-like protein 1 [Gossypium arboreum]
Length=75

 Score = 50.4 bits (119),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 28/51 (55%), Gaps = 0/51 (0%)
 Frame = -3

Query  250  VAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            V E   CE  S +FKG+C     C  +CR E   DG CRG R RC C +NC
Sbjct  25   VVEGRICESKSHRFKGVCLSDHNCGLVCRNEGFLDGWCRGFRHRCFCTRNC  75



>ref|XP_009397593.1| PREDICTED: defensin Ec-AMP-D1 {ECO:0000303|PubMed:18625284}-like 
[Musa acuminata subsp. malaccensis]
Length=77

 Score = 50.4 bits (119),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 32/53 (60%), Gaps = 0/53 (0%)
 Frame = -3

Query  256  ILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            ++  E   CE  S +FKG C RS  C S+C+ E   DG+C G+R RCMC K C
Sbjct  25   MVAVEGRTCESASTRFKGTCVRSSNCASVCQGEGFPDGKCEGVRRRCMCRKPC  77



>ref|XP_008349481.1| PREDICTED: defensin Ec-AMP-D2-like [Malus domestica]
 ref|XP_008344620.1| PREDICTED: defensin Ec-AMP-D2-like [Malus domestica]
 ref|XP_008363304.1| PREDICTED: defensin Ec-AMP-D2-like [Malus domestica]
 gb|AFH74424.1| defensin [Malus domestica]
Length=75

 Score = 50.4 bits (119),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 35/66 (53%), Gaps = 3/66 (5%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
            V L +    G    +VAE   CE  S +FKG C     C ++C+TE    G CRG+R RC
Sbjct  13   VFLLLLVATG---TMVAEGRTCESQSNRFKGTCVSKSNCAAVCQTEGFPGGNCRGLRRRC  69

Query  115  MCIKNC  98
             C K+C
Sbjct  70   FCTKHC  75



>gb|ACV84379.1| defensin precursor [Triticum aestivum]
 gb|EMT06280.1| Defensin-like protein 5 [Aegilops tauschii]
 gb|AIA66986.1| defensin [Triticum aestivum]
Length=81

 Score = 50.4 bits (119),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 35/68 (51%), Gaps = 2/68 (3%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRF--  122
            + L +  E G  T+ VAEA  C   S  FKG C  S  C ++CRTE   DG+C    +  
Sbjct  14   LFLLVATEMGTTTVKVAEARNCLSQSHNFKGACLSSSNCAAVCRTENFPDGECHAPHYER  73

Query  121  RCMCIKNC  98
            +C C + C
Sbjct  74   KCFCKRPC  81



>gb|AIT42149.1| defensin-like protein [Solanum tuberosum]
Length=78

 Score = 50.1 bits (118),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 33/66 (50%), Gaps = 2/66 (3%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
             ML M  E G   I+  EA  CE  S +FKG C   + C S+C TE    G CRG R  C
Sbjct  15   AMLVMATEMGPMRIV--EARHCESLSHRFKGPCASDRNCASVCETERFSGGNCRGFRRLC  72

Query  115  MCIKNC  98
             C K C
Sbjct  73   FCTKPC  78



>ref|XP_006585876.1| PREDICTED: defensin-like protein-like [Glycine max]
Length=127

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 34/64 (53%), Gaps = 2/64 (3%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
            ++L +  E G    +VAEA  CE  S +FKG C     C S+CRTE    G CRG   RC
Sbjct  15   LLLLIATEMG--PTMVAEARTCESQSHRFKGPCLSDTNCGSVCRTEGFSGGHCRGFSRRC  72

Query  115  MCIK  104
             C K
Sbjct  73   FCTK  76



>gb|EAY86781.1| hypothetical protein OsI_08161 [Oryza sativa Indica Group]
Length=487

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 25/56 (45%), Positives = 33/56 (59%), Gaps = 2/56 (4%)
 Frame = -3

Query  259  TILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCR--GIRFRCMCIKNC  98
            T  VAEA  C   S +FKG+C  S  C ++CRTE   DG+C+  G+  +C C K C
Sbjct  25   TTKVAEARHCLSQSHRFKGMCVSSNNCANVCRTESFPDGECKSHGLERKCFCKKPC  80



>ref|XP_003628978.1| Defensin [Medicago truncatula]
 ref|XP_003636615.1| Defensin [Medicago truncatula]
 gb|AET03454.1| Defensin MtDef4.3 [Medicago truncatula]
Length=77

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 32/65 (49%), Gaps = 3/65 (5%)
 Frame = -3

Query  292  MLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCM  113
            +L +  E G   +    A  CE PS  FKG C     C S+C+TE    G C+G R RC 
Sbjct  16   LLIVATEMGPSMV---AARTCETPSNSFKGACFSDTNCASVCQTEGFPGGHCKGFRQRCF  72

Query  112  CIKNC  98
            C K C
Sbjct  73   CTKPC  77



>gb|ABA81896.1| putative defensin [Aquilegia formosa]
 gb|ABA86588.1| putative defensin 1 [Aquilegia brevistyla]
Length=70

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 30/53 (57%), Gaps = 0/53 (0%)
 Frame = -3

Query  256  ILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            + VAEA  CE  S KFKG C R   C S+C++E    G CRG+  RC C   C
Sbjct  16   LKVAEARDCESQSHKFKGTCIRKSNCASVCQSEGFNGGHCRGVTRRCYCTAKC  68



>ref|XP_007204040.1| hypothetical protein PRUPE_ppa021088mg [Prunus persica]
 gb|EMJ05239.1| hypothetical protein PRUPE_ppa021088mg [Prunus persica]
Length=73

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 27/45 (60%), Gaps = 0/45 (0%)
 Frame = -3

Query  232  CEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            CE  S KFKGLC RS  C  IC+ E   +G+C G R RC C K C
Sbjct  29   CESLSTKFKGLCFRSSNCADICKKEGFLEGKCAGFRLRCTCTKKC  73



>sp|P81571.1|DEFD2_SPIOL RecName: Full=Defensin D2; AltName: Full=Antimicrobial peptide 
D2; AltName: Full=So-D2, partial [Spinacia oleracea]
Length=52

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 30/51 (59%), Gaps = 0/51 (0%)
 Frame = -3

Query  250  VAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            +  + KC+ PS  FKG+C R   C + CR E    G C+GIR RCMC K C
Sbjct  2    IFSSRKCKTPSKTFKGICTRDSNCDTSCRYEGYPAGDCKGIRRRCMCSKPC  52



>ref|XP_006395809.1| hypothetical protein EUTSA_v10005228mg [Eutrema salsugineum]
 gb|ACQ90606.1| defensin-like protein [Eutrema halophilum]
 gb|ESQ33095.1| hypothetical protein EUTSA_v10005228mg [Eutrema salsugineum]
Length=77

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 35/65 (54%), Gaps = 3/65 (5%)
 Frame = -3

Query  292  MLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCM  113
            M+F+    G  T+   EA  CE  S +FKG C     C+++C  E    G CRG+R RC 
Sbjct  16   MIFVATGMGPVTV---EARTCESKSHRFKGACLSETNCKNVCHNEGFRGGNCRGLRRRCF  72

Query  112  CIKNC  98
            C +NC
Sbjct  73   CTRNC  77



>gb|ACM90159.1| low-molecular-weight cysteine-rich 69 [Jatropha curcas]
 gb|KDP32806.1| hypothetical protein JCGZ_12098 [Jatropha curcas]
Length=77

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -3

Query  250  VAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            +AEA  CE  S KFKG C     C ++C+TE    G CRG+R RC C ++C
Sbjct  27   MAEARTCESQSHKFKGTCLSETNCANVCKTEGFTGGDCRGLRRRCFCTRHC  77



>ref|XP_008793609.1| PREDICTED: defensin Ec-AMP-D1-like isoform X1 [Phoenix dactylifera]
Length=78

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -3

Query  250  VAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            V EA  CE  S +FKG C R+  C ++C+TE    G CRG+R RC C K C
Sbjct  28   VVEARTCESQSHRFKGTCLRASNCANVCQTEGFQGGVCRGLRGRCFCTKRC  78



>gb|AHA50472.1| defensin-like protein 5 [Citrullus lanatus]
Length=74

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 30/52 (58%), Gaps = 0/52 (0%)
 Frame = -3

Query  253  LVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            +V EA  CE  S  FKGLC  S  C +IC+TE    G CRG R RC C K C
Sbjct  22   IVVEARVCESLSHSFKGLCFSSTNCGNICKTEGFTGGVCRGFRRRCFCTKPC  73



>ref|XP_008793610.1| PREDICTED: defensin Ec-AMP-D1-like isoform X2 [Phoenix dactylifera]
Length=77

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -3

Query  250  VAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            V EA  CE  S +FKG C R+  C ++C+TE    G CRG+R RC C K C
Sbjct  27   VVEARTCESQSHRFKGTCLRASNCANVCQTEGFQGGVCRGLRGRCFCTKRC  77



>ref|XP_010908980.1| PREDICTED: defensin Ec-AMP-D1-like [Elaeis guineensis]
 gb|AAN52490.1|AF322914_1 defensin EGAD1 [Elaeis guineensis]
Length=77

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -3

Query  250  VAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            VAEA  CE  S KF+G C R   C ++C+TE    G CRG+R RC C + C
Sbjct  27   VAEARTCESQSHKFQGTCLRESNCANVCQTEGFQGGVCRGVRRRCFCTRLC  77



>gb|AAL14240.1| proteinase inhibitor [Musa acuminata AAA Group]
Length=49

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = -3

Query  244  EAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            E+  CE  S +FKG C RS  C S+C+ E   DG+C G+R RCMC K C
Sbjct  1    ESRTCESASTRFKGTCVRSSNCASVCQGEGFPDGKCEGVRRRCMCRKPC  49



>ref|XP_010064921.1| PREDICTED: uncharacterized protein LOC104452094 [Eucalyptus grandis]
Length=135

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 30/57 (53%), Gaps = 0/57 (0%)
 Frame = -3

Query  268  GRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            G   +   E   CE  S KF GLC   +TC  +C+ E   DG+CRG R RC C K C
Sbjct  79   GEEVVWRIEGRMCESQSHKFHGLCMSDRTCVVVCKEEDFDDGKCRGFRHRCFCRKPC  135



>ref|XP_004242747.1| PREDICTED: defensin-like protein [Solanum lycopersicum]
 gb|ABO36635.1| defensin protein [Solanum lycopersicum]
 gb|ABO36640.1| defensin protein [Solanum pimpinellifolium]
Length=76

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 27/49 (55%), Gaps = 0/49 (0%)
 Frame = -3

Query  244  EAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            EA  CE  S  FKG C     C S+CRTE    G CRG R RC C +NC
Sbjct  28   EARTCESQSHHFKGNCLSDTNCGSVCRTEGFTGGNCRGFRRRCFCTRNC  76



>gb|ABA86586.1| putative defensin 1 [Aquilegia formosa]
Length=70

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 29/51 (57%), Gaps = 0/51 (0%)
 Frame = -3

Query  250  VAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            VAEA  CE  S KFKG C R   C S+C++E    G CRG+  RC C   C
Sbjct  18   VAEARDCESQSHKFKGTCIRKSNCASVCQSEGFNGGHCRGVTRRCYCTAKC  68



>sp|P82659.1|DFSD2_HELAN RecName: Full=Defensin SD2; AltName: Full=Flower-specific gamma-thionin; 
Flags: Precursor [Helianthus annuus]
 gb|AAF66591.1|AF141131_1 defensin [Helianthus annuus]
 gb|AAF72042.1|AF178634_1 defensin SD2 [Helianthus annuus]
Length=78

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 34/66 (52%), Gaps = 2/66 (3%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
            VM  +  E G    LV EA  CE  S KFKG C     C ++C +E    G+CRG R RC
Sbjct  15   VMCLLANEMG--GPLVVEARTCESQSHKFKGTCLSDTNCANVCHSERFSGGKCRGFRRRC  72

Query  115  MCIKNC  98
             C  +C
Sbjct  73   FCTTHC  78



>ref|XP_010270777.1| PREDICTED: defensin-like protein [Nelumbo nucifera]
 sp|A3FPF2.1|DEF_NELNU RecName: Full=Defensin-like protein; AltName: Full=Gamma-thionin 
homolog; Flags: Precursor [Nelumbo nucifera]
 gb|ABN46979.1| defensin [Nelumbo nucifera]
Length=77

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 30/51 (59%), Gaps = 0/51 (0%)
 Frame = -3

Query  250  VAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            VAEA  CE  S +FKG C     C S+C+TE    G C+G R RC C+K C
Sbjct  27   VAEARTCESQSHRFKGACLSDTNCASVCQTEGFPAGDCKGARRRCFCVKPC  77



>ref|XP_010319372.1| PREDICTED: defensin Ec-AMP-D2-like [Solanum lycopersicum]
Length=73

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 30/51 (59%), Gaps = 0/51 (0%)
 Frame = -3

Query  250  VAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            + EA  CE  S ++KG C R   C ++C+TE    G CRG R RC C K+C
Sbjct  23   LTEARTCESQSHRYKGPCVRKNNCANVCKTEGFSGGHCRGFRRRCFCAKHC  73



>emb|CAA65045.1| defensin [Capsicum annuum]
Length=75

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 34/62 (55%), Gaps = 0/62 (0%)
 Frame = -3

Query  289  LFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMC  110
            +F+       T ++AEA  CE  SG FKGLC  S+ C ++CR E    G CRG   +C C
Sbjct  11   IFLMMMLVFATDMMAEAKICEALSGNFKGLCLSSRDCGNVCRREGFTSGVCRGFPLKCFC  70

Query  109  IK  104
             K
Sbjct  71   RK  72



>ref|XP_002513261.1| 8.4 kDa sulfur-rich protein precursor, putative [Ricinus communis]
 gb|EEF49129.1| 8.4 kDa sulfur-rich protein precursor, putative [Ricinus communis]
Length=74

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 33/65 (51%), Gaps = 0/65 (0%)
 Frame = -3

Query  292  MLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCM  113
            +L +     +  I+  EA  CE  S  FKG C R   C  +CR E    G+C+G+R RC 
Sbjct  10   LLLLIVLASQEAIVPTEARVCESQSHYFKGPCLRDHNCAMVCRNEAFSGGRCKGVRRRCF  69

Query  112  CIKNC  98
            C K C
Sbjct  70   CTKLC  74



>ref|XP_008340513.1| PREDICTED: defensin-like protein 1 [Malus domestica]
 gb|AFH74425.1| defensin [Malus domestica]
Length=87

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 27/45 (60%), Gaps = 0/45 (0%)
 Frame = -3

Query  232  CEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            CE  SGKFKG+C  S  C + C  E    G+C+G R RCMC K C
Sbjct  43   CEAASGKFKGMCFSSNNCANTCAREKFDGGKCKGFRRRCMCTKKC  87



>ref|XP_008389119.1| PREDICTED: defensin Ec-AMP-D2-like [Malus domestica]
Length=77

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 33/66 (50%), Gaps = 0/66 (0%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
             +  +    G    +VAE   C+  S +FKG C     C ++C+TE    G CRG R RC
Sbjct  12   FLFLLLVATGMMGPMVAEGRTCDSQSHRFKGSCVSKSNCATVCQTEGFRGGHCRGFRRRC  71

Query  115  MCIKNC  98
             C K+C
Sbjct  72   FCTKHC  77



>gb|AGT51228.1| defensin [Brassica napus]
 emb|CDY03076.1| BnaC07g21510D [Brassica napus]
Length=76

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 34/66 (52%), Gaps = 0/66 (0%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
            V+LFM         +  EA  CE  S +FKG C  S  C ++C  E    G+CRG R RC
Sbjct  11   VLLFMIFVATGMGPVTVEARTCESKSHRFKGTCVSSTNCGNVCHNEGFGGGKCRGFRRRC  70

Query  115  MCIKNC  98
             C ++C
Sbjct  71   YCTRHC  76



>gb|ACB32234.1| gamma-thionin/defensin [Solanum chacoense]
Length=76

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 29/51 (57%), Gaps = 0/51 (0%)
 Frame = -3

Query  250  VAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            + EA  CE  S +FKG C   K C S+C TE    G CRG+R RC C + C
Sbjct  26   IVEARTCESQSHRFKGPCVSEKNCASVCETEGFSGGDCRGLRRRCFCTRPC  76



>ref|XP_004509602.1| PREDICTED: defensin-1-like [Cicer arietinum]
Length=80

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 36/67 (54%), Gaps = 4/67 (6%)
 Frame = -3

Query  292  MLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRF--R  119
            +L +  E G    +VAEA  C   S  +KGLC   + C ++CRTE   +G CRG  F  R
Sbjct  16   LLLVVTEMGAN--MVAEARSCISKSFTYKGLCVHDRNCANVCRTEGFVEGHCRGFAFGSR  73

Query  118  CMCIKNC  98
            C C K C
Sbjct  74   CFCYKPC  80



>emb|CDY48618.1| BnaC09g20670D [Brassica napus]
Length=77

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 35/65 (54%), Gaps = 3/65 (5%)
 Frame = -3

Query  292  MLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCM  113
            M+F+    G  T+   EA  CE  S KF+GLC     C ++C  E    G+CRG R RC 
Sbjct  16   MIFVASGMGPVTV---EARTCESKSHKFRGLCVSRHNCANVCHNEGFHGGKCRGFRRRCY  72

Query  112  CIKNC  98
            C ++C
Sbjct  73   CTRHC  77



>ref|XP_009792224.1| PREDICTED: defensin-like protein P322 [Nicotiana sylvestris]
Length=78

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 33/62 (53%), Gaps = 2/62 (3%)
 Frame = -3

Query  283  MXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIK  104
            M  E G  TI  AEA  CE    +FKG C R   C ++C TE    G CRG+R RC C +
Sbjct  19   MATEMGPMTI--AEARTCESQRHRFKGPCSRDGNCATVCLTEGFSGGDCRGLRRRCFCTR  76

Query  103  NC  98
             C
Sbjct  77   PC  78



>ref|XP_009351647.1| PREDICTED: defensin-like protein 1 [Pyrus x bretschneideri]
Length=87

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 27/45 (60%), Gaps = 0/45 (0%)
 Frame = -3

Query  232  CEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            CE  SGKFKG+C  S  C + C  E    G+C+G R RCMC K C
Sbjct  43   CEAASGKFKGMCFSSNNCANTCAREKFDGGKCKGFRRRCMCTKKC  87



>gb|ABW99097.1| defensin [Capsicum chinense]
Length=55

 Score = 48.5 bits (114),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 31/52 (60%), Gaps = 0/52 (0%)
 Frame = -3

Query  253  LVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            ++AEA  CE  SG FKGLC  S+ C ++CR E    G CRG   +C C K C
Sbjct  3    MMAEAKICEALSGNFKGLCLSSRDCGNVCRREGFTSGVCRGFPLKCFCRKPC  54



>dbj|BAB64929.1| defensin-like protein [Pyrus pyrifolia]
Length=87

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 27/45 (60%), Gaps = 0/45 (0%)
 Frame = -3

Query  232  CEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            CE  SGKFKG+C  S  C + C  E    G+C+G R RCMC K C
Sbjct  43   CEAASGKFKGMCFSSNNCANTCAREKFDGGKCKGFRRRCMCTKKC  87



>ref|XP_008389117.1| PREDICTED: defensin Tk-AMP-D1.1-like [Malus domestica]
Length=87

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 37/73 (51%), Gaps = 7/73 (10%)
 Frame = -3

Query  295  VMLFMXXEXGRXTI-LVAEAGK------CEVPSGKFKGLCGRSKTCRSICRTEVXXDGQC  137
            V+L    E G  ++  + E+ K      CEVPS  FKGLC  S  C+  CR E    G+C
Sbjct  15   VLLLAATEMGPISVEAMTESNKAVEGKICEVPSTLFKGLCFSSNNCKHTCRKEQFTRGKC  74

Query  136  RGIRFRCMCIKNC  98
             G+   CMC K C
Sbjct  75   SGLTRTCMCTKKC  87



>gb|AAA91049.1| protease inhibitor II [Brassica rapa]
Length=77

 Score = 48.5 bits (114),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 35/65 (54%), Gaps = 3/65 (5%)
 Frame = -3

Query  292  MLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCM  113
            M+F+    G  T+   EA  CE  S +FKG C  S  C ++C  E    G+CRG R RC 
Sbjct  16   MIFVATGMGPVTV---EARTCESKSHRFKGTCVSSTNCGNVCHNEGFGGGKCRGFRVRCY  72

Query  112  CIKNC  98
            C ++C
Sbjct  73   CTRHC  77



>ref|XP_006359485.1| PREDICTED: defensin-like protein-like [Solanum tuberosum]
Length=79

 Score = 48.5 bits (114),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 35/66 (53%), Gaps = 1/66 (2%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
             ML +  E G  +   AEA  CE  S  FKG C     C S+C+TE    G CRG+R +C
Sbjct  15   AMLLLSTEMGPMSG-GAEARTCESQSHSFKGPCVGDTNCASVCQTEGFIGGDCRGLRRQC  73

Query  115  MCIKNC  98
             C +NC
Sbjct  74   FCTRNC  79



>gb|ACS96442.1| defensin [Jatropha curcas]
Length=77

 Score = 48.5 bits (114),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -3

Query  250  VAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            +AEA  CE  + KFKG C     C ++C+TE    G CRG+R RC C ++C
Sbjct  27   MAEARTCESQTHKFKGTCLSETNCANVCKTEGFTGGDCRGLRRRCFCTRHC  77



>ref|XP_010513972.1| PREDICTED: defensin-like protein 2 [Camelina sativa]
 ref|XP_010495963.1| PREDICTED: defensin-like protein 2 [Camelina sativa]
Length=77

 Score = 48.5 bits (114),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 34/65 (52%), Gaps = 3/65 (5%)
 Frame = -3

Query  292  MLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCM  113
            M+F+    G  T+   EA  CE  S +FKG C     CR++C  E    G CRG R RC 
Sbjct  16   MIFVATGMGPVTV---EARTCESKSHRFKGKCFSETNCRNVCHNEGFSGGNCRGFRRRCF  72

Query  112  CIKNC  98
            C ++C
Sbjct  73   CTRHC  77



>ref|NP_176302.2| defensin-like protein [Arabidopsis thaliana]
 sp|Q9C947.2|DEF05_ARATH RecName: Full=Defensin-like protein 5; AltName: Full=Low-molecular-weight 
cysteine-rich protein 66; Short=Protein LCR66; 
AltName: Full=Plant defensin 2.4; Flags: Precursor [Arabidopsis 
thaliana]
 gb|ABE65729.1| plant defensin-fusion protein [Arabidopsis thaliana]
 gb|AEE33774.1| defensin-like protein [Arabidopsis thaliana]
Length=76

 Score = 48.5 bits (114),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 33/66 (50%), Gaps = 1/66 (2%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
            ++LFM        + V EA  CE  S  F G C  S  C ++C  E   DG CRG R RC
Sbjct  12   LLLFMILATVMGLVTV-EARTCETSSNLFNGPCLSSSNCANVCHNEGFSDGDCRGFRRRC  70

Query  115  MCIKNC  98
            +C + C
Sbjct  71   LCTRPC  76



>gb|ADQ43197.1| unknown [Schrenkiella parvula]
Length=72

 Score = 48.5 bits (114),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 30/49 (61%), Gaps = 2/49 (4%)
 Frame = -3

Query  244  EAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            EA  CE PSGK+ G+C  +K C S+C +E    G C+ +  RC CIK C
Sbjct  26   EAKTCESPSGKYHGVCLNAKNCASVCPSEGFTGGHCKSL--RCYCIKTC  72



>gb|ABO36641.1| defensin protein [Solanum pimpinellifolium]
Length=76

 Score = 48.1 bits (113),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 28/51 (55%), Gaps = 0/51 (0%)
 Frame = -3

Query  250  VAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            + EA  CE  S +FKG C   K C S+C TE    G CRG R RC C + C
Sbjct  26   IVEARTCESQSHRFKGPCVSEKNCASVCETEGFSGGDCRGFRRRCFCTRPC  76



>gb|ABK28445.1| unknown [Arabidopsis thaliana]
Length=77

 Score = 48.1 bits (113),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 33/66 (50%), Gaps = 1/66 (2%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
            ++LFM        + V EA  CE  S  F G C  S  C ++C  E   DG CRG R RC
Sbjct  12   LLLFMILATVMGLVTV-EARTCETSSNLFNGPCLSSSNCANVCHNEGFSDGDCRGFRRRC  70

Query  115  MCIKNC  98
            +C + C
Sbjct  71   LCTRPC  76



>gb|ABO36637.1| defensin protein [Solanum lycopersicum]
Length=76

 Score = 48.1 bits (113),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 28/51 (55%), Gaps = 0/51 (0%)
 Frame = -3

Query  250  VAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            + EA  CE  S +FKG C   K C S+C TE    G CRG R RC C + C
Sbjct  26   IVEARTCESQSHRFKGPCVSEKNCASVCETEGFSGGDCRGFRRRCFCTRPC  76



>gb|KCW70075.1| hypothetical protein EUGRSUZ_F03380 [Eucalyptus grandis]
Length=74

 Score = 48.1 bits (113),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 29/54 (54%), Gaps = 0/54 (0%)
 Frame = -3

Query  259  TILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
             +   E   CE  S KF GLC   +TC  +C+ E   DG+CRG R RC C K C
Sbjct  21   VVWRIEGRMCESQSHKFHGLCMSDRTCVVVCKEEDFDDGKCRGFRHRCFCRKPC  74



>ref|XP_006359487.1| PREDICTED: defensin-like protein-like [Solanum tuberosum]
Length=76

 Score = 48.1 bits (113),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 27/50 (54%), Gaps = 0/50 (0%)
 Frame = -3

Query  247  AEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
             EA  CE  S  FKG C     C S+C TE    G CRG+R RC C +NC
Sbjct  27   VEARTCESKSHHFKGKCLSDTNCGSVCHTEGFTGGNCRGLRQRCFCTRNC  76



>ref|NP_001234872.1| gamma-thionin precursor [Solanum lycopersicum]
 emb|CAB42006.1| gamma-thionin [Solanum lycopersicum]
Length=72

 Score = 48.1 bits (113),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 28/51 (55%), Gaps = 0/51 (0%)
 Frame = -3

Query  250  VAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            + EA  CE  S +FKG C   K C S+C TE    G CRG R RC C + C
Sbjct  22   IVEARTCESQSHRFKGPCVSEKNCASVCETEGFSGGDCRGFRRRCFCTRPC  72



>gb|KJB75524.1| hypothetical protein B456_012G045400 [Gossypium raimondii]
Length=85

 Score = 48.1 bits (113),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 28/51 (55%), Gaps = 0/51 (0%)
 Frame = -3

Query  250  VAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            + E   CE  S +FKG+C     C  +CR E   DG CRG R RC C +NC
Sbjct  35   MVEGRICESKSHRFKGVCLSDHNCGLVCRNEGFLDGWCRGFRHRCFCTRNC  85



>ref|XP_010260874.1| PREDICTED: defensin D2-like [Nelumbo nucifera]
Length=72

 Score = 48.1 bits (113),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 37/66 (56%), Gaps = 3/66 (5%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
            V+L+   E     ++  +A  C+ PS  F+GLC  ++ C + CR E   DG C+G+R RC
Sbjct  8    VLLWFVAEE---MVVHVDARMCDTPSRLFRGLCLINRNCDNTCRVEGFPDGHCKGLRRRC  64

Query  115  MCIKNC  98
             C + C
Sbjct  65   FCSRPC  70



>gb|KJB11914.1| hypothetical protein B456_002G029700 [Gossypium raimondii]
Length=78

 Score = 48.1 bits (113),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 32/53 (60%), Gaps = 1/53 (2%)
 Frame = -3

Query  253  LVAEAGK-CEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            +VA+  K CE PS  FKGLC R   C  +C+TE   +G C+G   +C+C K C
Sbjct  26   VVADGDKICESPSNAFKGLCLRDDNCDIVCKTEGFPNGDCKGFLRKCVCTKPC  78



>gb|KJB11913.1| hypothetical protein B456_002G029700 [Gossypium raimondii]
Length=78

 Score = 48.1 bits (113),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 32/53 (60%), Gaps = 1/53 (2%)
 Frame = -3

Query  253  LVAEAGK-CEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            +VA+  K CE PS  FKGLC R   C  +C+TE   +G C+G   +C+C K C
Sbjct  26   VVADGDKICESPSNAFKGLCLRDDNCDIVCKTEGFPNGDCKGFLRKCVCTKPC  78



>gb|ABA86589.1| putative defensin 1 [Aquilegia pyrenaica]
 gb|ABA86590.1| putative defensin 1 [Aquilegia olympica]
Length=70

 Score = 47.8 bits (112),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 28/51 (55%), Gaps = 0/51 (0%)
 Frame = -3

Query  250  VAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
             AEA  CE  S KFKG C R   C S+C++E    G CRG+  RC C   C
Sbjct  18   AAEARDCESQSHKFKGTCIRKSNCASVCQSEGFNGGHCRGVTRRCYCTAKC  68



>gb|AFD01290.1| defensin 3 [Pinus sylvestris]
Length=83

 Score = 48.1 bits (113),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/68 (37%), Positives = 35/68 (51%), Gaps = 2/68 (3%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQC--RGIRF  122
            +++ +    G   + VAE   C+ PSGKFKG C  S  C+++CRTE    G C       
Sbjct  15   LLVLLVITIGMMAVQVAEGRMCKTPSGKFKGYCVSSTNCKNVCRTEGFPSGSCDFHVTSR  74

Query  121  RCMCIKNC  98
            +C C K C
Sbjct  75   KCYCYKPC  82



>gb|AAG51654.1|AC018908_20 unknown protein; 87272-87105 [Arabidopsis thaliana]
Length=55

 Score = 47.4 bits (111),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 28/53 (53%), Gaps = 0/53 (0%)
 Frame = -3

Query  256  ILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            ++  EA  CE  S  F G C  S  C ++C  E   DG CRG R RC+C + C
Sbjct  3    LVTVEARTCETSSNLFNGPCLSSSNCANVCHNEGFSDGDCRGFRRRCLCTRPC  55



>gb|ABK23404.1| unknown [Picea sitchensis]
 gb|ABK23503.1| unknown [Picea sitchensis]
 gb|ABR17883.1| unknown [Picea sitchensis]
 gb|ACN40306.1| unknown [Picea sitchensis]
Length=83

 Score = 48.1 bits (113),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 2/68 (3%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQC--RGIRF  122
            +++ +    G   + +AEA  C+ PSGKFKG+C  S  C+++C+TE    G C       
Sbjct  15   LLVLLVISIGMIQLELAEARTCKTPSGKFKGVCASSNNCKNVCQTEGFPSGSCDFHVANR  74

Query  121  RCMCIKNC  98
            +C C K C
Sbjct  75   KCYCSKPC  82



>gb|AFE88173.1| g-thionin [Panax ginseng]
Length=75

 Score = 47.8 bits (112),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 28/50 (56%), Gaps = 0/50 (0%)
 Frame = -3

Query  247  AEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            AE   CE  S KFKG C     C ++C+TE    G+CRG R RC C  +C
Sbjct  26   AEGRTCESQSHKFKGTCASGTNCANVCKTEGFPGGKCRGFRRRCFCTTHC  75



>ref|XP_009357110.1| PREDICTED: defensin Ec-AMP-D1-like [Pyrus x bretschneideri]
Length=81

 Score = 47.8 bits (112),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 28/45 (62%), Gaps = 0/45 (0%)
 Frame = -3

Query  232  CEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            CE PS K++G+C RS  C + C+ E    G+C G R RC+C K C
Sbjct  37   CESPSHKYRGICFRSSNCATTCKKEGFMGGKCTGFRMRCVCTKKC  81



>ref|XP_011462172.1| PREDICTED: uncharacterized protein LOC105350880 [Fragaria vesca 
subsp. vesca]
Length=136

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 28/53 (53%), Gaps = 0/53 (0%)
 Frame = -3

Query  256  ILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            +   +A KCE  S  F GLC     C S+C TE    G CRG+R RC C K C
Sbjct  84   VAADDARKCESLSHNFNGLCLSESNCASVCATEGFTGGDCRGLRRRCFCTKQC  136



>gb|AAM62652.1| protease inhibitor II [Arabidopsis thaliana]
Length=76

 Score = 47.8 bits (112),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 33/66 (50%), Gaps = 1/66 (2%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
            ++LFM        + V EA  CE  S  F G C  S  C ++C  E   DG CRG R RC
Sbjct  12   LLLFMILATVMGPVRV-EARTCETSSNLFNGPCLSSSNCANVCHNEGFSDGDCRGFRRRC  70

Query  115  MCIKNC  98
            +C + C
Sbjct  71   LCTRPC  76



>ref|XP_007159918.1| hypothetical protein PHAVU_002G278600g [Phaseolus vulgaris]
 gb|ESW31912.1| hypothetical protein PHAVU_002G278600g [Phaseolus vulgaris]
Length=75

 Score = 47.8 bits (112),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 30/53 (57%), Gaps = 0/53 (0%)
 Frame = -3

Query  256  ILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            ++ +EA  CE PS  FKGLC   + C ++C TE    G+C G R RC C   C
Sbjct  23   VMKSEARLCESPSHSFKGLCFNDRNCANVCLTEGFTGGKCEGARHRCFCTIIC  75



>ref|XP_007226630.1| hypothetical protein PRUPE_ppa022845mg [Prunus persica]
 gb|EMJ27829.1| hypothetical protein PRUPE_ppa022845mg [Prunus persica]
Length=87

 Score = 47.8 bits (112),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 38/73 (52%), Gaps = 7/73 (10%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGK-------CEVPSGKFKGLCGRSKTCRSICRTEVXXDGQC  137
            V+L +  E G   +   +A K       C+  S KFKG+C  + +C   C++E    GQC
Sbjct  15   VLLLVAAEMGPMAVEGRDAKKVEPKKKTCDSQSQKFKGMCFLTSSCVQSCKSEGFTGGQC  74

Query  136  RGIRFRCMCIKNC  98
            RG R RC C KNC
Sbjct  75   RGFRRRCFCSKNC  87



>emb|CDP10467.1| unnamed protein product [Coffea canephora]
Length=104

 Score = 48.1 bits (113),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = -3

Query  232  CEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            CE PS +FKG C +   C ++C+TE    G+CRG+R RC C + C
Sbjct  57   CETPSKRFKGPCVKESNCAAVCQTEGFQGGKCRGLRRRCFCTRPC  101



>ref|XP_006292136.1| hypothetical protein CARUB_v10018340mg [Capsella rubella]
 gb|EOA25034.1| hypothetical protein CARUB_v10018340mg [Capsella rubella]
Length=77

 Score = 47.8 bits (112),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 34/65 (52%), Gaps = 3/65 (5%)
 Frame = -3

Query  292  MLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCM  113
            M+F+    G  T+   EA  CE  S +FKG C     C+++C  E    G CRG R RC 
Sbjct  16   MIFVATGMGPVTV---EARTCESKSHRFKGTCLSESNCKNVCHNEGFQGGNCRGFRRRCF  72

Query  112  CIKNC  98
            C ++C
Sbjct  73   CTRHC  77



>gb|EMT03363.1| hypothetical protein F775_43918 [Aegilops tauschii]
Length=82

 Score = 47.8 bits (112),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 31/53 (58%), Gaps = 0/53 (0%)
 Frame = -3

Query  256  ILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            ++VAEA  CE  S +F+G C R   C ++CRTE   DG+CRG      C  +C
Sbjct  28   VMVAEARTCESRSHRFRGPCVRRSNCANVCRTEGFSDGECRGFPPPPFCTTHC  80



>ref|XP_010502227.1| PREDICTED: defensin-like protein 2 [Camelina sativa]
Length=77

 Score = 47.8 bits (112),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 33/65 (51%), Gaps = 3/65 (5%)
 Frame = -3

Query  292  MLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCM  113
            M+F+    G  T+   EA  CE  S +FKG C     CR++C  E    G CRG R RC 
Sbjct  16   MIFVATGMGPVTV---EARTCESQSHRFKGKCFSETNCRNVCHNEGFSGGNCRGFRRRCF  72

Query  112  CIKNC  98
            C + C
Sbjct  73   CTRYC  77



>ref|XP_008340512.1| PREDICTED: defensin-like protein 1 [Malus domestica]
Length=90

 Score = 47.8 bits (112),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 30/52 (58%), Gaps = 1/52 (2%)
 Frame = -3

Query  250  VAEAGKCEV-PSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
             AE  KC+  PS KFKG+C  +  C   C+ E    GQCRG R RC+C K C
Sbjct  39   AAEKKKCDSHPSSKFKGVCFFTNNCVDTCKLEGSSGGQCRGFRRRCICTKQC  90



>ref|NP_178319.1| defensin-like protein 2 [Arabidopsis thaliana]
 sp|Q39182.1|DEF02_ARATH RecName: Full=Defensin-like protein 2; AltName: Full=Low-molecular-weight 
cysteine-rich protein 69; Short=Protein LCR69; 
AltName: Full=Plant defensin 2.2; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAK44170.1|AF370355_1 putative protease inhibitor II [Arabidopsis thaliana]
 emb|CAA48892.1| protease inhibitor II [Arabidopsis thaliana]
 gb|AAC97223.1| protease inhibitor II [Arabidopsis thaliana]
 gb|AAX39303.1| defensin-like protein [Arabidopsis thaliana]
 gb|AEC05546.1| defensin-like protein 2 [Arabidopsis thaliana]
Length=77

 Score = 47.4 bits (111),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 34/65 (52%), Gaps = 3/65 (5%)
 Frame = -3

Query  292  MLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCM  113
            M+F+    G  T+   EA  CE  S +FKG C  +  C ++C  E    G CRG R RC 
Sbjct  16   MIFVATGMGPVTV---EARTCESQSHRFKGTCVSASNCANVCHNEGFVGGNCRGFRRRCF  72

Query  112  CIKNC  98
            C ++C
Sbjct  73   CTRHC  77



>gb|AIA66989.1| defensin [Triticum aestivum]
Length=82

 Score = 47.8 bits (112),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 33/61 (54%), Gaps = 2/61 (3%)
 Frame = -3

Query  274  EXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRF--RCMCIKN  101
            E G  T+ +AEA  C   S KFKG C  S  C ++CRTE   DG+C    F  +C C + 
Sbjct  22   EMGATTVKLAEARDCLSQSHKFKGACLSSSNCAAVCRTENFPDGECHTHNFARKCFCKRA  81

Query  100  C  98
            C
Sbjct  82   C  82



>ref|XP_009101273.1| PREDICTED: defensin-like protein 2 [Brassica rapa]
 emb|CDY17613.1| BnaA06g34320D [Brassica napus]
Length=77

 Score = 47.4 bits (111),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 25/66 (38%), Positives = 34/66 (52%), Gaps = 0/66 (0%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
            ++LFM         +  EA  CE  S +FKG C  S  C ++C  E    G+CRG R RC
Sbjct  12   LLLFMIFVATGMGPVTVEARTCESKSHRFKGTCVSSTNCGNVCHNEGFGGGKCRGFRRRC  71

Query  115  MCIKNC  98
             C ++C
Sbjct  72   YCTRHC  77



>ref|XP_010229304.1| PREDICTED: defensin Tk-AMP-D1.1-like [Brachypodium distachyon]
Length=75

 Score = 47.4 bits (111),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 30/53 (57%), Gaps = 0/53 (0%)
 Frame = -3

Query  256  ILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            +  A+A  C+  SGKF GLC    +C + C TE    G+C GI  RCMC  +C
Sbjct  23   VAPAQAKDCQTASGKFHGLCFLDSSCTNACITEGFTSGECEGIHRRCMCKTSC  75



>ref|XP_006292781.1| hypothetical protein CARUB_v10019030mg [Capsella rubella]
 gb|EOA25679.1| hypothetical protein CARUB_v10019030mg [Capsella rubella]
Length=77

 Score = 47.4 bits (111),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 34/65 (52%), Gaps = 3/65 (5%)
 Frame = -3

Query  292  MLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCM  113
            M+F+    G  T+   EA  CE  S +FKG C     C+++C  E    G CRG R RC 
Sbjct  16   MIFVATGMGPVTV---EARTCESKSHRFKGKCFSETNCKNVCHNEGFTGGNCRGFRRRCF  72

Query  112  CIKNC  98
            C ++C
Sbjct  73   CTRHC  77



>gb|ACV84384.1| defensin precursor [Triticum turgidum subsp. durum]
Length=82

 Score = 47.4 bits (111),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 33/61 (54%), Gaps = 2/61 (3%)
 Frame = -3

Query  274  EXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRF--RCMCIKN  101
            E G  T+ +AEA  C   S KFKG C  S  C ++CRTE   DG+C    F  +C C + 
Sbjct  22   EMGATTVKLAEARDCLSQSHKFKGACLSSSNCAAVCRTENFPDGECHTHNFARKCFCKRP  81

Query  100  C  98
            C
Sbjct  82   C  82



>ref|NP_178320.1| defensin-like protein 4 [Arabidopsis thaliana]
 sp|Q41914.2|DEF04_ARATH RecName: Full=Defensin-like protein 4; AltName: Full=Low-molecular-weight 
cysteine-rich protein 70; Short=Protein LCR70; 
AltName: Full=Plant defensin 2.1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAC97222.1| protease inhibitor II [Arabidopsis thaliana]
 dbj|BAC42603.1| putative protease inhibitor II [Arabidopsis thaliana]
 gb|AAO42893.1| At2g02120 [Arabidopsis thaliana]
 gb|AEC05548.1| defensin-like protein 4 [Arabidopsis thaliana]
Length=77

 Score = 47.4 bits (111),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 33/66 (50%), Gaps = 3/66 (5%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
            VM+F+    G  T+   EA  C   S +FKG C     C ++C  E    G CRG R RC
Sbjct  15   VMIFVATGMGPVTV---EARTCASQSQRFKGKCVSDTNCENVCHNEGFPGGDCRGFRRRC  71

Query  115  MCIKNC  98
             C +NC
Sbjct  72   FCTRNC  77



>ref|XP_011099999.1| PREDICTED: defensin Ec-AMP-D2-like [Sesamum indicum]
Length=82

 Score = 47.4 bits (111),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 27/49 (55%), Gaps = 0/49 (0%)
 Frame = -3

Query  247  AEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKN  101
            AE   C   S KFKG C +   C S+C+TE    G+CRG R RC C K 
Sbjct  30   AEPKLCIAKSNKFKGFCLKDPKCVSVCKTEGFTGGRCRGFRLRCYCTKT  78



>dbj|BAD25113.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|EAZ22207.1| hypothetical protein OsJ_05867 [Oryza sativa Japonica Group]
Length=92

 Score = 47.4 bits (111),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 32/53 (60%), Gaps = 0/53 (0%)
 Frame = -3

Query  256  ILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            ++V +A  CE PS  FKGLC RS+ C + C  E   DG+C+ +  RC+C   C
Sbjct  28   VVVVQARLCEKPSSHFKGLCLRSQNCDNECMLEGYMDGKCKYLTRRCICSMEC  80



>ref|XP_007159919.1| hypothetical protein PHAVU_002G278700g [Phaseolus vulgaris]
 gb|ESW31913.1| hypothetical protein PHAVU_002G278700g [Phaseolus vulgaris]
Length=74

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/66 (38%), Positives = 32/66 (48%), Gaps = 0/66 (0%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
            + L          +  AEA  C   S  FKGLC  +  C ++C TE    G+C G+R RC
Sbjct  9    IFLLFLVLAADVAVKRAEARLCWSESQAFKGLCFSNDNCATVCLTEGFTGGKCEGLRRRC  68

Query  115  MCIKNC  98
             C KNC
Sbjct  69   FCSKNC  74



>ref|NP_001148158.1| LOC100281766 precursor [Zea mays]
 ref|NP_001152925.1| flower-specific gamma-thionin precursor [Zea mays]
 gb|ACG25111.1| flower-specific gamma-thionin precursor [Zea mays]
 gb|ACG29960.1| flower-specific gamma-thionin precursor [Zea mays]
 gb|ACG46032.1| flower-specific gamma-thionin precursor [Zea mays]
 gb|ACG49139.1| flower-specific gamma-thionin precursor [Zea mays]
 gb|ACN27540.1| unknown [Zea mays]
 tpg|DAA60145.1| TPA: flower-specific gamma-thionin [Zea mays]
Length=78

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 31/53 (58%), Gaps = 0/53 (0%)
 Frame = -3

Query  256  ILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            + +  A KCE  S +FKG C R   C ++C TE    G C+G+R RC C ++C
Sbjct  26   VTMVSARKCESQSFRFKGPCSRDANCANVCLTEGFTGGVCKGLRHRCFCTRDC  78



>ref|XP_008240819.1| PREDICTED: defensin Ec-AMP-D1-like [Prunus mume]
Length=85

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 28/49 (57%), Gaps = 0/49 (0%)
 Frame = -3

Query  244  EAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            ++G CE  S KFKG C RS +C   C+ E    G+C G R RC C K C
Sbjct  37   KSGTCESLSTKFKGFCFRSSSCADACQKEGFMGGKCPGFRLRCTCTKKC  85



>ref|XP_006420697.1| hypothetical protein CICLE_v10006362mg [Citrus clementina]
 ref|XP_006470884.1| PREDICTED: defensin-like protein-like [Citrus sinensis]
 gb|ESR33937.1| hypothetical protein CICLE_v10006362mg [Citrus clementina]
 gb|KDO53542.1| hypothetical protein CISIN_1g034999mg [Citrus sinensis]
Length=76

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 29/53 (55%), Gaps = 0/53 (0%)
 Frame = -3

Query  256  ILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            +  AEA  CE  S +FKG C     C ++C+TE    G CRG R RC C K C
Sbjct  24   LRAAEARICESQSHRFKGPCVSKSNCAAVCQTEGFHGGHCRGFRRRCFCTKRC  76



>emb|CAH58740.1| defensin [Plantago major]
Length=72

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 30/52 (58%), Gaps = 0/52 (0%)
 Frame = -3

Query  253  LVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            +V EA KC   S +FKG C     C S+C+TE    G C+G+R RC C  +C
Sbjct  21   MVGEARKCRSASHRFKGTCLSDTNCASVCKTEGFPGGDCKGLRRRCFCETHC  72



>ref|NP_178321.1| defensin-like protein 1 [Arabidopsis thaliana]
 sp|Q9ZUL7.1|DEF01_ARATH RecName: Full=Defensin-like protein 1; AltName: Full=Low-molecular-weight 
cysteine-rich protein 68; Short=Protein LCR68; 
AltName: Full=Plant defensin 2.3; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAC97221.1| protease inhibitor II [Arabidopsis thaliana]
 gb|AAK93656.1| putative protease inhibitor II [Arabidopsis thaliana]
 gb|AAL85136.1| putative protease inhibitor II [Arabidopsis thaliana]
 gb|AEC05549.1| defensin-like protein 1 [Arabidopsis thaliana]
Length=77

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 34/66 (52%), Gaps = 0/66 (0%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
            ++LFM         +  EA  CE  S +FKG C  +  C ++C  E    G+CRG R RC
Sbjct  12   LLLFMVFIATGMGPVTVEARTCESKSHRFKGPCVSTHNCANVCHNEGFGGGKCRGFRRRC  71

Query  115  MCIKNC  98
             C ++C
Sbjct  72   YCTRHC  77



>gb|ADK91098.1| PCP17C2, partial [Arabidopsis halleri]
 gb|ADK91099.1| PCP17C2, partial [Arabidopsis halleri]
 gb|ADK91100.1| PCP17C2, partial [Arabidopsis halleri]
 gb|ADK91101.1| PCP17C2, partial [Arabidopsis halleri]
 gb|ADK91102.1| PCP17C2, partial [Arabidopsis halleri]
 gb|ADK91103.1| PCP17C2, partial [Arabidopsis halleri]
 gb|ADK91104.1| PCP17C2, partial [Arabidopsis halleri]
 gb|ADK91105.1| PCP17C2, partial [Arabidopsis halleri]
 gb|ADK91106.1| PCP17C2, partial [Arabidopsis halleri]
 gb|ADK91107.1| PCP17C2, partial [Arabidopsis halleri]
 gb|ADK91108.1| PCP17C2, partial [Arabidopsis halleri]
 gb|ADK91109.1| PCP17C2, partial [Arabidopsis halleri]
 gb|ADK91110.1| PCP17C2, partial [Arabidopsis halleri]
 gb|ADK91111.1| PCP17C2, partial [Arabidopsis halleri]
 gb|ADK91112.1| PCP17C2, partial [Arabidopsis halleri]
 gb|ADK91113.1| PCP17C2, partial [Arabidopsis halleri]
 gb|ADK91114.1| PCP17C2, partial [Arabidopsis halleri]
 gb|ADK91115.1| PCP17C2, partial [Arabidopsis halleri]
 gb|ADK91117.1| PCP17C2, partial [Arabidopsis halleri]
 gb|ADK91118.1| PCP17C2, partial [Arabidopsis halleri]
 gb|ADK91119.1| PCP17C2, partial [Arabidopsis halleri]
 gb|ADK91120.1| PCP17C2, partial [Arabidopsis halleri]
Length=55

 Score = 46.6 bits (109),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 28/52 (54%), Gaps = 0/52 (0%)
 Frame = -3

Query  253  LVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            +  EA  CE  S +FKG C  +  C ++C  E    G CRG R RC C +NC
Sbjct  4    VTVEARTCESQSHRFKGTCVSASNCANVCHNEGFIGGNCRGFRRRCFCTRNC  55



>ref|XP_007203287.1| hypothetical protein PRUPE_ppa025677mg [Prunus persica]
 gb|EMJ04486.1| hypothetical protein PRUPE_ppa025677mg [Prunus persica]
Length=85

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 26/45 (58%), Gaps = 0/45 (0%)
 Frame = -3

Query  232  CEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            CE  S KFKG C RS  C +IC  E    G+C G R RC C KNC
Sbjct  41   CESLSTKFKGPCFRSSNCANICEKEGFKGGKCVGFRLRCTCTKNC  85



>ref|XP_011086331.1| PREDICTED: putative defensin-like protein 3 [Sesamum indicum]
Length=121

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 31/52 (60%), Gaps = 0/52 (0%)
 Frame = -3

Query  253  LVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            + AEA  C+  S +F+GLC R+  C +IC  E    G C+G   RC+C K+C
Sbjct  18   IGAEAAVCQTRSQQFRGLCFRNDNCAAICEKEGYISGSCKGFLLRCICFKDC  69



>gb|ABA86587.1| putative defensin 1 [Aquilegia chrysantha]
Length=70

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 28/53 (53%), Gaps = 0/53 (0%)
 Frame = -3

Query  256  ILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            + VA A  CE  S KFKG C R   C S+C +E    G CRG+  RC C   C
Sbjct  16   LKVAXARDCESQSHKFKGTCIRXSNCASVCXSEGFNGGHCRGVTRRCYCTAKC  68



>ref|XP_007137817.1| hypothetical protein PHAVU_009G158100g [Phaseolus vulgaris]
 gb|ESW09811.1| hypothetical protein PHAVU_009G158100g [Phaseolus vulgaris]
Length=145

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/53 (40%), Positives = 29/53 (55%), Gaps = 0/53 (0%)
 Frame = -3

Query  256  ILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            ++  E   CE  S +FKG+C   + C S+C  E    G CRG R RC C ++C
Sbjct  93   MVQTEGRHCESKSHRFKGMCLSDRNCASVCHLEGFTGGNCRGFRRRCFCTRHC  145



>gb|AGT51229.1| defensin [Brassica napus]
 emb|CDY51475.1| BnaC02g47680D [Brassica napus]
Length=77

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 34/66 (52%), Gaps = 0/66 (0%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
            ++LFM         +  EA  CE  S +FKG C     C ++C  E    G+CRG+R RC
Sbjct  12   LLLFMIFVATGMGPVSVEARTCESQSHRFKGPCVSDNNCANVCHNEGFGGGKCRGLRRRC  71

Query  115  MCIKNC  98
             C ++C
Sbjct  72   FCTRHC  77



>ref|XP_002875115.1| hypothetical protein ARALYDRAFT_484136 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51374.1| hypothetical protein ARALYDRAFT_484136 [Arabidopsis lyrata subsp. 
lyrata]
Length=77

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 35/65 (54%), Gaps = 3/65 (5%)
 Frame = -3

Query  292  MLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCM  113
            M+F+    G  T+   EA  CE  S +FKG C  +  C ++C  E    G+CRG R RC 
Sbjct  16   MVFVATGMGPVTV---EARTCESKSHRFKGPCVSTHNCANVCHNEGFGGGKCRGFRRRCY  72

Query  112  CIKNC  98
            C ++C
Sbjct  73   CTRHC  77



>ref|XP_007202934.1| hypothetical protein PRUPE_ppa016748mg [Prunus persica]
 ref|XP_007202943.1| hypothetical protein PRUPE_ppa016379mg [Prunus persica]
 ref|XP_007203068.1| hypothetical protein PRUPE_ppa023476mg [Prunus persica]
 gb|EMJ04133.1| hypothetical protein PRUPE_ppa016748mg [Prunus persica]
 gb|EMJ04142.1| hypothetical protein PRUPE_ppa016379mg [Prunus persica]
 gb|EMJ04267.1| hypothetical protein PRUPE_ppa023476mg [Prunus persica]
Length=85

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 26/45 (58%), Gaps = 0/45 (0%)
 Frame = -3

Query  232  CEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            CE  S KFKG C RS  C +IC  E    G+C G R RC C KNC
Sbjct  41   CESLSTKFKGPCIRSSNCANICEEEGFKGGKCVGFRLRCTCTKNC  85



>ref|XP_007202863.1| hypothetical protein PRUPE_ppa015550mg [Prunus persica]
 gb|EMJ04062.1| hypothetical protein PRUPE_ppa015550mg [Prunus persica]
Length=85

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 26/45 (58%), Gaps = 0/45 (0%)
 Frame = -3

Query  232  CEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            CE  S KFKG C RS  C +IC  E    G+C G R RC C KNC
Sbjct  41   CESLSTKFKGPCIRSSNCANICEEEGFKGGKCVGFRLRCTCTKNC  85



>ref|NP_001047493.1| Os02g0629800 [Oryza sativa Japonica Group]
 dbj|BAD23741.1| putative defensin [Oryza sativa Japonica Group]
 dbj|BAF09407.1| Os02g0629800 [Oryza sativa Japonica Group]
 gb|EEE57415.1| hypothetical protein OsJ_07607 [Oryza sativa Japonica Group]
Length=80

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 38/68 (56%), Gaps = 4/68 (6%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCR--GIRF  122
            + + +  E G  T  VAEA  C   S +FKG+C  S  C ++CRTE   DG+C+  G+  
Sbjct  15   LAILVATEMG--TTKVAEARHCLSQSHRFKGMCVSSNNCANVCRTESFPDGECKSHGLER  72

Query  121  RCMCIKNC  98
            +C C K C
Sbjct  73   KCFCKKVC  80



>gb|ACV84381.1| defensin precursor [Triticum turgidum subsp. durum]
Length=82

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 31/61 (51%), Gaps = 2/61 (3%)
 Frame = -3

Query  274  EXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRF--RCMCIKN  101
            E G  T  VAEA  C   S  FKG C  S  C ++CRTE   DG+C    F  +C C + 
Sbjct  22   EMGATTTKVAEARDCVSQSHNFKGACLSSSNCPAVCRTENFPDGECHTPHFERKCFCKRP  81

Query  100  C  98
            C
Sbjct  82   C  82



>ref|XP_009114206.1| PREDICTED: defensin-like protein 1 [Brassica rapa]
 emb|CDY04121.1| BnaA09g18990D [Brassica napus]
Length=77

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 34/65 (52%), Gaps = 3/65 (5%)
 Frame = -3

Query  292  MLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCM  113
            M+F+    G  T+   EA  CE  S KF+G C     C ++C  E    G+CRG R RC 
Sbjct  16   MIFVASGMGPVTV---EARTCESKSHKFRGPCVSRHNCANVCHNEGFHGGKCRGFRRRCY  72

Query  112  CIKNC  98
            C ++C
Sbjct  73   CTRHC  77



>ref|XP_003526900.1| PREDICTED: defensin-like protein 6-like [Glycine max]
 gb|ACU20671.1| unknown [Glycine max]
 gb|KHN09676.1| Defensin-like protein 6 [Glycine soja]
Length=73

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/53 (40%), Positives = 29/53 (55%), Gaps = 0/53 (0%)
 Frame = -3

Query  256  ILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            ++  E   CE  S +FKG+C     C S+C  E    G+CRG R RC C ++C
Sbjct  21   VVQTEGRHCESKSHRFKGMCLSKHNCASVCHLEGFTGGKCRGFRRRCFCTRHC  73



>gb|ABK25062.1| unknown [Picea sitchensis]
Length=83

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/68 (34%), Positives = 36/68 (53%), Gaps = 2/68 (3%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQC--RGIRF  122
            +++ +    G   + +AE   C+ PSGKFKG+C  S  C+++C+TE    G C       
Sbjct  15   LLVLLVISIGMMQLELAEGRTCKTPSGKFKGVCASSNNCKNVCQTEGFPSGSCDFHVANR  74

Query  121  RCMCIKNC  98
            +C C K C
Sbjct  75   KCYCSKPC  82



>ref|XP_009129168.1| PREDICTED: defensin-like protein 1 [Brassica rapa]
 emb|CDY09389.1| BnaA02g26210D [Brassica napus]
Length=77

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 34/66 (52%), Gaps = 0/66 (0%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
            ++LFM         +  EA  CE  S +FKG C     C ++C  E    G+CRG+R RC
Sbjct  12   LLLFMIFVATGMGPVSVEARTCESQSHRFKGPCVSENNCANVCHNEGFGGGKCRGLRRRC  71

Query  115  MCIKNC  98
             C ++C
Sbjct  72   FCTRHC  77



>emb|CAA62761.1| putative gamma-thionin protein [Picea abies]
Length=83

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/68 (34%), Positives = 36/68 (53%), Gaps = 2/68 (3%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQC--RGIRF  122
            +++ +    G   + +AE   C+ PSGKFKG+C  S  C+++C+TE    G C       
Sbjct  15   LLVLLVISIGMMQLELAEGRTCKTPSGKFKGVCASSNNCKNVCQTEGFPSGSCDFHVANR  74

Query  121  RCMCIKNC  98
            +C C K C
Sbjct  75   KCYCSKPC  82



>ref|XP_002325734.2| defensin-like family protein [Populus trichocarpa]
 gb|EEF00116.2| defensin-like family protein [Populus trichocarpa]
Length=76

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 31/65 (48%), Gaps = 0/65 (0%)
 Frame = -3

Query  292  MLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCM  113
            +L +        ++  EA  C+  S  FKG C R   C  +CR E    G+C+G R RC 
Sbjct  12   LLLIVLASPEEVVVPTEARVCQSQSHYFKGPCARDHNCAWVCRNEGFSGGRCKGFRRRCF  71

Query  112  CIKNC  98
            C K C
Sbjct  72   CTKLC  76



>ref|XP_006301968.1| hypothetical protein CARUB_v10022448mg [Capsella rubella]
 gb|EOA34866.1| hypothetical protein CARUB_v10022448mg [Capsella rubella]
Length=72

 Score = 45.8 bits (107),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/66 (38%), Positives = 31/66 (47%), Gaps = 5/66 (8%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
            ++LFM         +  E   CE  S  F G C     C ++C TE   DG CRG R RC
Sbjct  12   LLLFMLL-----ATVTVEGRTCESSSNLFSGPCLSESNCANVCNTEGFPDGDCRGFRRRC  66

Query  115  MCIKNC  98
            MC + C
Sbjct  67   MCTRPC  72



>ref|XP_010038383.1| PREDICTED: uncharacterized protein LOC104426904 [Eucalyptus grandis]
Length=221

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 33/59 (56%), Gaps = 0/59 (0%)
 Frame = -3

Query  274  EXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            E G+  +   E  KCE  S KFKG+C  ++ C  + R E    G+C+G+R RC C K C
Sbjct  126  EKGKDVVSAYEGPKCESKSLKFKGMCISTRHCGLVWRDEGFEGGKCKGLRRRCFCFKAC  184



>ref|XP_008360020.1| PREDICTED: defensin-like protein 2 [Malus domestica]
Length=87

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 27/49 (55%), Gaps = 0/49 (0%)
 Frame = -3

Query  244  EAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            E   CEVPS  FKGLC  S  C+  CR E    G+C G+   C+C K C
Sbjct  39   EGKICEVPSTLFKGLCFSSNNCKHTCRKEQFTRGKCSGLTRTCVCTKKC  87



>gb|AIA67013.1| defensin [Triticum aestivum]
Length=76

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 30/53 (57%), Gaps = 0/53 (0%)
 Frame = -3

Query  256  ILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            + +A A  C+  S KFKG+C R   C S+C  E    G+C+G   RC C K+C
Sbjct  24   VQLALARDCQSKSFKFKGMCVRDDNCASVCLLEGFTGGKCKGFWHRCYCTKDC  76



>gb|ABK93231.1| unknown [Populus trichocarpa]
Length=75

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 31/65 (48%), Gaps = 0/65 (0%)
 Frame = -3

Query  292  MLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCM  113
             L +     +  ++  EA  C+  S  FKG C R   C  +CR E    G+C+G R RC 
Sbjct  11   FLLLIVLASQEVVVPTEARVCQSQSHYFKGPCARDHNCAWVCRNEGFSGGRCKGFRRRCF  70

Query  112  CIKNC  98
            C K C
Sbjct  71   CTKLC  75



>dbj|BAD25507.1| hypothetical protein [Oryza sativa Japonica Group]
Length=102

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 26/51 (51%), Gaps = 0/51 (0%)
 Frame = -3

Query  250  VAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            VA A  C  PS  F+GLCG    C + C  E    G C  +R +CMC K C
Sbjct  29   VAAAKMCHDPSQTFRGLCGHPTNCIACCTNEGYTGGYCTTVRHKCMCTKAC  79



>gb|AAR84643.1| defensin [Picea glauca]
Length=83

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 33/59 (56%), Gaps = 2/59 (3%)
 Frame = -3

Query  268  GRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQC--RGIRFRCMCIKNC  98
            G   + +AEA  C+ PSGKFKG+C  S  C+++C+TE    G C       +C C K C
Sbjct  24   GMMQLELAEARTCKTPSGKFKGVCASSNNCKNVCQTEGFPSGSCDFHVANRKCYCSKPC  82



>ref|XP_010513973.1| PREDICTED: defensin-like protein 1 [Camelina sativa]
Length=77

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 34/65 (52%), Gaps = 3/65 (5%)
 Frame = -3

Query  292  MLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCM  113
            MLF+    G  T+   EA  CE  S +F+G C     C ++C  E    G+CRG R RC 
Sbjct  16   MLFVATGMGPVTV---EARTCESKSHRFRGPCVSRHNCGNVCHNEGFSGGKCRGFRRRCF  72

Query  112  CIKNC  98
            C ++C
Sbjct  73   CTRHC  77



>ref|XP_004509604.1| PREDICTED: defensin-like protein P322-like [Cicer arietinum]
Length=78

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 32/66 (48%), Gaps = 0/66 (0%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
            VM  +        I VAEA  C+  S  FKG C    +C  +C+TE    GQC G+R  C
Sbjct  13   VMFLLLVATEMGPIKVAEARICDSQSNTFKGPCVIDHSCAIVCQTEGFTGGQCEGLRRIC  72

Query  115  MCIKNC  98
             C K C
Sbjct  73   FCTKPC  78



>ref|XP_006392063.1| hypothetical protein EUTSA_v10023787mg [Eutrema salsugineum]
 gb|ESQ29349.1| hypothetical protein EUTSA_v10023787mg [Eutrema salsugineum]
Length=79

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/66 (38%), Positives = 33/66 (50%), Gaps = 1/66 (2%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
            +ML +    G   + V EA  CE  S  F G C  +  C +IC  E   DG C+G R RC
Sbjct  15   IMLMLLLATGMGPVTV-EARMCESSSQLFNGPCLSTTNCANICHNEGFTDGDCQGFRRRC  73

Query  115  MCIKNC  98
            +C + C
Sbjct  74   ICTRPC  79



>ref|XP_004503912.1| PREDICTED: defensin-like protein-like [Cicer arietinum]
Length=76

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 28/53 (53%), Gaps = 0/53 (0%)
 Frame = -3

Query  256  ILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            +  AEA  CE  S +FKG C    TC   CR E    G CRG+R RC C + C
Sbjct  24   VKTAEARTCESRSHRFKGTCLSDTTCAHACRNEGFSGGDCRGLRRRCFCNRLC  76



>ref|XP_002325735.1| hypothetical protein POPTR_0019s00770g [Populus trichocarpa]
 gb|ABK93028.1| unknown [Populus trichocarpa]
 gb|ABK93041.1| unknown [Populus trichocarpa]
 gb|ABK93536.1| unknown [Populus trichocarpa]
 gb|ABK93961.1| unknown [Populus trichocarpa]
 gb|ABK94429.1| unknown [Populus trichocarpa]
 gb|ABK94555.1| unknown [Populus trichocarpa]
 gb|EEF00117.1| hypothetical protein POPTR_0019s00770g [Populus trichocarpa]
Length=74

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 30/53 (57%), Gaps = 0/53 (0%)
 Frame = -3

Query  256  ILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            ++ AEA  C   S  FKG C R   C S+C+TE    G+C+G R RC C K C
Sbjct  22   MVPAEARVCLSQSHSFKGPCVRGHNCASVCKTEGFPGGECKGFRRRCFCAKPC  74



>ref|XP_003599384.1| Defensin [Medicago truncatula]
 gb|AES69635.1| gamma-thionin/defensin [Medicago truncatula]
Length=80

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/66 (35%), Positives = 31/66 (47%), Gaps = 0/66 (0%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
            + L +  E     +   EA  C+  S  FKG+C     C ++C+TE    G C G R RC
Sbjct  15   LFLLVSTEMQPTHVEEPEARTCDSQSHSFKGVCWIKHNCANVCKTEGFTGGHCHGFRRRC  74

Query  115  MCIKNC  98
             C K C
Sbjct  75   FCSKPC  80



>ref|XP_007156390.1| hypothetical protein PHAVU_003G282400g [Phaseolus vulgaris]
 gb|ESW28384.1| hypothetical protein PHAVU_003G282400g [Phaseolus vulgaris]
Length=78

 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 33/64 (52%), Gaps = 2/64 (3%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
            ++L +  E G    +VAEA  CE  S   +G C   + C S CRTE    G CRG R RC
Sbjct  15   LLLLLATEMG--PRMVAEARGCESRSRHLRGKCESDENCASACRTERFSGGHCRGFRCRC  72

Query  115  MCIK  104
             C K
Sbjct  73   FCDK  76



>gb|ADQ43196.1| unknown [Schrenkiella parvula]
Length=76

 Score = 45.1 bits (105),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/66 (38%), Positives = 34/66 (52%), Gaps = 1/66 (2%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
            +++FM        + V EA  CE  S +FKG C     C ++C  E    G+CRG R RC
Sbjct  12   LLMFMIFVAAMGPVTV-EARTCESQSHRFKGKCLSDGNCGNVCHNEGFGGGKCRGFRRRC  70

Query  115  MCIKNC  98
             C +NC
Sbjct  71   FCTRNC  76



>gb|AFK47422.1| unknown [Lotus japonicus]
Length=74

 Score = 45.1 bits (105),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 27/53 (51%), Gaps = 0/53 (0%)
 Frame = -3

Query  256  ILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            ++  E   CE  S +F GLC     C S+C  E    G+CRG R RC C K C
Sbjct  22   VVQTEGRHCESKSHRFHGLCLSHHNCASVCHLEGFTGGKCRGFRKRCFCKKRC  74



>gb|AIA67014.1| defensin [Triticum aestivum]
Length=75

 Score = 45.1 bits (105),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/53 (40%), Positives = 30/53 (57%), Gaps = 0/53 (0%)
 Frame = -3

Query  256  ILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            ++ A+A +CE  S +F GLC  S  C  +C  E    G+C G++  CMC K C
Sbjct  23   VVPAQARECETESERFNGLCFVSANCAGVCNAEGFTGGKCSGLKRSCMCTKEC  75



>ref|XP_007226225.1| hypothetical protein PRUPE_ppa016594mg [Prunus persica]
 gb|EMJ27424.1| hypothetical protein PRUPE_ppa016594mg [Prunus persica]
Length=87

 Score = 45.1 bits (105),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 26/45 (58%), Gaps = 0/45 (0%)
 Frame = -3

Query  232  CEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            CE  S KFKG+C  S  C + C TE    GQCRG R RC C K C
Sbjct  43   CESQSQKFKGICFLSSNCATSCTTEGFNGGQCRGFRRRCFCSKAC  87



>gb|KEH35661.1| Defensin [Medicago truncatula]
Length=73

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 27/53 (51%), Gaps = 0/53 (0%)
 Frame = -3

Query  256  ILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            ++  E   CE  S +FKG+C     C S+C  E    G CRG R RC C K C
Sbjct  21   MVQTEGRHCESKSHRFKGMCMSDHNCASVCHVEGFPGGNCRGFRRRCFCKKRC  73



>gb|EPS67569.1| gamma-thionin, partial [Genlisea aurea]
Length=50

 Score = 44.7 bits (104),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 26/49 (53%), Gaps = 0/49 (0%)
 Frame = -3

Query  244  EAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            EA  CE  S  F+G C  +  C  +CR E   DG CRG R RC C K C
Sbjct  2    EARTCESQSNGFQGTCLSNHNCGLVCRNEGFSDGWCRGFRRRCFCTKAC  50



>ref|NP_001172824.1| Os02g0172500 [Oryza sativa Japonica Group]
 dbj|BAH91553.1| Os02g0172500 [Oryza sativa Japonica Group]
Length=93

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 26/51 (51%), Gaps = 0/51 (0%)
 Frame = -3

Query  250  VAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            VA A  C  PS  F+GLCG    C + C  E    G C  +R +CMC K C
Sbjct  20   VAAAKMCHDPSQTFRGLCGHPTNCIACCTNEGYTGGYCTTVRHKCMCTKAC  70



>ref|XP_006647552.1| PREDICTED: defensin-like protein P322-like [Oryza brachyantha]
Length=80

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 33/56 (59%), Gaps = 2/56 (4%)
 Frame = -3

Query  259  TILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCR--GIRFRCMCIKNC  98
            T  VAEA  C   S +FKG+C  S  C ++C+TE   DG+C+  G+  +C C K C
Sbjct  25   TTQVAEARHCLSQSHRFKGMCVSSNNCANVCKTENFPDGECKSHGLERKCFCKKLC  80



>gb|EMT00351.1| Defensin-like protein [Aegilops tauschii]
Length=82

 Score = 44.7 bits (104),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 32/61 (52%), Gaps = 2/61 (3%)
 Frame = -3

Query  274  EXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQC--RGIRFRCMCIKN  101
            E G  T  VAEA  C   S KFKG C  S  C  +CRTE   DG+C  + +  +C C K 
Sbjct  22   EMGATTTKVAEARDCLSQSFKFKGACLSSSNCAGVCRTENFPDGECHRQHLERKCFCKKP  81

Query  100  C  98
            C
Sbjct  82   C  82



>gb|AIC35288.1| defensin 4 [Pinus sylvestris]
Length=83

 Score = 44.7 bits (104),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 31/59 (53%), Gaps = 2/59 (3%)
 Frame = -3

Query  268  GRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQC--RGIRFRCMCIKNC  98
            G   + VAE   C+ PSGKFKG C  S  C+++CRTE    G C       +C C K C
Sbjct  24   GMMEVQVAEGRMCKTPSGKFKGYCVSSTNCKNVCRTEGFPTGSCDFHVASRKCYCYKPC  82



>ref|XP_010495961.1| PREDICTED: defensin-like protein 1 [Camelina sativa]
Length=77

 Score = 44.7 bits (104),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/65 (37%), Positives = 34/65 (52%), Gaps = 3/65 (5%)
 Frame = -3

Query  292  MLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCM  113
            M+F+    G  T+   EA  CE  S +F+G C     C ++C  E    G+CRG R RC 
Sbjct  16   MIFVATGMGPVTV---EARTCESKSHRFRGPCVSRHNCGNVCHNEGFSGGKCRGFRRRCF  72

Query  112  CIKNC  98
            C ++C
Sbjct  73   CTRHC  77



>dbj|BAK06284.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=100

 Score = 45.1 bits (105),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 29/50 (58%), Gaps = 0/50 (0%)
 Frame = -3

Query  247  AEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            A+A +CEV S +F GLC  S  C  +C  E    G+C G++  CMC K C
Sbjct  51   AQARECEVESERFNGLCFVSANCAGVCGAEGFTGGKCSGLKRSCMCTKQC  100



>gb|AGT51227.1| defensin [Brassica napus]
Length=77

 Score = 44.7 bits (104),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 34/66 (52%), Gaps = 3/66 (5%)
 Frame = -3

Query  295  VMLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRC  116
            +M+F+    G  T+   EA   E  S KF+G C     C ++C  E    G+CRG R RC
Sbjct  15   IMIFVASGMGPVTV---EARTSESKSHKFRGPCVSRHNCANVCHNEGFHGGKCRGFRRRC  71

Query  115  MCIKNC  98
             C ++C
Sbjct  72   YCTRHC  77



>gb|KFK26328.1| hypothetical protein AALP_AA8G233400 [Arabis alpina]
Length=78

 Score = 44.7 bits (104),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 27/52 (52%), Gaps = 0/52 (0%)
 Frame = -3

Query  253  LVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            +  EA  CE  S  F G C  +  C ++C  E   DG CRG R RC+C + C
Sbjct  27   VTVEARTCETSSQLFNGPCLSTTNCANVCHNEGFPDGDCRGFRRRCLCSRPC  78



>ref|XP_007033927.1| Scorpion toxin-like knottin superfamily protein [Theobroma cacao]
 gb|EOY04853.1| Scorpion toxin-like knottin superfamily protein [Theobroma cacao]
Length=141

 Score = 45.4 bits (106),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 26/50 (52%), Gaps = 0/50 (0%)
 Frame = -3

Query  247  AEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCMCIKNC  98
            AE   CE  S KFKG C     C  +CR E    G+CRG R RC C K C
Sbjct  92   AEGRVCESKSHKFKGPCLGDHNCALVCRNEGFSGGRCRGFRHRCFCTKLC  141



>gb|EMS49334.1| Defensin-like protein [Triticum urartu]
 gb|AIA66991.1| defensin [Triticum aestivum]
Length=82

 Score = 44.7 bits (104),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 33/61 (54%), Gaps = 2/61 (3%)
 Frame = -3

Query  274  EXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQC--RGIRFRCMCIKN  101
            E G  T  VAEA  C   S KFKG C  S  C ++CRTE   DG+C  + +  +C C + 
Sbjct  22   EMGTTTTKVAEARDCLSQSFKFKGACLSSSNCAAVCRTEKFPDGECHRQHLERKCFCKRP  81

Query  100  C  98
            C
Sbjct  82   C  82



>gb|EMT18782.1| Defensin-like protein [Aegilops tauschii]
Length=404

 Score = 47.4 bits (111),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 26/55 (47%), Positives = 29/55 (53%), Gaps = 2/55 (4%)
 Frame = -3

Query  268  GRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRF--RCMC  110
            G  T  VAEA  C   S KFKG C  S  C SICRTE    G+C+   F  +C C
Sbjct  2    GTPTRKVAEARDCLSKSHKFKGACLSSSNCASICRTENFPGGECKLDSFARKCFC  56



>ref|XP_003575412.1| PREDICTED: defensin Tm-AMP-D1.2-like [Brachypodium distachyon]
Length=80

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 33/56 (59%), Gaps = 2/56 (4%)
 Frame = -3

Query  259  TILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCR--GIRFRCMCIKNC  98
            T  VAEA  C   S KFKG C RS  C ++C+TE   DG+C+  G+  +C C + C
Sbjct  25   TTKVAEARHCLSQSHKFKGTCVRSGNCANVCKTENFPDGECKTQGLERKCFCKRVC  80



>ref|XP_004986852.1| PREDICTED: defensin SD2-like [Setaria italica]
Length=100

 Score = 44.7 bits (104),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 27/51 (53%), Gaps = 2/51 (4%)
 Frame = -3

Query  244  EAGKCEVPSGKFKGLCGRSKTCRSICRTE--VXXDGQCRGIRFRCMCIKNC  98
            EAG+C   S  FKGLC  S +C   C  E      G+CRGI F C CI  C
Sbjct  28   EAGECLSQSTTFKGLCLDSDSCNDKCLQESNAYSGGKCRGIHFTCWCITPC  78



>ref|XP_011001251.1| PREDICTED: defensin-like protein 1 [Populus euphratica]
Length=75

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 30/65 (46%), Gaps = 0/65 (0%)
 Frame = -3

Query  292  MLFMXXEXGRXTILVAEAGKCEVPSGKFKGLCGRSKTCRSICRTEVXXDGQCRGIRFRCM  113
             L +     +  ++  EA  C   S  FKG C R   C  +CR E    G+C+G R RC 
Sbjct  11   FLLLIVLASQEVVVPTEARVCLSQSHYFKGPCARDHNCAWVCRNEGFSGGRCKGFRRRCF  70

Query  112  CIKNC  98
            C K C
Sbjct  71   CTKLC  75



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 565659253830