BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF009O22

Length=358
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006342637.1|  PREDICTED: polyadenylate-binding protein 8-like    109   4e-25   
ref|XP_004252758.1|  PREDICTED: polyadenylate-binding protein 2-like    109   5e-25   Solanum lycopersicum
ref|XP_011074396.1|  PREDICTED: polyadenylate-binding protein 8-like    106   4e-24   Sesamum indicum [beniseed]
ref|XP_011074395.1|  PREDICTED: polyadenylate-binding protein 8-like    106   5e-24   Sesamum indicum [beniseed]
gb|AAF66825.1|  poly(A)-binding protein                                 103   2e-23   Nicotiana tabacum [American tobacco]
ref|XP_009606598.1|  PREDICTED: polyadenylate-binding protein 2-l...    103   4e-23   Nicotiana tomentosiformis
ref|XP_009606599.1|  PREDICTED: polyadenylate-binding protein 2-l...    103   4e-23   Nicotiana tomentosiformis
dbj|BAM15222.1|  poly(A)-binding protein                                103   4e-23   Nicotiana tabacum [American tobacco]
ref|XP_009782956.1|  PREDICTED: polyadenylate-binding protein 2-l...    103   4e-23   Nicotiana sylvestris
ref|XP_009782955.1|  PREDICTED: polyadenylate-binding protein 2-l...    103   4e-23   Nicotiana sylvestris
emb|CAJ38367.1|  polyA-binding protein                                97.4    1e-21   Plantago major [cart-track plant]
ref|XP_009775186.1|  PREDICTED: polyadenylate-binding protein 2-like  99.4    2e-21   Nicotiana sylvestris
gb|AAK30205.1|AF349964_1  poly(A)-binding protein                     98.6    3e-21   Daucus carota [carrots]
gb|EPS62510.1|  hypothetical protein M569_12280                       94.4    6e-20   Genlisea aurea
ref|XP_010270544.1|  PREDICTED: polyadenylate-binding protein 2-l...  93.6    2e-19   Nelumbo nucifera [Indian lotus]
ref|XP_010270536.1|  PREDICTED: polyadenylate-binding protein 2-l...  93.6    2e-19   Nelumbo nucifera [Indian lotus]
gb|AAF63202.1|AF240679_1  poly(A)-binding protein                     92.4    6e-19   Cucumis sativus [cucumbers]
ref|XP_004136969.1|  PREDICTED: polyadenylate-binding protein 2-like  92.4    6e-19   
ref|XP_008454965.1|  PREDICTED: polyadenylate-binding protein 2       92.0    6e-19   Cucumis melo [Oriental melon]
ref|XP_002283105.1|  PREDICTED: polyadenylate-binding protein 2       92.0    6e-19   Vitis vinifera
ref|XP_003607922.1|  Poly(A)-binding protein                          90.9    1e-18   Medicago truncatula
ref|XP_008456143.1|  PREDICTED: polyadenylate-binding protein 8-l...  90.5    2e-18   Cucumis melo [Oriental melon]
ref|XP_004161443.1|  PREDICTED: LOW QUALITY PROTEIN: polyadenylat...  90.5    2e-18   
ref|XP_002285190.1|  PREDICTED: polyadenylate-binding protein 2       90.9    2e-18   Vitis vinifera
ref|XP_008456142.1|  PREDICTED: polyadenylate-binding protein 2-l...  90.9    2e-18   Cucumis melo [Oriental melon]
ref|XP_004140705.1|  PREDICTED: polyadenylate-binding protein 2-like  90.5    2e-18   Cucumis sativus [cucumbers]
ref|XP_003544466.1|  PREDICTED: polyadenylate-binding protein 8-like  90.1    3e-18   Glycine max [soybeans]
ref|XP_010107907.1|  Polyadenylate-binding protein 2                  89.4    5e-18   Morus notabilis
ref|XP_007160868.1|  hypothetical protein PHAVU_001G023500g           89.4    6e-18   Phaseolus vulgaris [French bean]
ref|XP_004499044.1|  PREDICTED: polyadenylate-binding protein 2-l...  88.6    1e-17   Cicer arietinum [garbanzo]
gb|KHG12838.1|  ELAV-like protein 2                                   87.4    3e-17   Gossypium arboreum [tree cotton]
gb|KJB79363.1|  hypothetical protein B456_013G046000                  87.0    3e-17   Gossypium raimondii
gb|KJB79366.1|  hypothetical protein B456_013G046000                  87.0    3e-17   Gossypium raimondii
gb|KHN12798.1|  Polyadenylate-binding protein 2                       86.3    6e-17   Glycine soja [wild soybean]
ref|XP_006855143.1|  hypothetical protein AMTR_s00051p00026490        86.3    7e-17   Amborella trichopoda
ref|XP_003550332.1|  PREDICTED: polyadenylate-binding protein 8-like  86.3    8e-17   Glycine max [soybeans]
ref|XP_003529405.1|  PREDICTED: polyadenylate-binding protein 8-like  85.9    8e-17   Glycine max [soybeans]
gb|KJB32340.1|  hypothetical protein B456_005G236500                  85.5    1e-16   Gossypium raimondii
gb|KHG19377.1|  Polyadenylate-binding protein 1-like 2                85.5    1e-16   Gossypium arboreum [tree cotton]
gb|KHN05826.1|  Polyadenylate-binding protein 2                       85.5    1e-16   Glycine soja [wild soybean]
ref|XP_006574897.1|  PREDICTED: polyadenylate-binding protein 8-like  85.5    1e-16   Glycine max [soybeans]
gb|EMS55649.1|  Polyadenylate-binding protein 2                       85.1    2e-16   Triticum urartu
gb|EMT14398.1|  Polyadenylate-binding protein 2                       85.1    2e-16   
gb|EPS61401.1|  hypothetical protein M569_13396                       84.7    2e-16   Genlisea aurea
dbj|BAJ96406.1|  predicted protein                                    85.1    2e-16   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAB38974.1|  poly(A)-binding protein                               84.7    2e-16   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009768210.1|  PREDICTED: polyadenylate-binding protein 8-like  84.0    4e-16   Nicotiana sylvestris
ref|XP_009386706.1|  PREDICTED: polyadenylate-binding protein 2-l...  83.6    6e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009386705.1|  PREDICTED: polyadenylate-binding protein 2-l...  83.6    7e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009386708.1|  PREDICTED: polyadenylate-binding protein 2-l...  83.6    7e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009386707.1|  PREDICTED: polyadenylate-binding protein 2-l...  83.2    7e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006346392.1|  PREDICTED: polyadenylate-binding protein 8-like  82.8    1e-15   Solanum tuberosum [potatoes]
ref|XP_009600995.1|  PREDICTED: polyadenylate-binding protein 8-like  82.8    1e-15   Nicotiana tomentosiformis
gb|AAF66824.1|AF190656_1  poly(A)-binding protein                     80.5    1e-15   Nicotiana tabacum [American tobacco]
emb|CAN61506.1|  hypothetical protein VITISV_011738                   81.3    2e-15   Vitis vinifera
ref|XP_009613515.1|  PREDICTED: polyadenylate-binding protein 2-like  82.4    2e-15   Nicotiana tomentosiformis
gb|KJB29450.1|  hypothetical protein B456_005G101600                  82.0    2e-15   Gossypium raimondii
ref|XP_003589160.1|  Polyadenylate-binding protein                    81.6    3e-15   Medicago truncatula
ref|XP_004956317.1|  PREDICTED: polyadenylate-binding protein 2-like  81.6    3e-15   Setaria italica
gb|AFP74112.1|  poly-A binding protein                                81.6    3e-15   Nicotiana benthamiana
gb|ADE76290.1|  unknown                                               79.0    3e-15   Picea sitchensis
gb|KCW66377.1|  hypothetical protein EUGRSUZ_F00193                   80.5    4e-15   Eucalyptus grandis [rose gum]
dbj|BAJ53195.1|  JHL03K20.4                                           80.9    5e-15   Jatropha curcas
gb|KCW66375.1|  hypothetical protein EUGRSUZ_F00193                   80.9    6e-15   Eucalyptus grandis [rose gum]
ref|XP_003576878.1|  PREDICTED: polyadenylate-binding protein 2-like  80.9    6e-15   Brachypodium distachyon [annual false brome]
ref|XP_010059905.1|  PREDICTED: polyadenylate-binding protein 2-like  80.5    6e-15   Eucalyptus grandis [rose gum]
ref|XP_004230758.1|  PREDICTED: polyadenylate-binding protein 8-like  79.7    1e-14   Solanum lycopersicum
ref|XP_009415843.1|  PREDICTED: polyadenylate-binding protein 2-like  79.3    2e-14   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS71660.1|  hypothetical protein M569_03099                       74.7    3e-14   Genlisea aurea
ref|XP_010093503.1|  Polyadenylate-binding protein 2                  77.8    6e-14   Morus notabilis
ref|XP_003573691.1|  PREDICTED: polyadenylate-binding protein 2-like  77.4    9e-14   Brachypodium distachyon [annual false brome]
ref|XP_006434727.1|  hypothetical protein CICLE_v10000537mg           77.4    1e-13   Citrus clementina [clementine]
ref|XP_006374904.1|  hypothetical protein POPTR_0014s02550g           77.0    1e-13   Populus trichocarpa [western balsam poplar]
ref|XP_011029544.1|  PREDICTED: polyadenylate-binding protein 2-like  77.0    1e-13   Populus euphratica
ref|XP_008651618.1|  PREDICTED: uncharacterized protein LOC100381...  77.0    1e-13   
ref|NP_001167831.1|  uncharacterized protein LOC100381531             74.3    1e-13   
ref|XP_007201197.1|  hypothetical protein PRUPE_ppa002607mg           76.6    2e-13   Prunus persica
ref|XP_008236485.1|  PREDICTED: polyadenylate-binding protein 8       76.6    2e-13   Prunus mume [ume]
ref|XP_002510185.1|  polyadenylate-binding protein, putative          76.3    2e-13   Ricinus communis
ref|XP_009395913.1|  PREDICTED: polyadenylate-binding protein 2-like  76.3    2e-13   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAQ56324.1|  putative poly(A)-binding protein                      73.6    2e-13   Oryza sativa Japonica Group [Japonica rice]
gb|EEC83349.1|  hypothetical protein OsI_28748                        73.6    2e-13   Oryza sativa Indica Group [Indian rice]
ref|NP_001168063.1|  uncharacterized protein LOC100381794             73.2    2e-13   
ref|XP_009408013.1|  PREDICTED: polyadenylate-binding protein 2-like  76.3    2e-13   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEE68458.1|  hypothetical protein OsJ_26852                        73.6    2e-13   Oryza sativa Japonica Group [Japonica rice]
gb|AAB61594.1|  poly(A)-binding protein                               72.4    3e-13   Mesembryanthemum crystallinum
ref|NP_001061515.1|  Os08g0314800                                     75.5    4e-13   
gb|KDO84109.1|  hypothetical protein CISIN_1g006282mg                 75.1    4e-13   Citrus sinensis [apfelsine]
ref|XP_009398670.1|  PREDICTED: polyadenylate-binding protein 2-like  75.5    4e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010263472.1|  PREDICTED: polyadenylate-binding protein 2-like  75.1    5e-13   Nelumbo nucifera [Indian lotus]
gb|KDO84108.1|  hypothetical protein CISIN_1g006282mg                 75.1    5e-13   Citrus sinensis [apfelsine]
gb|KDO84110.1|  hypothetical protein CISIN_1g006282mg                 74.7    5e-13   Citrus sinensis [apfelsine]
ref|XP_006659302.1|  PREDICTED: polyadenylate-binding protein 8-like  75.1    5e-13   Oryza brachyantha
tpg|DAA39543.1|  TPA: hypothetical protein ZEAMMB73_983793            72.4    6e-13   
ref|XP_006473293.1|  PREDICTED: polyadenylate-binding protein 8-like  75.1    6e-13   Citrus sinensis [apfelsine]
gb|KDO84107.1|  hypothetical protein CISIN_1g006282mg                 75.1    6e-13   Citrus sinensis [apfelsine]
ref|XP_008220252.1|  PREDICTED: polyadenylate-binding protein 2-like  74.7    7e-13   Prunus mume [ume]
ref|XP_007226962.1|  hypothetical protein PRUPE_ppa002618mg           74.7    7e-13   Prunus persica
ref|XP_002284923.1|  PREDICTED: polyadenylate-binding protein 8 i...  74.3    9e-13   Vitis vinifera
ref|NP_564554.1|  poly(A) binding protein 8                           74.3    9e-13   Arabidopsis thaliana [mouse-ear cress]
tpg|DAA39541.1|  TPA: hypothetical protein ZEAMMB73_983793            74.3    1e-12   
tpg|DAA39542.1|  TPA: hypothetical protein ZEAMMB73_983793            74.3    1e-12   
gb|EEE61291.1|  hypothetical protein OsJ_15377                        73.9    1e-12   Oryza sativa Japonica Group [Japonica rice]
gb|AFW58788.1|  hypothetical protein ZEAMMB73_448418                  71.2    1e-12   
ref|XP_009147891.1|  PREDICTED: polyadenylate-binding protein 8       73.9    2e-12   Brassica rapa
ref|XP_010691731.1|  PREDICTED: polyadenylate-binding protein 2-like  73.6    2e-12   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002313862.1|  polyadenylate-binding family protein             73.6    2e-12   
ref|XP_002448132.1|  hypothetical protein SORBIDRAFT_06g021850        73.6    2e-12   Sorghum bicolor [broomcorn]
ref|XP_008663371.1|  PREDICTED: polyadenylate-binding protein 2-like  73.6    2e-12   
emb|CDY54068.1|  BnaCnng26160D                                        73.6    2e-12   Brassica napus [oilseed rape]
gb|EEC77593.1|  hypothetical protein OsI_16552                        73.6    2e-12   Oryza sativa Indica Group [Indian rice]
ref|NP_001053248.1|  Os04g0504800                                     73.6    2e-12   
emb|CAE02947.3|  OSJNBa0014K14.19                                     73.6    2e-12   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001151785.1|  LOC100285420                                     73.2    2e-12   Zea mays [maize]
ref|XP_002301171.2|  hypothetical protein POPTR_0002s12570g           73.2    2e-12   Populus trichocarpa [western balsam poplar]
emb|CDP01307.1|  unnamed protein product                              73.2    3e-12   Coffea canephora [robusta coffee]
ref|XP_004304018.1|  PREDICTED: polyadenylate-binding protein 8-like  72.8    4e-12   Fragaria vesca subsp. vesca
ref|XP_008347611.1|  PREDICTED: polyadenylate-binding protein 8-like  69.7    4e-12   
ref|XP_008364810.1|  PREDICTED: polyadenylate-binding protein 8-like  72.4    4e-12   
ref|XP_002518733.1|  polyadenylate-binding protein, putative          72.4    4e-12   Ricinus communis
gb|ABK94932.1|  unknown                                               71.6    4e-12   Populus trichocarpa [western balsam poplar]
gb|EYU37653.1|  hypothetical protein MIMGU_mgv1a002809mg              72.4    5e-12   Erythranthe guttata [common monkey flower]
ref|XP_006421219.1|  hypothetical protein CICLE_v10007158mg           71.6    5e-12   
ref|XP_006404818.1|  hypothetical protein EUTSA_v10000075mg           72.0    5e-12   Eutrema salsugineum [saltwater cress]
ref|XP_008378021.1|  PREDICTED: polyadenylate-binding protein 2-like  72.0    6e-12   
ref|XP_008393785.1|  PREDICTED: polyadenylate-binding protein 2-like  71.6    8e-12   
ref|XP_009359888.1|  PREDICTED: polyadenylate-binding protein 2-like  71.6    8e-12   Pyrus x bretschneideri [bai li]
ref|XP_002891531.1|  PAB8 binding protein 8                           71.6    8e-12   Arabidopsis lyrata subsp. lyrata
ref|XP_007153579.1|  hypothetical protein PHAVU_003G0475001g          71.2    1e-11   Phaseolus vulgaris [French bean]
ref|XP_010928350.1|  PREDICTED: polyadenylate-binding protein 8-l...  71.2    1e-11   Elaeis guineensis
ref|XP_010928349.1|  PREDICTED: polyadenylate-binding protein 2-l...  71.2    1e-11   Elaeis guineensis
ref|XP_011017176.1|  PREDICTED: polyadenylate-binding protein 8-like  71.2    1e-11   Populus euphratica
ref|XP_008373847.1|  PREDICTED: polyadenylate-binding protein 8-like  70.9    1e-11   
dbj|BAJ97269.1|  predicted protein                                    70.1    2e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ90169.1|  predicted protein                                    70.1    2e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006393217.1|  hypothetical protein EUTSA_v10011289mg           70.1    3e-11   Eutrema salsugineum [saltwater cress]
gb|EYU36333.1|  hypothetical protein MIMGU_mgv1a002664mg              69.7    4e-11   Erythranthe guttata [common monkey flower]
ref|XP_008795896.1|  PREDICTED: polyadenylate-binding protein 2-like  69.7    4e-11   Phoenix dactylifera
gb|AGF69179.1|  polyadenylate-binding protein 2-like protein          69.3    4e-11   Triticum aestivum [Canadian hard winter wheat]
gb|KFK32750.1|  poly binding protein                                  69.3    5e-11   Arabis alpina [alpine rockcress]
gb|EMS47633.1|  Polyadenylate-binding protein 2                       68.9    5e-11   Triticum urartu
gb|KFK35979.1|  hypothetical protein AALP_AA4G062600                  69.3    6e-11   Arabis alpina [alpine rockcress]
dbj|BAJ86310.1|  predicted protein                                    68.9    7e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010527159.1|  PREDICTED: polyadenylate-binding protein 4-like  68.6    8e-11   Tarenaya hassleriana [spider flower]
gb|EMT11581.1|  Polyadenylate-binding protein 2                       65.9    8e-11   
gb|EMT03423.1|  Polyadenylate-binding protein 2                       68.6    9e-11   
gb|AFG69765.1|  hypothetical protein CL4424Contig1_01                 63.9    9e-11   Pinus taeda
ref|XP_010526963.1|  PREDICTED: polyadenylate-binding protein 2-like  68.6    1e-10   Tarenaya hassleriana [spider flower]
ref|XP_007042478.1|  Poly(A) binding protein 8                        68.2    1e-10   
gb|AEW09165.1|  hypothetical protein CL4424Contig1_01                 63.9    1e-10   Pinus radiata
gb|KJB40266.1|  hypothetical protein B456_007G054700                  68.2    1e-10   Gossypium raimondii
ref|XP_008788846.1|  PREDICTED: polyadenylate-binding protein 2-like  68.2    1e-10   Phoenix dactylifera
ref|XP_003580095.1|  PREDICTED: polyadenylate-binding protein 2-like  67.8    2e-10   Brachypodium distachyon [annual false brome]
emb|CDO97198.1|  unnamed protein product                              67.8    2e-10   Coffea canephora [robusta coffee]
emb|CDO97200.1|  unnamed protein product                              67.8    2e-10   Coffea canephora [robusta coffee]
gb|KJB40263.1|  hypothetical protein B456_007G054700                  67.8    2e-10   Gossypium raimondii
ref|XP_010531254.1|  PREDICTED: polyadenylate-binding protein 4       67.4    2e-10   Tarenaya hassleriana [spider flower]
gb|KJB40264.1|  hypothetical protein B456_007G054700                  67.4    2e-10   Gossypium raimondii
ref|XP_010447142.1|  PREDICTED: polyadenylate-binding protein 2-like  67.4    2e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010432464.1|  PREDICTED: polyadenylate-binding protein 2-like  67.4    2e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010437669.1|  PREDICTED: polyadenylate-binding protein 2-like  67.4    2e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010432462.1|  PREDICTED: polyadenylate-binding protein 2-l...  67.0    3e-10   Camelina sativa [gold-of-pleasure]
ref|XP_011000130.1|  PREDICTED: polyadenylate-binding protein 8-like  67.0    3e-10   Populus euphratica
ref|XP_002300227.1|  polyadenylate-binding family protein             67.0    3e-10   Populus trichocarpa [western balsam poplar]
ref|XP_006295403.1|  hypothetical protein CARUB_v10024499mg           67.0    3e-10   Capsella rubella
gb|AID60122.1|  poly(A) binding protein 8                             67.0    3e-10   Brassica napus [oilseed rape]
ref|XP_010555994.1|  PREDICTED: polyadenylate-binding protein 8       67.0    3e-10   Tarenaya hassleriana [spider flower]
emb|CDX75397.1|  BnaA01g03050D                                        67.0    3e-10   
ref|XP_011000826.1|  PREDICTED: polyadenylate-binding protein 8-like  67.0    3e-10   Populus euphratica
gb|KJB14633.1|  hypothetical protein B456_002G134900                  66.6    4e-10   Gossypium raimondii
gb|KJB14629.1|  hypothetical protein B456_002G134900                  66.6    4e-10   Gossypium raimondii
gb|KHG25571.1|  Polyadenylate-binding protein 1-like 2                66.6    4e-10   Gossypium arboreum [tree cotton]
ref|XP_006283328.1|  hypothetical protein CARUB_v10004368mg           66.6    4e-10   Capsella rubella
emb|CDX69025.1|  BnaC01g04280D                                        66.6    4e-10   
ref|XP_010110808.1|  Polyadenylate-binding protein 2                  66.2    5e-10   Morus notabilis
gb|KJB58541.1|  hypothetical protein B456_009G214100                  66.2    5e-10   Gossypium raimondii
ref|XP_006422975.1|  hypothetical protein CICLE_v10027999mg           66.2    6e-10   Citrus clementina [clementine]
ref|XP_010447143.1|  PREDICTED: polyadenylate-binding protein 2       66.2    6e-10   Camelina sativa [gold-of-pleasure]
ref|XP_002878680.1|  PAB4 binding protein 4                           66.2    6e-10   Arabidopsis lyrata subsp. lyrata
dbj|BAD94406.1|  putative poly(A) binding protein                     62.8    7e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002869174.1|  predicted protein                                65.9    7e-10   
ref|XP_010530761.1|  PREDICTED: LOW QUALITY PROTEIN: polyadenylat...  65.9    9e-10   Tarenaya hassleriana [spider flower]
gb|KCW55175.1|  hypothetical protein EUGRSUZ_I01129                   65.1    1e-09   Eucalyptus grandis [rose gum]
ref|XP_010417088.1|  PREDICTED: polyadenylate-binding protein 4-like  65.5    1e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010028424.1|  PREDICTED: polyadenylate-binding protein 2       65.1    1e-09   Eucalyptus grandis [rose gum]
ref|XP_007017178.1|  Poly(A) binding protein 8 isoform 1              65.1    1e-09   
ref|XP_007047341.1|  Poly(A) binding protein 8                        65.1    2e-09   
emb|CDY62723.1|  BnaC03g77220D                                        64.7    2e-09   Brassica napus [oilseed rape]
ref|XP_009108756.1|  PREDICTED: polyadenylate-binding protein 2       64.7    2e-09   Brassica rapa
emb|CDY51957.1|  BnaA08g11610D                                        64.7    2e-09   Brassica napus [oilseed rape]
ref|XP_004499046.1|  PREDICTED: polyadenylate-binding protein 2-l...  64.3    2e-09   
emb|CDY36634.1|  BnaA07g04230D                                        64.3    2e-09   Brassica napus [oilseed rape]
emb|CDX71223.1|  BnaC07g05020D                                        64.3    2e-09   
emb|CDX89562.1|  BnaC04g35810D                                        64.3    3e-09   
gb|KFK40021.1|  hypothetical protein AALP_AA3G319900                  64.3    3e-09   Arabis alpina [alpine rockcress]
ref|XP_009117148.1|  PREDICTED: polyadenylate-binding protein 2       63.9    3e-09   Brassica rapa
ref|NP_179916.1|  poly(A) binding protein 4                           63.9    3e-09   Arabidopsis thaliana [mouse-ear cress]
emb|CBI19492.3|  unnamed protein product                              60.8    3e-09   Vitis vinifera
gb|AAK25927.1|AF360217_1  putative poly(A) binding protein            63.9    3e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010519297.1|  PREDICTED: polyadenylate-binding protein 8-like  63.9    3e-09   Tarenaya hassleriana [spider flower]
ref|XP_006412276.1|  hypothetical protein EUTSA_v10024683mg           63.9    4e-09   
ref|XP_006412275.1|  hypothetical protein EUTSA_v10024683mg           63.9    4e-09   Eutrema salsugineum [saltwater cress]
ref|XP_006425948.1|  hypothetical protein CICLE_v10025109mg           63.5    4e-09   Citrus clementina [clementine]
ref|NP_001275799.1|  poly A-binding protein 2                         63.5    4e-09   Citrus sinensis [apfelsine]
ref|XP_006425947.1|  hypothetical protein CICLE_v10025109mg           63.5    4e-09   
dbj|BAJ53194.1|  JHL03K20.3                                           63.5    5e-09   Jatropha curcas
ref|XP_006494495.1|  PREDICTED: polyadenylate-binding protein 4       63.5    5e-09   
ref|XP_006409548.1|  hypothetical protein EUTSA_v10022589mg           63.5    5e-09   Eutrema salsugineum [saltwater cress]
gb|KDO79129.1|  hypothetical protein CISIN_1g006290mg                 63.5    5e-09   Citrus sinensis [apfelsine]
ref|XP_004505404.1|  PREDICTED: polyadenylate-binding protein 2-like  63.5    5e-09   
gb|KHG04753.1|  Polyadenylate-binding 2 -like protein                 63.5    5e-09   Gossypium arboreum [tree cotton]
gb|KFK30042.1|  hypothetical protein AALP_AA7G209600                  63.5    5e-09   Arabis alpina [alpine rockcress]
gb|EYU36334.1|  hypothetical protein MIMGU_mgv1a002624mg              63.5    5e-09   Erythranthe guttata [common monkey flower]
pdb|2DYD|A  Chain A, Solution Structure Of The Pabc Domain From T...  59.3    5e-09   Triticum aestivum [Canadian hard winter wheat]
emb|CDY38939.1|  BnaA04g13600D                                        63.2    6e-09   Brassica napus [oilseed rape]
ref|XP_009140459.1|  PREDICTED: polyadenylate-binding protein 4-like  63.2    6e-09   Brassica rapa
gb|KHG04776.1|  Polyadenylate-binding 2 -like protein                 63.2    6e-09   Gossypium arboreum [tree cotton]
gb|KHN22334.1|  Polyadenylate-binding protein 2                       63.2    6e-09   Glycine soja [wild soybean]
ref|XP_003525892.1|  PREDICTED: polyadenylate-binding protein 8-like  63.2    7e-09   Glycine max [soybeans]
emb|CDX79295.1|  BnaC06g20080D                                        58.9    1e-08   
ref|XP_011092553.1|  PREDICTED: polyadenylate-binding protein 2-like  62.4    1e-08   Sesamum indicum [beniseed]
ref|XP_009119410.1|  PREDICTED: polyadenylate-binding protein 2       62.4    1e-08   Brassica rapa
gb|EYU42687.1|  hypothetical protein MIMGU_mgv1a002746mg              62.4    1e-08   Erythranthe guttata [common monkey flower]
gb|KJB14632.1|  hypothetical protein B456_002G134900                  62.0    1e-08   Gossypium raimondii
ref|NP_001062583.1|  Os09g0115400                                     62.0    1e-08   
ref|XP_009136273.1|  PREDICTED: polyadenylate-binding protein 2-l...  62.0    2e-08   Brassica rapa
ref|XP_009136272.1|  PREDICTED: polyadenylate-binding protein 2-l...  62.0    2e-08   Brassica rapa
ref|XP_006661030.1|  PREDICTED: polyadenylate-binding protein 8-like  61.6    2e-08   
dbj|BAD94856.1|  poly(A)-binding protein                              58.5    2e-08   Arabidopsis thaliana [mouse-ear cress]
gb|KDP31970.1|  hypothetical protein JCGZ_12431                       61.6    2e-08   Jatropha curcas
emb|CDY08990.1|  BnaC01g31010D                                        57.4    3e-08   Brassica napus [oilseed rape]
gb|KHG16756.1|  Polyadenylate-binding 2 -like protein                 60.8    3e-08   Gossypium arboreum [tree cotton]
ref|XP_010429282.1|  PREDICTED: polyadenylate-binding protein 4       60.8    3e-08   Camelina sativa [gold-of-pleasure]
emb|CDX89664.1|  BnaC03g45780D                                        60.8    4e-08   
emb|CBI32381.3|  unnamed protein product                              60.8    5e-08   Vitis vinifera
ref|XP_002863435.1|  predicted protein                                59.7    5e-08   
gb|KHN04485.1|  Polyadenylate-binding protein 2                       60.1    6e-08   Glycine soja [wild soybean]
ref|XP_006578034.1|  PREDICTED: polyadenylate-binding protein 8 i...  60.1    6e-08   Glycine max [soybeans]
ref|XP_006578033.1|  PREDICTED: polyadenylate-binding protein 8 i...  60.1    6e-08   Glycine max [soybeans]
ref|XP_003523956.1|  PREDICTED: polyadenylate-binding protein 8 i...  60.1    6e-08   Glycine max [soybeans]
gb|KJB32341.1|  hypothetical protein B456_005G236500                  59.7    8e-08   Gossypium raimondii
gb|AFK34295.1|  unknown                                               56.2    9e-08   Medicago truncatula
gb|AAL86321.1|  putative poly(A)-binding protein                      59.3    1e-07   Arabidopsis thaliana [mouse-ear cress]
ref|NP_195137.5|  polyadenylate-binding protein 2                     59.3    1e-07   Arabidopsis thaliana [mouse-ear cress]
emb|CDY67364.1|  BnaA03g57630D                                        57.8    2e-07   Brassica napus [oilseed rape]
ref|XP_004978120.1|  PREDICTED: polyadenylate-binding protein 2-like  58.5    2e-07   
ref|XP_010688794.1|  PREDICTED: polyadenylate-binding protein 2-like  58.2    3e-07   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010906556.1|  PREDICTED: polyadenylate-binding protein 2-l...  58.2    3e-07   Elaeis guineensis
ref|XP_010906557.1|  PREDICTED: polyadenylate-binding protein 8-l...  57.8    3e-07   
ref|XP_002307526.2|  hypothetical protein POPTR_0005s22040g           57.8    4e-07   
ref|XP_011044832.1|  PREDICTED: polyadenylate-binding protein 3-like  57.8    4e-07   Populus euphratica
ref|XP_010261307.1|  PREDICTED: LOW QUALITY PROTEIN: polyadenylat...  57.8    5e-07   
ref|XP_011092554.1|  PREDICTED: polyadenylate-binding protein 2-like  57.4    5e-07   Sesamum indicum [beniseed]
ref|XP_003603074.1|  Poly(A)-binding protein                          57.0    7e-07   Medicago truncatula
ref|XP_006842170.1|  hypothetical protein AMTR_s00078p00149860        57.0    7e-07   
ref|XP_008787484.1|  PREDICTED: polyadenylate-binding protein 2-like  57.0    9e-07   
gb|KCW66376.1|  hypothetical protein EUGRSUZ_F00193                   56.2    1e-06   Eucalyptus grandis [rose gum]
ref|XP_007201196.1|  hypothetical protein PRUPE_ppa002584mg           56.2    1e-06   Prunus persica
ref|XP_008237538.1|  PREDICTED: polyadenylate-binding protein 3-like  56.2    2e-06   
ref|XP_009342699.1|  PREDICTED: polyadenylate-binding protein 3       54.7    4e-06   Pyrus x bretschneideri [bai li]
gb|KJB63886.1|  hypothetical protein B456_010G021800                  54.7    5e-06   Gossypium raimondii
gb|KJB63885.1|  hypothetical protein B456_010G021800                  54.3    5e-06   Gossypium raimondii
ref|XP_006406512.1|  hypothetical protein EUTSA_v10020750mg           53.9    6e-06   
ref|XP_009335160.1|  PREDICTED: polyadenylate-binding protein 3       53.5    1e-05   
ref|XP_008337230.1|  PREDICTED: polyadenylate-binding protein 3-like  53.5    1e-05   
ref|XP_010089427.1|  Polyadenylate-binding protein 3                  53.1    1e-05   
ref|XP_011459765.1|  PREDICTED: LOW QUALITY PROTEIN: polyadenylat...  53.1    1e-05   Fragaria vesca subsp. vesca
ref|XP_004496415.1|  PREDICTED: polyadenylate-binding protein 3-l...  52.8    2e-05   Cicer arietinum [garbanzo]
ref|XP_004496416.1|  PREDICTED: polyadenylate-binding protein 3-l...  52.8    2e-05   Cicer arietinum [garbanzo]
ref|XP_009402160.1|  PREDICTED: polyadenylate-binding protein 5-like  52.8    2e-05   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX92325.1|  BnaA05g20820D                                        51.6    2e-05   
ref|XP_002985732.1|  hypothetical protein SELMODRAFT_122762           52.4    3e-05   
ref|XP_002974435.1|  hypothetical protein SELMODRAFT_101161           52.4    3e-05   
ref|XP_010645822.1|  PREDICTED: LOW QUALITY PROTEIN: polyadenylat...  52.0    3e-05   
emb|CBI29360.3|  unnamed protein product                              52.0    3e-05   Vitis vinifera
emb|CAN75447.1|  hypothetical protein VITISV_030926                   52.0    3e-05   Vitis vinifera
gb|KDO83840.1|  hypothetical protein CISIN_1g006641mg                 52.0    3e-05   Citrus sinensis [apfelsine]
ref|XP_006434548.1|  hypothetical protein CICLE_v10003530mg           52.0    4e-05   Citrus clementina [clementine]
ref|XP_007140277.1|  hypothetical protein PHAVU_008G098700g           51.6    4e-05   Phaseolus vulgaris [French bean]
ref|XP_008456718.1|  PREDICTED: polyadenylate-binding protein 3       51.2    5e-05   
ref|XP_004291087.1|  PREDICTED: polyadenylate-binding protein 2-like  51.2    6e-05   
ref|XP_002527095.1|  polyadenylate-binding protein, putative          51.2    6e-05   
gb|EYU24331.1|  hypothetical protein MIMGU_mgv1a025142mg              51.2    6e-05   
ref|XP_007011217.1|  Poly(A) binding 8-like protein                   48.9    9e-05   
ref|XP_002883899.1|  hypothetical protein ARALYDRAFT_899764           50.1    1e-04   
ref|XP_001779388.1|  predicted protein                                49.7    2e-04   
ref|XP_006473877.1|  PREDICTED: polyadenylate-binding protein 3-like  49.7    2e-04   
ref|XP_001780529.1|  predicted protein                                49.7    2e-04   
ref|XP_001770548.1|  predicted protein                                49.3    3e-04   
ref|XP_011100720.1|  PREDICTED: polyadenylate-binding protein 3       48.9    4e-04   
ref|XP_002300896.1|  Polyadenylate-binding protein 5                  48.5    4e-04   
gb|KEH43623.1|  polyadenylate-binding protein                         48.5    5e-04   
ref|XP_006406509.1|  hypothetical protein EUTSA_v10021769mg           45.8    5e-04   



>ref|XP_006342637.1| PREDICTED: polyadenylate-binding protein 8-like [Solanum tuberosum]
Length=665

 Score =   109 bits (273),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 62/68 (91%), Gaps = 4/68 (6%)
 Frame = -1

Query  193  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENL  26
            NV DGPMPGV GGM+S+PYDMGGMLPRDAA   PVPI+ LA+ALANAPPEQQRTMLGE+L
Sbjct  533  NVPDGPMPGVAGGMLSVPYDMGGMLPRDAAMGQPVPISTLATALANAPPEQQRTMLGESL  592

Query  25   YPLVDQLE  2
            YPLVDQLE
Sbjct  593  YPLVDQLE  600



>ref|XP_004252758.1| PREDICTED: polyadenylate-binding protein 2-like [Solanum lycopersicum]
Length=666

 Score =   109 bits (272),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 57/69 (83%), Positives = 62/69 (90%), Gaps = 5/69 (7%)
 Frame = -1

Query  193  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA----PVPITALASALANAPPEQQRTMLGEN  29
            NV DGPMPGV GGM+S+PYDMGGMLPRDAA    PVPI+ LA+ALANAPPEQQRTMLGE+
Sbjct  533  NVPDGPMPGVAGGMLSVPYDMGGMLPRDAAAMGQPVPISTLATALANAPPEQQRTMLGES  592

Query  28   LYPLVDQLE  2
            LYPLVDQLE
Sbjct  593  LYPLVDQLE  601



>ref|XP_011074396.1| PREDICTED: polyadenylate-binding protein 8-like [Sesamum indicum]
Length=654

 Score =   106 bits (265),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 61/68 (90%), Gaps = 4/68 (6%)
 Frame = -1

Query  193  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENL  26
            NV D P+PGV GGM+S+PYDMGGMLPRDAA   P+PITALASALANA PEQQRTMLGENL
Sbjct  523  NVPDVPIPGVAGGMLSVPYDMGGMLPRDAAIPQPMPITALASALANATPEQQRTMLGENL  582

Query  25   YPLVDQLE  2
            YPLVDQLE
Sbjct  583  YPLVDQLE  590



>ref|XP_011074395.1| PREDICTED: polyadenylate-binding protein 8-like [Sesamum indicum]
Length=654

 Score =   106 bits (265),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 61/68 (90%), Gaps = 4/68 (6%)
 Frame = -1

Query  193  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENL  26
            NV D P+PGV GGM+S+PYDMGGMLPRDAA   P+PITALASALANA PEQQRTMLGENL
Sbjct  523  NVPDVPIPGVAGGMLSVPYDMGGMLPRDAAVPQPMPITALASALANATPEQQRTMLGENL  582

Query  25   YPLVDQLE  2
            YPLVDQLE
Sbjct  583  YPLVDQLE  590



>gb|AAF66825.1| poly(A)-binding protein [Nicotiana tabacum]
Length=479

 Score =   103 bits (256),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 60/65 (92%), Gaps = 4/65 (6%)
 Frame = -1

Query  184  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  17
            +GPMPGV GGM+S+PYDMGGMLPRD+A   P+PI+ LASALANAPPEQQRTMLGE+LYPL
Sbjct  351  EGPMPGVPGGMLSVPYDMGGMLPRDSAMGQPMPISTLASALANAPPEQQRTMLGESLYPL  410

Query  16   VDQLE  2
            VDQLE
Sbjct  411  VDQLE  415



>ref|XP_009606598.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Nicotiana 
tomentosiformis]
Length=660

 Score =   103 bits (258),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 60/65 (92%), Gaps = 4/65 (6%)
 Frame = -1

Query  184  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  17
            +GPMPGV GGM+S+PYDMGGMLPRD+A   P+PI+ LASALANAPPEQQRTMLGE+LYPL
Sbjct  532  EGPMPGVPGGMLSVPYDMGGMLPRDSAMGQPMPISTLASALANAPPEQQRTMLGESLYPL  591

Query  16   VDQLE  2
            VDQLE
Sbjct  592  VDQLE  596



>ref|XP_009606599.1| PREDICTED: polyadenylate-binding protein 2-like isoform X2 [Nicotiana 
tomentosiformis]
Length=657

 Score =   103 bits (258),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 60/65 (92%), Gaps = 4/65 (6%)
 Frame = -1

Query  184  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  17
            +GPMPGV GGM+S+PYDMGGMLPRD+A   P+PI+ LASALANAPPEQQRTMLGE+LYPL
Sbjct  529  EGPMPGVPGGMLSVPYDMGGMLPRDSAMGQPMPISTLASALANAPPEQQRTMLGESLYPL  588

Query  16   VDQLE  2
            VDQLE
Sbjct  589  VDQLE  593



>dbj|BAM15222.1| poly(A)-binding protein [Nicotiana tabacum]
Length=657

 Score =   103 bits (258),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 60/65 (92%), Gaps = 4/65 (6%)
 Frame = -1

Query  184  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  17
            +GPMPGV GGM+S+PYDMGGMLPRD+A   P+PI+ LASALANAPPEQQRTMLGE+LYPL
Sbjct  529  EGPMPGVPGGMLSVPYDMGGMLPRDSAMGQPMPISTLASALANAPPEQQRTMLGESLYPL  588

Query  16   VDQLE  2
            VDQLE
Sbjct  589  VDQLE  593



>ref|XP_009782956.1| PREDICTED: polyadenylate-binding protein 2-like isoform X2 [Nicotiana 
sylvestris]
Length=658

 Score =   103 bits (258),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 60/65 (92%), Gaps = 4/65 (6%)
 Frame = -1

Query  184  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  17
            +GPMPGV GGM+S+PYDMGGMLPRD+A   P+PI+ LASALANAPPEQQRTMLGE+LYPL
Sbjct  530  EGPMPGVPGGMLSVPYDMGGMLPRDSAMGQPMPISTLASALANAPPEQQRTMLGESLYPL  589

Query  16   VDQLE  2
            VDQLE
Sbjct  590  VDQLE  594



>ref|XP_009782955.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Nicotiana 
sylvestris]
Length=661

 Score =   103 bits (258),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 60/65 (92%), Gaps = 4/65 (6%)
 Frame = -1

Query  184  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  17
            +GPMPGV GGM+S+PYDMGGMLPRD+A   P+PI+ LASALANAPPEQQRTMLGE+LYPL
Sbjct  533  EGPMPGVPGGMLSVPYDMGGMLPRDSAMGQPMPISTLASALANAPPEQQRTMLGESLYPL  592

Query  16   VDQLE  2
            VDQLE
Sbjct  593  VDQLE  597



>emb|CAJ38367.1| polyA-binding protein [Plantago major]
Length=314

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 57/68 (84%), Gaps = 5/68 (7%)
 Frame = -1

Query  193  NVSDGPMPGVGGMVSLPYDMGGMLPRDAA----PVPITALASALANAPPEQQRTMLGENL  26
            NV D PM G GGM S+PYDM GMLPRDAA    P+P+TALASALANA PEQQRTMLGENL
Sbjct  182  NVPDVPMTG-GGMFSVPYDMTGMLPRDAAAIPQPMPVTALASALANATPEQQRTMLGENL  240

Query  25   YPLVDQLE  2
            YPLVDQLE
Sbjct  241  YPLVDQLE  248



>ref|XP_009775186.1| PREDICTED: polyadenylate-binding protein 2-like [Nicotiana sylvestris]
Length=662

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 60/68 (88%), Gaps = 4/68 (6%)
 Frame = -1

Query  193  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENL  26
            N  + P+PG+ GGM+S+PYDMGGMLPR+AA   P+PI+ LASALANAPPEQQRTMLGE+L
Sbjct  531  NGQEAPIPGLAGGMLSVPYDMGGMLPREAAMGQPMPISTLASALANAPPEQQRTMLGESL  590

Query  25   YPLVDQLE  2
            YPLVDQLE
Sbjct  591  YPLVDQLE  598



>gb|AAK30205.1|AF349964_1 poly(A)-binding protein [Daucus carota]
Length=658

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 59/68 (87%), Gaps = 4/68 (6%)
 Frame = -1

Query  193  NVSDGPMPGVGG-MVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENL  26
            NV D  MPGVGG M+ +PY+MGGMLPR+AA   P+PITALASALANAP +QQRTMLGENL
Sbjct  528  NVGDVTMPGVGGGMLPVPYNMGGMLPREAAMGQPMPITALASALANAPADQQRTMLGENL  587

Query  25   YPLVDQLE  2
            YPLVDQLE
Sbjct  588  YPLVDQLE  595



>gb|EPS62510.1| hypothetical protein M569_12280, partial [Genlisea aurea]
Length=524

 Score = 94.4 bits (233),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 57/67 (85%), Gaps = 4/67 (6%)
 Frame = -1

Query  193  NVSDGPMPGVGGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLY  23
            N+ D P+P  GG++S+PYDMGGMLPRD A   P+PITALASALANA  EQQRTMLGENLY
Sbjct  401  NMPDVPIPS-GGLLSVPYDMGGMLPRDVAIPQPMPITALASALANATLEQQRTMLGENLY  459

Query  22   PLVDQLE  2
            PLVDQLE
Sbjct  460  PLVDQLE  466



>ref|XP_010270544.1| PREDICTED: polyadenylate-binding protein 2-like isoform X2 [Nelumbo 
nucifera]
Length=648

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 57/69 (83%), Gaps = 5/69 (7%)
 Frame = -1

Query  193  NVSDGPMPGVGG-MVSLPYDMGGMLPRDAA----PVPITALASALANAPPEQQRTMLGEN  29
            N+ D PMPGV G M+S+PYDMGGM  RDAA    P+PI ALASALANA PEQQRTMLGE+
Sbjct  511  NIPDVPMPGVAGSMLSVPYDMGGMPLRDAAAITQPIPIGALASALANATPEQQRTMLGES  570

Query  28   LYPLVDQLE  2
            LYPLVDQLE
Sbjct  571  LYPLVDQLE  579



>ref|XP_010270536.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Nelumbo 
nucifera]
Length=654

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 57/69 (83%), Gaps = 5/69 (7%)
 Frame = -1

Query  193  NVSDGPMPGVGG-MVSLPYDMGGMLPRDAA----PVPITALASALANAPPEQQRTMLGEN  29
            N+ D PMPGV G M+S+PYDMGGM  RDAA    P+PI ALASALANA PEQQRTMLGE+
Sbjct  517  NIPDVPMPGVAGSMLSVPYDMGGMPLRDAAAITQPIPIGALASALANATPEQQRTMLGES  576

Query  28   LYPLVDQLE  2
            LYPLVDQLE
Sbjct  577  LYPLVDQLE  585



>gb|AAF63202.1|AF240679_1 poly(A)-binding protein [Cucumis sativus]
Length=649

 Score = 92.4 bits (228),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 55/65 (85%), Gaps = 4/65 (6%)
 Frame = -1

Query  184  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  17
            D PMPGV GGM S+PY+MGGM PRDA    PVP+ ALASALANA P+QQRTMLGENLYPL
Sbjct  520  DLPMPGVAGGMFSVPYEMGGMPPRDAVHPQPVPVGALASALANATPDQQRTMLGENLYPL  579

Query  16   VDQLE  2
            V+QLE
Sbjct  580  VEQLE  584



>ref|XP_004136969.1| PREDICTED: polyadenylate-binding protein 2-like [Cucumis sativus]
 ref|XP_004159899.1| PREDICTED: polyadenylate-binding protein 2-like [Cucumis sativus]
 gb|KGN43917.1| hypothetical protein Csa_7G073530 [Cucumis sativus]
Length=649

 Score = 92.4 bits (228),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 55/65 (85%), Gaps = 4/65 (6%)
 Frame = -1

Query  184  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  17
            D PMPGV GGM S+PY+MGGM PRDA    PVP+ ALASALANA P+QQRTMLGENLYPL
Sbjct  520  DLPMPGVAGGMFSVPYEMGGMPPRDAVHPQPVPVGALASALANATPDQQRTMLGENLYPL  579

Query  16   VDQLE  2
            V+QLE
Sbjct  580  VEQLE  584



>ref|XP_008454965.1| PREDICTED: polyadenylate-binding protein 2 [Cucumis melo]
Length=649

 Score = 92.0 bits (227),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 55/65 (85%), Gaps = 4/65 (6%)
 Frame = -1

Query  184  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  17
            D PMPGV GGM S+PY+MGGM PRDA    PVP+ ALASALANA P+QQRTMLGENLYPL
Sbjct  520  DLPMPGVAGGMFSVPYEMGGMPPRDAVHPQPVPVGALASALANATPDQQRTMLGENLYPL  579

Query  16   VDQLE  2
            V+QLE
Sbjct  580  VEQLE  584



>ref|XP_002283105.1| PREDICTED: polyadenylate-binding protein 2 [Vitis vinifera]
 emb|CBI21386.3| unnamed protein product [Vitis vinifera]
Length=654

 Score = 92.0 bits (227),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 58/68 (85%), Gaps = 4/68 (6%)
 Frame = -1

Query  193  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENL  26
            N++D P+PGV GGM+S PYDM GM  RDAA   P+PI ALA+ALANAPP+QQRT+LGENL
Sbjct  521  NMADVPIPGVPGGMLSAPYDMAGMPFRDAAVSQPMPIGALATALANAPPDQQRTLLGENL  580

Query  25   YPLVDQLE  2
            YPLVDQLE
Sbjct  581  YPLVDQLE  588



>ref|XP_003607922.1| Poly(A)-binding protein [Medicago truncatula]
 gb|AES90119.1| polyadenylate-binding protein [Medicago truncatula]
Length=654

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/65 (75%), Positives = 54/65 (83%), Gaps = 4/65 (6%)
 Frame = -1

Query  184  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  17
            DGPMPGV GGM S+PYD+GGM  RDA+    +PI ALAS LANA PEQQRTMLGENLYPL
Sbjct  524  DGPMPGVAGGMYSVPYDVGGMPIRDASLSQQIPIGALASHLANASPEQQRTMLGENLYPL  583

Query  16   VDQLE  2
            V+QLE
Sbjct  584  VEQLE  588



>ref|XP_008456143.1| PREDICTED: polyadenylate-binding protein 8-like isoform X2 [Cucumis 
melo]
Length=552

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 54/65 (83%), Gaps = 4/65 (6%)
 Frame = -1

Query  184  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  17
            D  MPGV GGM S+PYDMGGM  RDAA   P+PI ALASALANA P+QQRTMLGENLYPL
Sbjct  418  DVAMPGVAGGMFSVPYDMGGMPLRDAAHSQPIPIGALASALANATPDQQRTMLGENLYPL  477

Query  16   VDQLE  2
            V+QLE
Sbjct  478  VEQLE  482



>ref|XP_004161443.1| PREDICTED: LOW QUALITY PROTEIN: polyadenylate-binding protein 
2-like [Cucumis sativus]
Length=576

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 54/65 (83%), Gaps = 4/65 (6%)
 Frame = -1

Query  184  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  17
            D  MPGV GGM S+PYDMGGM  RDAA   P+PI ALASALANA P+QQRTMLGENLYPL
Sbjct  442  DVAMPGVAGGMFSVPYDMGGMPLRDAAHSQPIPIGALASALANATPDQQRTMLGENLYPL  501

Query  16   VDQLE  2
            V+QLE
Sbjct  502  VEQLE  506



>ref|XP_002285190.1| PREDICTED: polyadenylate-binding protein 2 [Vitis vinifera]
 emb|CAN65906.1| hypothetical protein VITISV_004873 [Vitis vinifera]
Length=648

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 56/67 (84%), Gaps = 4/67 (6%)
 Frame = -1

Query  190  VSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLY  23
            +SD PMPGV GGMVS+PYDMGGM   DAA    +P+ ALA+ALANAPP +QRTMLGENLY
Sbjct  520  LSDVPMPGVAGGMVSVPYDMGGMPLHDAAISQSIPVGALATALANAPPAEQRTMLGENLY  579

Query  22   PLVDQLE  2
            PLV+QLE
Sbjct  580  PLVEQLE  586



>ref|XP_008456142.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Cucumis 
melo]
Length=654

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 54/65 (83%), Gaps = 4/65 (6%)
 Frame = -1

Query  184  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  17
            D  MPGV GGM S+PYDMGGM  RDAA   P+PI ALASALANA P+QQRTMLGENLYPL
Sbjct  520  DVAMPGVAGGMFSVPYDMGGMPLRDAAHSQPIPIGALASALANATPDQQRTMLGENLYPL  579

Query  16   VDQLE  2
            V+QLE
Sbjct  580  VEQLE  584



>ref|XP_004140705.1| PREDICTED: polyadenylate-binding protein 2-like [Cucumis sativus]
 gb|KGN57514.1| hypothetical protein Csa_3G202720 [Cucumis sativus]
Length=654

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 54/65 (83%), Gaps = 4/65 (6%)
 Frame = -1

Query  184  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  17
            D  MPGV GGM S+PYDMGGM  RDAA   P+PI ALASALANA P+QQRTMLGENLYPL
Sbjct  520  DVAMPGVAGGMFSVPYDMGGMPLRDAAHSQPIPIGALASALANATPDQQRTMLGENLYPL  579

Query  16   VDQLE  2
            V+QLE
Sbjct  580  VEQLE  584



>ref|XP_003544466.1| PREDICTED: polyadenylate-binding protein 8-like [Glycine max]
 gb|KHN35693.1| Polyadenylate-binding protein 2 [Glycine soja]
Length=652

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 56/67 (84%), Gaps = 3/67 (4%)
 Frame = -1

Query  193  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA--PVPITALASALANAPPEQQRTMLGENLY  23
            N+ D P+ GV GGM+S+PYDMGG+  RDA   P+PI ALA+ALANAPPEQQRTMLGE LY
Sbjct  521  NMQDVPLQGVAGGMMSVPYDMGGLPIRDAVGQPMPIQALATALANAPPEQQRTMLGEALY  580

Query  22   PLVDQLE  2
            PLVDQLE
Sbjct  581  PLVDQLE  587



>ref|XP_010107907.1| Polyadenylate-binding protein 2 [Morus notabilis]
 gb|EXC17307.1| Polyadenylate-binding protein 2 [Morus notabilis]
Length=651

 Score = 89.4 bits (220),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 54/65 (83%), Gaps = 4/65 (6%)
 Frame = -1

Query  184  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  17
            D PMPGV GGM S+P+DMGGM  RDA    P+PI A+A+ALANA PEQQRTMLGENLYPL
Sbjct  520  DVPMPGVAGGMFSVPFDMGGMPLRDAGMSQPIPIGAMATALANATPEQQRTMLGENLYPL  579

Query  16   VDQLE  2
            V+QLE
Sbjct  580  VEQLE  584



>ref|XP_007160868.1| hypothetical protein PHAVU_001G023500g [Phaseolus vulgaris]
 gb|ESW32862.1| hypothetical protein PHAVU_001G023500g [Phaseolus vulgaris]
Length=651

 Score = 89.4 bits (220),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 56/67 (84%), Gaps = 3/67 (4%)
 Frame = -1

Query  193  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA--PVPITALASALANAPPEQQRTMLGENLY  23
            N+ D P+ GV GGM+S+PYDMGG+  RD+   P+PI ALA+ALANAPPEQQRTMLGE LY
Sbjct  520  NMQDVPLQGVAGGMMSVPYDMGGLPIRDSVGQPMPIQALATALANAPPEQQRTMLGEALY  579

Query  22   PLVDQLE  2
            PLVDQLE
Sbjct  580  PLVDQLE  586



>ref|XP_004499044.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Cicer 
arietinum]
 ref|XP_004499045.1| PREDICTED: polyadenylate-binding protein 2-like isoform X2 [Cicer 
arietinum]
Length=648

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 55/67 (82%), Gaps = 3/67 (4%)
 Frame = -1

Query  193  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA--PVPITALASALANAPPEQQRTMLGENLY  23
            N+ D P+ GV GGM+S+PYDMGG+  RDA   P+PI ALA+ALANAP EQQRTMLGE LY
Sbjct  520  NMQDVPLQGVAGGMMSVPYDMGGLPIRDAVGQPMPIQALATALANAPSEQQRTMLGEALY  579

Query  22   PLVDQLE  2
            PLVDQLE
Sbjct  580  PLVDQLE  586



>gb|KHG12838.1| ELAV-like protein 2 [Gossypium arboreum]
Length=648

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 54/65 (83%), Gaps = 4/65 (6%)
 Frame = -1

Query  184  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  17
            D  MP + GGM+S+PYDMGGM  RDA+   P+PI ALASALANA P+QQRTMLGENLYPL
Sbjct  516  DVSMPNIAGGMLSVPYDMGGMPMRDASISQPIPIGALASALANATPDQQRTMLGENLYPL  575

Query  16   VDQLE  2
            V+QLE
Sbjct  576  VEQLE  580



>gb|KJB79363.1| hypothetical protein B456_013G046000 [Gossypium raimondii]
Length=648

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 54/65 (83%), Gaps = 4/65 (6%)
 Frame = -1

Query  184  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  17
            D  MP + GGM+S+PYDMGGM  RDA+   P+PI ALASALANA P+QQRTMLGENLYPL
Sbjct  516  DVSMPNIAGGMLSVPYDMGGMPMRDASISQPIPIGALASALANATPDQQRTMLGENLYPL  575

Query  16   VDQLE  2
            V+QLE
Sbjct  576  VEQLE  580



>gb|KJB79366.1| hypothetical protein B456_013G046000 [Gossypium raimondii]
Length=649

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 54/65 (83%), Gaps = 4/65 (6%)
 Frame = -1

Query  184  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  17
            D  MP + GGM+S+PYDMGGM  RDA+   P+PI ALASALANA P+QQRTMLGENLYPL
Sbjct  517  DVSMPNIAGGMLSVPYDMGGMPMRDASISQPIPIGALASALANATPDQQRTMLGENLYPL  576

Query  16   VDQLE  2
            V+QLE
Sbjct  577  VEQLE  581



>gb|KHN12798.1| Polyadenylate-binding protein 2 [Glycine soja]
Length=654

 Score = 86.3 bits (212),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 54/67 (81%), Gaps = 3/67 (4%)
 Frame = -1

Query  193  NVSDGPMP-GVGGMVSLPYDMGGMLPRDAA--PVPITALASALANAPPEQQRTMLGENLY  23
            N+ D P+    GGM+S+PYDMGG+  RDA   P+PI ALA+ALANAPPEQQRTMLGE LY
Sbjct  523  NMQDVPLQVAAGGMLSVPYDMGGLPIRDAVGQPMPIQALATALANAPPEQQRTMLGEALY  582

Query  22   PLVDQLE  2
            PLVDQLE
Sbjct  583  PLVDQLE  589



>ref|XP_006855143.1| hypothetical protein AMTR_s00051p00026490 [Amborella trichopoda]
 gb|ERN16610.1| hypothetical protein AMTR_s00051p00026490 [Amborella trichopoda]
Length=654

 Score = 86.3 bits (212),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 56/68 (82%), Gaps = 4/68 (6%)
 Frame = -1

Query  193  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENL  26
            N+ D P+PGV GGM+S+PYDMG +  R++    P+PI ALASALANA PEQQRTMLGE+L
Sbjct  518  NMPDVPLPGVAGGMLSVPYDMGSVPLRESGISQPIPIGALASALANATPEQQRTMLGESL  577

Query  25   YPLVDQLE  2
            YPLVDQLE
Sbjct  578  YPLVDQLE  585



>ref|XP_003550332.1| PREDICTED: polyadenylate-binding protein 8-like [Glycine max]
Length=654

 Score = 86.3 bits (212),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 54/67 (81%), Gaps = 3/67 (4%)
 Frame = -1

Query  193  NVSDGPMP-GVGGMVSLPYDMGGMLPRDAA--PVPITALASALANAPPEQQRTMLGENLY  23
            N+ D P+    GGM+S+PYDMGG+  RDA   P+PI ALA+ALANAPPEQQRTMLGE LY
Sbjct  523  NMQDVPLQVAAGGMLSVPYDMGGLPMRDAVGQPMPIQALATALANAPPEQQRTMLGEALY  582

Query  22   PLVDQLE  2
            PLVDQLE
Sbjct  583  PLVDQLE  589



>ref|XP_003529405.1| PREDICTED: polyadenylate-binding protein 8-like [Glycine max]
 gb|KHN43051.1| Polyadenylate-binding protein 2 [Glycine soja]
Length=651

 Score = 85.9 bits (211),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 54/65 (83%), Gaps = 4/65 (6%)
 Frame = -1

Query  184  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  17
            D P+PGV GGM S+PYD+GGM  RDA+    +P+ ALA+ALANA PEQQRTMLGENLYPL
Sbjct  521  DVPIPGVAGGMFSVPYDVGGMPLRDASISQQIPVGALATALANASPEQQRTMLGENLYPL  580

Query  16   VDQLE  2
            V+QLE
Sbjct  581  VEQLE  585



>gb|KJB32340.1| hypothetical protein B456_005G236500 [Gossypium raimondii]
Length=647

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 51/62 (82%), Gaps = 4/62 (6%)
 Frame = -1

Query  175  MPGV-GGMVSLPYDMGGMLPRDA---APVPITALASALANAPPEQQRTMLGENLYPLVDQ  8
            MP V GGM+S+PYDMG M  RDA    P+PI ALASALANA PEQQRTMLGENLYPLV+Q
Sbjct  518  MPNVPGGMLSVPYDMGSMPMRDAPLSQPIPIGALASALANATPEQQRTMLGENLYPLVEQ  577

Query  7    LE  2
            LE
Sbjct  578  LE  579



>gb|KHG19377.1| Polyadenylate-binding protein 1-like 2 [Gossypium arboreum]
Length=647

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 51/62 (82%), Gaps = 4/62 (6%)
 Frame = -1

Query  175  MPGV-GGMVSLPYDMGGMLPRDA---APVPITALASALANAPPEQQRTMLGENLYPLVDQ  8
            MP V GGM+S+PYDMG M  RDA    P+PI ALASALANA PEQQRTMLGENLYPLV+Q
Sbjct  518  MPNVPGGMLSVPYDMGSMPMRDAPLAQPIPIGALASALANATPEQQRTMLGENLYPLVEQ  577

Query  7    LE  2
            LE
Sbjct  578  LE  579



>gb|KHN05826.1| Polyadenylate-binding protein 2 [Glycine soja]
Length=648

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 53/65 (82%), Gaps = 4/65 (6%)
 Frame = -1

Query  184  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  17
            D  MPGV GGM S+PYD+GGM  RDA+    +P+ ALA+ALANA PEQQRTMLGENLYPL
Sbjct  518  DVSMPGVAGGMFSVPYDVGGMPLRDASISQQIPVGALATALANASPEQQRTMLGENLYPL  577

Query  16   VDQLE  2
            V+QLE
Sbjct  578  VEQLE  582



>ref|XP_006574897.1| PREDICTED: polyadenylate-binding protein 8-like [Glycine max]
Length=648

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 53/65 (82%), Gaps = 4/65 (6%)
 Frame = -1

Query  184  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  17
            D  MPGV GGM S+PYD+GGM  RDA+    +P+ ALA+ALANA PEQQRTMLGENLYPL
Sbjct  518  DVSMPGVAGGMFSVPYDVGGMPLRDASISQQIPVGALATALANASPEQQRTMLGENLYPL  577

Query  16   VDQLE  2
            V+QLE
Sbjct  578  VEQLE  582



>gb|EMS55649.1| Polyadenylate-binding protein 2 [Triticum urartu]
Length=625

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 51/64 (80%), Gaps = 3/64 (5%)
 Frame = -1

Query  184  DGPMPGVGGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPLV  14
            D  M GVGG+++ PY+MGGM  RDA    PVPI ALASALAN+PPE QR MLGENLYPLV
Sbjct  495  DPAMHGVGGVMTSPYEMGGMPMRDAGASQPVPIGALASALANSPPETQRMMLGENLYPLV  554

Query  13   DQLE  2
            DQLE
Sbjct  555  DQLE  558



>gb|EMT14398.1| Polyadenylate-binding protein 2 [Aegilops tauschii]
Length=573

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 51/64 (80%), Gaps = 3/64 (5%)
 Frame = -1

Query  184  DGPMPGVGGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPLV  14
            D  M GVGG+++ PY+MGGM  RDA    PVPI ALASALAN+PPE QR MLGENLYPLV
Sbjct  443  DPAMHGVGGVMTSPYEMGGMPMRDAGASQPVPIGALASALANSPPETQRMMLGENLYPLV  502

Query  13   DQLE  2
            DQLE
Sbjct  503  DQLE  506



>gb|EPS61401.1| hypothetical protein M569_13396, partial [Genlisea aurea]
Length=551

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 52/65 (80%), Gaps = 3/65 (5%)
 Frame = -1

Query  193  NVSDGPMPGVGG-MVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPL  17
            N+ +  M G GG MVS PYDM  M+P+   P+PITALASALAN+ PEQQRTMLGENLYPL
Sbjct  435  NLGEVNMAGYGGGMVSSPYDMVAMIPQQ--PMPITALASALANSTPEQQRTMLGENLYPL  492

Query  16   VDQLE  2
            VDQLE
Sbjct  493  VDQLE  497



>dbj|BAJ96406.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=744

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 51/64 (80%), Gaps = 3/64 (5%)
 Frame = -1

Query  184  DGPMPGVGGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPLV  14
            D  M GVGG+++ PY+MGGM  RDA    PVPI ALASALAN+PPE QR MLGENLYPLV
Sbjct  614  DPAMHGVGGVMTSPYEMGGMPMRDAGASQPVPIGALASALANSPPETQRMMLGENLYPLV  673

Query  13   DQLE  2
            DQLE
Sbjct  674  DQLE  677



>gb|AAB38974.1| poly(A)-binding protein [Triticum aestivum]
Length=651

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 51/64 (80%), Gaps = 3/64 (5%)
 Frame = -1

Query  184  DGPMPGVGGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPLV  14
            D  M GVGG+++ PY+MGGM  RDA    PVPI ALASALAN+PPE QR MLGENLYPLV
Sbjct  521  DPAMHGVGGVMTSPYEMGGMPMRDAGESQPVPIGALASALANSPPETQRMMLGENLYPLV  580

Query  13   DQLE  2
            DQLE
Sbjct  581  DQLE  584



>ref|XP_009768210.1| PREDICTED: polyadenylate-binding protein 8-like [Nicotiana sylvestris]
Length=649

 Score = 84.0 bits (206),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 51/65 (78%), Gaps = 4/65 (6%)
 Frame = -1

Query  184  DGPMPGVGG-MVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  17
            D   PGVGG M S+PYDMGGM  RDA    P+P+ ALA+ALANA P +QRTMLGENLYPL
Sbjct  519  DVAFPGVGGGMFSIPYDMGGMPVRDAGIVQPIPVGALATALANASPTEQRTMLGENLYPL  578

Query  16   VDQLE  2
            V+QLE
Sbjct  579  VEQLE  583



>ref|XP_009386706.1| PREDICTED: polyadenylate-binding protein 2-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=657

 Score = 83.6 bits (205),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 55/68 (81%), Gaps = 5/68 (7%)
 Frame = -1

Query  193  NVSDGPMPGV-GGMVSLPYDMGGMLPRDA---APVPITALASALANAPPEQQRTMLGENL  26
            N+ D P+PGV GGM+S PYDMGG+  RDA    P+PI ALASALANA PEQQR MLGENL
Sbjct  524  NMPDIPIPGVVGGMLS-PYDMGGLPMRDAPMSQPIPIGALASALANATPEQQRMMLGENL  582

Query  25   YPLVDQLE  2
            YPLV+QLE
Sbjct  583  YPLVEQLE  590



>ref|XP_009386705.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=658

 Score = 83.6 bits (205),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 55/68 (81%), Gaps = 5/68 (7%)
 Frame = -1

Query  193  NVSDGPMPGV-GGMVSLPYDMGGMLPRDA---APVPITALASALANAPPEQQRTMLGENL  26
            N+ D P+PGV GGM+S PYDMGG+  RDA    P+PI ALASALANA PEQQR MLGENL
Sbjct  525  NMPDIPIPGVVGGMLS-PYDMGGLPMRDAPMSQPIPIGALASALANATPEQQRMMLGENL  583

Query  25   YPLVDQLE  2
            YPLV+QLE
Sbjct  584  YPLVEQLE  591



>ref|XP_009386708.1| PREDICTED: polyadenylate-binding protein 2-like isoform X4 [Musa 
acuminata subsp. malaccensis]
Length=652

 Score = 83.6 bits (205),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 55/68 (81%), Gaps = 5/68 (7%)
 Frame = -1

Query  193  NVSDGPMPGV-GGMVSLPYDMGGMLPRDA---APVPITALASALANAPPEQQRTMLGENL  26
            N+ D P+PGV GGM+S PYDMGG+  RDA    P+PI ALASALANA PEQQR MLGENL
Sbjct  519  NMPDIPIPGVVGGMLS-PYDMGGLPMRDAPMSQPIPIGALASALANATPEQQRMMLGENL  577

Query  25   YPLVDQLE  2
            YPLV+QLE
Sbjct  578  YPLVEQLE  585



>ref|XP_009386707.1| PREDICTED: polyadenylate-binding protein 2-like isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=653

 Score = 83.2 bits (204),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 55/68 (81%), Gaps = 5/68 (7%)
 Frame = -1

Query  193  NVSDGPMPGV-GGMVSLPYDMGGMLPRDA---APVPITALASALANAPPEQQRTMLGENL  26
            N+ D P+PGV GGM+S PYDMGG+  RDA    P+PI ALASALANA PEQQR MLGENL
Sbjct  520  NMPDIPIPGVVGGMLS-PYDMGGLPMRDAPMSQPIPIGALASALANATPEQQRMMLGENL  578

Query  25   YPLVDQLE  2
            YPLV+QLE
Sbjct  579  YPLVEQLE  586



>ref|XP_006346392.1| PREDICTED: polyadenylate-binding protein 8-like [Solanum tuberosum]
Length=643

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 51/65 (78%), Gaps = 4/65 (6%)
 Frame = -1

Query  184  DGPMPGVGG-MVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  17
            D   PGVGG M S+PYDMGGM  RDA    P+P+ ALA+ALANA P +QRTMLGENLYPL
Sbjct  513  DVGFPGVGGGMFSVPYDMGGMPVRDAGIAQPIPVGALATALANASPTEQRTMLGENLYPL  572

Query  16   VDQLE  2
            V+QLE
Sbjct  573  VEQLE  577



>ref|XP_009600995.1| PREDICTED: polyadenylate-binding protein 8-like [Nicotiana tomentosiformis]
 gb|AAF66823.1|AF190655_1 poly(A)-binding protein [Nicotiana tabacum]
Length=649

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 51/65 (78%), Gaps = 4/65 (6%)
 Frame = -1

Query  184  DGPMPGVGG-MVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  17
            D   PGVGG M S+PYDMGGM  RDA    P+P+ ALA+ALAN+ P +QRTMLGENLYPL
Sbjct  519  DVAFPGVGGGMFSIPYDMGGMPVRDAGIVQPIPVGALATALANSSPTEQRTMLGENLYPL  578

Query  16   VDQLE  2
            V+QLE
Sbjct  579  VEQLE  583



>gb|AAF66824.1|AF190656_1 poly(A)-binding protein [Nicotiana tabacum]
Length=330

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 51/65 (78%), Gaps = 4/65 (6%)
 Frame = -1

Query  184  DGPMPGVGG-MVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  17
            D   PGVGG M S+PYDMGGM  RDA    P+P+ ALA+ALAN+ P +QRTMLGENLYPL
Sbjct  200  DVAFPGVGGGMFSIPYDMGGMPVRDAGIVQPIPVGALATALANSSPTEQRTMLGENLYPL  259

Query  16   VDQLE  2
            V+QLE
Sbjct  260  VEQLE  264



>emb|CAN61506.1| hypothetical protein VITISV_011738 [Vitis vinifera]
Length=433

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 52/68 (76%), Gaps = 4/68 (6%)
 Frame = -1

Query  193  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENL  26
            N+ D PMPGV GGM+S+PYDMG ML RDA    P+ I+ LAS  A+   +QQRTMLGE+L
Sbjct  338  NMLDSPMPGVAGGMLSIPYDMGDMLLRDAXFXQPILISXLASTHASVASDQQRTMLGESL  397

Query  25   YPLVDQLE  2
            YPL+DQLE
Sbjct  398  YPLLDQLE  405



>ref|XP_009613515.1| PREDICTED: polyadenylate-binding protein 2-like [Nicotiana tomentosiformis]
Length=663

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 61/68 (90%), Gaps = 4/68 (6%)
 Frame = -1

Query  193  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENL  26
            N  + P+PG+ GGM+S+PYDMGGMLPR+AA   P+PI+ALASALANAPPEQQRTMLGE+L
Sbjct  532  NGQEAPIPGLAGGMLSVPYDMGGMLPREAAMGQPMPISALASALANAPPEQQRTMLGESL  591

Query  25   YPLVDQLE  2
            YPLVDQLE
Sbjct  592  YPLVDQLE  599



>gb|KJB29450.1| hypothetical protein B456_005G101600 [Gossypium raimondii]
Length=648

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 49/57 (86%), Gaps = 3/57 (5%)
 Frame = -1

Query  163  GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPLVDQLE  2
            GGM+S+PYDMG M  RDA    P+P+TALA++LANA PEQQRTMLGE+LYPLV++LE
Sbjct  525  GGMLSIPYDMGSMPVRDAGSGQPIPVTALATSLANATPEQQRTMLGESLYPLVERLE  581



>ref|XP_003589160.1| Polyadenylate-binding protein [Medicago truncatula]
 gb|AES59411.1| polyadenylate-binding protein [Medicago truncatula]
Length=647

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 51/65 (78%), Gaps = 2/65 (3%)
 Frame = -1

Query  193  NVSDGPMPGVGGMVSLPYDMGGMLPRDAAP-VPITALASALANAPPEQQRTMLGENLYPL  17
            N+ D P+  +GG + + YDMGG+  RD  P +PI ALA+ALANAPPEQQRTMLGE LYPL
Sbjct  521  NIQDAPVQNIGGGM-MSYDMGGLPLRDVVPPMPIHALATALANAPPEQQRTMLGEALYPL  579

Query  16   VDQLE  2
            VDQLE
Sbjct  580  VDQLE  584



>ref|XP_004956317.1| PREDICTED: polyadenylate-binding protein 2-like [Setaria italica]
Length=664

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 49/61 (80%), Gaps = 3/61 (5%)
 Frame = -1

Query  175  MPGVGGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPLVDQL  5
            M GVG ++  PY+MGGM  RDA    PVPI ALA+ALANAPP+QQR MLGENLYPLVDQL
Sbjct  535  MHGVGAVMPSPYEMGGMPIRDAGVSQPVPIGALATALANAPPDQQRLMLGENLYPLVDQL  594

Query  4    E  2
            E
Sbjct  595  E  595



>gb|AFP74112.1| poly-A binding protein, partial [Nicotiana benthamiana]
Length=643

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 49/62 (79%), Gaps = 4/62 (6%)
 Frame = -1

Query  184  DGPMPGVGG-MVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLVDQ  8
            DG  PGVGG M S+PYD+GG   R   P+P+ ALA+ALANA P +QRTMLGENLYPLV+Q
Sbjct  519  DGAFPGVGGGMFSIPYDIGG---RIVQPIPVGALATALANASPTEQRTMLGENLYPLVEQ  575

Query  7    LE  2
            LE
Sbjct  576  LE  577



>gb|ADE76290.1| unknown [Picea sitchensis]
Length=313

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 53/70 (76%), Gaps = 6/70 (9%)
 Frame = -1

Query  193  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA-----PVPITALASALANAPPEQQRTMLGE  32
            NV++ P+ GV GGM  LP DMGG+  R A      P+PI ALASALANA PEQQRTMLGE
Sbjct  179  NVNEIPLSGVAGGMHPLPLDMGGLPLRAAETTISQPIPIGALASALANATPEQQRTMLGE  238

Query  31   NLYPLVDQLE  2
            +LYPLVDQLE
Sbjct  239  SLYPLVDQLE  248



>gb|KCW66377.1| hypothetical protein EUGRSUZ_F00193 [Eucalyptus grandis]
Length=441

 Score = 80.5 bits (197),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 52/67 (78%), Gaps = 3/67 (4%)
 Frame = -1

Query  193  NVSDGPMPGVGGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLY  23
            N+ + PM G GGM  +PY MG M  R+ +   P+PITALA+ALAN+ PEQQRT+LGE+LY
Sbjct  307  NLQEVPMAGSGGMFPVPYGMGDMALREPSVPQPLPITALATALANSSPEQQRTLLGESLY  366

Query  22   PLVDQLE  2
            PLVDQLE
Sbjct  367  PLVDQLE  373



>dbj|BAJ53195.1| JHL03K20.4 [Jatropha curcas]
Length=642

 Score = 80.9 bits (198),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 51/65 (78%), Gaps = 4/65 (6%)
 Frame = -1

Query  184  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  17
            D PM G+ GGM+ +PYDMGGM  RD A   PV   ALA+ALANA PEQQRT+LGENLYPL
Sbjct  513  DVPMAGLPGGMLPVPYDMGGMPFRDGAFSQPVQTGALATALANAMPEQQRTLLGENLYPL  572

Query  16   VDQLE  2
            VDQLE
Sbjct  573  VDQLE  577



>gb|KCW66375.1| hypothetical protein EUGRSUZ_F00193 [Eucalyptus grandis]
Length=627

 Score = 80.9 bits (198),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 52/67 (78%), Gaps = 3/67 (4%)
 Frame = -1

Query  193  NVSDGPMPGVGGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLY  23
            N+ + PM G GGM  +PY MG M  R+ +   P+PITALA+ALAN+ PEQQRT+LGE+LY
Sbjct  493  NLQEVPMAGSGGMFPVPYGMGDMALREPSVPQPLPITALATALANSSPEQQRTLLGESLY  552

Query  22   PLVDQLE  2
            PLVDQLE
Sbjct  553  PLVDQLE  559



>ref|XP_003576878.1| PREDICTED: polyadenylate-binding protein 2-like [Brachypodium 
distachyon]
Length=653

 Score = 80.9 bits (198),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 50/64 (78%), Gaps = 3/64 (5%)
 Frame = -1

Query  184  DGPMPGVGGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPLV  14
            D  M GVGG +  PY++GGM  RDA    PVPI ALA+ALANAPP+QQR MLGENLYPLV
Sbjct  523  DPAMHGVGGGMPSPYEIGGMPMRDAGASQPVPIGALATALANAPPDQQRMMLGENLYPLV  582

Query  13   DQLE  2
            DQLE
Sbjct  583  DQLE  586



>ref|XP_010059905.1| PREDICTED: polyadenylate-binding protein 2-like [Eucalyptus grandis]
 gb|KCW66374.1| hypothetical protein EUGRSUZ_F00193 [Eucalyptus grandis]
Length=657

 Score = 80.5 bits (197),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 52/67 (78%), Gaps = 3/67 (4%)
 Frame = -1

Query  193  NVSDGPMPGVGGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLY  23
            N+ + PM G GGM  +PY MG M  R+ +   P+PITALA+ALAN+ PEQQRT+LGE+LY
Sbjct  523  NLQEVPMAGSGGMFPVPYGMGDMALREPSVPQPLPITALATALANSSPEQQRTLLGESLY  582

Query  22   PLVDQLE  2
            PLVDQLE
Sbjct  583  PLVDQLE  589



>ref|XP_004230758.1| PREDICTED: polyadenylate-binding protein 8-like [Solanum lycopersicum]
Length=643

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 50/65 (77%), Gaps = 4/65 (6%)
 Frame = -1

Query  184  DGPMPGVGG-MVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  17
            D   PGVGG M S+PYDMGGM  R A    P+P+ ALA+ALANA P +QRTMLGENLYPL
Sbjct  513  DVGFPGVGGGMFSVPYDMGGMPVRAAGIAQPIPVGALATALANASPTEQRTMLGENLYPL  572

Query  16   VDQLE  2
            V+QLE
Sbjct  573  VEQLE  577



>ref|XP_009415843.1| PREDICTED: polyadenylate-binding protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=651

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 53/68 (78%), Gaps = 5/68 (7%)
 Frame = -1

Query  193  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENL  26
            N+ + PMPG  GGM+S PYDMG +  R+AA   P+P   LASALANA PEQQRTMLGE+L
Sbjct  516  NIPEVPMPGAPGGMLS-PYDMGSLPIREAAISQPIPTGTLASALANANPEQQRTMLGESL  574

Query  25   YPLVDQLE  2
            YPLVDQLE
Sbjct  575  YPLVDQLE  582



>gb|EPS71660.1| hypothetical protein M569_03099, partial [Genlisea aurea]
Length=150

 Score = 74.7 bits (182),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 47/58 (81%), Gaps = 4/58 (7%)
 Frame = -1

Query  163  GGMVSLPYDMGGMLPRD----AAPVPITALASALANAPPEQQRTMLGENLYPLVDQLE  2
            GGMV+LPYDMGG   R+    A PVPI ALASALANA P +QRT+LGE+LYPLV+Q+E
Sbjct  33   GGMVTLPYDMGGFPLREIGIPAQPVPIGALASALANATPAEQRTLLGESLYPLVEQVE  90



>ref|XP_010093503.1| Polyadenylate-binding protein 2 [Morus notabilis]
 gb|EXB54169.1| Polyadenylate-binding protein 2 [Morus notabilis]
Length=647

 Score = 77.8 bits (190),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 52/68 (76%), Gaps = 4/68 (6%)
 Frame = -1

Query  193  NVSDGPMPGV-GGMVSLPYDMGGMLPRDA---APVPITALASALANAPPEQQRTMLGENL  26
            N+SD P+ G  GGM+S+PY MGG+  RD     P+   ALAS+LANA P+QQRT+LGENL
Sbjct  512  NMSDIPIGGAPGGMLSVPYSMGGVPIRDTPYGQPMSTGALASSLANATPDQQRTLLGENL  571

Query  25   YPLVDQLE  2
            YPLVDQLE
Sbjct  572  YPLVDQLE  579



>ref|XP_003573691.1| PREDICTED: polyadenylate-binding protein 2-like [Brachypodium 
distachyon]
Length=663

 Score = 77.4 bits (189),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 48/64 (75%), Gaps = 3/64 (5%)
 Frame = -1

Query  184  DGPMPGVGGMVSLPYDMGGM-LPRDAAP--VPITALASALANAPPEQQRTMLGENLYPLV  14
            D P  GVGGMV  PY+MG M L  + AP  VP   LASALAN+PPEQQR MLGE+LYPLV
Sbjct  534  DSPFRGVGGMVPSPYEMGRMTLNDNGAPQQVPSGTLASALANSPPEQQRLMLGESLYPLV  593

Query  13   DQLE  2
            DQLE
Sbjct  594  DQLE  597



>ref|XP_006434727.1| hypothetical protein CICLE_v10000537mg [Citrus clementina]
 gb|ESR47967.1| hypothetical protein CICLE_v10000537mg [Citrus clementina]
Length=651

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 52/69 (75%), Gaps = 5/69 (7%)
 Frame = -1

Query  193  NVSDGPMP-GVGGMVSLPYDMGGMLPRDAA----PVPITALASALANAPPEQQRTMLGEN  29
            N+ D P   G GGM+ +P DMG  +PR  A    P+PITAL++ALANA PEQQRT+LGE+
Sbjct  517  NMQDFPFDMGAGGMLPVPVDMGAGIPRRDASVGQPMPITALSTALANASPEQQRTLLGES  576

Query  28   LYPLVDQLE  2
            LYPLV+QLE
Sbjct  577  LYPLVEQLE  585



>ref|XP_006374904.1| hypothetical protein POPTR_0014s02550g [Populus trichocarpa]
 gb|ERP52701.1| hypothetical protein POPTR_0014s02550g [Populus trichocarpa]
Length=651

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 59/66 (89%), Gaps = 2/66 (3%)
 Frame = -1

Query  193  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA-PVPITALASALANAPPEQQRTMLGENLYP  20
            N+ D PMPGV GGM+S+PYDMGGM  RDAA P+PITALA+ALANA PEQQRTMLGE+LYP
Sbjct  519  NMPDVPMPGVAGGMLSVPYDMGGMPIRDAAQPMPITALATALANATPEQQRTMLGESLYP  578

Query  19   LVDQLE  2
            +VDQLE
Sbjct  579  IVDQLE  584



>ref|XP_011029544.1| PREDICTED: polyadenylate-binding protein 2-like [Populus euphratica]
Length=651

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 59/66 (89%), Gaps = 2/66 (3%)
 Frame = -1

Query  193  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA-PVPITALASALANAPPEQQRTMLGENLYP  20
            N+ D PMPGV GGM+S+PYDMGGM  RDAA P+PITALA+ALANA PEQQRTMLGE+LYP
Sbjct  519  NMPDVPMPGVAGGMLSVPYDMGGMPIRDAAQPMPITALATALANATPEQQRTMLGESLYP  578

Query  19   LVDQLE  2
            +VDQLE
Sbjct  579  IVDQLE  584



>ref|XP_008651618.1| PREDICTED: uncharacterized protein LOC100381531 isoform X1 [Zea 
mays]
Length=656

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 47/61 (77%), Gaps = 3/61 (5%)
 Frame = -1

Query  175  MPGVGGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPLVDQL  5
            M  VG ++  PY+MGGM  RDA    PVPI ALA+ALANA P+QQR MLGENLYPLV+QL
Sbjct  527  MHNVGAVMPSPYEMGGMAMRDAGVSQPVPIGALATALANASPDQQRLMLGENLYPLVEQL  586

Query  4    E  2
            E
Sbjct  587  E  587



>ref|NP_001167831.1| uncharacterized protein LOC100381531 [Zea mays]
 gb|ACN26239.1| unknown [Zea mays]
Length=249

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 47/61 (77%), Gaps = 3/61 (5%)
 Frame = -1

Query  175  MPGVGGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPLVDQL  5
            M  VG ++  PY+MGGM  RDA    PVPI ALA+ALANA P+QQR MLGENLYPLV+QL
Sbjct  120  MHNVGAVMPSPYEMGGMAMRDAGVSQPVPIGALATALANASPDQQRLMLGENLYPLVEQL  179

Query  4    E  2
            E
Sbjct  180  E  180



>ref|XP_007201197.1| hypothetical protein PRUPE_ppa002607mg [Prunus persica]
 gb|EMJ02396.1| hypothetical protein PRUPE_ppa002607mg [Prunus persica]
Length=653

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 55/65 (85%), Gaps = 4/65 (6%)
 Frame = -1

Query  184  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  17
            D PMPGV GGM S+PYDMGGM  RDAA   P+PI ALA+ALANA PEQQRTMLGENLYPL
Sbjct  522  DVPMPGVAGGMFSVPYDMGGMPMRDAALSQPIPIGALATALANATPEQQRTMLGENLYPL  581

Query  16   VDQLE  2
            V+QLE
Sbjct  582  VEQLE  586



>ref|XP_008236485.1| PREDICTED: polyadenylate-binding protein 8 [Prunus mume]
Length=653

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 55/65 (85%), Gaps = 4/65 (6%)
 Frame = -1

Query  184  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  17
            D PMPGV GGM S+PYDMGGM  RDAA   P+PI ALA+ALANA PEQQRTMLGENLYPL
Sbjct  522  DVPMPGVAGGMFSVPYDMGGMPMRDAALSQPIPIGALATALANATPEQQRTMLGENLYPL  581

Query  16   VDQLE  2
            V+QLE
Sbjct  582  VEQLE  586



>ref|XP_002510185.1| polyadenylate-binding protein, putative [Ricinus communis]
 gb|EEF52372.1| polyadenylate-binding protein, putative [Ricinus communis]
Length=658

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 58/68 (85%), Gaps = 4/68 (6%)
 Frame = -1

Query  193  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENL  26
            N+ D PMPGV GGM+S+PYDMGGM  RDAA   PVPITALA+ALANA PE QRT+LGE+L
Sbjct  524  NMPDVPMPGVAGGMLSVPYDMGGMPIRDAAAGQPVPITALATALANASPEHQRTLLGESL  583

Query  25   YPLVDQLE  2
            YPLVDQLE
Sbjct  584  YPLVDQLE  591



>ref|XP_009395913.1| PREDICTED: polyadenylate-binding protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=652

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 53/68 (78%), Gaps = 5/68 (7%)
 Frame = -1

Query  193  NVSDGPMPGV-GGMVSLPYDMGGMLPRDA---APVPITALASALANAPPEQQRTMLGENL  26
            N+ D PMPGV  GM+S PY+MGG+  RD     P+PI ALASALAN+ PEQQR MLGE+L
Sbjct  519  NMPDVPMPGVVSGMLS-PYEMGGLPMRDVPIPQPIPIGALASALANSTPEQQRMMLGESL  577

Query  25   YPLVDQLE  2
            YPLV+QLE
Sbjct  578  YPLVEQLE  585



>gb|AAQ56324.1| putative poly(A)-binding protein [Oryza sativa Japonica Group]
Length=266

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 47/64 (73%), Gaps = 3/64 (5%)
 Frame = -1

Query  184  DGPMPGVGGMVSLPYDMGGMLPRDAAP---VPITALASALANAPPEQQRTMLGENLYPLV  14
            D    GVGG+V  PY+MG M   DA     VPI ALASALAN+PP+QQR MLGE+LYPLV
Sbjct  137  DNAFRGVGGLVPSPYEMGRMPLSDAGAPPQVPIGALASALANSPPDQQRLMLGESLYPLV  196

Query  13   DQLE  2
            DQLE
Sbjct  197  DQLE  200



>gb|EEC83349.1| hypothetical protein OsI_28748 [Oryza sativa Indica Group]
Length=252

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 47/64 (73%), Gaps = 3/64 (5%)
 Frame = -1

Query  184  DGPMPGVGGMVSLPYDMGGMLPRDAAP---VPITALASALANAPPEQQRTMLGENLYPLV  14
            D    GVGG+V  PY+MG M   DA     VPI ALASALAN+PP+QQR MLGE+LYPLV
Sbjct  123  DNAFRGVGGLVPSPYEMGRMPLSDAGAPPQVPIGALASALANSPPDQQRLMLGESLYPLV  182

Query  13   DQLE  2
            DQLE
Sbjct  183  DQLE  186



>ref|NP_001168063.1| uncharacterized protein LOC100381794 [Zea mays]
 gb|ACN26977.1| unknown [Zea mays]
Length=183

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 48/60 (80%), Gaps = 2/60 (3%)
 Frame = -1

Query  175  MPGVGGMVSLPYDMGGMLPRDAAP--VPITALASALANAPPEQQRTMLGENLYPLVDQLE  2
            M  VG ++   Y+MGGM  R+AAP  VPI ALA+ALANAPP+QQR MLGENLYPLV+QLE
Sbjct  55   MHSVGAVMPPSYEMGGMPMREAAPQPVPIGALATALANAPPDQQRLMLGENLYPLVEQLE  114



>ref|XP_009408013.1| PREDICTED: polyadenylate-binding protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=645

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 47/60 (78%), Gaps = 3/60 (5%)
 Frame = -1

Query  178  PMPGV-GGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLVDQLE  2
            P+ G+ GGM SLPYDMGG +P+    VPI  L SALANA  EQQRTMLGE+LYPLVDQLE
Sbjct  521  PVSGIHGGMFSLPYDMGGGMPQ--PTVPIGELTSALANATLEQQRTMLGESLYPLVDQLE  578



>gb|EEE68458.1| hypothetical protein OsJ_26852 [Oryza sativa Japonica Group]
Length=252

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 47/64 (73%), Gaps = 3/64 (5%)
 Frame = -1

Query  184  DGPMPGVGGMVSLPYDMGGMLPRDAAP---VPITALASALANAPPEQQRTMLGENLYPLV  14
            D    GVGG+V  PY+MG M   DA     VPI ALASALAN+PP+QQR MLGE+LYPLV
Sbjct  123  DNAFRGVGGLVPSPYEMGRMPLSDAGAPPQVPIGALASALANSPPDQQRLMLGESLYPLV  182

Query  13   DQLE  2
            DQLE
Sbjct  183  DQLE  186



>gb|AAB61594.1| poly(A)-binding protein, partial [Mesembryanthemum crystallinum]
Length=176

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 41/64 (64%), Positives = 48/64 (75%), Gaps = 3/64 (5%)
 Frame = -1

Query  184  DGPMPGVGGMV--SLPYDMGGMLPRDAAP-VPITALASALANAPPEQQRTMLGENLYPLV  14
            D P+PGV G V   + YDMGGM  RD +P VP+  LA+ LANA PEQQR +LGENLYPLV
Sbjct  42   DAPLPGVTGGVLPGVQYDMGGMPIRDLSPTVPVGTLATLLANATPEQQRLLLGENLYPLV  101

Query  13   DQLE  2
            +QLE
Sbjct  102  EQLE  105



>ref|NP_001061515.1| Os08g0314800 [Oryza sativa Japonica Group]
 dbj|BAC92404.1| putative polyadenylate-binding protein [Oryza sativa Japonica 
Group]
 dbj|BAC92537.1| putative polyadenylate-binding protein [Oryza sativa Japonica 
Group]
 dbj|BAF23429.1| Os08g0314800 [Oryza sativa Japonica Group]
 dbj|BAG89395.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAI39945.1| putative poly(A)-binding protein [Oryza sativa Indica Group]
Length=660

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 47/64 (73%), Gaps = 3/64 (5%)
 Frame = -1

Query  184  DGPMPGVGGMVSLPYDMGGMLPRDAAP---VPITALASALANAPPEQQRTMLGENLYPLV  14
            D    GVGG+V  PY+MG M   DA     VPI ALASALAN+PP+QQR MLGE+LYPLV
Sbjct  531  DNAFRGVGGLVPSPYEMGRMPLSDAGAPPQVPIGALASALANSPPDQQRLMLGESLYPLV  590

Query  13   DQLE  2
            DQLE
Sbjct  591  DQLE  594



>gb|KDO84109.1| hypothetical protein CISIN_1g006282mg [Citrus sinensis]
Length=575

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 51/69 (74%), Gaps = 5/69 (7%)
 Frame = -1

Query  193  NVSDGPMP-GVGGMVSLPYDMGGMLPRDAA----PVPITALASALANAPPEQQRTMLGEN  29
            N+ D P   G G M+ +P DMG  +PR  A    P+PITAL++ALANA PEQQRT+LGE+
Sbjct  441  NMQDFPFDMGAGSMLPVPVDMGAGIPRRDASVGQPMPITALSTALANASPEQQRTLLGES  500

Query  28   LYPLVDQLE  2
            LYPLV+QLE
Sbjct  501  LYPLVEQLE  509



>ref|XP_009398670.1| PREDICTED: polyadenylate-binding protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=643

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 46/64 (72%), Gaps = 6/64 (9%)
 Frame = -1

Query  175  MPGVG---GMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPLV  14
            MP VG   GM S PYDMGGM  R A    PVP+  L SALANA PEQQR MLGE+LYPLV
Sbjct  518  MPEVGNPEGMFSPPYDMGGMPARHAGMSQPVPVGELTSALANATPEQQRLMLGESLYPLV  577

Query  13   DQLE  2
            DQLE
Sbjct  578  DQLE  581



>ref|XP_010263472.1| PREDICTED: polyadenylate-binding protein 2-like [Nelumbo nucifera]
Length=653

 Score = 75.1 bits (183),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 57/68 (84%), Gaps = 4/68 (6%)
 Frame = -1

Query  193  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENL  26
            N+ D PM GV GGM+S+PYDMGGM  RDAA   P+PI ALA+ALANA PEQQRTMLGE+L
Sbjct  519  NMPDVPMSGVAGGMLSVPYDMGGMPLRDAAMSQPIPIGALATALANATPEQQRTMLGESL  578

Query  25   YPLVDQLE  2
            YPLVDQLE
Sbjct  579  YPLVDQLE  586



>gb|KDO84108.1| hypothetical protein CISIN_1g006282mg [Citrus sinensis]
Length=593

 Score = 75.1 bits (183),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 51/69 (74%), Gaps = 5/69 (7%)
 Frame = -1

Query  193  NVSDGPMP-GVGGMVSLPYDMGGMLPRDAA----PVPITALASALANAPPEQQRTMLGEN  29
            N+ D P   G G M+ +P DMG  +PR  A    P+PITAL++ALANA PEQQRT+LGE+
Sbjct  459  NMQDFPFDMGAGSMLPVPVDMGAGIPRRDASVGQPMPITALSTALANASPEQQRTLLGES  518

Query  28   LYPLVDQLE  2
            LYPLV+QLE
Sbjct  519  LYPLVEQLE  527



>gb|KDO84110.1| hypothetical protein CISIN_1g006282mg [Citrus sinensis]
Length=472

 Score = 74.7 bits (182),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 51/69 (74%), Gaps = 5/69 (7%)
 Frame = -1

Query  193  NVSDGPMP-GVGGMVSLPYDMGGMLPRDAA----PVPITALASALANAPPEQQRTMLGEN  29
            N+ D P   G G M+ +P DMG  +PR  A    P+PITAL++ALANA PEQQRT+LGE+
Sbjct  338  NMQDFPFDMGAGSMLPVPVDMGAGIPRRDASVGQPMPITALSTALANASPEQQRTLLGES  397

Query  28   LYPLVDQLE  2
            LYPLV+QLE
Sbjct  398  LYPLVEQLE  406



>ref|XP_006659302.1| PREDICTED: polyadenylate-binding protein 8-like [Oryza brachyantha]
Length=659

 Score = 75.1 bits (183),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 50/66 (76%), Gaps = 3/66 (5%)
 Frame = -1

Query  190  VSDGPMPGVGGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYP  20
            ++D    GVGG+V  PY+MG +   DA    P+PI ALASALAN+PP+QQR MLGE+LYP
Sbjct  528  MTDTGFRGVGGLVPSPYEMGRLPLSDAGAPQPLPIGALASALANSPPDQQRLMLGESLYP  587

Query  19   LVDQLE  2
            LVDQLE
Sbjct  588  LVDQLE  593



>tpg|DAA39543.1| TPA: hypothetical protein ZEAMMB73_983793 [Zea mays]
Length=246

 Score = 72.4 bits (176),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 48/60 (80%), Gaps = 2/60 (3%)
 Frame = -1

Query  175  MPGVGGMVSLPYDMGGMLPRDAAP--VPITALASALANAPPEQQRTMLGENLYPLVDQLE  2
            M  VG ++   Y+MGGM  R+AAP  VPI ALA+ALANAPP+QQR MLGENLYPLV+QLE
Sbjct  118  MHSVGAVMPPSYEMGGMPMREAAPQPVPIGALATALANAPPDQQRLMLGENLYPLVEQLE  177



>ref|XP_006473293.1| PREDICTED: polyadenylate-binding protein 8-like [Citrus sinensis]
Length=652

 Score = 75.1 bits (183),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 51/69 (74%), Gaps = 5/69 (7%)
 Frame = -1

Query  193  NVSDGPMP-GVGGMVSLPYDMGGMLPRDAA----PVPITALASALANAPPEQQRTMLGEN  29
            N+ D P   G G M+ +P DMG  +PR  A    P+PITAL++ALANA PEQQRT+LGE+
Sbjct  518  NMQDFPFDMGAGSMLPVPVDMGAGIPRRDASVGQPMPITALSTALANASPEQQRTLLGES  577

Query  28   LYPLVDQLE  2
            LYPLV+QLE
Sbjct  578  LYPLVEQLE  586



>gb|KDO84107.1| hypothetical protein CISIN_1g006282mg [Citrus sinensis]
Length=652

 Score = 75.1 bits (183),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 51/69 (74%), Gaps = 5/69 (7%)
 Frame = -1

Query  193  NVSDGPMP-GVGGMVSLPYDMGGMLPRDAA----PVPITALASALANAPPEQQRTMLGEN  29
            N+ D P   G G M+ +P DMG  +PR  A    P+PITAL++ALANA PEQQRT+LGE+
Sbjct  518  NMQDFPFDMGAGSMLPVPVDMGAGIPRRDASVGQPMPITALSTALANASPEQQRTLLGES  577

Query  28   LYPLVDQLE  2
            LYPLV+QLE
Sbjct  578  LYPLVEQLE  586



>ref|XP_008220252.1| PREDICTED: polyadenylate-binding protein 2-like [Prunus mume]
Length=651

 Score = 74.7 bits (182),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 50/66 (76%), Gaps = 2/66 (3%)
 Frame = -1

Query  193  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAAP-VPITALASALANAPPEQQRTMLGENLYP  20
            N+ + P  GV  GM+S+PYDMGG+  RDAA    + ALA+ALANA  EQQRTMLGE LYP
Sbjct  520  NMQEVPFSGVPSGMLSVPYDMGGIPMRDAAGGQGVPALATALANASTEQQRTMLGEALYP  579

Query  19   LVDQLE  2
            LVDQLE
Sbjct  580  LVDQLE  585



>ref|XP_007226962.1| hypothetical protein PRUPE_ppa002618mg [Prunus persica]
 ref|XP_007226963.1| hypothetical protein PRUPE_ppa002618mg [Prunus persica]
 gb|EMJ28161.1| hypothetical protein PRUPE_ppa002618mg [Prunus persica]
 gb|EMJ28162.1| hypothetical protein PRUPE_ppa002618mg [Prunus persica]
Length=651

 Score = 74.7 bits (182),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 50/66 (76%), Gaps = 2/66 (3%)
 Frame = -1

Query  193  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAAP-VPITALASALANAPPEQQRTMLGENLYP  20
            N+ + P  GV  GM+S+PYDMGG+  RDAA    + ALA+ALANA  EQQRTMLGE LYP
Sbjct  520  NMQEVPFSGVPSGMLSVPYDMGGIPMRDAAGGQGVPALATALANASTEQQRTMLGEALYP  579

Query  19   LVDQLE  2
            LVDQLE
Sbjct  580  LVDQLE  585



>ref|XP_002284923.1| PREDICTED: polyadenylate-binding protein 8 isoform X1 [Vitis 
vinifera]
 ref|XP_010664560.1| PREDICTED: polyadenylate-binding protein 8 isoform X2 [Vitis 
vinifera]
 emb|CAN76464.1| hypothetical protein VITISV_017035 [Vitis vinifera]
Length=640

 Score = 74.3 bits (181),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 59/68 (87%), Gaps = 4/68 (6%)
 Frame = -1

Query  193  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENL  26
            N+ D PMPGV GGM+S+PYDMGG+  RDAA   P+PI+ALASALANA P+QQRTMLGE+L
Sbjct  507  NMPDVPMPGVAGGMLSIPYDMGGVPLRDAAIGQPMPISALASALANATPDQQRTMLGESL  566

Query  25   YPLVDQLE  2
            YPLVDQLE
Sbjct  567  YPLVDQLE  574



>ref|NP_564554.1| poly(A) binding protein 8 [Arabidopsis thaliana]
 ref|NP_001185184.1| poly(A) binding protein 8 [Arabidopsis thaliana]
 sp|Q9FXA2.1|PABP8_ARATH RecName: Full=Polyadenylate-binding protein 8; Short=PABP-8; 
Short=Poly(A)-binding protein 8 [Arabidopsis thaliana]
 gb|AAG13056.1|AC011807_15 Putative Poly-A Binding Protein [Arabidopsis thaliana]
 gb|AAK43894.1|AF370517_1 Putative Poly-A Binding Protein [Arabidopsis thaliana]
 gb|AAL47336.1| putative Poly-A Binding Protein [Arabidopsis thaliana]
 gb|AEE32472.1| poly(A) binding protein 8 [Arabidopsis thaliana]
 gb|AEE32473.1| poly(A) binding protein 8 [Arabidopsis thaliana]
Length=671

 Score = 74.3 bits (181),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 49/65 (75%), Gaps = 7/65 (11%)
 Frame = -1

Query  175  MPG-VGGMVSLPYDM---GGMLPRDA---APVPITALASALANAPPEQQRTMLGENLYPL  17
            MPG    M+S+PYD+   GG+  RD+    PVPI ALA+ LANA PEQQRTMLGENLYPL
Sbjct  541  MPGPTQNMLSVPYDVSSGGGVHHRDSPTSQPVPIVALATRLANAAPEQQRTMLGENLYPL  600

Query  16   VDQLE  2
            V+QLE
Sbjct  601  VEQLE  605



>tpg|DAA39541.1| TPA: hypothetical protein ZEAMMB73_983793 [Zea mays]
Length=654

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 48/60 (80%), Gaps = 2/60 (3%)
 Frame = -1

Query  175  MPGVGGMVSLPYDMGGMLPRDAAP--VPITALASALANAPPEQQRTMLGENLYPLVDQLE  2
            M  VG ++   Y+MGGM  R+AAP  VPI ALA+ALANAPP+QQR MLGENLYPLV+QLE
Sbjct  526  MHSVGAVMPPSYEMGGMPMREAAPQPVPIGALATALANAPPDQQRLMLGENLYPLVEQLE  585



>tpg|DAA39542.1| TPA: hypothetical protein ZEAMMB73_983793 [Zea mays]
Length=648

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 48/60 (80%), Gaps = 2/60 (3%)
 Frame = -1

Query  175  MPGVGGMVSLPYDMGGMLPRDAAP--VPITALASALANAPPEQQRTMLGENLYPLVDQLE  2
            M  VG ++   Y+MGGM  R+AAP  VPI ALA+ALANAPP+QQR MLGENLYPLV+QLE
Sbjct  520  MHSVGAVMPPSYEMGGMPMREAAPQPVPIGALATALANAPPDQQRLMLGENLYPLVEQLE  579



>gb|EEE61291.1| hypothetical protein OsJ_15377 [Oryza sativa Japonica Group]
Length=613

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 45/61 (74%), Gaps = 2/61 (3%)
 Frame = -1

Query  178  PMPGVGGMVSLPYDMGGMLPRDA--APVPITALASALANAPPEQQRTMLGENLYPLVDQL  5
            PMPGV G +   YDMGG   RDA  +P PI  L SALANA PEQQRT+LGE+LYPLV+ L
Sbjct  486  PMPGVAGGMIQSYDMGGFPVRDAGLSPAPIGTLTSALANANPEQQRTILGESLYPLVELL  545

Query  4    E  2
            E
Sbjct  546  E  546



>gb|AFW58788.1| hypothetical protein ZEAMMB73_448418 [Zea mays]
Length=212

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 44/61 (72%), Gaps = 3/61 (5%)
 Frame = -1

Query  175  MPGVGGMVSLPYDMGGMLPRDAAPVP---ITALASALANAPPEQQRTMLGENLYPLVDQL  5
            MPGV G +   YDMGG   RDAA  P   I  L SALANA PEQQRT+LGENLYPLV+QL
Sbjct  85   MPGVAGGMIQAYDMGGFPVRDAALSPAAQIGTLTSALANANPEQQRTILGENLYPLVEQL  144

Query  4    E  2
            E
Sbjct  145  E  145



>ref|XP_009147891.1| PREDICTED: polyadenylate-binding protein 8 [Brassica rapa]
 emb|CDY51045.1| BnaA06g03080D [Brassica napus]
Length=653

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 50/66 (76%), Gaps = 7/66 (11%)
 Frame = -1

Query  178  PMPGVG-GMVSLPYDM--GGMLPRDA----APVPITALASALANAPPEQQRTMLGENLYP  20
            PMPG+   M+S+PYD+  GG   RD+     PVPI ALA++LANA PE QRTMLGENLYP
Sbjct  521  PMPGLTPNMLSVPYDVSGGGAHLRDSPAASQPVPIGALATSLANAAPEHQRTMLGENLYP  580

Query  19   LVDQLE  2
            LV+QLE
Sbjct  581  LVEQLE  586



>ref|XP_010691731.1| PREDICTED: polyadenylate-binding protein 2-like [Beta vulgaris 
subsp. vulgaris]
Length=667

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 50/66 (76%), Gaps = 5/66 (8%)
 Frame = -1

Query  184  DGPMPGV-GGMV-SLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYP  20
            DGP+PGV GGM+  + +DMGGM  RDAA    VP+  LA+ LANA PE QR +LGENLYP
Sbjct  528  DGPIPGVTGGMLPGVQFDMGGMPVRDAALSPTVPVGTLATLLANATPEHQRLLLGENLYP  587

Query  19   LVDQLE  2
            LV+QLE
Sbjct  588  LVEQLE  593



>ref|XP_002313862.1| polyadenylate-binding family protein [Populus trichocarpa]
 gb|EEE87817.1| polyadenylate-binding family protein [Populus trichocarpa]
Length=642

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/65 (75%), Positives = 55/65 (85%), Gaps = 4/65 (6%)
 Frame = -1

Query  184  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  17
            D PM GV GGM+S+PYDMGGM  RDAA   P+PI ALA+ALANA P+QQRTMLGENLYPL
Sbjct  513  DVPMTGVAGGMLSVPYDMGGMPMRDAALSQPIPIGALATALANATPDQQRTMLGENLYPL  572

Query  16   VDQLE  2
            V+QLE
Sbjct  573  VEQLE  577



>ref|XP_002448132.1| hypothetical protein SORBIDRAFT_06g021850 [Sorghum bicolor]
 gb|EES12460.1| hypothetical protein SORBIDRAFT_06g021850 [Sorghum bicolor]
Length=664

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 44/61 (72%), Gaps = 3/61 (5%)
 Frame = -1

Query  175  MPGVGGMVSLPYDMGGMLPRDAAPVP---ITALASALANAPPEQQRTMLGENLYPLVDQL  5
            MPGV G +   YDMGG   RDAA  P   I  L SALANA PEQQRT+LGENLYPLV+QL
Sbjct  537  MPGVAGGMIQAYDMGGFPVRDAAVSPAAQIGTLTSALANANPEQQRTILGENLYPLVEQL  596

Query  4    E  2
            E
Sbjct  597  E  597



>ref|XP_008663371.1| PREDICTED: polyadenylate-binding protein 2-like [Zea mays]
Length=652

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 44/61 (72%), Gaps = 3/61 (5%)
 Frame = -1

Query  175  MPGVGGMVSLPYDMGGMLPRDAAPVP---ITALASALANAPPEQQRTMLGENLYPLVDQL  5
            MPGV G +   YDMGG   RDAA  P   I  L SALANA PEQQRT+LGENLYPLV+QL
Sbjct  525  MPGVAGGMIQAYDMGGFPVRDAALSPAAQIGTLTSALANANPEQQRTILGENLYPLVEQL  584

Query  4    E  2
            E
Sbjct  585  E  585



>emb|CDY54068.1| BnaCnng26160D [Brassica napus]
Length=653

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 50/66 (76%), Gaps = 7/66 (11%)
 Frame = -1

Query  178  PMPGVG-GMVSLPYDM--GGMLPRDA----APVPITALASALANAPPEQQRTMLGENLYP  20
            PMPG+   M+S+PYD+  GG   RD+     PVPI ALA++LANA PE QRTMLGENLYP
Sbjct  521  PMPGLTPNMLSVPYDVSGGGAHLRDSPAASQPVPIGALATSLANAAPEHQRTMLGENLYP  580

Query  19   LVDQLE  2
            LV+QLE
Sbjct  581  LVEQLE  586



>gb|EEC77593.1| hypothetical protein OsI_16552 [Oryza sativa Indica Group]
Length=659

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 45/61 (74%), Gaps = 2/61 (3%)
 Frame = -1

Query  178  PMPGVGGMVSLPYDMGGMLPRDA--APVPITALASALANAPPEQQRTMLGENLYPLVDQL  5
            PMPGV G +   YDMGG   RDA  +P PI  L SALANA PEQQRT+LGE+LYPLV+ L
Sbjct  532  PMPGVAGGMIQSYDMGGFPVRDAGLSPAPIGTLTSALANANPEQQRTILGESLYPLVELL  591

Query  4    E  2
            E
Sbjct  592  E  592



>ref|NP_001053248.1| Os04g0504800 [Oryza sativa Japonica Group]
 emb|CAE05558.1| OSJNBb0116K07.11 [Oryza sativa Japonica Group]
 dbj|BAF15162.1| Os04g0504800 [Oryza sativa Japonica Group]
 dbj|BAG90316.1| unnamed protein product [Oryza sativa Japonica Group]
Length=659

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 45/61 (74%), Gaps = 2/61 (3%)
 Frame = -1

Query  178  PMPGVGGMVSLPYDMGGMLPRDA--APVPITALASALANAPPEQQRTMLGENLYPLVDQL  5
            PMPGV G +   YDMGG   RDA  +P PI  L SALANA PEQQRT+LGE+LYPLV+ L
Sbjct  532  PMPGVAGGMIQSYDMGGFPVRDAGLSPAPIGTLTSALANANPEQQRTILGESLYPLVELL  591

Query  4    E  2
            E
Sbjct  592  E  592



>emb|CAE02947.3| OSJNBa0014K14.19 [Oryza sativa Japonica Group]
Length=657

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 45/61 (74%), Gaps = 2/61 (3%)
 Frame = -1

Query  178  PMPGVGGMVSLPYDMGGMLPRDA--APVPITALASALANAPPEQQRTMLGENLYPLVDQL  5
            PMPGV G +   YDMGG   RDA  +P PI  L SALANA PEQQRT+LGE+LYPLV+ L
Sbjct  530  PMPGVAGGMIQSYDMGGFPVRDAGLSPAPIGTLTSALANANPEQQRTILGESLYPLVELL  589

Query  4    E  2
            E
Sbjct  590  E  590



>ref|NP_001151785.1| LOC100285420 [Zea mays]
 gb|ACG44303.1| polyadenylate-binding protein 2 [Zea mays]
 tpg|DAA37055.1| TPA: polyadenylate-binding protein 2 [Zea mays]
Length=660

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 44/61 (72%), Gaps = 3/61 (5%)
 Frame = -1

Query  175  MPGVGGMVSLPYDMGGMLPRDAAPVP---ITALASALANAPPEQQRTMLGENLYPLVDQL  5
            MPGV G +   YDMGG   RDAA  P   I  L SALANA PEQQRT+LGENLYPLV+QL
Sbjct  533  MPGVAGGMMQAYDMGGFPVRDAALSPAAQIGTLTSALANANPEQQRTILGENLYPLVEQL  592

Query  4    E  2
            E
Sbjct  593  E  593



>ref|XP_002301171.2| hypothetical protein POPTR_0002s12570g [Populus trichocarpa]
 gb|EEE80444.2| hypothetical protein POPTR_0002s12570g [Populus trichocarpa]
Length=657

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 57/68 (84%), Gaps = 4/68 (6%)
 Frame = -1

Query  193  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENL  26
            N+ D PMPGV GGM+S+PYDMG M  RDAA   P+PITALA+ALANA PEQQRTMLGE L
Sbjct  517  NMPDVPMPGVAGGMLSVPYDMGVMPIRDAAGGQPMPITALATALANATPEQQRTMLGEGL  576

Query  25   YPLVDQLE  2
            YPLVDQLE
Sbjct  577  YPLVDQLE  584



>emb|CDP01307.1| unnamed protein product [Coffea canephora]
Length=658

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 52/67 (78%), Gaps = 3/67 (4%)
 Frame = -1

Query  193  NVSDGPMPGVGGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLY  23
            +V D  MPGV G V  PYDMGG LPR+     P+P TALASALANA PEQQRTMLGENLY
Sbjct  528  SVPDVRMPGVAGGVLSPYDMGGTLPREGTIGQPMPTTALASALANASPEQQRTMLGENLY  587

Query  22   PLVDQLE  2
            PLVDQLE
Sbjct  588  PLVDQLE  594



>ref|XP_004304018.1| PREDICTED: polyadenylate-binding protein 8-like [Fragaria vesca 
subsp. vesca]
Length=651

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 43/53 (81%), Gaps = 3/53 (6%)
 Frame = -1

Query  151  SLPYDMGGMLPRD---AAPVPITALASALANAPPEQQRTMLGENLYPLVDQLE  2
            S+PYD+ GM  RD   + P+PI  LASALANA PEQQRTMLGE+LYPLVDQLE
Sbjct  532  SVPYDLSGMPLRDPALSQPLPIGTLASALANATPEQQRTMLGESLYPLVDQLE  584



>ref|XP_008347611.1| PREDICTED: polyadenylate-binding protein 8-like [Malus domestica]
Length=213

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 49/66 (74%), Gaps = 2/66 (3%)
 Frame = -1

Query  193  NVSDGPMPGVGG-MVSLPYDMGGMLPRDAAP-VPITALASALANAPPEQQRTMLGENLYP  20
            N+ + P  GVGG M S+PYDMG +  RDAA    + ALA+ALANA  EQQRTMLGE LYP
Sbjct  87   NMQEVPFSGVGGGMHSVPYDMGPIPIRDAAGGQGVPALATALANASTEQQRTMLGEALYP  146

Query  19   LVDQLE  2
            LVDQLE
Sbjct  147  LVDQLE  152



>ref|XP_008364810.1| PREDICTED: polyadenylate-binding protein 8-like [Malus domestica]
Length=652

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 55/69 (80%), Gaps = 8/69 (12%)
 Frame = -1

Query  184  DGPMPGV-GGMVSLPYDMGG---MLPRDAA----PVPITALASALANAPPEQQRTMLGEN  29
            DGPMPGV GGM S+PYDMGG   M  RDAA     VPI ALA+ALANA PEQQRTMLGEN
Sbjct  517  DGPMPGVAGGMFSVPYDMGGGGSMPIRDAAVSQPTVPIGALATALANATPEQQRTMLGEN  576

Query  28   LYPLVDQLE  2
            LYPLV+QLE
Sbjct  577  LYPLVEQLE  585



>ref|XP_002518733.1| polyadenylate-binding protein, putative [Ricinus communis]
 gb|EEF43658.1| polyadenylate-binding protein, putative [Ricinus communis]
Length=644

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 54/65 (83%), Gaps = 4/65 (6%)
 Frame = -1

Query  184  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  17
            D PM GV GGM+S+PYDM GM  RDAA   P+PI ALASALANA PEQQRTMLGENLYPL
Sbjct  514  DVPMTGVAGGMLSVPYDMSGMPMRDAALSQPIPIGALASALANASPEQQRTMLGENLYPL  573

Query  16   VDQLE  2
            V+QLE
Sbjct  574  VEQLE  578



>gb|ABK94932.1| unknown [Populus trichocarpa]
Length=408

 Score = 71.6 bits (174),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 49/65 (75%), Positives = 55/65 (85%), Gaps = 4/65 (6%)
 Frame = -1

Query  184  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  17
            D PM GV GGM+S+PYDMGGM  RDAA   P+PI ALA+ALANA P+QQRTMLGENLYPL
Sbjct  279  DVPMTGVAGGMLSVPYDMGGMPMRDAALSQPIPIGALATALANATPDQQRTMLGENLYPL  338

Query  16   VDQLE  2
            V+QLE
Sbjct  339  VEQLE  343



>gb|EYU37653.1| hypothetical protein MIMGU_mgv1a002809mg [Erythranthe guttata]
Length=635

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 42/57 (74%), Gaps = 3/57 (5%)
 Frame = -1

Query  163  GGMVSLPYDMGGMLPRD---AAPVPITALASALANAPPEQQRTMLGENLYPLVDQLE  2
            GGM S+PY MG M   D   + P PI AL SALAN+ P +QRTMLGENLYPLV+QLE
Sbjct  520  GGMFSVPYQMGNMPSHDGGMSRPTPIGALTSALANSSPTEQRTMLGENLYPLVEQLE  576



>ref|XP_006421219.1| hypothetical protein CICLE_v10007158mg, partial [Citrus clementina]
 gb|ESR34459.1| hypothetical protein CICLE_v10007158mg, partial [Citrus clementina]
Length=437

 Score = 71.6 bits (174),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 51/69 (74%), Gaps = 5/69 (7%)
 Frame = -1

Query  193  NVSDGPMPGVGG-MVSLPYDMGGMLPRDAA----PVPITALASALANAPPEQQRTMLGEN  29
            N+ D PM GV G M+ +P+DMG  +PR  A    P PIT L++ALANA PEQ+RT+ GE+
Sbjct  284  NMQDVPMQGVAGCMLPIPFDMGAGMPRRDASVGQPTPITPLSTALANASPEQRRTLPGES  343

Query  28   LYPLVDQLE  2
            LYPL++QLE
Sbjct  344  LYPLIEQLE  352



>ref|XP_006404818.1| hypothetical protein EUTSA_v10000075mg [Eutrema salsugineum]
 gb|ESQ46271.1| hypothetical protein EUTSA_v10000075mg [Eutrema salsugineum]
Length=652

 Score = 72.0 bits (175),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 48/65 (74%), Gaps = 6/65 (9%)
 Frame = -1

Query  193  NVSDGPMPGVGGMVSLPYDMGGM-LPRDAAPVPITALASALANAPPEQQRTMLGENLYPL  17
            N+ DG MPG  GMV + YDM GM  P+   P+P  ALAS+LA A P QQRT+LGENLYPL
Sbjct  522  NMQDGSMPG--GMVPVAYDMNGMPFPQ---PMPAGALASSLAQASPAQQRTLLGENLYPL  576

Query  16   VDQLE  2
            VDQ+E
Sbjct  577  VDQIE  581



>ref|XP_008378021.1| PREDICTED: polyadenylate-binding protein 2-like [Malus domestica]
Length=648

 Score = 72.0 bits (175),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 49/66 (74%), Gaps = 2/66 (3%)
 Frame = -1

Query  193  NVSDGPMPGVGG-MVSLPYDMGGMLPRDAAP-VPITALASALANAPPEQQRTMLGENLYP  20
            N+ + P  GVGG M S+PYDMG +  RDAA    + ALA+ALANA  EQQRTMLGE LYP
Sbjct  522  NMQEVPFSGVGGGMHSVPYDMGPIPIRDAAGGQGVPALATALANASTEQQRTMLGEALYP  581

Query  19   LVDQLE  2
            LVDQLE
Sbjct  582  LVDQLE  587



>ref|XP_008393785.1| PREDICTED: polyadenylate-binding protein 2-like [Malus domestica]
 ref|XP_008351992.1| PREDICTED: polyadenylate-binding protein 2-like [Malus domestica]
Length=649

 Score = 71.6 bits (174),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 49/66 (74%), Gaps = 2/66 (3%)
 Frame = -1

Query  193  NVSDGPMPGVG-GMVSLPYDMGGMLPRDAAP-VPITALASALANAPPEQQRTMLGENLYP  20
            N+ + P  GVG GM+ +PYDMG +  RDAA    + ALA+ALANA  EQQRTMLGE LYP
Sbjct  523  NMQEVPFSGVGSGMLPVPYDMGAIPMRDAAGGQGVPALATALANASTEQQRTMLGEALYP  582

Query  19   LVDQLE  2
            LVDQLE
Sbjct  583  LVDQLE  588



>ref|XP_009359888.1| PREDICTED: polyadenylate-binding protein 2-like [Pyrus x bretschneideri]
 ref|XP_009359896.1| PREDICTED: polyadenylate-binding protein 2-like [Pyrus x bretschneideri]
Length=650

 Score = 71.6 bits (174),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 49/66 (74%), Gaps = 2/66 (3%)
 Frame = -1

Query  193  NVSDGPMPGVG-GMVSLPYDMGGMLPRDAAP-VPITALASALANAPPEQQRTMLGENLYP  20
            N+ + P  GVG GM+ +PYDMG +  RDAA    + ALA+ALANA  EQQRTMLGE LYP
Sbjct  524  NMQEVPFSGVGSGMLPVPYDMGAIPMRDAAGGQGVPALATALANASTEQQRTMLGEALYP  583

Query  19   LVDQLE  2
            LVDQLE
Sbjct  584  LVDQLE  589



>ref|XP_002891531.1| PAB8 binding protein 8 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67790.1| PAB8 binding protein 8 [Arabidopsis lyrata subsp. lyrata]
Length=669

 Score = 71.6 bits (174),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 49/65 (75%), Gaps = 7/65 (11%)
 Frame = -1

Query  175  MPGVG-GMVSLPYDM---GGMLPRDA---APVPITALASALANAPPEQQRTMLGENLYPL  17
            MPG+   M+S+PYD+   GG+  RD+     VPI ALA+ LANA PEQQRTMLGENLYPL
Sbjct  539  MPGLTPNMLSVPYDVSSGGGVHHRDSPASQSVPIGALATQLANAAPEQQRTMLGENLYPL  598

Query  16   VDQLE  2
            V+QLE
Sbjct  599  VEQLE  603



>ref|XP_007153579.1| hypothetical protein PHAVU_003G0475001g, partial [Phaseolus vulgaris]
 gb|ESW25573.1| hypothetical protein PHAVU_003G0475001g, partial [Phaseolus vulgaris]
Length=561

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 49/65 (75%), Positives = 54/65 (83%), Gaps = 4/65 (6%)
 Frame = -1

Query  184  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  17
            D PMPGV GGM S+PYD+GGM  RDA+    +PI ALASALANA PEQQRTMLGENLYPL
Sbjct  432  DVPMPGVAGGMFSVPYDVGGMPLRDASHSQQIPIGALASALANASPEQQRTMLGENLYPL  491

Query  16   VDQLE  2
            V+QLE
Sbjct  492  VEQLE  496



>ref|XP_010928350.1| PREDICTED: polyadenylate-binding protein 8-like isoform X2 [Elaeis 
guineensis]
Length=633

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 55/68 (81%), Gaps = 4/68 (6%)
 Frame = -1

Query  193  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENL  26
            N+ D PMPGV GGM+S PYDMG M  RDA    P+PI ALASALANA PEQQRTMLGE+L
Sbjct  498  NMPDVPMPGVAGGMLSAPYDMGVMPMRDAGMSQPIPIGALASALANASPEQQRTMLGESL  557

Query  25   YPLVDQLE  2
            YPLVDQLE
Sbjct  558  YPLVDQLE  565



>ref|XP_010928349.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Elaeis 
guineensis]
Length=658

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 55/68 (81%), Gaps = 4/68 (6%)
 Frame = -1

Query  193  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENL  26
            N+ D PMPGV GGM+S PYDMG M  RDA    P+PI ALASALANA PEQQRTMLGE+L
Sbjct  523  NMPDVPMPGVAGGMLSAPYDMGVMPMRDAGMSQPIPIGALASALANASPEQQRTMLGESL  582

Query  25   YPLVDQLE  2
            YPLVDQLE
Sbjct  583  YPLVDQLE  590



>ref|XP_011017176.1| PREDICTED: polyadenylate-binding protein 8-like [Populus euphratica]
Length=651

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 57/68 (84%), Gaps = 4/68 (6%)
 Frame = -1

Query  193  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENL  26
            N+ D PMPGV GGM+S+PYDMG M  RDAA   P+PITALA+ALANA PEQQR MLGE+L
Sbjct  517  NMPDVPMPGVAGGMLSVPYDMGVMPIRDAAGGQPMPITALATALANATPEQQRMMLGESL  576

Query  25   YPLVDQLE  2
            YPLVDQLE
Sbjct  577  YPLVDQLE  584



>ref|XP_008373847.1| PREDICTED: polyadenylate-binding protein 8-like [Malus domestica]
 ref|XP_008364535.1| PREDICTED: polyadenylate-binding protein 8-like [Malus domestica]
Length=658

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 50/69 (72%), Positives = 55/69 (80%), Gaps = 8/69 (12%)
 Frame = -1

Query  184  DGPMPGV-GGMVSLPYDM---GGMLPRDAA----PVPITALASALANAPPEQQRTMLGEN  29
            DGPMPGV GGM S+PYD+   GGM  RDAA     +PI ALA+ALANA PEQQRTMLGEN
Sbjct  523  DGPMPGVAGGMFSVPYDISGGGGMPIRDAALSQPTIPIGALATALANATPEQQRTMLGEN  582

Query  28   LYPLVDQLE  2
            LYPLV+QLE
Sbjct  583  LYPLVEQLE  591



>dbj|BAJ97269.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=663

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 46/64 (72%), Gaps = 3/64 (5%)
 Frame = -1

Query  184  DGPMPGVGGMVSLPYDMGGMLPRDA-APVPIT--ALASALANAPPEQQRTMLGENLYPLV  14
            +    GVGGM    Y+MG M P D  AP  ++  ALASALAN+PPEQQR MLGE+LYPLV
Sbjct  533  EAAFRGVGGMAPSLYEMGRMTPGDTGAPQQVSSGALASALANSPPEQQRLMLGESLYPLV  592

Query  13   DQLE  2
            DQLE
Sbjct  593  DQLE  596



>dbj|BAJ90169.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87575.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=663

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 46/64 (72%), Gaps = 3/64 (5%)
 Frame = -1

Query  184  DGPMPGVGGMVSLPYDMGGMLPRDA-APVPIT--ALASALANAPPEQQRTMLGENLYPLV  14
            +    GVGGM    Y+MG M P D  AP  ++  ALASALAN+PPEQQR MLGE+LYPLV
Sbjct  533  EAAFRGVGGMAPSLYEMGRMTPGDTGAPQQVSSGALASALANSPPEQQRLMLGESLYPLV  592

Query  13   DQLE  2
            DQLE
Sbjct  593  DQLE  596



>ref|XP_006393217.1| hypothetical protein EUTSA_v10011289mg [Eutrema salsugineum]
 gb|ESQ30503.1| hypothetical protein EUTSA_v10011289mg [Eutrema salsugineum]
Length=669

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 49/66 (74%), Gaps = 8/66 (12%)
 Frame = -1

Query  175  MPGVG-GMVSLPYDM----GGMLPRDA---APVPITALASALANAPPEQQRTMLGENLYP  20
            MPG+   M+S+PYD+    GG   RD+    PVPI ALA++LANA PE QRTMLGENLYP
Sbjct  537  MPGLTPNMLSVPYDVSGGAGGGHLRDSPAGQPVPIGALATSLANAAPEHQRTMLGENLYP  596

Query  19   LVDQLE  2
            LV+QLE
Sbjct  597  LVEQLE  602



>gb|EYU36333.1| hypothetical protein MIMGU_mgv1a002664mg [Erythranthe guttata]
Length=649

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 49/57 (86%), Gaps = 6/57 (11%)
 Frame = -1

Query  154  VSLPYDMGGMLPRDAAPV------PITALASALANAPPEQQRTMLGENLYPLVDQLE  2
            +S+PYDMGGMLPRD+AP+      PITALA+ALANA PEQQR MLGENLYPLVDQLE
Sbjct  528  LSVPYDMGGMLPRDSAPIQPQQPMPITALATALANATPEQQRIMLGENLYPLVDQLE  584



>ref|XP_008795896.1| PREDICTED: polyadenylate-binding protein 2-like [Phoenix dactylifera]
Length=660

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 54/65 (83%), Gaps = 4/65 (6%)
 Frame = -1

Query  184  DGPMPGV-GGMVSLPYDMGGMLPRD---AAPVPITALASALANAPPEQQRTMLGENLYPL  17
            D P+PGV GGM+S PYD+GGM  RD   + P+PI ALASALANA PEQQRTMLGE+LYPL
Sbjct  526  DVPVPGVAGGMLSAPYDIGGMPLRDPGMSQPIPIGALASALANASPEQQRTMLGESLYPL  585

Query  16   VDQLE  2
            VDQLE
Sbjct  586  VDQLE  590



>gb|AGF69179.1| polyadenylate-binding protein 2-like protein, partial [Triticum 
aestivum]
Length=497

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 46/63 (73%), Gaps = 6/63 (10%)
 Frame = -1

Query  178  PMPGVGGMVSLPYDMGGMLPRDA----APVPITALASALANAPPEQQRTMLGENLYPLVD  11
            P  GVGGMV  PYDMG    RDA    AP PI  L SALANA PEQQRT+LGE+LYPLV+
Sbjct  420  PGVGVGGMVQ-PYDMGSFPVRDAGVSPAP-PIGTLTSALANATPEQQRTILGESLYPLVE  477

Query  10   QLE  2
            +LE
Sbjct  478  KLE  480



>gb|KFK32750.1| poly binding protein [Arabis alpina]
Length=646

 Score = 69.3 bits (168),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 48/64 (75%), Gaps = 4/64 (6%)
 Frame = -1

Query  193  NVSDGPMPGVGGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLV  14
            N+ DGPMPG  GMV + YDM GM      P+P  ALAS+LA+A P QQRT+LGE+LYPLV
Sbjct  517  NMPDGPMPG--GMVPVAYDMNGMPF--GQPMPTGALASSLASATPAQQRTILGESLYPLV  572

Query  13   DQLE  2
            DQ+E
Sbjct  573  DQIE  576



>gb|EMS47633.1| Polyadenylate-binding protein 2 [Triticum urartu]
Length=567

 Score = 68.9 bits (167),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 47/67 (70%), Gaps = 6/67 (9%)
 Frame = -1

Query  190  VSDGPMPGVGGMVSLPYDMGGMLPRDA----APVPITALASALANAPPEQQRTMLGENLY  23
            V   P  GVGGMV  PYDMG    RDA    AP PI  L SALANA PEQQRT+LGE+LY
Sbjct  436  VQQMPGVGVGGMVQ-PYDMGSFPVRDAGVSPAP-PIGTLTSALANATPEQQRTILGESLY  493

Query  22   PLVDQLE  2
            PLV++LE
Sbjct  494  PLVEKLE  500



>gb|KFK35979.1| hypothetical protein AALP_AA4G062600 [Arabis alpina]
Length=671

 Score = 69.3 bits (168),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 49/67 (73%), Gaps = 9/67 (13%)
 Frame = -1

Query  175  MPGVG-GMVSLPYDMGG-----MLPRDA---APVPITALASALANAPPEQQRTMLGENLY  23
            MPG+   M+S+PYD+ G     +  RD+    PVPI ALA++LANA PE QRTMLGENLY
Sbjct  538  MPGLTPNMLSVPYDVSGAGGGNVHLRDSPSSQPVPIGALATSLANAAPEHQRTMLGENLY  597

Query  22   PLVDQLE  2
            PLV+QLE
Sbjct  598  PLVEQLE  604



>dbj|BAJ86310.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=746

 Score = 68.9 bits (167),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 46/63 (73%), Gaps = 6/63 (10%)
 Frame = -1

Query  178  PMPGVGGMVSLPYDMGGMLPRDA----APVPITALASALANAPPEQQRTMLGENLYPLVD  11
            P  GVGGMV  PYDMG    RDA    AP PI  L SALANA PEQQRT+LGE+LYPLV+
Sbjct  619  PGVGVGGMVQ-PYDMGSFPVRDAGVSPAP-PIGTLTSALANATPEQQRTILGESLYPLVE  676

Query  10   QLE  2
            +LE
Sbjct  677  KLE  679



>ref|XP_010527159.1| PREDICTED: polyadenylate-binding protein 4-like, partial [Tarenaya 
hassleriana]
Length=636

 Score = 68.6 bits (166),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 49/65 (75%), Gaps = 6/65 (9%)
 Frame = -1

Query  193  NVSDGPMPGVGGMVSLPYDMGGM-LPRDAAPVPITALASALANAPPEQQRTMLGENLYPL  17
            N+ DGP+PG  G++ + YDM GM  P+   P+   ALASALANA P QQRT+LGE+LYPL
Sbjct  517  NMPDGPIPG--GILPVAYDMTGMPFPQ---PLSTGALASALANATPAQQRTLLGEHLYPL  571

Query  16   VDQLE  2
            VDQLE
Sbjct  572  VDQLE  576



>gb|EMT11581.1| Polyadenylate-binding protein 2 [Aegilops tauschii]
Length=195

 Score = 65.9 bits (159),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 44/64 (69%), Gaps = 3/64 (5%)
 Frame = -1

Query  184  DGPMPGVGGMVSLPYDMGGMLPRD-AAPVPIT--ALASALANAPPEQQRTMLGENLYPLV  14
            D    GVG MV   Y+MG   P D  AP  ++  ALASAL N+PPEQQR MLGE+LYPLV
Sbjct  65   DAAFRGVGAMVPSLYEMGRTTPGDTGAPQQVSSGALASALVNSPPEQQRLMLGESLYPLV  124

Query  13   DQLE  2
            DQLE
Sbjct  125  DQLE  128



>gb|EMT03423.1| Polyadenylate-binding protein 2 [Aegilops tauschii]
Length=566

 Score = 68.6 bits (166),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 47/63 (75%), Gaps = 7/63 (11%)
 Frame = -1

Query  175  MPGVG-GMVSLPYDMGGMLPRDA----APVPITALASALANAPPEQQRTMLGENLYPLVD  11
            MPGVG GMV  PYDMG    RDA    AP PI  L SALANA PEQQRT+LGE+LYPLV+
Sbjct  439  MPGVGVGMVQ-PYDMGSFPVRDAGVSPAP-PIGTLTSALANATPEQQRTILGESLYPLVE  496

Query  10   QLE  2
            +LE
Sbjct  497  KLE  499



>gb|AFG69765.1| hypothetical protein CL4424Contig1_01, partial [Pinus taeda]
 gb|AFG69766.1| hypothetical protein CL4424Contig1_01, partial [Pinus taeda]
 gb|AFG69767.1| hypothetical protein CL4424Contig1_01, partial [Pinus taeda]
 gb|AFG69768.1| hypothetical protein CL4424Contig1_01, partial [Pinus taeda]
 gb|AFG69769.1| hypothetical protein CL4424Contig1_01, partial [Pinus taeda]
Length=84

 Score = 63.9 bits (154),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 51/70 (73%), Gaps = 6/70 (9%)
 Frame = -1

Query  193  NVSDGPMPGVGG-MVSLPYDMGGM-LPRDAAPV----PITALASALANAPPEQQRTMLGE  32
            NV + P+ GVGG M+ +P+DM  + +P   A +    P+  +ASALANA PEQQRTMLGE
Sbjct  1    NVPEVPLTGVGGGMLPVPFDMSSVPIPAPDAGISQSSPMETMASALANATPEQQRTMLGE  60

Query  31   NLYPLVDQLE  2
            +LYPLV+QLE
Sbjct  61   SLYPLVNQLE  70



>ref|XP_010526963.1| PREDICTED: polyadenylate-binding protein 2-like [Tarenaya hassleriana]
Length=638

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 45/61 (74%), Gaps = 6/61 (10%)
 Frame = -1

Query  172  PGVGGMVSLPYDMGGMLPRD----AAPVPITALASALANAPPEQQRTMLGENLYPLVDQL  5
            P + GM  LPY+M  M  R+      PVPI ALASALANA PEQQRTMLGENLYP+V+Q+
Sbjct  515  PAMSGM--LPYEMTNMPLREPVLSHQPVPIGALASALANATPEQQRTMLGENLYPMVEQV  572

Query  4    E  2
            E
Sbjct  573  E  573



>ref|XP_007042478.1| Poly(A) binding protein 8 [Theobroma cacao]
 gb|EOX98309.1| Poly(A) binding protein 8 [Theobroma cacao]
Length=645

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 53/65 (82%), Gaps = 4/65 (6%)
 Frame = -1

Query  184  DGPMPGV-GGMVSLPYDMGGMLPRD---AAPVPITALASALANAPPEQQRTMLGENLYPL  17
            D  MP V GGM+S+PYDMGGM  RD   + P+PI ALASALANA P+QQRTMLGENLYPL
Sbjct  517  DVSMPNVAGGMLSVPYDMGGMPMRDVPLSQPIPIGALASALANASPDQQRTMLGENLYPL  576

Query  16   VDQLE  2
            V+QLE
Sbjct  577  VEQLE  581



>gb|AEW09165.1| hypothetical protein CL4424Contig1_01, partial [Pinus radiata]
Length=84

 Score = 63.9 bits (154),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 50/70 (71%), Gaps = 6/70 (9%)
 Frame = -1

Query  193  NVSDGPMPGVGG-MVSLPYDMGGM-LPRDAAPV----PITALASALANAPPEQQRTMLGE  32
            NV + P+ GVGG M+ +P+DM  + +P   A +    P+  +ASALANA PEQQRTMLGE
Sbjct  1    NVPEVPLTGVGGGMLPVPFDMSSVPIPAPDAGISQSSPMETMASALANATPEQQRTMLGE  60

Query  31   NLYPLVDQLE  2
            +LYPLV QLE
Sbjct  61   SLYPLVHQLE  70



>gb|KJB40266.1| hypothetical protein B456_007G054700 [Gossypium raimondii]
Length=607

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 47/62 (76%), Gaps = 4/62 (6%)
 Frame = -1

Query  175  MPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPLVDQ  8
            MP V G ++ +PY++GGM  RDAA   P+   ALASALANA   QQRT+LGENLYPLVDQ
Sbjct  478  MPDVPGRVLPVPYNVGGMPFRDAAFSQPMATGALASALANATTVQQRTLLGENLYPLVDQ  537

Query  7    LE  2
            LE
Sbjct  538  LE  539



>ref|XP_008788846.1| PREDICTED: polyadenylate-binding protein 2-like [Phoenix dactylifera]
Length=665

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 54/68 (79%), Gaps = 4/68 (6%)
 Frame = -1

Query  193  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENL  26
            N+ + PMPG  GGM+S PYDMG M  RDA    P+PI ALASALANA PEQQRTMLGE+L
Sbjct  530  NMPEVPMPGAAGGMLSAPYDMGVMPMRDAGMSQPIPIGALASALANASPEQQRTMLGESL  589

Query  25   YPLVDQLE  2
            YPLVDQLE
Sbjct  590  YPLVDQLE  597



>ref|XP_003580095.1| PREDICTED: polyadenylate-binding protein 2-like [Brachypodium 
distachyon]
Length=661

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 45/64 (70%), Gaps = 6/64 (9%)
 Frame = -1

Query  178  PMPGVG--GMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPLV  14
            PM GVG  GM+  PYDMGG   RDA      PI  L SALANA P+QQRT+LGE+LYPLV
Sbjct  532  PMAGVGAGGMIQ-PYDMGGFPVRDAGLSPAAPIGTLTSALANATPDQQRTLLGESLYPLV  590

Query  13   DQLE  2
            + LE
Sbjct  591  ELLE  594



>emb|CDO97198.1| unnamed protein product [Coffea canephora]
Length=653

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 52/64 (81%), Gaps = 3/64 (5%)
 Frame = -1

Query  184  DGPMPGV-GGMVSLPYDMGGMLPRD--AAPVPITALASALANAPPEQQRTMLGENLYPLV  14
            D  MPGV GGM+S+PYDMGGM  RD  + PVPI ALASALANA P  QRTMLGENLYPLV
Sbjct  523  DVSMPGVVGGMLSVPYDMGGMPLRDVVSQPVPIGALASALANASPADQRTMLGENLYPLV  582

Query  13   DQLE  2
            +QLE
Sbjct  583  EQLE  586



>emb|CDO97200.1| unnamed protein product [Coffea canephora]
Length=654

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 52/64 (81%), Gaps = 3/64 (5%)
 Frame = -1

Query  184  DGPMPGVGG-MVSLPYDMGGMLPRD--AAPVPITALASALANAPPEQQRTMLGENLYPLV  14
            D  MPGVGG M+S+PYDMGGM  RD  + PVPI ALASALANA P  QRTMLGENLYPLV
Sbjct  524  DVSMPGVGGGMLSVPYDMGGMPLRDVVSQPVPIGALASALANASPADQRTMLGENLYPLV  583

Query  13   DQLE  2
            +QLE
Sbjct  584  EQLE  587



>gb|KJB40263.1| hypothetical protein B456_007G054700 [Gossypium raimondii]
Length=653

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 47/62 (76%), Gaps = 4/62 (6%)
 Frame = -1

Query  175  MPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPLVDQ  8
            MP V G ++ +PY++GGM  RDAA   P+   ALASALANA   QQRT+LGENLYPLVDQ
Sbjct  524  MPDVPGRVLPVPYNVGGMPFRDAAFSQPMATGALASALANATTVQQRTLLGENLYPLVDQ  583

Query  7    LE  2
            LE
Sbjct  584  LE  585



>ref|XP_010531254.1| PREDICTED: polyadenylate-binding protein 4 [Tarenaya hassleriana]
Length=644

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 48/64 (75%), Gaps = 4/64 (6%)
 Frame = -1

Query  193  NVSDGPMPGVGGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLV  14
            N+ DGP+PG  G++ + YDM GM P  A P+   ALASALAN  P QQRT+LGE+LYPLV
Sbjct  516  NMLDGPIPG--GILPIAYDMNGM-PF-AQPLSTGALASALANGTPAQQRTLLGEHLYPLV  571

Query  13   DQLE  2
            DQ+E
Sbjct  572  DQME  575



>gb|KJB40264.1| hypothetical protein B456_007G054700 [Gossypium raimondii]
Length=651

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 47/62 (76%), Gaps = 4/62 (6%)
 Frame = -1

Query  175  MPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPLVDQ  8
            MP V G ++ +PY++GGM  RDAA   P+   ALASALANA   QQRT+LGENLYPLVDQ
Sbjct  522  MPDVPGRVLPVPYNVGGMPFRDAAFSQPMATGALASALANATTVQQRTLLGENLYPLVDQ  581

Query  7    LE  2
            LE
Sbjct  582  LE  583



>ref|XP_010447142.1| PREDICTED: polyadenylate-binding protein 2-like [Camelina sativa]
Length=632

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 42/57 (74%), Gaps = 6/57 (11%)
 Frame = -1

Query  169  GVGGMVSLP-YDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLVDQLE  2
            G GG   +P YDMG  +P     +PI ALAS LANA PEQQRTMLGENLYPLV+QLE
Sbjct  523  GRGGSGDMPSYDMGNNMP-----LPIGALASNLANASPEQQRTMLGENLYPLVEQLE  574



>ref|XP_010432464.1| PREDICTED: polyadenylate-binding protein 2-like [Camelina sativa]
Length=632

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 42/57 (74%), Gaps = 6/57 (11%)
 Frame = -1

Query  169  GVGGMVSLP-YDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLVDQLE  2
            G GG   +P YDMG  +P     +PI ALAS LANA PEQQRTMLGENLYPLV+QLE
Sbjct  523  GRGGSGDMPSYDMGNNMP-----LPIGALASNLANASPEQQRTMLGENLYPLVEQLE  574



>ref|XP_010437669.1| PREDICTED: polyadenylate-binding protein 2-like [Camelina sativa]
Length=633

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 42/57 (74%), Gaps = 6/57 (11%)
 Frame = -1

Query  169  GVGGMVSLP-YDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLVDQLE  2
            G GG   +P YDMG  +P     +PI ALAS LANA PEQQRTMLGENLYPLV+QLE
Sbjct  524  GRGGSGDMPSYDMGNNMP-----LPIGALASNLANATPEQQRTMLGENLYPLVEQLE  575



>ref|XP_010432462.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Camelina 
sativa]
 ref|XP_010432463.1| PREDICTED: polyadenylate-binding protein 2-like isoform X2 [Camelina 
sativa]
Length=632

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 42/57 (74%), Gaps = 6/57 (11%)
 Frame = -1

Query  169  GVGGMVSLP-YDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLVDQLE  2
            G GG   +P YDMG  +P     +PI ALAS LANA PEQQRTMLGENLYPLV+QLE
Sbjct  523  GRGGSGDVPSYDMGNNMP-----LPIGALASNLANASPEQQRTMLGENLYPLVEQLE  574



>ref|XP_011000130.1| PREDICTED: polyadenylate-binding protein 8-like [Populus euphratica]
Length=644

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 53/65 (82%), Gaps = 4/65 (6%)
 Frame = -1

Query  184  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  17
            D PM GV GGM+ +PYDMGGM  RDAA    +P+ ALA+ALANA P+QQRTMLGENLYPL
Sbjct  515  DVPMTGVAGGMLPVPYDMGGMPMRDAALSQSIPVGALATALANATPDQQRTMLGENLYPL  574

Query  16   VDQLE  2
            V+QLE
Sbjct  575  VEQLE  579



>ref|XP_002300227.1| polyadenylate-binding family protein [Populus trichocarpa]
 gb|EEE85032.1| polyadenylate-binding family protein [Populus trichocarpa]
Length=644

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 53/65 (82%), Gaps = 4/65 (6%)
 Frame = -1

Query  184  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  17
            D PM GV GGM+ +PYDMGGM  RDAA    +P+ ALA+ALANA P+QQRTMLGENLYPL
Sbjct  515  DVPMTGVAGGMLPVPYDMGGMPMRDAALSQSIPVGALATALANATPDQQRTMLGENLYPL  574

Query  16   VDQLE  2
            V+QLE
Sbjct  575  VEQLE  579



>ref|XP_006295403.1| hypothetical protein CARUB_v10024499mg [Capsella rubella]
 gb|EOA28301.1| hypothetical protein CARUB_v10024499mg [Capsella rubella]
Length=658

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 46/64 (72%), Gaps = 4/64 (6%)
 Frame = -1

Query  193  NVSDGPMPGVGGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLV  14
            N+ DGPM G  GMV + YDM GM      P+  + LAS+LAN+ P QQRT+LGE+LYPLV
Sbjct  526  NMPDGPMQG--GMVQVAYDMNGMPF--GQPLSASQLASSLANSSPAQQRTLLGESLYPLV  581

Query  13   DQLE  2
            DQ+E
Sbjct  582  DQIE  585



>gb|AID60122.1| poly(A) binding protein 8 [Brassica napus]
 gb|AID60165.1| polyA binding protein 8 [Brassica napus]
Length=606

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 42/56 (75%), Gaps = 5/56 (9%)
 Frame = -1

Query  169  GVGGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLVDQLE  2
            G GG V+ PYDMG     +   +PI ALAS LANA PEQQRTMLGENLYPLV+QLE
Sbjct  498  GSGGDVA-PYDMGN----NNITMPIGALASNLANASPEQQRTMLGENLYPLVEQLE  548



>ref|XP_010555994.1| PREDICTED: polyadenylate-binding protein 8 [Tarenaya hassleriana]
Length=646

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 53/64 (83%), Gaps = 5/64 (8%)
 Frame = -1

Query  178  PMPGVG-GMVSLPYDMGGMLP-RDAA---PVPITALASALANAPPEQQRTMLGENLYPLV  14
            PMPGV   M+S+PYDM G +P RD++   PVPI ALASALANA PEQQRTMLGENLYPLV
Sbjct  519  PMPGVAPSMLSVPYDMAGAVPLRDSSVSQPVPIGALASALANASPEQQRTMLGENLYPLV  578

Query  13   DQLE  2
            +QLE
Sbjct  579  EQLE  582



>emb|CDX75397.1| BnaA01g03050D [Brassica napus]
Length=616

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 42/56 (75%), Gaps = 5/56 (9%)
 Frame = -1

Query  169  GVGGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLVDQLE  2
            G GG V+ PYDMG     +   +PI ALAS LANA PEQQRTMLGENLYPLV+QLE
Sbjct  508  GSGGDVA-PYDMGN----NNITMPIGALASNLANASPEQQRTMLGENLYPLVEQLE  558



>ref|XP_011000826.1| PREDICTED: polyadenylate-binding protein 8-like [Populus euphratica]
Length=643

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 53/65 (82%), Gaps = 4/65 (6%)
 Frame = -1

Query  184  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  17
            D PM GV GGM+ +PYDMGGM  RDAA    +P+ ALA+ALANA P+QQRTMLGENLYPL
Sbjct  514  DVPMTGVAGGMLPVPYDMGGMPMRDAALSQSIPVGALATALANATPDQQRTMLGENLYPL  573

Query  16   VDQLE  2
            V+QLE
Sbjct  574  VEQLE  578



>gb|KJB14633.1| hypothetical protein B456_002G134900 [Gossypium raimondii]
Length=645

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 50/57 (88%), Gaps = 3/57 (5%)
 Frame = -1

Query  163  GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPLVDQLE  2
            GGM+S+PYDMGGM  RDAA   P+PI ALA+ALANA PEQQRTMLGE+LYPLV++LE
Sbjct  522  GGMLSVPYDMGGMSLRDAAIGQPMPIPALATALANATPEQQRTMLGESLYPLVERLE  578



>gb|KJB14629.1| hypothetical protein B456_002G134900 [Gossypium raimondii]
Length=651

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 50/57 (88%), Gaps = 3/57 (5%)
 Frame = -1

Query  163  GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPLVDQLE  2
            GGM+S+PYDMGGM  RDAA   P+PI ALA+ALANA PEQQRTMLGE+LYPLV++LE
Sbjct  528  GGMLSVPYDMGGMSLRDAAIGQPMPIPALATALANATPEQQRTMLGESLYPLVERLE  584



>gb|KHG25571.1| Polyadenylate-binding protein 1-like 2 [Gossypium arboreum]
Length=653

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 47/62 (76%), Gaps = 4/62 (6%)
 Frame = -1

Query  175  MPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPLVDQ  8
            MP V G ++ +PY++GGM  RDAA   P+   ALASALANA P QQRT+LGENLYPLV Q
Sbjct  524  MPDVPGRVLPVPYNVGGMPFRDAAFSQPMATGALASALANATPVQQRTLLGENLYPLVGQ  583

Query  7    LE  2
            LE
Sbjct  584  LE  585



>ref|XP_006283328.1| hypothetical protein CARUB_v10004368mg [Capsella rubella]
 gb|EOA16226.1| hypothetical protein CARUB_v10004368mg [Capsella rubella]
Length=629

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 38/48 (79%), Gaps = 5/48 (10%)
 Frame = -1

Query  145  PYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLVDQLE  2
            PYDMG  +P     +PI ALAS LANA PEQQRTMLGENLYPLV+Q+E
Sbjct  529  PYDMGNNMP-----LPIGALASNLANASPEQQRTMLGENLYPLVEQIE  571



>emb|CDX69025.1| BnaC01g04280D [Brassica napus]
Length=611

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 42/56 (75%), Gaps = 3/56 (5%)
 Frame = -1

Query  169  GVGGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLVDQLE  2
            G GG V+ PYDMG     +   +PI ALAS LANA PEQQRTMLGENLYPLV+QLE
Sbjct  501  GSGGDVA-PYDMGN--NNNNITMPIGALASNLANASPEQQRTMLGENLYPLVEQLE  553



>ref|XP_010110808.1| Polyadenylate-binding protein 2 [Morus notabilis]
 gb|EXC28180.1| Polyadenylate-binding protein 2 [Morus notabilis]
Length=639

 Score = 66.2 bits (160),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 55/67 (82%), Gaps = 3/67 (4%)
 Frame = -1

Query  193  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA--PVPITALASALANAPPEQQRTMLGENLY  23
            N+ +  +PGV GGM+ +PYD+GG+  RD A   +PITALA+ALANAPPEQQRTMLGE LY
Sbjct  513  NIQEVQIPGVAGGMLPVPYDVGGLPIRDGAGQAMPITALATALANAPPEQQRTMLGEALY  572

Query  22   PLVDQLE  2
            PLVDQLE
Sbjct  573  PLVDQLE  579



>gb|KJB58541.1| hypothetical protein B456_009G214100 [Gossypium raimondii]
Length=650

 Score = 66.2 bits (160),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 54/65 (83%), Gaps = 4/65 (6%)
 Frame = -1

Query  184  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  17
            +GPM  V GGM+S+PYDMGGM  RDA    P+P+ ALA+ALANA PEQQRTMLGE+LYPL
Sbjct  520  EGPMSNVPGGMLSVPYDMGGMPMRDAGVGQPMPVPALATALANATPEQQRTMLGESLYPL  579

Query  16   VDQLE  2
            V++LE
Sbjct  580  VERLE  584



>ref|XP_006422975.1| hypothetical protein CICLE_v10027999mg [Citrus clementina]
 ref|XP_006487035.1| PREDICTED: polyadenylate-binding protein 2-like [Citrus sinensis]
 gb|ESR36215.1| hypothetical protein CICLE_v10027999mg [Citrus clementina]
Length=645

 Score = 66.2 bits (160),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 51/65 (78%), Gaps = 4/65 (6%)
 Frame = -1

Query  184  DGPMPGVGGMVSLPY-DMGGMLPRDA---APVPITALASALANAPPEQQRTMLGENLYPL  17
            D  MPGVGGM+ +PY DM  M  RDA    PVPI ALASALANA PEQQRTMLGENLYPL
Sbjct  514  DVSMPGVGGMLPIPYGDMAAMPLRDAPISQPVPIGALASALANASPEQQRTMLGENLYPL  573

Query  16   VDQLE  2
            V+QLE
Sbjct  574  VEQLE  578



>ref|XP_010447143.1| PREDICTED: polyadenylate-binding protein 2 [Camelina sativa]
Length=632

 Score = 66.2 bits (160),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 42/57 (74%), Gaps = 6/57 (11%)
 Frame = -1

Query  169  GVGGMVSLP-YDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLVDQLE  2
            G GG   +P YDMG  +P     +PI ALAS LANA PEQQRTMLGENLYPLV+Q+E
Sbjct  523  GRGGSGDVPSYDMGNNMP-----LPIGALASNLANASPEQQRTMLGENLYPLVEQVE  574



>ref|XP_002878680.1| PAB4 binding protein 4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54939.1| PAB4 binding protein 4 [Arabidopsis lyrata subsp. lyrata]
Length=655

 Score = 66.2 bits (160),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 47/64 (73%), Gaps = 4/64 (6%)
 Frame = -1

Query  193  NVSDGPMPGVGGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLV  14
            N+ DGPM  +GGMV + YDM GM    A P+    LA++LANA P QQRT+LGE+LYPLV
Sbjct  524  NMPDGPM--LGGMVPVAYDMNGMPI--AQPMSAGQLATSLANATPAQQRTLLGESLYPLV  579

Query  13   DQLE  2
            DQ+E
Sbjct  580  DQIE  583



>dbj|BAD94406.1| putative poly(A) binding protein [Arabidopsis thaliana]
Length=154

 Score = 62.8 bits (151),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 48/64 (75%), Gaps = 4/64 (6%)
 Frame = -1

Query  193  NVSDGPMPGVGGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLV  14
            N+ DGPMPG  GMV + YDM  ++P  + P+    LA++LANA P QQRT+LGE+LYPLV
Sbjct  23   NMPDGPMPG--GMVPVAYDMN-VMPY-SQPMSAGQLATSLANATPAQQRTLLGESLYPLV  78

Query  13   DQLE  2
            DQ+E
Sbjct  79   DQIE  82



>ref|XP_002869174.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45433.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=625

 Score = 65.9 bits (159),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 38/48 (79%), Gaps = 5/48 (10%)
 Frame = -1

Query  145  PYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLVDQLE  2
            PYDMG  +P     +PI ALAS LANA PEQQRTMLGE+LYPLV+QLE
Sbjct  525  PYDMGNNMP-----LPIGALASHLANASPEQQRTMLGESLYPLVEQLE  567



>ref|XP_010530761.1| PREDICTED: LOW QUALITY PROTEIN: polyadenylate-binding protein 
2 [Tarenaya hassleriana]
Length=649

 Score = 65.9 bits (159),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 46/62 (74%), Gaps = 9/62 (15%)
 Frame = -1

Query  175  MPGVGGMVSLPYDMGGMLPRD---AAP-VPITALASALANAPPEQQRTMLGENLYPLVDQ  8
            MPG+     LPY+M  M  R+   + P VPI ALASALANA PEQQRTMLGENLYPLV++
Sbjct  527  MPGM-----LPYEMANMSMREPVMSQPAVPIGALASALANATPEQQRTMLGENLYPLVER  581

Query  7    LE  2
            +E
Sbjct  582  VE  583



>gb|KCW55175.1| hypothetical protein EUGRSUZ_I01129 [Eucalyptus grandis]
Length=471

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 54/65 (83%), Gaps = 4/65 (6%)
 Frame = -1

Query  184  DGPMPGV-GGMVSLPYDMGGMLPRD---AAPVPITALASALANAPPEQQRTMLGENLYPL  17
            D  +PGV GGM+ +PYDMGGM  RD   + P+PITALASALANA P+QQRTMLGE+LYPL
Sbjct  341  DMSVPGVAGGMMPMPYDMGGMPLRDTPISQPLPITALASALANASPDQQRTMLGESLYPL  400

Query  16   VDQLE  2
            V+QLE
Sbjct  401  VEQLE  405



>ref|XP_010417088.1| PREDICTED: polyadenylate-binding protein 4-like [Camelina sativa]
Length=660

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 46/64 (72%), Gaps = 4/64 (6%)
 Frame = -1

Query  193  NVSDGPMPGVGGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLV  14
            N+ DGPM G  GMV + YDM GM    A P+    LA++LANA P QQRT+LGE+LYPLV
Sbjct  528  NMPDGPMQG--GMVPVAYDMNGMPF--AQPMSAGQLATSLANATPAQQRTLLGESLYPLV  583

Query  13   DQLE  2
            DQ+E
Sbjct  584  DQIE  587



>ref|XP_010028424.1| PREDICTED: polyadenylate-binding protein 2 [Eucalyptus grandis]
 gb|KCW55174.1| hypothetical protein EUGRSUZ_I01129 [Eucalyptus grandis]
Length=646

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 54/65 (83%), Gaps = 4/65 (6%)
 Frame = -1

Query  184  DGPMPGV-GGMVSLPYDMGGMLPRD---AAPVPITALASALANAPPEQQRTMLGENLYPL  17
            D  +PGV GGM+ +PYDMGGM  RD   + P+PITALASALANA P+QQRTMLGE+LYPL
Sbjct  516  DMSVPGVAGGMMPMPYDMGGMPLRDTPISQPLPITALASALANASPDQQRTMLGESLYPL  575

Query  16   VDQLE  2
            V+QLE
Sbjct  576  VEQLE  580



>ref|XP_007017178.1| Poly(A) binding protein 8 isoform 1 [Theobroma cacao]
 gb|EOY14403.1| Poly(A) binding protein 8 isoform 1 [Theobroma cacao]
Length=648

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/68 (68%), Positives = 55/68 (81%), Gaps = 4/68 (6%)
 Frame = -1

Query  193  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENL  26
            N+ D PM  V GGM+S+PYD+GGM  RDA    P+PI ALA+ALANA PEQQRTMLGE+L
Sbjct  514  NMPDVPMSSVAGGMLSVPYDLGGMPLRDAGVGQPMPIPALATALANATPEQQRTMLGESL  573

Query  25   YPLVDQLE  2
            YPLV++LE
Sbjct  574  YPLVERLE  581



>ref|XP_007047341.1| Poly(A) binding protein 8 [Theobroma cacao]
 gb|EOX91498.1| Poly(A) binding protein 8 [Theobroma cacao]
Length=659

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 55/68 (81%), Gaps = 4/68 (6%)
 Frame = -1

Query  193  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENL  26
            N++D P+ GV GGM+ +PY++GGM  RDAA   P+   ALA+ALANA PEQQRT+LGENL
Sbjct  525  NMTDVPISGVPGGMLPVPYEVGGMPFRDAAFSQPMTTGALATALANATPEQQRTLLGENL  584

Query  25   YPLVDQLE  2
            YPLVDQLE
Sbjct  585  YPLVDQLE  592



>emb|CDY62723.1| BnaC03g77220D [Brassica napus]
Length=617

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 42/64 (66%), Gaps = 4/64 (6%)
 Frame = -1

Query  193  NVSDGPMPGVGGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLV  14
            N+      GV G    PYDMG     +  P+PI  LAS LANA PEQQRTMLGENLYPLV
Sbjct  500  NIRYSQGRGVSGGDVPPYDMGN----NNMPLPIGTLASNLANASPEQQRTMLGENLYPLV  555

Query  13   DQLE  2
            ++LE
Sbjct  556  EKLE  559



>ref|XP_009108756.1| PREDICTED: polyadenylate-binding protein 2 [Brassica rapa]
Length=619

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 42/64 (66%), Gaps = 4/64 (6%)
 Frame = -1

Query  193  NVSDGPMPGVGGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLV  14
            N+      GV G    PYDMG     +  P+PI  LAS LANA PEQQRTMLGENLYPLV
Sbjct  502  NIRYSQGRGVSGGDVPPYDMGN----NNMPLPIGTLASNLANASPEQQRTMLGENLYPLV  557

Query  13   DQLE  2
            ++LE
Sbjct  558  EKLE  561



>emb|CDY51957.1| BnaA08g11610D [Brassica napus]
Length=619

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 42/64 (66%), Gaps = 4/64 (6%)
 Frame = -1

Query  193  NVSDGPMPGVGGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLV  14
            N+      GV G    PYDMG     +  P+PI  LAS LANA PEQQRTMLGENLYPLV
Sbjct  502  NIRYSQGRGVSGGDVPPYDMGN----NNMPLPIGTLASNLANASPEQQRTMLGENLYPLV  557

Query  13   DQLE  2
            ++LE
Sbjct  558  EKLE  561



>ref|XP_004499046.1| PREDICTED: polyadenylate-binding protein 2-like isoform X3 [Cicer 
arietinum]
Length=588

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 50/67 (75%), Gaps = 5/67 (7%)
 Frame = -1

Query  193  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA--PVPITALASALANAPPEQQRTM--LGEN  29
            N+ D P+ GV GGM+S+PYDMGG+  RDA   P+PI ALA+ALANAP EQQRT+  + E+
Sbjct  520  NMQDVPLQGVAGGMMSVPYDMGGLPIRDAVGQPMPIQALATALANAPSEQQRTVSPVSEH  579

Query  28   LYPLVDQ  8
             + ++ Q
Sbjct  580  CFSVLIQ  586



>emb|CDY36634.1| BnaA07g04230D [Brassica napus]
Length=649

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 48/66 (73%), Gaps = 7/66 (11%)
 Frame = -1

Query  187  SDGPMPGVGGMVSLPYDMGGMLP-RD---AAPVPITALASALANAPPEQQRTMLGENLYP  20
            S GP P V GM  LPY+M   +P RD   +  VPI ALA++LANA PE QRTMLGENLYP
Sbjct  509  SGGP-PDVPGM--LPYEMPSNMPLRDPVLSQHVPIGALATSLANASPEHQRTMLGENLYP  565

Query  19   LVDQLE  2
            LV+QLE
Sbjct  566  LVEQLE  571



>emb|CDX71223.1| BnaC07g05020D [Brassica napus]
Length=638

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 48/66 (73%), Gaps = 7/66 (11%)
 Frame = -1

Query  187  SDGPMPGVGGMVSLPYDMGGMLP-RD---AAPVPITALASALANAPPEQQRTMLGENLYP  20
            S GP P V GM  LPY+M   +P RD   +  VPI ALA++LANA PE QRTMLGENLYP
Sbjct  513  SGGP-PDVPGM--LPYEMPSNMPLRDPVLSQHVPIGALATSLANASPEHQRTMLGENLYP  569

Query  19   LVDQLE  2
            LV+QLE
Sbjct  570  LVEQLE  575



>emb|CDX89562.1| BnaC04g35810D [Brassica napus]
Length=645

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 45/64 (70%), Gaps = 4/64 (6%)
 Frame = -1

Query  193  NVSDGPMPGVGGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLV  14
            N+ DGPM   GGMV  PYD+ GM      P+P  ALAS+LA A P QQRT+LGE LYPLV
Sbjct  516  NMPDGPM--AGGMVPFPYDINGMPL--GQPMPAGALASSLAQASPAQQRTILGETLYPLV  571

Query  13   DQLE  2
            +++E
Sbjct  572  NKIE  575



>gb|KFK40021.1| hypothetical protein AALP_AA3G319900 [Arabis alpina]
Length=651

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 48/66 (73%), Gaps = 7/66 (11%)
 Frame = -1

Query  187  SDGPMPGVGGMVSLPYDMGGMLP-RDAA---PVPITALASALANAPPEQQRTMLGENLYP  20
            S GP P V GM  LPY+M   +P RD+     VPI ALA++LANA PE QRTMLGENLYP
Sbjct  526  SGGP-PDVPGM--LPYEMPSNMPLRDSVLSQHVPIGALATSLANASPEHQRTMLGENLYP  582

Query  19   LVDQLE  2
            LV+QLE
Sbjct  583  LVEQLE  588



>ref|XP_009117148.1| PREDICTED: polyadenylate-binding protein 2 [Brassica rapa]
Length=613

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 41/56 (73%), Gaps = 6/56 (11%)
 Frame = -1

Query  169  GVGGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLVDQLE  2
            G GG V+ PYDMG     +   +PI ALAS LANA PEQQR MLGENLYPLV+QLE
Sbjct  506  GSGGDVA-PYDMG-----NNNTMPIGALASNLANASPEQQRMMLGENLYPLVEQLE  555



>ref|NP_179916.1| poly(A) binding protein 4 [Arabidopsis thaliana]
 sp|O22173.1|PABP4_ARATH RecName: Full=Polyadenylate-binding protein 4; Short=PABP-4; 
Short=Poly(A)-binding protein 4 [Arabidopsis thaliana]
 gb|AAB87097.1| putative poly(A) binding protein [Arabidopsis thaliana]
 gb|AAK92796.1| putative poly(A) binding protein [Arabidopsis thaliana]
 gb|AAL85120.1| putative poly(A) binding protein [Arabidopsis thaliana]
 gb|AEC07446.1| poly(A) binding protein 4 [Arabidopsis thaliana]
Length=662

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 48/64 (75%), Gaps = 4/64 (6%)
 Frame = -1

Query  193  NVSDGPMPGVGGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLV  14
            N+ DGPMPG  GMV + YDM  ++P  + P+    LA++LANA P QQRT+LGE+LYPLV
Sbjct  531  NMPDGPMPG--GMVPVAYDMN-VMPY-SQPMSAGQLATSLANATPAQQRTLLGESLYPLV  586

Query  13   DQLE  2
            DQ+E
Sbjct  587  DQIE  590



>emb|CBI19492.3| unnamed protein product [Vitis vinifera]
Length=153

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  109  APVPITALASALANAPPEQQRTMLGENLYPLVDQLE  2
            +P+PI+ LASALANA P+QQRTML E+LYPLVDQLE
Sbjct  52   SPMPISTLASALANATPDQQRTMLSESLYPLVDQLE  87



>gb|AAK25927.1|AF360217_1 putative poly(A) binding protein [Arabidopsis thaliana]
Length=662

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 48/64 (75%), Gaps = 4/64 (6%)
 Frame = -1

Query  193  NVSDGPMPGVGGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLV  14
            N+ DGPMPG  GMV + YDM  ++P  + P+    LA++LANA P QQRT+LGE+LYPLV
Sbjct  531  NMPDGPMPG--GMVPVAYDMN-VMPY-SQPMSAGQLATSLANATPAQQRTLLGESLYPLV  586

Query  13   DQLE  2
            DQ+E
Sbjct  587  DQIE  590



>ref|XP_010519297.1| PREDICTED: polyadenylate-binding protein 8-like [Tarenaya hassleriana]
Length=649

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 54/67 (81%), Gaps = 6/67 (9%)
 Frame = -1

Query  184  DGPMPGVG-GMVSLPYDM-GGMLP-RDAA---PVPITALASALANAPPEQQRTMLGENLY  23
            D PMPGV   M+S+PYD+ GG  P RD+A   PVPI ALASALANA PEQQRTMLGENLY
Sbjct  518  DVPMPGVSPSMLSVPYDIAGGAAPLRDSAVSQPVPIGALASALANASPEQQRTMLGENLY  577

Query  22   PLVDQLE  2
            PLV+QLE
Sbjct  578  PLVEQLE  584



>ref|XP_006412276.1| hypothetical protein EUTSA_v10024683mg [Eutrema salsugineum]
 gb|ESQ53729.1| hypothetical protein EUTSA_v10024683mg [Eutrema salsugineum]
Length=599

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  GGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLVDQLE  2
            GG +P    P+PI ALAS LANA PEQQRTMLGENLYPLV+QLE
Sbjct  499  GGDVPPYDVPLPIGALASNLANASPEQQRTMLGENLYPLVEQLE  542



>ref|XP_006412275.1| hypothetical protein EUTSA_v10024683mg [Eutrema salsugineum]
 gb|ESQ53728.1| hypothetical protein EUTSA_v10024683mg [Eutrema salsugineum]
Length=624

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -1

Query  133  GGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLVDQLE  2
            GG +P    P+PI ALAS LANA PEQQRTMLGENLYPLV+QLE
Sbjct  524  GGDVPPYDVPLPIGALASNLANASPEQQRTMLGENLYPLVEQLE  567



>ref|XP_006425948.1| hypothetical protein CICLE_v10025109mg [Citrus clementina]
 gb|ESR39188.1| hypothetical protein CICLE_v10025109mg [Citrus clementina]
Length=652

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 53/68 (78%), Gaps = 4/68 (6%)
 Frame = -1

Query  193  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENL  26
            N+ D P+ GV GGM+  PYD+GGM  RDAA   P+   ALASALANA PEQQRT+LGENL
Sbjct  517  NIPDVPVAGVPGGMLPGPYDIGGMPFRDAAFSQPMQTGALASALANASPEQQRTLLGENL  576

Query  25   YPLVDQLE  2
            YPLVDQLE
Sbjct  577  YPLVDQLE  584



>ref|NP_001275799.1| poly A-binding protein 2 [Citrus sinensis]
 gb|AEV43365.1| poly A-binding protein 2 [Citrus sinensis]
 gb|KDO79128.1| hypothetical protein CISIN_1g006290mg [Citrus sinensis]
Length=652

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 53/68 (78%), Gaps = 4/68 (6%)
 Frame = -1

Query  193  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENL  26
            N+ D P+ GV GGM+  PYD+GGM  RDAA   P+   ALASALANA PEQQRT+LGENL
Sbjct  517  NIPDVPVAGVPGGMLPGPYDIGGMPFRDAAFSQPMQTGALASALANASPEQQRTLLGENL  576

Query  25   YPLVDQLE  2
            YPLVDQLE
Sbjct  577  YPLVDQLE  584



>ref|XP_006425947.1| hypothetical protein CICLE_v10025109mg [Citrus clementina]
 gb|ESR39187.1| hypothetical protein CICLE_v10025109mg [Citrus clementina]
Length=650

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 53/68 (78%), Gaps = 4/68 (6%)
 Frame = -1

Query  193  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENL  26
            N+ D P+ GV GGM+  PYD+GGM  RDAA   P+   ALASALANA PEQQRT+LGENL
Sbjct  515  NIPDVPVAGVPGGMLPGPYDIGGMPFRDAAFSQPMQTGALASALANASPEQQRTLLGENL  574

Query  25   YPLVDQLE  2
            YPLVDQLE
Sbjct  575  YPLVDQLE  582



>dbj|BAJ53194.1| JHL03K20.3 [Jatropha curcas]
Length=642

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 51/65 (78%), Gaps = 4/65 (6%)
 Frame = -1

Query  184  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  17
            D PM G+ GGM+ +PYDMGGM  RD A   P+   ALA+ALANA PEQQRT+LGENLYPL
Sbjct  513  DVPMAGLPGGMLPVPYDMGGMPFRDGAFSQPMQTGALATALANATPEQQRTLLGENLYPL  572

Query  16   VDQLE  2
            VDQLE
Sbjct  573  VDQLE  577



>ref|XP_006494495.1| PREDICTED: polyadenylate-binding protein 4 [Citrus sinensis]
Length=663

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 53/68 (78%), Gaps = 4/68 (6%)
 Frame = -1

Query  193  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENL  26
            N+ D P+ GV GGM+  PYD+GGM  RDAA   P+   ALASALANA PEQQRT+LGENL
Sbjct  528  NIPDVPVAGVPGGMLPGPYDIGGMPFRDAAFSQPMQTGALASALANASPEQQRTLLGENL  587

Query  25   YPLVDQLE  2
            YPLVDQLE
Sbjct  588  YPLVDQLE  595



>ref|XP_006409548.1| hypothetical protein EUTSA_v10022589mg [Eutrema salsugineum]
 gb|ESQ51001.1| hypothetical protein EUTSA_v10022589mg [Eutrema salsugineum]
Length=649

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 41/53 (77%), Gaps = 4/53 (8%)
 Frame = -1

Query  148  LPYDMGGMLP-RDAA---PVPITALASALANAPPEQQRTMLGENLYPLVDQLE  2
            LPY+M   +P RD+     VPI ALA++LANA PE QRTMLGENLYPLV+QLE
Sbjct  534  LPYEMPSNMPLRDSVLSQHVPIGALATSLANASPEHQRTMLGENLYPLVEQLE  586



>gb|KDO79129.1| hypothetical protein CISIN_1g006290mg [Citrus sinensis]
Length=650

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 53/68 (78%), Gaps = 4/68 (6%)
 Frame = -1

Query  193  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENL  26
            N+ D P+ GV GGM+  PYD+GGM  RDAA   P+   ALASALANA PEQQRT+LGENL
Sbjct  515  NIPDVPVAGVPGGMLPGPYDIGGMPFRDAAFSQPMQTGALASALANASPEQQRTLLGENL  574

Query  25   YPLVDQLE  2
            YPLVDQLE
Sbjct  575  YPLVDQLE  582



>ref|XP_004505404.1| PREDICTED: polyadenylate-binding protein 2-like [Cicer arietinum]
Length=585

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 41/52 (79%), Gaps = 4/52 (8%)
 Frame = -1

Query  184  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTM  41
            DGPMPGV GGM S+PYD+GG+  RDA+    +PI ALAS LANA PEQQRT+
Sbjct  529  DGPMPGVAGGMFSVPYDVGGIPLRDASLPQQIPIGALASHLANASPEQQRTV  580



>gb|KHG04753.1| Polyadenylate-binding 2 -like protein [Gossypium arboreum]
Length=590

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 49/57 (86%), Gaps = 3/57 (5%)
 Frame = -1

Query  163  GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPLVDQLE  2
            GGM+S+PYDMGGM  RDA    P+PI ALA+ALANA PEQQRTMLGE+LYPLV++LE
Sbjct  467  GGMLSVPYDMGGMPLRDAGIGQPMPIPALATALANATPEQQRTMLGESLYPLVERLE  523



>gb|KFK30042.1| hypothetical protein AALP_AA7G209600 [Arabis alpina]
Length=632

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 42/56 (75%), Gaps = 5/56 (9%)
 Frame = -1

Query  169  GVGGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLVDQLE  2
            G GG V  PYDMG     +  P+PI ALAS LA+A PEQQRTMLGE+LYPLV+QLE
Sbjct  524  GSGGDVP-PYDMGN----NNMPLPIGALASNLAHASPEQQRTMLGESLYPLVEQLE  574



>gb|EYU36334.1| hypothetical protein MIMGU_mgv1a002624mg [Erythranthe guttata]
Length=653

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 49/58 (84%), Gaps = 7/58 (12%)
 Frame = -1

Query  154  VSLPYDMG-GMLPRDAAPV------PITALASALANAPPEQQRTMLGENLYPLVDQLE  2
            +S+PYDMG GMLPRD+AP+      PITALA+ALANA  +QQRTMLGENLYPLVDQLE
Sbjct  531  LSVPYDMGSGMLPRDSAPIQQQQPMPITALATALANATSDQQRTMLGENLYPLVDQLE  588



>pdb|2DYD|A Chain A, Solution Structure Of The Pabc Domain From Triticum 
Aevestium Poly(A)-Binding Protein
Length=85

 Score = 59.3 bits (142),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -1

Query  100 PITALASALANAPPEQQRTMLGENLYPLVDQLE  2
           PI ALASALAN+PPE QR MLGENLYPLVDQLE
Sbjct  6   PIGALASALANSPPETQRMMLGENLYPLVDQLE  38



>emb|CDY38939.1| BnaA04g13600D [Brassica napus]
Length=644

 Score = 63.2 bits (152),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 45/64 (70%), Gaps = 4/64 (6%)
 Frame = -1

Query  193  NVSDGPMPGVGGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLV  14
            N+ DGPMPG  GMV  PYD+ GM      P+   ALAS+L+ A P QQRT+LGE LYPLV
Sbjct  515  NMPDGPMPG--GMVPFPYDINGMPL--GQPMSAGALASSLSQASPAQQRTILGETLYPLV  570

Query  13   DQLE  2
            +++E
Sbjct  571  NKIE  574



>ref|XP_009140459.1| PREDICTED: polyadenylate-binding protein 4-like [Brassica rapa]
Length=644

 Score = 63.2 bits (152),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 45/64 (70%), Gaps = 4/64 (6%)
 Frame = -1

Query  193  NVSDGPMPGVGGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLV  14
            N+ DGPMPG  GMV  PYD+ GM      P+   ALAS+L+ A P QQRT+LGE LYPLV
Sbjct  515  NMPDGPMPG--GMVPFPYDINGMPL--GQPMSAGALASSLSQASPAQQRTILGETLYPLV  570

Query  13   DQLE  2
            +++E
Sbjct  571  NKIE  574



>gb|KHG04776.1| Polyadenylate-binding 2 -like protein [Gossypium arboreum]
Length=622

 Score = 63.2 bits (152),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 54/65 (83%), Gaps = 4/65 (6%)
 Frame = -1

Query  184  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  17
            +GPM  V GG++S+PY+MGGM  RDA    P+P+ ALA+ALANA PEQQRTMLGE+LYPL
Sbjct  491  EGPMSNVPGGILSVPYEMGGMPMRDAGVGQPMPVPALATALANATPEQQRTMLGESLYPL  550

Query  16   VDQLE  2
            V++LE
Sbjct  551  VERLE  555



>gb|KHN22334.1| Polyadenylate-binding protein 2 [Glycine soja]
Length=592

 Score = 63.2 bits (152),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 45/65 (69%), Gaps = 10/65 (15%)
 Frame = -1

Query  193  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPL  17
            N+ +  + GV GGMVS  Y +G        P+P  ALASALANA PEQQRTMLGE LYPL
Sbjct  471  NMQNIQLAGVPGGMVS--YGIG-------QPMPTQALASALANATPEQQRTMLGEALYPL  521

Query  16   VDQLE  2
            VD+LE
Sbjct  522  VDKLE  526



>ref|XP_003525892.1| PREDICTED: polyadenylate-binding protein 8-like [Glycine max]
Length=630

 Score = 63.2 bits (152),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 45/65 (69%), Gaps = 10/65 (15%)
 Frame = -1

Query  193  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPL  17
            N+ +  + GV GGMVS  Y +G        P+P  ALASALANA PEQQRTMLGE LYPL
Sbjct  509  NMQNIQLAGVPGGMVS--YGIG-------QPMPTQALASALANATPEQQRTMLGEALYPL  559

Query  16   VDQLE  2
            VD+LE
Sbjct  560  VDKLE  564



>emb|CDX79295.1| BnaC06g20080D [Brassica napus]
Length=100

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  PVPITALASALANAPPEQQRTMLGENLYPLVDQLE  2
             +PI ALAS LANA PEQQRTMLGENLYPLV++LE
Sbjct  8    TMPIGALASNLANASPEQQRTMLGENLYPLVEKLE  42



>ref|XP_011092553.1| PREDICTED: polyadenylate-binding protein 2-like [Sesamum indicum]
Length=644

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 51/65 (78%), Gaps = 4/65 (6%)
 Frame = -1

Query  184  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  17
            D  + GV GGM+S+PY+MGG+  RD     P+PI ALASALANA P +QRTMLGENLYPL
Sbjct  518  DVSLQGVAGGMISVPYEMGGLPLRDVGMPQPIPIGALASALANASPSEQRTMLGENLYPL  577

Query  16   VDQLE  2
            V+QLE
Sbjct  578  VEQLE  582



>ref|XP_009119410.1| PREDICTED: polyadenylate-binding protein 2 [Brassica rapa]
Length=634

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 47/66 (71%), Gaps = 7/66 (11%)
 Frame = -1

Query  187  SDGPMPGVGGMVSLPYDMGGMLP-RD---AAPVPITALASALANAPPEQQRTMLGENLYP  20
            S GP P V GM  LPY+M   +P RD   +  VPI ALA++LANA PE QRTMLGENLY 
Sbjct  509  SGGP-PDVLGM--LPYEMPSNMPLRDPVLSQHVPIGALATSLANASPEHQRTMLGENLYQ  565

Query  19   LVDQLE  2
            LV+QLE
Sbjct  566  LVEQLE  571



>gb|EYU42687.1| hypothetical protein MIMGU_mgv1a002746mg [Erythranthe guttata]
Length=642

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 48/57 (84%), Gaps = 3/57 (5%)
 Frame = -1

Query  163  GGMVSLPYDMGGMLPRDA---APVPITALASALANAPPEQQRTMLGENLYPLVDQLE  2
            GGM+S+PY+MGG+  RDA    P+PI ALASALANA P +QRTMLGENLYPLV+QLE
Sbjct  525  GGMLSVPYEMGGLPLRDARISQPIPIGALASALANASPTEQRTMLGENLYPLVEQLE  581



>gb|KJB14632.1| hypothetical protein B456_002G134900 [Gossypium raimondii]
Length=652

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 50/58 (86%), Gaps = 4/58 (7%)
 Frame = -1

Query  163  GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRT-MLGENLYPLVDQLE  2
            GGM+S+PYDMGGM  RDAA   P+PI ALA+ALANA PEQQRT MLGE+LYPLV++LE
Sbjct  528  GGMLSVPYDMGGMSLRDAAIGQPMPIPALATALANATPEQQRTQMLGESLYPLVERLE  585



>ref|NP_001062583.1| Os09g0115400 [Oryza sativa Japonica Group]
 dbj|BAD16229.1| putative poly(A)-binding protein [Oryza sativa Japonica Group]
 dbj|BAF24497.1| Os09g0115400 [Oryza sativa Japonica Group]
 gb|EAZ08133.1| hypothetical protein OsI_30396 [Oryza sativa Indica Group]
 gb|EAZ43770.1| hypothetical protein OsJ_28392 [Oryza sativa Japonica Group]
 gb|ACA50516.1| poly(A)-binding protein [Oryza sativa Japonica Group]
 dbj|BAG90618.1| unnamed protein product [Oryza sativa Japonica Group]
Length=662

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 50/65 (77%), Gaps = 4/65 (6%)
 Frame = -1

Query  184  DGPMPGVGGMVS-LPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  17
            D  M GVGG V   PY+MGGM  RDAA   PVPI ALA+ALANA P+QQR MLGENLYPL
Sbjct  530  DPAMHGVGGGVMPSPYEMGGMPMRDAAASQPVPIGALATALANAAPDQQRMMLGENLYPL  589

Query  16   VDQLE  2
            VDQLE
Sbjct  590  VDQLE  594



>ref|XP_009136273.1| PREDICTED: polyadenylate-binding protein 2-like isoform X2 [Brassica 
rapa]
Length=614

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 44/62 (71%), Gaps = 9/62 (15%)
 Frame = -1

Query  187  SDGPMPGVGGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLVDQ  8
            S GP P V G   LPY+M    P+    VPI ALA++LANA PE QRTMLGENLYPLV+Q
Sbjct  504  SGGPPPDVPG--RLPYEM----PQH---VPIGALATSLANASPEHQRTMLGENLYPLVEQ  554

Query  7    LE  2
            LE
Sbjct  555  LE  556



>ref|XP_009136272.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Brassica 
rapa]
Length=616

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 44/62 (71%), Gaps = 9/62 (15%)
 Frame = -1

Query  187  SDGPMPGVGGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLVDQ  8
            S GP P V G   LPY+M    P+    VPI ALA++LANA PE QRTMLGENLYPLV+Q
Sbjct  506  SGGPPPDVPG--RLPYEM----PQH---VPIGALATSLANASPEHQRTMLGENLYPLVEQ  556

Query  7    LE  2
            LE
Sbjct  557  LE  558



>ref|XP_006661030.1| PREDICTED: polyadenylate-binding protein 8-like, partial [Oryza 
brachyantha]
Length=627

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 50/65 (77%), Gaps = 4/65 (6%)
 Frame = -1

Query  184  DGPMPGVGGMVS-LPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  17
            D  M GVGG V   PY+MGGM  RDAA   P+PI ALA+ALANA P+QQR MLGENLYPL
Sbjct  495  DPAMHGVGGGVMPSPYEMGGMPMRDAAASQPIPIGALATALANAAPDQQRMMLGENLYPL  554

Query  16   VDQLE  2
            VDQLE
Sbjct  555  VDQLE  559



>dbj|BAD94856.1| poly(A)-binding protein [Arabidopsis thaliana]
Length=126

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 36/48 (75%), Gaps = 5/48 (10%)
 Frame = -1

Query  145  PYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLVDQLE  2
            PYDMG  +P     + I ALAS L+NA PEQQRTMLGE LYPLV+Q+E
Sbjct  26   PYDMGNNMP-----LTIGALASNLSNATPEQQRTMLGEVLYPLVEQVE  68



>gb|KDP31970.1| hypothetical protein JCGZ_12431 [Jatropha curcas]
Length=642

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 50/64 (78%), Gaps = 4/64 (6%)
 Frame = -1

Query  184  DGPMPGV-GGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPL  17
            D PM G+ GGM+ +PYDMGGM  RD A   P+   ALA+ALANA PEQQRT+LGENLYPL
Sbjct  513  DVPMAGLPGGMLPVPYDMGGMPFRDGAFSQPMQTGALATALANATPEQQRTLLGENLYPL  572

Query  16   VDQL  5
            VDQL
Sbjct  573  VDQL  576



>emb|CDY08990.1| BnaC01g31010D [Brassica napus]
Length=99

 Score = 57.4 bits (137),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  106  PVPITALASALANAPPEQQRTMLGENLYPLVDQLE  2
            P+PI ALAS LAN  PEQQRTMLG+NLYPLV++LE
Sbjct  7    PLPIGALASNLANTSPEQQRTMLGDNLYPLVEKLE  41



>gb|KHG16756.1| Polyadenylate-binding 2 -like protein [Gossypium arboreum]
Length=514

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 37/42 (88%), Gaps = 3/42 (7%)
 Frame = -1

Query  118  RDAA---PVPITALASALANAPPEQQRTMLGENLYPLVDQLE  2
            RDA    P+P+TALA++LANA PEQQRTMLGE+LYPLV++LE
Sbjct  411  RDAGSGQPMPVTALATSLANAAPEQQRTMLGESLYPLVERLE  452



>ref|XP_010429282.1| PREDICTED: polyadenylate-binding protein 4 [Camelina sativa]
Length=662

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 45/64 (70%), Gaps = 4/64 (6%)
 Frame = -1

Query  193  NVSDGPMPGVGGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLV  14
            N+ DGPM G  GMV + YDM GM    + P+    LA++LANA P QQRT+LGE+LYPLV
Sbjct  530  NMPDGPMQG--GMVPVAYDMNGMPF--SQPMSAGQLATSLANATPAQQRTLLGESLYPLV  585

Query  13   DQLE  2
            D +E
Sbjct  586  DLIE  589



>emb|CDX89664.1| BnaC03g45780D [Brassica napus]
Length=614

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 42/60 (70%), Gaps = 12/60 (20%)
 Frame = -1

Query  181  GPMPGVGGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLVDQLE  2
            G +PG      LPY+M    P+    VPI ALA++LANA PE QRTMLGENLYPLV+QLE
Sbjct  509  GDVPG-----RLPYEM----PQH---VPIGALATSLANASPEHQRTMLGENLYPLVEQLE  556



>emb|CBI32381.3| unnamed protein product [Vitis vinifera]
Length=766

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -1

Query  124  LPRDAAPVPITALASALANAPPEQQRTMLGENLYPLVDQLE  2
            +P  +  +P+ ALA+ALANAPP +QRTMLGENLYPLV+QLE
Sbjct  664  MPAISQSIPVGALATALANAPPAEQRTMLGENLYPLVEQLE  704



>ref|XP_002863435.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39694.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=341

 Score = 59.7 bits (143),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/34 (85%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  103  VPITALASALANAPPEQQRTMLGENLYPLVDQLE  2
            VPI ALA+ LANA PEQQRTMLGENLYPLV+QLE
Sbjct  254  VPIGALATQLANAAPEQQRTMLGENLYPLVEQLE  287



>gb|KHN04485.1| Polyadenylate-binding protein 2, partial [Glycine soja]
Length=606

 Score = 60.1 bits (144),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 44/65 (68%), Gaps = 10/65 (15%)
 Frame = -1

Query  193  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPL  17
            N+ +  + GV GGMV+  Y +G  +P         ALASALANA PEQQRTMLGE LYPL
Sbjct  485  NMQNIQLAGVPGGMVT--YGIGQQMP-------TQALASALANATPEQQRTMLGEALYPL  535

Query  16   VDQLE  2
            VD+LE
Sbjct  536  VDKLE  540



>ref|XP_006578034.1| PREDICTED: polyadenylate-binding protein 8 isoform X3 [Glycine 
max]
Length=623

 Score = 60.1 bits (144),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 44/65 (68%), Gaps = 10/65 (15%)
 Frame = -1

Query  193  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPL  17
            N+ +  + GV GGMV+  Y +G  +P         ALASALANA PEQQRTMLGE LYPL
Sbjct  502  NMQNIQLAGVPGGMVT--YGIGQQMP-------TQALASALANATPEQQRTMLGEALYPL  552

Query  16   VDQLE  2
            VD+LE
Sbjct  553  VDKLE  557



>ref|XP_006578033.1| PREDICTED: polyadenylate-binding protein 8 isoform X2 [Glycine 
max]
Length=624

 Score = 60.1 bits (144),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 44/65 (68%), Gaps = 10/65 (15%)
 Frame = -1

Query  193  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPL  17
            N+ +  + GV GGMV+  Y +G  +P         ALASALANA PEQQRTMLGE LYPL
Sbjct  503  NMQNIQLAGVPGGMVT--YGIGQQMP-------TQALASALANATPEQQRTMLGEALYPL  553

Query  16   VDQLE  2
            VD+LE
Sbjct  554  VDKLE  558



>ref|XP_003523956.1| PREDICTED: polyadenylate-binding protein 8 isoform X1 [Glycine 
max]
 gb|ABC47841.1| poly(A)-binding protein [Glycine max]
Length=630

 Score = 60.1 bits (144),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 44/65 (68%), Gaps = 10/65 (15%)
 Frame = -1

Query  193  NVSDGPMPGV-GGMVSLPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPL  17
            N+ +  + GV GGMV+  Y +G  +P         ALASALANA PEQQRTMLGE LYPL
Sbjct  509  NMQNIQLAGVPGGMVT--YGIGQQMP-------TQALASALANATPEQQRTMLGEALYPL  559

Query  16   VDQLE  2
            VD+LE
Sbjct  560  VDKLE  564



>gb|KJB32341.1| hypothetical protein B456_005G236500 [Gossypium raimondii]
Length=634

 Score = 59.7 bits (143),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 42/56 (75%), Gaps = 6/56 (11%)
 Frame = -1

Query  175  MPGV-GGMVSLPYDMGGMLPRDA---APVPITALASALANAPPEQQRTML--GENL  26
            MP V GGM+S+PYDMG M  RDA    P+PI ALASALANA PEQQRT+   GE+L
Sbjct  518  MPNVPGGMLSVPYDMGSMPMRDAPLSQPIPIGALASALANATPEQQRTVHAGGESL  573



>gb|AFK34295.1| unknown [Medicago truncatula]
Length=107

 Score = 56.2 bits (134),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -1

Query  124  LPRDAAPVPITALASALANAPPEQQRTMLGENLYPLVDQLE  2
            +P  A   P+ ALA+ALANAPPEQQRTMLGE LYPLV+++E
Sbjct  1    MPGVAGGTPMQALATALANAPPEQQRTMLGEVLYPLVEKIE  41



>gb|AAL86321.1| putative poly(A)-binding protein [Arabidopsis thaliana]
Length=613

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 36/48 (75%), Gaps = 5/48 (10%)
 Frame = -1

Query  145  PYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLVDQLE  2
            PYDMG  +P     + I ALAS L+NA PEQQRTMLGE LYPLV+Q+E
Sbjct  513  PYDMGNNMP-----LTIGALASNLSNATPEQQRTMLGEVLYPLVEQVE  555



>ref|NP_195137.5| polyadenylate-binding protein 2 [Arabidopsis thaliana]
 sp|P42731.1|PABP2_ARATH RecName: Full=Polyadenylate-binding protein 2; Short=PABP-2; 
Short=Poly(A)-binding protein 2 [Arabidopsis thaliana]
 gb|AAA61780.1| poly(A)-binding protein [Arabidopsis thaliana]
 emb|CAA17561.1| poly(A)-binding protein [Arabidopsis thaliana]
 emb|CAB80128.1| poly(A)-binding protein [Arabidopsis thaliana]
 gb|AAN86187.1| putative polyadenylate-binding protein 2 (PABP2) [Arabidopsis 
thaliana]
 gb|AEE86325.1| polyadenylate-binding protein 2 [Arabidopsis thaliana]
Length=629

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 36/48 (75%), Gaps = 5/48 (10%)
 Frame = -1

Query  145  PYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLVDQLE  2
            PYDMG  +P     + I ALAS L+NA PEQQRTMLGE LYPLV+Q+E
Sbjct  529  PYDMGNNMP-----LTIGALASNLSNATPEQQRTMLGEVLYPLVEQVE  571



>emb|CDY67364.1| BnaA03g57630D [Brassica napus]
Length=293

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 37/49 (76%), Gaps = 7/49 (14%)
 Frame = -1

Query  148  LPYDMGGMLPRDAAPVPITALASALANAPPEQQRTMLGENLYPLVDQLE  2
            LPY+M    P+    VPI ALA++LANA PE QR MLGENLYPLV+QLE
Sbjct  194  LPYEM----PQH---VPIGALATSLANASPEHQRAMLGENLYPLVEQLE  235



>ref|XP_004978120.1| PREDICTED: polyadenylate-binding protein 2-like [Setaria italica]
Length=692

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 45/96 (47%), Gaps = 38/96 (40%)
 Frame = -1

Query  175  MPGVGGMVSLPYDMGGMLPRDAAPVP---ITALASALANAPPEQQRT-------------  44
            MPGV G +  PYDMGG   RDAA  P   I  L SALANA PEQQRT             
Sbjct  531  MPGVAGGMIQPYDMGGFPVRDAALSPSAQIGTLTSALANATPEQQRTVCSYLVLINLEMS  590

Query  43   ----------------------MLGENLYPLVDQLE  2
                                  +LGENLYPLV+QLE
Sbjct  591  GGICFCKFYGFKGVYSHCILISILGENLYPLVEQLE  626



>ref|XP_010688794.1| PREDICTED: polyadenylate-binding protein 2-like [Beta vulgaris 
subsp. vulgaris]
Length=661

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 51/68 (75%), Gaps = 8/68 (12%)
 Frame = -1

Query  193  NVSDGPMPGVGGMVSLP-YDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENL  26
            N+ D PMPG      LP YDMGGM  RDA    PVPITALA+ALANA PEQQRTMLGE+L
Sbjct  532  NMPDVPMPGA----MLPGYDMGGMPLRDAGIAQPVPITALATALANASPEQQRTMLGESL  587

Query  25   YPLVDQLE  2
            YPLVD +E
Sbjct  588  YPLVDAIE  595



>ref|XP_010906556.1| PREDICTED: polyadenylate-binding protein 2-like isoform X1 [Elaeis 
guineensis]
Length=654

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 49/64 (77%), Gaps = 5/64 (8%)
 Frame = -1

Query  184  DGPMPGVGGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPLV  14
            D P+PG  GM+S  YD+G M  RD+    P+PI ALASALANA PE QRTMLGE+LYPLV
Sbjct  526  DVPVPG--GMLSATYDVGVMPIRDSGMSQPIPIGALASALANASPEHQRTMLGESLYPLV  583

Query  13   DQLE  2
            DQLE
Sbjct  584  DQLE  587



>ref|XP_010906557.1| PREDICTED: polyadenylate-binding protein 8-like isoform X2 [Elaeis 
guineensis]
Length=549

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 49/64 (77%), Gaps = 5/64 (8%)
 Frame = -1

Query  184  DGPMPGVGGMVSLPYDMGGMLPRDAA---PVPITALASALANAPPEQQRTMLGENLYPLV  14
            D P+PG  GM+S  YD+G M  RD+    P+PI ALASALANA PE QRTMLGE+LYPLV
Sbjct  421  DVPVPG--GMLSATYDVGVMPIRDSGMSQPIPIGALASALANASPEHQRTMLGESLYPLV  478

Query  13   DQLE  2
            DQLE
Sbjct  479  DQLE  482



>ref|XP_002307526.2| hypothetical protein POPTR_0005s22040g [Populus trichocarpa]
 gb|EEE94522.2| hypothetical protein POPTR_0005s22040g [Populus trichocarpa]
Length=649

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 45/67 (67%), Gaps = 5/67 (7%)
 Frame = -1

Query  187  SDGPMPGVGGMVSLPYDMGGM--LPRDA---APVPITALASALANAPPEQQRTMLGENLY  23
            S  P   VG +V  P++  GM   P DA   APVPI+AL +ALA+A PE++  MLGE LY
Sbjct  524  SAAPQGFVGPVVPFPFEASGMPVTPSDAQRTAPVPISALTTALASATPEKRMVMLGEQLY  583

Query  22   PLVDQLE  2
            PLV++LE
Sbjct  584  PLVERLE  590



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 565659253830