BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF009N12

Length=781
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ADX99209.1|  zeaxanthin epoxidase                                    407   1e-134   Ipomoea nil [qian niu]
sp|Q40412.1|ABA2_NICPL  RecName: Full=Zeaxanthin epoxidase, chlor...    299   5e-93    Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_009610655.1|  PREDICTED: zeaxanthin epoxidase, chloroplastic     295   2e-91    Nicotiana tomentosiformis
ref|XP_009767383.1|  PREDICTED: zeaxanthin epoxidase, chloroplastic     295   3e-91    Nicotiana sylvestris
ref|XP_011099134.1|  PREDICTED: LOW QUALITY PROTEIN: zeaxanthin e...    289   3e-89    
gb|AGN03858.1|  zeaxanthin epoxidase                                    288   1e-88    Scutellaria baicalensis [Baikal skullcap]
ref|XP_004232029.1|  PREDICTED: zeaxanthin epoxidase, chloroplastic     286   4e-88    
ref|NP_001274839.1|  zeaxanthin epoxidase, chloroplastic-like           286   5e-88    Solanum tuberosum [potatoes]
gb|ADF28630.1|  zeaxanthin epoxidase                                    286   6e-88    Solanum tuberosum [potatoes]
sp|P93236.1|ABA2_SOLLC  RecName: Full=Zeaxanthin epoxidase, chlor...    286   6e-88    Solanum lycopersicum
gb|AIX87505.1|  zeaxanthin epoxidase                                    284   3e-87    Lycium barbarum [Duke of Argyll's teatree]
gb|EYU44400.1|  hypothetical protein MIMGU_mgv1a003436mg                282   3e-87    Erythranthe guttata [common monkey flower]
gb|ADF28629.1|  zeaxanthin epoxidase                                    283   6e-87    Solanum tuberosum [potatoes]
gb|AIX87529.1|  zeaxanthin epoxidase                                    283   1e-86    Lycium ruthenicum
emb|CAN61301.1|  hypothetical protein VITISV_011317                     271   1e-86    Vitis vinifera
gb|AGU91434.1|  zeaxanthin epoxidase                                    281   3e-86    Chrysanthemum boreale
dbj|BAE79556.1|  zeaxanthin epoxidase                                   281   3e-86    Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_010093641.1|  Zeaxanthin epoxidase                               281   5e-86    Morus notabilis
dbj|BAE72089.1|  Lactuca sativa zeaxantin epoxidase 1                   281   5e-86    Lactuca sativa [cultivated lettuce]
gb|ABC87737.1|  zeaxanthin epoxidase                                    269   5e-85    Coffea canephora [robusta coffee]
gb|ABB52077.1|  putative zeaxanthin epoxidase                           278   8e-85    Daucus carota subsp. sativus
gb|KDP31935.1|  hypothetical protein JCGZ_12396                         277   9e-85    Jatropha curcas
ref|XP_010269709.1|  PREDICTED: zeaxanthin epoxidase, chloroplastic     275   1e-83    Nelumbo nucifera [Indian lotus]
ref|XP_011043539.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    273   5e-83    Populus euphratica
ref|XP_011005864.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    273   7e-83    Populus euphratica
gb|AJB84624.1|  zeaxanthin epoxidase                                    273   8e-83    Camellia sinensis [black tea]
ref|NP_001268202.1|  zeaxanthin epoxidase                               272   1e-82    Vitis vinifera
emb|CDP02496.1|  unnamed protein product                                271   1e-82    Coffea canephora [robusta coffee]
ref|XP_006393902.1|  hypothetical protein EUTSA_v10003769mg             272   2e-82    
gb|AIU94746.1|  zeaxanthin epoxidase                                    271   2e-82    Morus alba var. multicaulis
ref|XP_006393901.1|  hypothetical protein EUTSA_v10003769mg             271   2e-82    Eutrema salsugineum [saltwater cress]
ref|XP_009103460.1|  PREDICTED: zeaxanthin epoxidase, chloroplastic     270   6e-82    Brassica rapa
emb|CBI21425.3|  unnamed protein product                                270   6e-82    Vitis vinifera
gb|AAR11195.1|  zeaxanthin epoxidase                                    270   1e-81    Vitis vinifera
ref|XP_008457782.1|  PREDICTED: zeaxanthin epoxidase, chloroplastic     270   1e-81    
gb|AAV85824.1|  zeaxanthin epoxidase                                    269   2e-81    Eutrema halophilum
ref|XP_010028248.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    269   2e-81    Eucalyptus grandis [rose gum]
gb|ACM68704.1|  zeaxanthin epoxidase                                    268   4e-81    Brassica rapa subsp. pekinensis [bai cai]
ref|XP_010666612.1|  PREDICTED: zeaxanthin epoxidase, chloroplastic     268   5e-81    Beta vulgaris subsp. vulgaris [field beet]
emb|CDY01444.1|  BnaA07g12170D                                          268   9e-81    
gb|ADC29517.1|  zeaxanthin epoxidase                                    267   9e-81    Brassica napus [oilseed rape]
sp|Q96375.1|ABA2_CAPAN  RecName: Full=Zeaxanthin epoxidase, chlor...    266   2e-80    Capsicum annuum
ref|XP_004149704.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    265   6e-80    
ref|XP_011078061.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    264   1e-79    
emb|CDY12798.1|  BnaC07g16350D                                          266   1e-79    Brassica napus [oilseed rape]
ref|XP_002307265.1|  zeaxanthin epoxidase family protein                265   1e-79    
dbj|BAA88841.1|  zea-xanthin epoxidase                                  264   1e-79    Gentiana lutea
ref|XP_002523587.1|  zeaxanthin epoxidase, putative                     264   1e-79    Ricinus communis
gb|KFK28343.1|  hypothetical protein AALP_AA8G503900                    263   3e-79    Arabis alpina [alpine rockcress]
gb|ADP69105.1|  zeaxanthin epoxidase                                    263   3e-79    Cucumis sativus [cucumbers]
ref|XP_002865032.1|  hypothetical protein ARALYDRAFT_496897             262   8e-79    Arabidopsis lyrata subsp. lyrata
gb|KDO79217.1|  hypothetical protein CISIN_1g005770mg                   253   2e-78    Citrus sinensis [apfelsine]
dbj|BAA88842.1|  zea-Xanthin epoxidase                                  261   3e-78    Gentiana lutea
gb|KDO79216.1|  hypothetical protein CISIN_1g005770mg                   253   7e-78    Citrus sinensis [apfelsine]
ref|XP_006280131.1|  hypothetical protein CARUB_v10026026mg             259   8e-78    Capsella rubella
sp|O81360.1|ABA2_PRUAR  RecName: Full=Zeaxanthin epoxidase, chlor...    259   1e-77    Prunus armeniaca
gb|ADI56522.1|  zeaxanthin epoxidase                                    259   1e-77    Citrullus lanatus [wild melon]
gb|KDO79214.1|  hypothetical protein CISIN_1g005770mg                   254   2e-77    Citrus sinensis [apfelsine]
gb|AAG17703.1|AF281655_1  zeaxanthin epoxidase                          258   2e-77    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007204247.1|  hypothetical protein PRUPE_ppa002248mg             259   2e-77    
ref|NP_851285.1|  zeaxanthin epoxidase                                  258   2e-77    Arabidopsis thaliana [mouse-ear cress]
gb|AAF82390.1|AF134577_1  zeaxanthin epoxidase                          258   3e-77    Arabidopsis thaliana [mouse-ear cress]
dbj|BAB11935.1|  AtABA1                                                 258   3e-77    Arabidopsis thaliana [mouse-ear cress]
gb|KDO79213.1|  hypothetical protein CISIN_1g005770mg                   254   4e-77    Citrus sinensis [apfelsine]
dbj|BAB78733.1|  zeaxanthin epoxidase                                   258   4e-77    Citrus unshiu [satsuma mandarin]
ref|XP_010484561.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    258   4e-77    Camelina sativa [gold-of-pleasure]
dbj|BAI79257.1|  zeaxanthin epoxidase                                   257   5e-77    Citrus unshiu [satsuma mandarin]
ref|XP_006466600.1|  PREDICTED: zeaxanthin epoxidase, chloroplastic     257   5e-77    Citrus sinensis [apfelsine]
ref|XP_010444704.1|  PREDICTED: zeaxanthin epoxidase, chloroplastic     257   6e-77    Camelina sativa [gold-of-pleasure]
gb|ACE79170.1|  zeaxanthin epoxidase                                    257   7e-77    Citrus maxima [buntan]
gb|KDO79163.1|  hypothetical protein CISIN_1g0151672mg                  246   9e-77    Citrus sinensis [apfelsine]
ref|XP_008340140.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    258   1e-76    
ref|XP_006653464.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    254   1e-76    
ref|XP_006425899.1|  hypothetical protein CICLE_v10025089mg             256   1e-76    Citrus clementina [clementine]
gb|KHN42080.1|  Zeaxanthin epoxidase, chloroplastic                     256   2e-76    Glycine soja [wild soybean]
ref|NP_001241348.1|  zeaxanthin epoxidase, chloroplastic-like           256   2e-76    Glycine max [soybeans]
ref|XP_007047261.1|  Zeaxanthin epoxidase (ZEP) (ABA1) isoform 2        255   3e-76    
ref|XP_010547517.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    255   3e-76    Tarenaya hassleriana [spider flower]
ref|XP_009345968.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    255   4e-76    Pyrus x bretschneideri [bai li]
gb|KDO79210.1|  hypothetical protein CISIN_1g005770mg                   255   4e-76    Citrus sinensis [apfelsine]
ref|XP_007156802.1|  hypothetical protein PHAVU_002G018700g             254   5e-76    Phaseolus vulgaris [French bean]
ref|XP_009343160.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    254   5e-76    Pyrus x bretschneideri [bai li]
ref|XP_010939415.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    254   5e-76    Elaeis guineensis
emb|CDY63427.1|  BnaC08g48380D                                          246   7e-76    Brassica napus [oilseed rape]
emb|CAX36916.1|  zeaxanthin epoxidase enzyme                            246   1e-75    Triticum aestivum [Canadian hard winter wheat]
gb|AFK33361.1|  unknown                                                 239   4e-75    Lotus japonicus
ref|XP_008338317.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    252   5e-75    Malus domestica [apple tree]
gb|AEN94901.1|  zeaxanthin epoxidase                                    252   7e-75    Cucurbita moschata [ayote]
ref|XP_003579861.1|  PREDICTED: zeaxanthin epoxidase, chloroplastic     251   9e-75    Brachypodium distachyon [annual false brome]
dbj|BAN15741.1|  zeaxanthin epoxydase                                   251   1e-74    Dianthus caryophyllus [carnation]
gb|AIP98334.1|  ZEP                                                     251   1e-74    Medicago sativa [alfalfa]
ref|XP_008241462.1|  PREDICTED: zeaxanthin epoxidase, chloroplastic     251   2e-74    Prunus mume [ume]
ref|XP_007047262.1|  Zeaxanthin epoxidase (ZEP) (ABA1) isoform 3        251   2e-74    
ref|XP_009345967.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    250   3e-74    
ref|XP_003638746.1|  Zeaxanthin epoxidase                               249   4e-74    
dbj|BAK08085.1|  predicted protein                                      249   4e-74    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAB11934.1|  CpABA1                                                 248   5e-74    Vigna unguiculata
gb|AAN63502.2|AF384103_1  zeaxanthin epoxidase                          241   6e-74    Triticum aestivum [Canadian hard winter wheat]
gb|EAY94319.1|  hypothetical protein OsI_16086                          248   8e-74    Oryza sativa Indica Group [Indian rice]
ref|XP_007047260.1|  Zeaxanthin epoxidase (ZEP) (ABA1) isoform 1        249   1e-73    
emb|CAD40867.2|  OSJNBa0064H22.16                                       248   1e-73    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001052926.1|  Os04g0448900                                       248   1e-73    
gb|EAZ30898.1|  hypothetical protein OsJ_14973                          248   1e-73    Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ93704.1|  predicted protein                                      248   2e-73    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009112352.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    248   2e-73    Brassica rapa
ref|XP_006494451.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    248   2e-73    Citrus sinensis [apfelsine]
ref|XP_008338316.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    248   3e-73    
gb|AHI87686.1|  zeaxanthin epoxidase                                    248   3e-73    Lupinus luteus
ref|XP_010558547.1|  PREDICTED: zeaxanthin epoxidase, chloroplastic     247   4e-73    Tarenaya hassleriana [spider flower]
gb|AFW58424.1|  hypothetical protein ZEAMMB73_168386                    236   4e-73    
ref|XP_007155924.1|  hypothetical protein PHAVU_003G243800g             247   4e-73    Phaseolus vulgaris [French bean]
ref|XP_008338315.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    246   6e-73    Malus domestica [apple tree]
ref|XP_004511928.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    246   8e-73    Cicer arietinum [garbanzo]
gb|EMS59958.1|  Zeaxanthin epoxidase, chloroplastic                     246   8e-73    Triticum urartu
emb|CDY18634.1|  BnaA09g07610D                                          246   9e-73    Brassica napus [oilseed rape]
ref|XP_008663244.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    236   1e-72    
gb|KDO79209.1|  hypothetical protein CISIN_1g005770mg                   245   2e-72    Citrus sinensis [apfelsine]
gb|KHN26473.1|  Zeaxanthin epoxidase, chloroplastic                     244   4e-72    Glycine soja [wild soybean]
ref|NP_001276261.1|  zeaxanthin epoxidase                               244   5e-72    Glycine max [soybeans]
gb|KDO79212.1|  hypothetical protein CISIN_1g005770mg                   243   6e-72    Citrus sinensis [apfelsine]
tpg|DAA37569.1|  TPA: hypothetical protein ZEAMMB73_483204              242   7e-72    
ref|XP_008797271.1|  PREDICTED: zeaxanthin epoxidase, chloroplastic     243   1e-71    Phoenix dactylifera
emb|CDX81344.1|  BnaC09g07550D                                          243   1e-71    
ref|XP_011457329.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    233   1e-71    Fragaria vesca subsp. vesca
ref|XP_003611740.1|  Zeaxanthin epoxidase                               234   2e-71    
ref|XP_008668109.1|  PREDICTED: zeaxanthin epoxidase isoform X1         243   2e-71    Zea mays [maize]
ref|XP_004509142.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    242   2e-71    Cicer arietinum [garbanzo]
tpg|DAA37570.1|  TPA: zeaxanthin epoxidase                              242   3e-71    
ref|NP_001151443.1|  zeaxanthin epoxidase                               242   4e-71    Zea mays [maize]
ref|XP_004975770.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    239   2e-70    Setaria italica
dbj|BAI79258.1|  zeaxanthin epoxidase                                   238   8e-70    Citrus unshiu [satsuma mandarin]
dbj|BAI79260.1|  zeaxanthin epoxidase                                   238   2e-69    Citrus sinensis [apfelsine]
gb|AFR11774.2|  zeaxanthin epoxidase                                    237   3e-69    Fragaria x ananassa
gb|KEH27527.1|  zeaxanthin epoxidase                                    236   6e-69    Medicago truncatula
ref|XP_010028251.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    231   1e-68    
gb|KHG01019.1|  Zeaxanthin epoxidase, chloroplastic -like protein       231   7e-68    Gossypium arboreum [tree cotton]
ref|XP_010028249.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    233   1e-67    Eucalyptus grandis [rose gum]
dbj|BAF49058.1|  zeaxanthin epoxidase                                   228   3e-67    Prunus mume [ume]
ref|XP_010028250.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    231   3e-67    Eucalyptus grandis [rose gum]
ref|XP_009410101.1|  PREDICTED: zeaxanthin epoxidase, chloroplastic     231   4e-67    Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB43726.1|  hypothetical protein B456_007G213500                    230   7e-67    Gossypium raimondii
ref|XP_002310139.1|  zeaxanthin epoxidase family protein                225   3e-65    
gb|KEH27529.1|  zeaxanthin epoxidase                                    218   5e-62    Medicago truncatula
sp|C3VEQ2.1|ZEP_ONCHC  RecName: Full=Zeaxanthin epoxidase, chloro...    211   2e-59    Oncidium hybrid cultivar
ref|XP_006425928.1|  hypothetical protein CICLE_v10027323mg             206   8e-58    
gb|AHE41420.1|  zeaxanthin epoxidase                                    184   3e-54    Lycium chinense [Chinese boxthorn]
dbj|BAB39765.1|  zeaxanthin epoxidase                                   195   6e-54    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010939416.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    189   4e-52    
gb|AFA36620.1|  zeaxanthin epoxidase enzyme                             177   2e-50    Lolium perenne [perennial ryegrass]
ref|XP_001767201.1|  predicted protein                                  182   2e-49    
ref|XP_004975774.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    180   1e-48    Setaria italica
ref|XP_002972237.1|  zeaxanthin epoxidase                               168   2e-44    
ref|XP_002984150.1|  hypothetical protein SELMODRAFT_234460             168   4e-44    Selaginella moellendorffii
gb|EPS62910.1|  zeaxanthin epoxidase, chloroplastic                     165   1e-43    Genlisea aurea
ref|NP_201504.2|  zeaxanthin epoxidase                                  157   1e-40    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006842967.1|  hypothetical protein AMTR_s00076p00039590          151   2e-38    
gb|KHN36228.1|  Zeaxanthin epoxidase, chloroplastic                     146   5e-37    Glycine soja [wild soybean]
ref|XP_010939417.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    145   3e-36    
ref|XP_009112353.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    144   7e-36    
gb|KCW54949.1|  hypothetical protein EUGRSUZ_I00922                     141   6e-35    Eucalyptus grandis [rose gum]
gb|KEH27528.1|  zeaxanthin epoxidase                                    139   2e-34    Medicago truncatula
gb|EPS69457.1|  zeaxanthin epoxidase, chloroplastic                     120   2e-30    Genlisea aurea
gb|AET07431.1|  zeaxanthin epoxidase                                    113   3e-28    Ipomoea batatas [batate]
ref|XP_008358098.1|  PREDICTED: LOW QUALITY PROTEIN: zeaxanthin e...    119   7e-27    
ref|XP_010939418.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...    118   9e-27    
gb|AGT01911.1|  putative zeaxanthin epoxidase                         93.2    2e-20    Vaccinium myrtillus [bilberry]
gb|AGS79171.1|  zeaxanthin epoxidase                                  93.2    9e-20    Fagopyrum tataricum [Kangra buckwheat]
gb|ACL27574.1|  zeaxanthin epoxidase                                  90.5    2e-18    Cucumis melo [Oriental melon]
gb|EYU39329.1|  hypothetical protein MIMGU_mgv1a005544mg              90.9    2e-17    Erythranthe guttata [common monkey flower]
gb|ADJ55721.1|  zeaxanthin epoxidase                                  83.2    1e-16    Ensete ventricosum
gb|ADJ55718.1|  zeaxanthin epoxidase                                  82.4    2e-16    Musa beccarii
gb|AES94698.2|  zeaxanthin epoxidase                                  88.2    2e-16    Medicago truncatula
gb|ADJ55709.1|  zeaxanthin epoxidase                                  81.3    5e-16    Musa acuminata [banana]
gb|ADJ55713.1|  zeaxanthin epoxidase                                  81.3    5e-16    Musa ornata [flowering banana]
gb|ADJ55711.1|  zeaxanthin epoxidase                                  81.3    5e-16    Musa balbisiana [starchy banana]
gb|ADJ55720.1|  zeaxanthin epoxidase                                  81.3    5e-16    Musella lasiocarpa
ref|XP_011399382.1|  Zeaxanthin epoxidase, chloroplastic              87.0    8e-16    Auxenochlorella protothecoides
ref|XP_005844735.1|  hypothetical protein CHLNCDRAFT_138731           85.9    2e-15    Chlorella variabilis
gb|ADJ55715.1|  zeaxanthin epoxidase                                  79.3    2e-15    Musa troglodytarum [fe'i banana]
ref|XP_005646300.1|  FAD/NAD(P)-binding domain-containing protein     81.3    6e-14    Coccomyxa subellipsoidea C-169
gb|EYU39330.1|  hypothetical protein MIMGU_mgv1a005544mg              74.7    7e-12    Erythranthe guttata [common monkey flower]
gb|AAO48941.1|  zeaxanthin epoxidase precursor                        69.3    5e-10    Chlamydomonas sp. W80
gb|AGK25933.1|  zeaxanthin epoxidase                                  65.9    4e-09    Eriobotrya japonica [loquat]
gb|AAL91193.1|  zeaxanthin epoxidase precursor                        65.5    9e-09    Arabidopsis thaliana [mouse-ear cress]
gb|KIZ01704.1|  zeaxanthin epoxidase                                  61.2    2e-07    Monoraphidium neglectum
emb|CCI79384.1|  zeaxanthin epoxidase                                 60.1    5e-07    Chromochloris zofingiensis
ref|XP_002953670.1|  hypothetical protein VOLCADRAFT_75879            58.9    1e-06    Volvox carteri f. nagariensis
ref|XP_001701701.1|  zeaxanthin epoxidase                             56.2    1e-05    Chlamydomonas reinhardtii
gb|AEK69513.1|  zeaxanthin epoxidase 3                                55.8    1e-05    Glycine max [soybeans]
ref|NP_001066037.1|  Os12g0124000                                     54.7    1e-05    
gb|ABA95708.2|  FHA domain containing protein, expressed              55.1    2e-05    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006662695.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...  53.5    3e-05    Oryza brachyantha
ref|XP_004978482.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...  52.8    7e-05    Setaria italica
ref|XP_006663771.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...  52.0    1e-04    Oryza brachyantha
gb|EEC67581.1|  hypothetical protein OsI_34939                        50.4    5e-04    Oryza sativa Indica Group [Indian rice]
ref|XP_004977424.1|  PREDICTED: zeaxanthin epoxidase, chloroplast...  49.3    0.001    Setaria italica



>gb|ADX99209.1| zeaxanthin epoxidase [Ipomoea nil]
Length=672

 Score =   407 bits (1046),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 205/205 (100%), Positives = 205/205 (100%), Gaps = 0/205 (0%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD
Sbjct  468  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  527

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTSVVVSSPEVS
Sbjct  528  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTSVVVSSPEVS  587

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF
Sbjct  588  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  647

Query  239  HVKVKVMKFPPFSGGKGEMEVLQAA  165
            HVKVKVMKFPPFSGGKGEMEVLQAA
Sbjct  648  HVKVKVMKFPPFSGGKGEMEVLQAA  672



>sp|Q40412.1|ABA2_NICPL RecName: Full=Zeaxanthin epoxidase, chloroplastic; Flags: Precursor 
[Nicotiana plumbaginifolia]
 emb|CAA65048.1| zeaxanthin epoxidase [Nicotiana plumbaginifolia]
Length=663

 Score =   299 bits (766),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 170/205 (83%), Gaps = 3/205 (1%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FRIPHPGRVGGRFFIDL MPLMLSWVLGGNGEKLEGR + CRLS+KANDQLR WF+DD
Sbjct  462  TKFRIPHPGRVGGRFFIDLGMPLMLSWVLGGNGEKLEGRIQHCRLSEKANDQLRNWFEDD  521

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALERA + EW L P  N+ + A E ++L RDE  PC +GSV H N PG SVV+  P+VS
Sbjct  522  DALERATDAEWLLLPAGNSNA-ALETLVLSRDENMPCNIGSVSHANIPGKSVVIPLPQVS  580

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            E+HARISYK GAFFVTDLRS+HGTWITDNEGRRYR SPNFPTRFHPSDI+EFGSD+KAAF
Sbjct  581  EMHARISYKGGAFFVTDLRSEHGTWITDNEGRRYRASPNFPTRFHPSDIIEFGSDKKAAF  640

Query  239  HVKVKVMKFPPFSGGKGEMEVLQAA  165
              +VKVMKFPP +  K E + + AA
Sbjct  641  --RVKVMKFPPKTAAKEERQAVGAA  663



>ref|XP_009610655.1| PREDICTED: zeaxanthin epoxidase, chloroplastic [Nicotiana tomentosiformis]
Length=664

 Score =   295 bits (756),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 148/198 (75%), Positives = 163/198 (82%), Gaps = 3/198 (2%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T FRIPHPGRVGGRFFIDL MPLMLSWVLGGNGEKLEGR K CRLS+KANDQLR WF DD
Sbjct  462  TNFRIPHPGRVGGRFFIDLGMPLMLSWVLGGNGEKLEGRIKHCRLSEKANDQLRNWFVDD  521

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALERA + EW L P  N  + A E ++L RDE  PC +GSV H N PG S+V+  P+VS
Sbjct  522  DALERATDAEWLLLPAGNGNA-AVEALVLSRDEDMPCTIGSVSHTNIPGKSLVIPLPQVS  580

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            E+HARISYK GAFFVTDLRS+HGTWITDNEGRRYR SPNFPTRFHPSDI+EFGSD+KAAF
Sbjct  581  EMHARISYKGGAFFVTDLRSEHGTWITDNEGRRYRASPNFPTRFHPSDIIEFGSDKKAAF  640

Query  239  HVKVKVMKFPPFSGGKGE  186
              +VKVMKFPP +  K E
Sbjct  641  --RVKVMKFPPKTAAKKE  656



>ref|XP_009767383.1| PREDICTED: zeaxanthin epoxidase, chloroplastic [Nicotiana sylvestris]
Length=664

 Score =   295 bits (754),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 146/198 (74%), Positives = 165/198 (83%), Gaps = 3/198 (2%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FRIPHPGRVGGRFFIDL MPLMLSWVLGGNGEKLEGR + CRLS+KANDQLR WF+DD
Sbjct  462  TKFRIPHPGRVGGRFFIDLGMPLMLSWVLGGNGEKLEGRIQHCRLSEKANDQLRNWFEDD  521

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALERA + EW L P  N+ +   E ++L RDE  PC +GSV H N PG SVV+  P+VS
Sbjct  522  DALERATDAEWLLLPAGNSNADL-ETLVLSRDENMPCTIGSVSHTNIPGKSVVIPLPQVS  580

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            ++HARISYK GAFFVTDLRS+HGTWITDNEGRRYR SPNFPTRFHPSDI+EFGSD+KAAF
Sbjct  581  QMHARISYKGGAFFVTDLRSEHGTWITDNEGRRYRASPNFPTRFHPSDIIEFGSDKKAAF  640

Query  239  HVKVKVMKFPPFSGGKGE  186
              +VKVMKFPP +  K E
Sbjct  641  --RVKVMKFPPKTAAKKE  656



>ref|XP_011099134.1| PREDICTED: LOW QUALITY PROTEIN: zeaxanthin epoxidase, chloroplastic 
[Sesamum indicum]
Length=656

 Score =   289 bits (740),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 146/206 (71%), Positives = 173/206 (84%), Gaps = 4/206 (2%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FRIPHPGRVGGR FID+ MPLMLSWVLGGNG +LEGR + CRLSDKANDQLR+WF DD
Sbjct  454  TKFRIPHPGRVGGRLFIDIGMPLMLSWVLGGNGSELEGRVQHCRLSDKANDQLRRWFTDD  513

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            +ALERA++ +WFL P+ ++T+ ASE I L RDEK P +VGSV H NF G S+V+ SP+VS
Sbjct  514  EALERALDADWFLFPIGDSTA-ASETIFLSRDEKNPYVVGSVSHANFAGVSIVIPSPQVS  572

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            E+HARISYKDGAFFVTDL+S+HGTWITDNEGRRYRVSPNFPTRF P+D++EFGSD+KA+F
Sbjct  573  EMHARISYKDGAFFVTDLKSEHGTWITDNEGRRYRVSPNFPTRFRPTDVIEFGSDKKASF  632

Query  239  HVKVKVMKFPP-FSGGKGEMEVLQAA  165
              +VK MK  P  +  K E EVLQA 
Sbjct  633  --RVKAMKLSPKKTDKKDEDEVLQAV  656



>gb|AGN03858.1| zeaxanthin epoxidase [Scutellaria baicalensis]
Length=661

 Score =   288 bits (736),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 143/205 (70%), Positives = 169/205 (82%), Gaps = 2/205 (1%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FRIPHPGRVGGR FID+ MPLMLSWVLGGNG KLEGR  QCRLSDKA+DQLRKWFDDD
Sbjct  459  TKFRIPHPGRVGGRVFIDIGMPLMLSWVLGGNGSKLEGRALQCRLSDKASDQLRKWFDDD  518

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALERA++ EW+L P+ ++T+ ASE I L RDEK P ++GSV H NFPG S+V+ SP+VS
Sbjct  519  DALERALDAEWYLFPIGDSTA-ASETIFLSRDEKKPYVIGSVSHSNFPGVSIVIPSPQVS  577

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            ++HARISYKDGAF+VTDL+S+HGTWI DNEGRR  VSPN PTRF P+D++EFGSD+KAAF
Sbjct  578  KMHARISYKDGAFYVTDLKSEHGTWIVDNEGRRLCVSPNIPTRFRPTDLIEFGSDKKAAF  637

Query  239  HVKVKVMKFPPFSGGKGEMEVLQAA  165
             VK  +   P  +  K E EVLQA 
Sbjct  638  RVKA-LKSLPKTTKTKDENEVLQAV  661



>ref|XP_004232029.1| PREDICTED: zeaxanthin epoxidase, chloroplastic [Solanum lycopersicum]
 gb|ABQ52698.1| zeaxanthin epoxidase [Solanum lycopersicum]
 gb|ABS82068.1| chloroplast zeaxanthin epoxidase precursor [Solanum lycopersicum]
Length=669

 Score =   286 bits (733),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 148/206 (72%), Positives = 167/206 (81%), Gaps = 5/206 (2%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            TQ+RIPHPGRVGGR FIDL MPLMLSWVLGGNG+KLEGR K CRLS+KANDQLRKWF+DD
Sbjct  468  TQYRIPHPGRVGGRVFIDLGMPLMLSWVLGGNGDKLEGRIKHCRLSEKANDQLRKWFEDD  527

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALERA + EW L P  N  S+  E I+L RDE  PC VGS+ H N PG S+V+  P+VS
Sbjct  528  DALERATDAEWLLLPAGNG-SSGLEAIVLSRDEDVPCTVGSISHTNIPGKSIVLPLPQVS  586

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            E+HARIS KDGAFFVTDLRS+HGTW+TDNEGRRYR SPNFPTRFHPSD++EFGSD KAAF
Sbjct  587  EMHARISCKDGAFFVTDLRSEHGTWVTDNEGRRYRTSPNFPTRFHPSDVIEFGSD-KAAF  645

Query  239  HVKVKVMKFP-PFSGGKGEMEVLQAA  165
              +VK MKFP   S  K E E ++AA
Sbjct  646  --RVKAMKFPLKTSERKEEREAVEAA  669



>ref|NP_001274839.1| zeaxanthin epoxidase, chloroplastic-like [Solanum tuberosum]
 gb|ABA55731.1| zeaxanthin epoxidase [Solanum tuberosum]
Length=670

 Score =   286 bits (732),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 160/191 (84%), Gaps = 4/191 (2%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            TQ+RIPHPGRVGGR FIDL MPLMLSWVLGGNG+KLEGR K CRLS+KANDQLRKWF+DD
Sbjct  468  TQYRIPHPGRVGGRVFIDLGMPLMLSWVLGGNGDKLEGRIKHCRLSEKANDQLRKWFEDD  527

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALERA + EW L P  N TS   E I+L RDE  PC +GSV H N PG SVV+  P+VS
Sbjct  528  DALERATDAEWLLLPAGNGTS-GLEAIVLSRDEDVPCTIGSVSHTNIPGKSVVLPLPQVS  586

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            E+HARIS KDGAFFVTDL+S+HGTW+TDNEGRRYR SPNFPTRFHPSD++EFGSD KAAF
Sbjct  587  EMHARISCKDGAFFVTDLQSEHGTWVTDNEGRRYRTSPNFPTRFHPSDVIEFGSD-KAAF  645

Query  239  HVKVKVMKFPP  207
              +VK MKFPP
Sbjct  646  --RVKAMKFPP  654



>gb|ADF28630.1| zeaxanthin epoxidase [Solanum tuberosum]
Length=669

 Score =   286 bits (732),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 160/191 (84%), Gaps = 4/191 (2%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            TQ+RIPHPGRVGGR FIDL MPLMLSWVLGGNG+KLEGR K CRLS+KANDQLRKWF+DD
Sbjct  468  TQYRIPHPGRVGGRVFIDLGMPLMLSWVLGGNGDKLEGRIKHCRLSEKANDQLRKWFEDD  527

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALERA + EW L P  N TS   E I+L RDE  PC +GSV H N PG SVV+  P+VS
Sbjct  528  DALERATDAEWLLLPAGNGTS-GLEAIVLSRDEDVPCTIGSVSHTNIPGKSVVLPLPQVS  586

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            E+HARIS KDGAFFVTDL+S+HGTW+TDNEGRRYR SPNFPTRFHPSD++EFGSD KAAF
Sbjct  587  EMHARISCKDGAFFVTDLQSEHGTWVTDNEGRRYRTSPNFPTRFHPSDVIEFGSD-KAAF  645

Query  239  HVKVKVMKFPP  207
              +VK MKFPP
Sbjct  646  --RVKAMKFPP  654



>sp|P93236.1|ABA2_SOLLC RecName: Full=Zeaxanthin epoxidase, chloroplastic; Flags: Precursor 
[Solanum lycopersicum]
 emb|CAB06084.1| zeaxanthin epoxidase [Solanum lycopersicum]
Length=669

 Score =   286 bits (732),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 148/206 (72%), Positives = 167/206 (81%), Gaps = 5/206 (2%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            TQ+RIPHPGRVGGR FIDL MPLMLSWVLGGNG+KLEGR K CRLS+KANDQLRKWF+DD
Sbjct  468  TQYRIPHPGRVGGRVFIDLGMPLMLSWVLGGNGDKLEGRIKHCRLSEKANDQLRKWFEDD  527

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALERA + EW L P  N  S+  E I+L RDE  PC VGS+ H N PG S+V+  P+VS
Sbjct  528  DALERATDAEWLLLPAGNG-SSGLEAIVLSRDEDVPCTVGSISHTNIPGKSIVLPLPQVS  586

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            E+HARIS KDGAFFVTDLRS+HGTW+TDNEGRRYR SPNFPTRFHPSD++EFGSD KAAF
Sbjct  587  EMHARISCKDGAFFVTDLRSEHGTWVTDNEGRRYRTSPNFPTRFHPSDVIEFGSD-KAAF  645

Query  239  HVKVKVMKFP-PFSGGKGEMEVLQAA  165
              +VK MKFP   S  K E E ++AA
Sbjct  646  --RVKAMKFPLKTSERKEEREAVEAA  669



>gb|AIX87505.1| zeaxanthin epoxidase [Lycium barbarum]
Length=662

 Score =   284 bits (727),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 142/198 (72%), Positives = 165/198 (83%), Gaps = 4/198 (2%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T++RIPHPGRVGGR FIDL MPLMLSWVLGGNG+KLEGR + CRLS+KANDQLRKWF+DD
Sbjct  461  TKYRIPHPGRVGGRVFIDLGMPLMLSWVLGGNGDKLEGRIQHCRLSEKANDQLRKWFEDD  520

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALERA + EW L P  N  + A +PI+L RDE  PC +GSV H N PG S+VV  P+VS
Sbjct  521  DALERATDAEWLLLPAGNGNA-ALQPIVLSRDEGIPCTIGSVSHTNIPGKSIVVPLPQVS  579

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            ++HARIS KDGAFFVTDL+S+HGTW+TDNEGR+YRVSPNFPTRFHPSD +EFGSD KAAF
Sbjct  580  QIHARISCKDGAFFVTDLQSEHGTWVTDNEGRKYRVSPNFPTRFHPSDAIEFGSD-KAAF  638

Query  239  HVKVKVMKFPPFSGGKGE  186
              +VKVMK PP + G+ E
Sbjct  639  --RVKVMKVPPKTAGRTE  654



>gb|EYU44400.1| hypothetical protein MIMGU_mgv1a003436mg [Erythranthe guttata]
Length=585

 Score =   282 bits (721),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 140/206 (68%), Positives = 169/206 (82%), Gaps = 4/206 (2%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FRIPHPGRVGGR FID+ MPLMLSWVLGGNG KLEGR  QCRLSDKA+DQLR WF DD
Sbjct  383  TKFRIPHPGRVGGRVFIDIGMPLMLSWVLGGNGSKLEGRALQCRLSDKASDQLRTWFSDD  442

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            +ALERA++ +WFL P+ ++T+ ASE I L RDE  P ++GSV HPN PG S+ + SP+VS
Sbjct  443  EALERALDADWFLFPIGDSTA-ASETIFLSRDENNPYVIGSVSHPNVPGVSIAIPSPQVS  501

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            E+HA+I+YKDG F+VTDLRS+HGTWI DNE +R+RVSPNFPTRF P+D++EFGSD+KAAF
Sbjct  502  EMHAKITYKDGFFYVTDLRSEHGTWIADNEDKRFRVSPNFPTRFRPTDVIEFGSDKKAAF  561

Query  239  HVKVKVMKFPPFSGGK-GEMEVLQAA  165
              +VK MK  P +  K GE EVLQA 
Sbjct  562  --RVKAMKLAPKATNKEGEKEVLQAV  585



>gb|ADF28629.1| zeaxanthin epoxidase [Solanum tuberosum]
Length=669

 Score =   283 bits (725),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 159/191 (83%), Gaps = 4/191 (2%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            TQ+RIPHPGRVGGR FIDL MPLMLSWVLGGNG+KLEGR   CRLS+KANDQLRKWF+DD
Sbjct  468  TQYRIPHPGRVGGRVFIDLGMPLMLSWVLGGNGDKLEGRIIHCRLSEKANDQLRKWFEDD  527

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALERA + EW L P  N TS   E I+L RDE  PC +GSV H N PG SVV+  P+VS
Sbjct  528  DALERATDAEWLLLPAGNGTS-GLEAIVLSRDEDVPCTIGSVSHTNIPGKSVVLPLPQVS  586

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            E+HARIS KDGAFFVTDL+S+HGTW+TDNEGRRYR SPNFPTRFHPSD++EFGSD KAAF
Sbjct  587  EMHARISCKDGAFFVTDLQSEHGTWVTDNEGRRYRTSPNFPTRFHPSDVIEFGSD-KAAF  645

Query  239  HVKVKVMKFPP  207
              +VK MKFPP
Sbjct  646  --RVKAMKFPP  654



>gb|AIX87529.1| zeaxanthin epoxidase [Lycium ruthenicum]
Length=661

 Score =   283 bits (723),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 140/198 (71%), Positives = 165/198 (83%), Gaps = 4/198 (2%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T++RIPHPGRVGGR FIDL MPLMLSWVLGGNG+KLEGR + CRLS+K NDQLRKWF+DD
Sbjct  460  TKYRIPHPGRVGGRVFIDLGMPLMLSWVLGGNGDKLEGRIQHCRLSEKVNDQLRKWFEDD  519

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALERA + EW L P  N  + A +PI+L RD+  PC +GSV H N PG S+VV  P+VS
Sbjct  520  DALERATDAEWLLLPAGNGNA-ALQPIVLSRDDGIPCTIGSVSHTNIPGKSIVVPLPQVS  578

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            ++HARIS KDGAFFVTDL+S+HGTW+TDNEGR+YRVSPNFPTRFHPSD++EFGSD KAAF
Sbjct  579  QIHARISCKDGAFFVTDLQSEHGTWVTDNEGRKYRVSPNFPTRFHPSDVIEFGSD-KAAF  637

Query  239  HVKVKVMKFPPFSGGKGE  186
              +VKVMK PP + G+ E
Sbjct  638  --RVKVMKVPPKTAGRTE  653



>emb|CAN61301.1| hypothetical protein VITISV_011317 [Vitis vinifera]
Length=285

 Score =   271 bits (693),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 136/198 (69%), Positives = 164/198 (83%), Gaps = 6/198 (3%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+ RIPHPGRVGGRFFID+AMPLMLSWVLGGN  KLEGRP  CRLSDKANDQLR+WF+DD
Sbjct  86   TKLRIPHPGRVGGRFFIDIAMPLMLSWVLGGNSSKLEGRPPSCRLSDKANDQLRRWFEDD  145

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALERA+ GEWFL P   +  +  +PI L +DE  PCI+GSV H +FPG S V+ SP+VS
Sbjct  146  DALERAIGGEWFLLP---SGESGLQPICLSKDENKPCIIGSVSHTDFPGISTVIPSPKVS  202

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            ++HARIS KDGAFF+TDL+S+HGTWITDN GRR RVSPNFPTRFHPS++++FGS+ KA+F
Sbjct  203  KMHARISCKDGAFFLTDLQSEHGTWITDNVGRRQRVSPNFPTRFHPSEVIDFGSE-KASF  261

Query  239  HVKVKVMKFPPFSGGKGE  186
              +VKV++ PP +  K E
Sbjct  262  --RVKVVRTPPDNAAKNE  277



>gb|AGU91434.1| zeaxanthin epoxidase [Chrysanthemum boreale]
Length=658

 Score =   281 bits (720),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 142/205 (69%), Positives = 168/205 (82%), Gaps = 3/205 (1%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T FRIPHPGRVGGRFFID+ MPLMLSWVLGGNG KLEGRP+ CRL+DKAND+L+ WF DD
Sbjct  457  TNFRIPHPGRVGGRFFIDIGMPLMLSWVLGGNGSKLEGRPQSCRLTDKANDELQNWFRDD  516

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALERA+ GEWFL P+  +++  S P+ L RDEK PCIVGSVPH + PG S+V+SSPE+S
Sbjct  517  DALERALTGEWFLLPI-GSSNADSAPVSLSRDEKMPCIVGSVPHTSIPGNSIVISSPEIS  575

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            +LHARIS KDGAF+VTDLRS+HGTWITDNE RRYRV PNFP RFHPSD++EFG ++K AF
Sbjct  576  KLHARISCKDGAFYVTDLRSEHGTWITDNEDRRYRVPPNFPARFHPSDVLEFGPNKKVAF  635

Query  239  HVKVKVMKFPPFSGGKGEMEVLQAA  165
              +VKV++  P    +G   VLQA 
Sbjct  636  --RVKVIRSQPKITEEGGDRVLQAV  658



>dbj|BAE79556.1| zeaxanthin epoxidase [Chrysanthemum x morifolium]
Length=658

 Score =   281 bits (720),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 142/205 (69%), Positives = 168/205 (82%), Gaps = 3/205 (1%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T FRIPHPGRVGGRFFID+ MPLMLSWVLGGNG KLEGRP+ CRL+DKAND+L+ WF DD
Sbjct  457  TNFRIPHPGRVGGRFFIDIGMPLMLSWVLGGNGSKLEGRPQSCRLTDKANDELQNWFRDD  516

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALERA+ GEWFL P+  +++  S P+ L RDEK PCIVGSVPH + PG S+V+SSPE+S
Sbjct  517  DALERALTGEWFLLPI-GSSNADSAPVSLSRDEKMPCIVGSVPHTSIPGNSIVISSPEIS  575

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            +LHARIS KDGAF+VTDLRS+HGTWITDNE RRYRV PNFP RFHPSD++EFG ++K AF
Sbjct  576  KLHARISCKDGAFYVTDLRSEHGTWITDNEDRRYRVPPNFPARFHPSDVLEFGPNKKVAF  635

Query  239  HVKVKVMKFPPFSGGKGEMEVLQAA  165
              +VKV++  P    +G   VLQA 
Sbjct  636  --RVKVIRSQPKITEEGGDRVLQAV  658



>ref|XP_010093641.1| Zeaxanthin epoxidase [Morus notabilis]
 gb|EXB54402.1| Zeaxanthin epoxidase [Morus notabilis]
Length=666

 Score =   281 bits (719),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 142/205 (69%), Positives = 160/205 (78%), Gaps = 1/205 (0%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T++RIPHPG  GGRFFIDLAMPLML+WVLGGN  KLEGRP+ CRLSDKA+DQLRKWF+DD
Sbjct  463  TKYRIPHPGTFGGRFFIDLAMPLMLNWVLGGNSSKLEGRPQSCRLSDKASDQLRKWFEDD  522

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALERAM GEWF+ P  NAT T  +PI L RDE  P IVGSVPH +  GTS+ +  P+VS
Sbjct  523  DALERAMKGEWFILPHGNATGTL-QPIRLNRDENKPSIVGSVPHDDSSGTSITLPLPQVS  581

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
              HARISYKDGAFFVTDLRS+HGTWI DNEGRRYR+ PNFPTRF PSD +EFGSD+KA F
Sbjct  582  NRHARISYKDGAFFVTDLRSEHGTWIVDNEGRRYRIPPNFPTRFRPSDSIEFGSDKKATF  641

Query  239  HVKVKVMKFPPFSGGKGEMEVLQAA  165
             VKV           K E ++LQ A
Sbjct  642  RVKVIRSSSTTTVAQKEESDLLQTA  666



>dbj|BAE72089.1| Lactuca sativa zeaxantin epoxidase 1
Length=663

 Score =   281 bits (719),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 141/205 (69%), Positives = 167/205 (81%), Gaps = 3/205 (1%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T FRIPHPGRVGGRFFI + MPLMLSWVLGGNG  LEGRP+QCRL+DKAND+L+ WF DD
Sbjct  462  TNFRIPHPGRVGGRFFITIGMPLMLSWVLGGNGANLEGRPQQCRLTDKANDELQNWFRDD  521

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DA+ER + GEWFL P+  + +  S+PI L RDEK PCIVGSVPH + PG S+V+SSPE+S
Sbjct  522  DAIERILGGEWFLLPV-GSQNVGSDPISLSRDEKKPCIVGSVPHTSIPGNSIVISSPEIS  580

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            +LHARIS KDGAFFVTDLRS+HGT+ITDNE RRYRV PNFP RFHPSD++EFG ++K AF
Sbjct  581  KLHARISCKDGAFFVTDLRSEHGTYITDNEDRRYRVPPNFPARFHPSDVLEFGPNKKVAF  640

Query  239  HVKVKVMKFPPFSGGKGEMEVLQAA  165
              +VKVM+ PP    +GE  +LQ  
Sbjct  641  --RVKVMREPPKMSKEGENRILQTV  663



>gb|ABC87737.1| zeaxanthin epoxidase [Coffea canephora]
Length=343

 Score =   269 bits (688),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 138/205 (67%), Positives = 163/205 (80%), Gaps = 4/205 (2%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FRIPHPGRVGGR FID+ MPLMLSWVLGGNG KLEGRP  CRL+DKA+DQL+KWF DD
Sbjct  143  TKFRIPHPGRVGGRIFIDIGMPLMLSWVLGGNGSKLEGRPLHCRLTDKASDQLQKWFQDD  202

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            D+LERA+NGEWFL P+  A       I L RDEK  C +GS  HP+  G S++++SP+VS
Sbjct  203  DSLERALNGEWFLFPIGQANPDPVA-IFLGRDEKNICTIGSASHPDILGASIIINSPQVS  261

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            +LHA+ISYKDG FF+TDL+S+HGTWITDN+GRRYR+ PN P RFHP DI+EFGSD KAAF
Sbjct  262  KLHAQISYKDGLFFLTDLQSEHGTWITDNDGRRYRLPPNSPARFHPYDIIEFGSD-KAAF  320

Query  239  HVKVKVMKFPPFSGGKGEMEVLQAA  165
              +VKV   PPFSG K E +VL A 
Sbjct  321  --RVKVTNQPPFSGKKRETKVLSAV  343



>gb|ABB52077.1| putative zeaxanthin epoxidase [Daucus carota subsp. sativus]
Length=668

 Score =   278 bits (711),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 158/190 (83%), Gaps = 3/190 (2%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+ RIPHPGRVGGRFFID+ MPLMLSWVLGGNG  LEGRP QCRLSD+AN  L++WF+DD
Sbjct  466  TKLRIPHPGRVGGRFFIDIGMPLMLSWVLGGNGSNLEGRPLQCRLSDRANSDLKRWFEDD  525

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALERA  GEW L P+ N TS +SE I L +DE  PCIVGSV HPN PGTS+ + SP+VS
Sbjct  526  DALERATKGEWVLFPVGN-TSASSEAIFLSKDEGKPCIVGSVLHPNIPGTSIAIPSPQVS  584

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
             LHA+I+ K+GAF VTDLRS+HGT+++DNEGRRYR+ PNFPTRFHPSDI+ FGSD K AF
Sbjct  585  SLHAKITCKNGAFSVTDLRSEHGTYLSDNEGRRYRIPPNFPTRFHPSDIIGFGSDEKVAF  644

Query  239  HVKVKVMKFP  210
              +VKVMKFP
Sbjct  645  --RVKVMKFP  652



>gb|KDP31935.1| hypothetical protein JCGZ_12396 [Jatropha curcas]
Length=633

 Score =   277 bits (708),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 139/205 (68%), Positives = 165/205 (80%), Gaps = 3/205 (1%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T++RIPHPGRVGGRFFID+AMP+MLSWVLGGN  KLEGR + CRLSDKA+DQLR WF+DD
Sbjct  432  TKYRIPHPGRVGGRFFIDIAMPVMLSWVLGGNSSKLEGRSQCCRLSDKASDQLRTWFEDD  491

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALERA+N EWFL PL N     SEPI L R+E TPC+VG V H +FPG S+V+ SP+VS
Sbjct  492  DALERALNAEWFLLPLGNKV-VVSEPICLSRNENTPCVVGKVSHKDFPGMSIVIPSPQVS  550

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            E+HARISYKDGAF+V DL+S+HGT+I+D +GRRYRV  N PTRFHPSD++EFGSD KA F
Sbjct  551  EMHARISYKDGAFYVIDLQSEHGTYISDADGRRYRVPQNSPTRFHPSDVIEFGSDEKAKF  610

Query  239  HVKVKVMKFPPFSGGKGEMEVLQAA  165
              +VKVMK P     K   E+LQ+ 
Sbjct  611  --RVKVMKSPSRIKEKEGSEILQSV  633



>ref|XP_010269709.1| PREDICTED: zeaxanthin epoxidase, chloroplastic [Nelumbo nucifera]
Length=665

 Score =   275 bits (703),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 132/198 (67%), Positives = 160/198 (81%), Gaps = 2/198 (1%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+F+IPHPGRVGGRFFI  AMPLM+SWVLGGN  KLEGR   CRL+DKAN+QL+KWF+DD
Sbjct  462  TKFKIPHPGRVGGRFFIHFAMPLMMSWVLGGNSSKLEGRSLCCRLTDKANNQLQKWFEDD  521

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALERA+N EWFL P ++  +   +PI L RDE  PC VG++ H N PG S+ + S +VS
Sbjct  522  DALERALNAEWFLFPSESEANGDLQPIHLGRDENKPCFVGNISHANLPGISIAIPSSQVS  581

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            ++HARISYKDGAF++TDLRS+HGTWITD EGRRYR+ PNFP RFHPSD++EFGSD+KAAF
Sbjct  582  KMHARISYKDGAFYLTDLRSEHGTWITDKEGRRYRIPPNFPARFHPSDVIEFGSDKKAAF  641

Query  239  HVKVKVMKFPPFSGGKGE  186
              +VKV+K PP    K E
Sbjct  642  --RVKVLKDPPKVTEKNE  657



>ref|XP_011043539.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Populus 
euphratica]
Length=661

 Score =   273 bits (698),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 138/206 (67%), Positives = 165/206 (80%), Gaps = 4/206 (2%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T FRIPHPGRVGGRFFID+AMP+ML WVLGGN  KLEGR   CRLSDKA+DQLR+WF DD
Sbjct  459  TNFRIPHPGRVGGRFFIDIAMPVMLDWVLGGNSSKLEGRSLSCRLSDKASDQLRRWFVDD  518

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALER++NGEWFL P  N  + AS+PI L RDE  PC+VGSV   +FPG S+V+ +P+VS
Sbjct  519  DALERSLNGEWFLLPCGN-DAVASQPIGLSRDENKPCVVGSVSQEDFPGMSIVIPAPQVS  577

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            + HARI+ KDGAF++ DLRS+HGT+ITD EGRRYR  PNFPTRFHPSD++EFGSD+K  F
Sbjct  578  KTHARITCKDGAFYLIDLRSEHGTFITDIEGRRYRAPPNFPTRFHPSDMIEFGSDKKVIF  637

Query  239  HVKVKVMKFPP-FSGGKGEMEVLQAA  165
              +VKVM+ PP  S  K E +VLQ+ 
Sbjct  638  --RVKVMRSPPKISEKKDEGQVLQSV  661



>ref|XP_011005864.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Populus 
euphratica]
Length=662

 Score =   273 bits (697),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 138/206 (67%), Positives = 170/206 (83%), Gaps = 4/206 (2%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FRIPHPGRVGGRFF+D+AMP+ML+WVLGGN  KLEGR   CRLSDKA+DQL++WF+DD
Sbjct  460  TKFRIPHPGRVGGRFFVDIAMPVMLNWVLGGNSSKLEGRSLNCRLSDKASDQLQRWFEDD  519

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALERA+NGEWFL P  N  + AS+PI L RDE  PC+VGSV H +FPG S+V+ +PEVS
Sbjct  520  DALERALNGEWFLLPCGN-EAVASQPIGLSRDETKPCVVGSVSHDDFPGMSIVIPAPEVS  578

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            E+HARIS K+GAF++ DLRS+HGT+ITD+EGRRYR +PNFP RFHPSD++EFGSD+KA F
Sbjct  579  EMHARISCKNGAFYLIDLRSEHGTFITDHEGRRYRATPNFPARFHPSDMIEFGSDKKATF  638

Query  239  HVKVKVMKFP-PFSGGKGEMEVLQAA  165
              +VKVM  P   S  K E +VL++ 
Sbjct  639  --RVKVMWSPLKISEKKEESQVLRSV  662



>gb|AJB84624.1| zeaxanthin epoxidase [Camellia sinensis]
Length=667

 Score =   273 bits (697),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 135/184 (73%), Positives = 152/184 (83%), Gaps = 1/184 (1%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FRIPHPGRVGGRFFIDLAMPLMLSWVLGGNG  L+GR   CRLSDKANDQLR WF+DD
Sbjct  464  TKFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGSNLDGRSLSCRLSDKANDQLRNWFEDD  523

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALERA+NGEW L P  NA   A +PI L RDEK PCI+GSV H + PG SV +  P+VS
Sbjct  524  DALERAVNGEWCLLPYGNADG-ALKPIFLSRDEKQPCIIGSVSHADIPGMSVTLPLPQVS  582

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            ++HARIS K+GAFFVTDLRS+HGTW+ DNE ++YRV  NFPTRF PSDI+EFGSDRK AF
Sbjct  583  KMHARISCKNGAFFVTDLRSEHGTWLRDNEDKQYRVPSNFPTRFRPSDIIEFGSDRKVAF  642

Query  239  HVKV  228
             VKV
Sbjct  643  RVKV  646



>ref|NP_001268202.1| zeaxanthin epoxidase [Vitis vinifera]
 gb|AFP28801.1| zeaxanthin epoxidase 1 [Vitis vinifera]
Length=658

 Score =   272 bits (696),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 136/198 (69%), Positives = 164/198 (83%), Gaps = 6/198 (3%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+ RIPHPGRVGGRFFID+AMPLMLSWVLGGN  KLEGRP  CRLSDKANDQLR+WF+DD
Sbjct  459  TKLRIPHPGRVGGRFFIDIAMPLMLSWVLGGNSSKLEGRPPSCRLSDKANDQLRRWFEDD  518

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALERA+ GEWFL P   +  +  +PI L +DE  PCI+GSV H +FPG S V+ SP+VS
Sbjct  519  DALERAIGGEWFLLP---SGESGLQPICLSKDENKPCIIGSVSHTDFPGISTVIPSPKVS  575

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            ++HARIS KDGAFF+TDL+S+HGTWITDN GRR RVSPNFPTRFHPS++++FGS+ KA+F
Sbjct  576  KMHARISCKDGAFFLTDLQSEHGTWITDNVGRRQRVSPNFPTRFHPSEVIDFGSE-KASF  634

Query  239  HVKVKVMKFPPFSGGKGE  186
              +VKV++ PP +  K E
Sbjct  635  --RVKVVRTPPDNAAKNE  650



>emb|CDP02496.1| unnamed protein product [Coffea canephora]
Length=649

 Score =   271 bits (694),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 138/205 (67%), Positives = 163/205 (80%), Gaps = 4/205 (2%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FRIPHPGRVGGR FID+ MPLMLSWVLGGNG KLEGRP  CRL+DKA+DQL+KWF DD
Sbjct  449  TKFRIPHPGRVGGRIFIDIGMPLMLSWVLGGNGSKLEGRPLHCRLTDKASDQLQKWFQDD  508

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            D+LERA+NGEWFL P+  A       I L RDEK  C +GS  HP+  G S++++SP+VS
Sbjct  509  DSLERALNGEWFLFPIGQANPDPV-AIFLGRDEKNICTIGSASHPDILGASIIINSPQVS  567

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            +LHA+ISYKDG FF+TDL+S+HGTWITDN+GRRYR+ PN P RFHP DI+EFGSD KAAF
Sbjct  568  KLHAQISYKDGLFFLTDLQSEHGTWITDNDGRRYRLPPNSPARFHPYDIIEFGSD-KAAF  626

Query  239  HVKVKVMKFPPFSGGKGEMEVLQAA  165
              +VKV   PPFSG K E +VL A 
Sbjct  627  --RVKVTNQPPFSGKKRETKVLSAV  649



>ref|XP_006393902.1| hypothetical protein EUTSA_v10003769mg [Eutrema salsugineum]
 gb|ESQ31188.1| hypothetical protein EUTSA_v10003769mg [Eutrema salsugineum]
Length=667

 Score =   272 bits (695),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 127/184 (69%), Positives = 157/184 (85%), Gaps = 1/184 (1%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FR+PHPGRVGGRFFID+AMPLML+WVLGGN EKLEGRP  CRL+DKA+D+LR+WF+DD
Sbjct  463  TKFRVPHPGRVGGRFFIDIAMPLMLNWVLGGNSEKLEGRPPSCRLTDKADDRLREWFEDD  522

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALER +NGEW+L P  N  S  SE + L +DE  PCI+GS P  +FPG  +V+ +P+VS
Sbjct  523  DALERTINGEWYLIPYGNECSV-SETLCLTKDEDQPCIIGSEPDQDFPGMHIVIPAPQVS  581

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            ++HAR++YKDGAFF+ DLRS+HGT++TDNEGRRYRV+PNFP RF  SDI+EFGSD+KAAF
Sbjct  582  KMHARVTYKDGAFFLMDLRSEHGTYVTDNEGRRYRVTPNFPARFRSSDIIEFGSDKKAAF  641

Query  239  HVKV  228
             VKV
Sbjct  642  RVKV  645



>gb|AIU94746.1| zeaxanthin epoxidase [Morus alba var. multicaulis]
Length=666

 Score =   271 bits (694),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 137/205 (67%), Positives = 158/205 (77%), Gaps = 1/205 (0%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T++RIPHPG  GGRFFIDLAMPLML+WVLGGN  KLEGRP+ CRLSDKA+D LRKWF+D+
Sbjct  463  TKYRIPHPGTFGGRFFIDLAMPLMLNWVLGGNSSKLEGRPQSCRLSDKASDHLRKWFEDN  522

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALERAM GEWF+ P  NAT T  +PI L RDE  P IVGSVPH +   TS+ +  P+VS
Sbjct  523  DALERAMKGEWFILPHGNATGTL-QPIRLNRDENKPSIVGSVPHDDSSETSITLPLPQVS  581

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
              HARISYKDGAFFVTDLRS+HGTWI DNEGRRYR+ PNFP+RF PSD +EFGSD++A F
Sbjct  582  NRHARISYKDGAFFVTDLRSEHGTWIADNEGRRYRIPPNFPSRFRPSDSIEFGSDKQAVF  641

Query  239  HVKVKVMKFPPFSGGKGEMEVLQAA  165
             VKV           K E ++LQ A
Sbjct  642  RVKVIRSSSTTTVAQKEESDLLQTA  666



>ref|XP_006393901.1| hypothetical protein EUTSA_v10003769mg [Eutrema salsugineum]
 gb|ESQ31187.1| hypothetical protein EUTSA_v10003769mg [Eutrema salsugineum]
Length=666

 Score =   271 bits (694),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 127/184 (69%), Positives = 157/184 (85%), Gaps = 1/184 (1%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FR+PHPGRVGGRFFID+AMPLML+WVLGGN EKLEGRP  CRL+DKA+D+LR+WF+DD
Sbjct  462  TKFRVPHPGRVGGRFFIDIAMPLMLNWVLGGNSEKLEGRPPSCRLTDKADDRLREWFEDD  521

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALER +NGEW+L P  N  S  SE + L +DE  PCI+GS P  +FPG  +V+ +P+VS
Sbjct  522  DALERTINGEWYLIPYGNECSV-SETLCLTKDEDQPCIIGSEPDQDFPGMHIVIPAPQVS  580

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            ++HAR++YKDGAFF+ DLRS+HGT++TDNEGRRYRV+PNFP RF  SDI+EFGSD+KAAF
Sbjct  581  KMHARVTYKDGAFFLMDLRSEHGTYVTDNEGRRYRVTPNFPARFRSSDIIEFGSDKKAAF  640

Query  239  HVKV  228
             VKV
Sbjct  641  RVKV  644



>ref|XP_009103460.1| PREDICTED: zeaxanthin epoxidase, chloroplastic [Brassica rapa]
Length=668

 Score =   270 bits (691),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 135/207 (65%), Positives = 169/207 (82%), Gaps = 4/207 (2%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FR+PHPGRVGGRFFID+AMPLML+WVLGGN EKLEGRP  CRL+DKA+D+LR+WF+DD
Sbjct  464  TKFRVPHPGRVGGRFFIDIAMPLMLNWVLGGNSEKLEGRPPSCRLTDKADDRLREWFEDD  523

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            +ALER +NGEW+L P  N  S  SE + L +DE+ PCIVGS P  +FPGT +V+ SP+VS
Sbjct  524  EALERTINGEWYLIPHGNECSV-SETLRLTKDEEQPCIVGSEPDQDFPGTHIVIPSPQVS  582

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            ++HAR+ YKDGAFFV DLRS+HGT++TDNEG +YRV+PNFP RF PSDI+EFGSD+KAAF
Sbjct  583  KMHARVIYKDGAFFVMDLRSEHGTYLTDNEGGKYRVTPNFPARFRPSDIIEFGSDKKAAF  642

Query  239  HVKVKVMKFPPFS--GGKGEMEVLQAA  165
             VKV +   P  +    K + ++LQAA
Sbjct  643  RVKV-IRTTPKLTRRDEKSDGKLLQAA  668



>emb|CBI21425.3| unnamed protein product [Vitis vinifera]
Length=658

 Score =   270 bits (691),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 164/198 (83%), Gaps = 6/198 (3%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+ RIPHPGRVGGRFFID+AMPLMLSWVLGGN  KLEGRP  CRLSDKA+DQLR+WF+DD
Sbjct  459  TKLRIPHPGRVGGRFFIDIAMPLMLSWVLGGNSSKLEGRPPSCRLSDKASDQLRRWFEDD  518

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALERA+ GEWFL P   +  +  +PI L +DE  PCI+GSV H +FPG S V+ SP+VS
Sbjct  519  DALERAIGGEWFLLP---SGESGLQPICLSKDENKPCIIGSVSHTDFPGISTVIPSPKVS  575

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            ++HARIS KDGAFF+TDL+S+HGTWITDN GRR RVSPNFPTRFHPS++++FGS+ KA+F
Sbjct  576  KMHARISCKDGAFFLTDLQSEHGTWITDNVGRRQRVSPNFPTRFHPSEVIDFGSE-KASF  634

Query  239  HVKVKVMKFPPFSGGKGE  186
              +VKV++ PP +  K E
Sbjct  635  --RVKVVRTPPDNAAKNE  650



>gb|AAR11195.1| zeaxanthin epoxidase [Vitis vinifera]
Length=658

 Score =   270 bits (689),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 164/198 (83%), Gaps = 6/198 (3%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+ RIPHPGRVGGRFFID+AMPLMLSWVLGGN  KLEGRP  CRLSDKA+DQLR+WF+DD
Sbjct  459  TKLRIPHPGRVGGRFFIDIAMPLMLSWVLGGNSSKLEGRPPSCRLSDKASDQLRRWFEDD  518

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALERA+ GEWFL P   +  +  +PI L +DE  PCI+GSV H +FPG S V+ SP+VS
Sbjct  519  DALERAIGGEWFLLP---SGESGLQPICLSKDENKPCIIGSVSHTDFPGISTVIPSPKVS  575

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            ++HARIS KDGAFF+TDL+S+HGTWITDN GRR RVSPNFPTRFHPS++++FGS+ KA+F
Sbjct  576  KMHARISCKDGAFFLTDLQSEHGTWITDNVGRRQRVSPNFPTRFHPSEVIDFGSE-KASF  634

Query  239  HVKVKVMKFPPFSGGKGE  186
              +VKV++ PP +  K E
Sbjct  635  --RVKVVRTPPDNAAKDE  650



>ref|XP_008457782.1| PREDICTED: zeaxanthin epoxidase, chloroplastic [Cucumis melo]
 gb|AID51469.1| zeaxanthin epoxidase [Cucumis melo var. makuwa]
Length=665

 Score =   270 bits (689),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 132/184 (72%), Positives = 153/184 (83%), Gaps = 1/184 (1%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            TQFRIPHPG  GGRFFIDLAMPLML+WVLGGN  KLEGRP  CRLSDKANDQLRKWF+DD
Sbjct  467  TQFRIPHPGTFGGRFFIDLAMPLMLNWVLGGNSSKLEGRPPACRLSDKANDQLRKWFEDD  526

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALERA+NG+WFL P +   ++ S+PI LRRDE  PC++GSV      G SV +  P+VS
Sbjct  527  DALERAINGDWFLLP-QGGKASVSQPICLRRDENQPCLIGSVEQEVDSGLSVAIPLPQVS  585

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            E HARI+YKDGAFF+TDLRS+HGTW++D+EGRRYRV PNFP RFH SD++EFGSD+KA F
Sbjct  586  EKHARINYKDGAFFLTDLRSEHGTWLSDHEGRRYRVPPNFPVRFHQSDLIEFGSDKKAIF  645

Query  239  HVKV  228
             VKV
Sbjct  646  RVKV  649



>gb|AAV85824.1| zeaxanthin epoxidase [Eutrema halophilum]
Length=666

 Score =   269 bits (687),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 126/184 (68%), Positives = 156/184 (85%), Gaps = 1/184 (1%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FR+PHPGRVGGRFFID+AMPLML+WVLG N EKLEGRP  CRL+DKA+D+LR+WF+DD
Sbjct  462  TKFRVPHPGRVGGRFFIDIAMPLMLNWVLGXNSEKLEGRPPSCRLTDKADDRLREWFEDD  521

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALER +NGEW+L P  N  S  SE + L +DE  PCI+GS P  +FPG  +V+ +P+VS
Sbjct  522  DALERTINGEWYLIPYGNECSV-SETLCLTKDEDQPCIIGSEPDQDFPGMHIVIPAPQVS  580

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            ++HAR++YKDGAFF+ DLRS+HGT++TDNEGRRYRV+PNFP RF  SDI+EFGSD+KAAF
Sbjct  581  KMHARVTYKDGAFFLMDLRSEHGTYVTDNEGRRYRVTPNFPARFRSSDIIEFGSDKKAAF  640

Query  239  HVKV  228
             VKV
Sbjct  641  RVKV  644



>ref|XP_010028248.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW54948.1| hypothetical protein EUGRSUZ_I00922 [Eucalyptus grandis]
Length=667

 Score =   269 bits (687),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 129/184 (70%), Positives = 151/184 (82%), Gaps = 1/184 (1%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FRIPHPGRVGGRFFID+AMPLML+WVLGGN  KLEGRP  CRLSDKANDQLR+WF+DD
Sbjct  466  TKFRIPHPGRVGGRFFIDIAMPLMLNWVLGGNSSKLEGRPPSCRLSDKANDQLRRWFEDD  525

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALERAMNGEW L P  N TS  S+PI L RDE T CI+GS    + PG  V +  P++S
Sbjct  526  DALERAMNGEWLLLPSGNKTS-PSQPIGLSRDESTSCIIGSELDDDLPGIPVTIPLPQIS  584

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            ++HA+ISYKDGAFFVTDL+S+HGTWI+D  GRRYR +PNFP R HPSD +EFGSD++A +
Sbjct  585  KVHAQISYKDGAFFVTDLQSEHGTWISDAMGRRYRATPNFPARIHPSDTIEFGSDKRAVY  644

Query  239  HVKV  228
             VKV
Sbjct  645  RVKV  648



>gb|ACM68704.1| zeaxanthin epoxidase [Brassica rapa subsp. pekinensis]
Length=668

 Score =   268 bits (685),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 134/207 (65%), Positives = 168/207 (81%), Gaps = 4/207 (2%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FR+PHPGRVGGRFFID+AMPLML+WVLG N EKLEGRP  CRL+DKA+D+LR+WF+DD
Sbjct  464  TKFRVPHPGRVGGRFFIDIAMPLMLNWVLGSNSEKLEGRPPSCRLTDKADDRLREWFEDD  523

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            +ALER +NGEW+L P  N  S  SE + L +DE+ PCIVGS P  +FPGT +V+ SP+VS
Sbjct  524  EALERTINGEWYLIPHGNECSV-SETLRLTKDEEQPCIVGSEPDQDFPGTHIVIPSPQVS  582

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            ++HAR+ YKDGAFFV DLRS+HGT++TDNEG +YRV+PNFP RF PSDI+EFGSD+KAAF
Sbjct  583  KMHARVIYKDGAFFVMDLRSEHGTYLTDNEGGKYRVTPNFPARFRPSDIIEFGSDKKAAF  642

Query  239  HVKVKVMKFPPFS--GGKGEMEVLQAA  165
             VKV +   P  +    K + ++LQAA
Sbjct  643  RVKV-IRTTPKLTRRDEKSDGKLLQAA  668



>ref|XP_010666612.1| PREDICTED: zeaxanthin epoxidase, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=675

 Score =   268 bits (685),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 137/205 (67%), Positives = 157/205 (77%), Gaps = 2/205 (1%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+F+IPHPGRVGGR FI  AMPLMLSWVLGGN EKLEGR   CRLS+KAN+QLR+WF+DD
Sbjct  473  TKFKIPHPGRVGGRVFISPAMPLMLSWVLGGNSEKLEGRVPHCRLSEKANNQLRRWFEDD  532

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALERA++GEWFL P  N   T  EPI L R E  PC +G V H + PG SV + SP+VS
Sbjct  533  DALERALSGEWFLLPQGNDAETL-EPICLSRKEDEPCTIGRVSHEDLPGVSVALRSPQVS  591

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            E HARIS KDGAFF+TDLRS+HGTWITD EGR YRV PNFPTRFHPSDI++FGSD+KA++
Sbjct  592  ERHARISCKDGAFFLTDLRSEHGTWITDKEGRHYRVPPNFPTRFHPSDIIQFGSDKKASY  651

Query  239  HVKVKVMKFPPFSGGKGEMEVLQAA  165
             VKV  M  P  +  K    VLQ  
Sbjct  652  RVKVS-MTSPNLAQNKQNAGVLQTV  675



>emb|CDY01444.1| BnaA07g12170D [Brassica napus]
Length=687

 Score =   268 bits (684),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 134/207 (65%), Positives = 167/207 (81%), Gaps = 4/207 (2%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FR+PHPGRVGGRFFID+AMPLML+WVLGGN EKLEGRP  CRL+DKA+D+LR+WF+DD
Sbjct  483  TKFRVPHPGRVGGRFFIDIAMPLMLNWVLGGNSEKLEGRPPSCRLTDKADDRLREWFEDD  542

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            +ALER +NGEW+L P  N  S  SE + L +DE  PCIVGS P  +FPG  +V+ SP+VS
Sbjct  543  EALERTINGEWYLIPHGNECSV-SETLRLTKDEDQPCIVGSEPDQDFPGMHIVIPSPQVS  601

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            ++HAR+ YKDGAFFV DLRS+HGT++TDNEG +YRV+PNFP RF PSDI+EFGSD+KAAF
Sbjct  602  KMHARVIYKDGAFFVMDLRSEHGTYLTDNEGGKYRVTPNFPARFRPSDIIEFGSDKKAAF  661

Query  239  HVKVKVMKFPPFS--GGKGEMEVLQAA  165
             VKV +   P  +    K + ++LQAA
Sbjct  662  RVKV-IRTTPKLTRRDEKSDGKLLQAA  687



>gb|ADC29517.1| zeaxanthin epoxidase [Brassica napus]
 gb|ADD62493.1| zeaxanthin epoxidase [Brassica napus]
Length=669

 Score =   267 bits (683),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 134/207 (65%), Positives = 167/207 (81%), Gaps = 4/207 (2%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FR+PHPGRVGGRFFID+AMPLML+WVLGGN EKLEGRP  CRL+DKA+D+LR+WF+DD
Sbjct  465  TKFRVPHPGRVGGRFFIDIAMPLMLNWVLGGNSEKLEGRPPSCRLTDKADDRLREWFEDD  524

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            +ALER +NGEW+L P  N  S  SE + L +DE  PCIVGS P  +FPG  +V+ SP+VS
Sbjct  525  EALERTINGEWYLIPHGNECSV-SETLRLTKDEDQPCIVGSEPDQDFPGMHIVIPSPQVS  583

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            ++HAR+ YKDGAFFV DLRS+HGT++TDNEG +YRV+PNFP RF PSDI+EFGSD+KAAF
Sbjct  584  KMHARVIYKDGAFFVMDLRSEHGTYLTDNEGGKYRVTPNFPARFRPSDIIEFGSDKKAAF  643

Query  239  HVKVKVMKFPPFS--GGKGEMEVLQAA  165
             VKV +   P  +    K + ++LQAA
Sbjct  644  RVKV-IRTTPKLTRRDEKSDGKLLQAA  669



>sp|Q96375.1|ABA2_CAPAN RecName: Full=Zeaxanthin epoxidase, chloroplastic; AltName: Full=Beta-cyclohexenyl 
epoxidase; AltName: Full=Xanthophyll epoxidase; 
Flags: Precursor [Capsicum annuum]
 emb|CAA62795.1| Xanthophyll epoxidase [Capsicum annuum]
Length=660

 Score =   266 bits (681),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 134/205 (65%), Positives = 156/205 (76%), Gaps = 4/205 (2%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FRIPHPGRVGGRFFIDL MPLMLSWVLGGNGEKLEGR + CRLS+KANDQLR WF+DD
Sbjct  460  TKFRIPHPGRVGGRFFIDLGMPLMLSWVLGGNGEKLEGRIQHCRLSEKANDQLRNWFEDD  519

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALERA + EW L P  N ++ A E ++L RDE  PC +GSV H N PG SVV+   +VS
Sbjct  520  DALERATDAEWLLLPAGN-SNAALETLVLSRDENMPCTIGSVSHANIPGKSVVIPLSQVS  578

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            ++HARISY  GAF  T  RS HGTW  DNEGRRYRVSPNFP RFH SD++ FGSD KAAF
Sbjct  579  DMHARISYNGGAFLGTAFRSDHGTWFIDNEGRRYRVSPNFPMRFHSSDVIVFGSD-KAAF  637

Query  239  HVKVKVMKFPPFSGGKGEMEVLQAA  165
              ++K MKF P +  K + + + AA
Sbjct  638  --RIKAMKFAPKTAAKEDRQAVGAA  660



>ref|XP_004149704.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004163276.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Cucumis 
sativus]
 gb|KGN61963.1| hypothetical protein Csa_2G277050 [Cucumis sativus]
Length=665

 Score =   265 bits (677),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 130/184 (71%), Positives = 151/184 (82%), Gaps = 1/184 (1%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            TQFRIPHPG  GGRFFIDLAMPLML+WVLGGN  KLEGRP  CRLSDKANDQLRKWF+DD
Sbjct  467  TQFRIPHPGTFGGRFFIDLAMPLMLNWVLGGNSSKLEGRPPACRLSDKANDQLRKWFEDD  526

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALERA+NG+WFL P +   ++ S+PI LR+DE  PC++GSV      G SV +  P+VS
Sbjct  527  DALERAINGDWFLLP-QGGEASVSQPICLRKDENQPCLIGSVEKEVDSGLSVAIPLPQVS  585

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            E HARI YKDGAFF+TDLRS+HGTW++D+EGRRYR  PNFP RFH SD++EFGSD+KA F
Sbjct  586  EKHARIYYKDGAFFLTDLRSEHGTWLSDHEGRRYRAPPNFPVRFHQSDLIEFGSDKKARF  645

Query  239  HVKV  228
             VKV
Sbjct  646  RVKV  649



>ref|XP_011078061.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Sesamum 
indicum]
Length=656

 Score =   264 bits (675),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 128/184 (70%), Positives = 155/184 (84%), Gaps = 2/184 (1%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+++IPHPGRVGGR FID+AMPLMLSWVLGGNG KLEGR   CRLSDKA+DQLR+WF D+
Sbjct  453  TKYKIPHPGRVGGRIFIDVAMPLMLSWVLGGNGSKLEGRVLHCRLSDKASDQLRRWFTDN  512

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALERA++ +WFL P+  +TS ASE  +L RDEK PCI+GSVPH N    S+ + S +VS
Sbjct  513  DALERALDADWFLLPVGGSTS-ASEIFVLSRDEKRPCIIGSVPHANSLEASITIPSQQVS  571

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDR-KAA  243
            E+HARISYKDGAFF+TDL SKHGTWITDNEGR+YRV+PN PTR  P+D+++FGSD+ +AA
Sbjct  572  EMHARISYKDGAFFLTDLSSKHGTWITDNEGRQYRVTPNLPTRLRPTDVIDFGSDKLQAA  631

Query  242  FHVK  231
            F VK
Sbjct  632  FRVK  635



>emb|CDY12798.1| BnaC07g16350D [Brassica napus]
Length=723

 Score =   266 bits (679),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 133/207 (64%), Positives = 167/207 (81%), Gaps = 4/207 (2%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FR+PHPGRVGGRFFID+AMPLML+WVLGGN EKLEGRP  CRL+DKA+D+LR+WF+DD
Sbjct  519  TKFRVPHPGRVGGRFFIDIAMPLMLNWVLGGNSEKLEGRPPSCRLTDKADDRLREWFEDD  578

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            +ALER +NGEW+L P  N  S  SE + L +DE  PCIVGS P  + PGT +V+ SP+VS
Sbjct  579  EALERTINGEWYLIPHGNECSV-SETLRLTKDEDQPCIVGSEPDQDIPGTHIVIPSPQVS  637

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            ++HAR+ YKDGAFF+ DLRS+HGT++TDNEG +YRV+PNFP RF PSDI+EFGSD+KAAF
Sbjct  638  KMHARVIYKDGAFFLMDLRSEHGTYLTDNEGGKYRVTPNFPARFRPSDIIEFGSDKKAAF  697

Query  239  HVKVKVMKFPPFS--GGKGEMEVLQAA  165
             VKV +   P  +    K + ++LQAA
Sbjct  698  RVKV-IRTTPKLTRRDEKSDGKLLQAA  723



>ref|XP_002307265.1| zeaxanthin epoxidase family protein [Populus trichocarpa]
 gb|EEE94261.1| zeaxanthin epoxidase family protein [Populus trichocarpa]
Length=692

 Score =   265 bits (677),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 127/178 (71%), Positives = 154/178 (87%), Gaps = 1/178 (1%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FRIPHPGRVGGRFF+D+AMP+ML+WVLGGN  KLEGR   CRLSDKA+DQLR+WF+DD
Sbjct  460  TKFRIPHPGRVGGRFFVDIAMPVMLNWVLGGNSSKLEGRSLSCRLSDKASDQLRRWFEDD  519

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALERA++GEWFL P  N  + AS+PI L RDE  PC+VGSV H +FPG S+V+ +PEVS
Sbjct  520  DALERALDGEWFLLPCGN-EAVASQPIGLSRDENKPCVVGSVSHDDFPGMSIVIPAPEVS  578

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKA  246
            E+HARIS K+GAF++ DLRS+HGT+ITDNEGRRYR +PNFP RFHPSD++EFGSD+K 
Sbjct  579  EMHARISCKNGAFYLIDLRSEHGTFITDNEGRRYRATPNFPARFHPSDMIEFGSDKKV  636



>dbj|BAA88841.1| zea-xanthin epoxidase [Gentiana lutea]
Length=663

 Score =   264 bits (675),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 138/208 (66%), Positives = 160/208 (77%), Gaps = 11/208 (5%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+ RIPHPGRVGGR FID+ MPLMLSWVLGGNG KLEGRP QCRLSDKANDQL+ WF DD
Sbjct  464  TKLRIPHPGRVGGRVFIDIGMPLMLSWVLGGNGSKLEGRPLQCRLSDKANDQLQTWFVDD  523

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            D++ERA+N EWFL P+   T T+S+ I L RDEK PC +GS    +      V+SS +VS
Sbjct  524  DSMERALNAEWFLFPIGPLT-TSSQTIFLNRDEKNPCTIGSESMLD-----AVISSSQVS  577

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            + HARI YKDGAFFV DL+S++GT+ITDNEGRRYRV+PN PTRFHPSDI+EFGSD+KA F
Sbjct  578  KQHARIEYKDGAFFVVDLQSEYGTYITDNEGRRYRVTPNSPTRFHPSDIIEFGSDKKATF  637

Query  239  HVKVKVMKFPPFSG---GKGEMEVLQAA  165
              +VKVMK  P       KG  E LQAA
Sbjct  638  --RVKVMKNTPKIAEKTSKGSEEALQAA  663



>ref|XP_002523587.1| zeaxanthin epoxidase, putative [Ricinus communis]
 gb|EEF38782.1| zeaxanthin epoxidase, putative [Ricinus communis]
Length=665

 Score =   264 bits (675),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 134/205 (65%), Positives = 162/205 (79%), Gaps = 4/205 (2%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T++RIPHPGRVGGRFFID+AMP+ML+WVLGGN  KLEGRP  CRLSDKA+DQL+ WF+DD
Sbjct  465  TKYRIPHPGRVGGRFFIDIAMPVMLNWVLGGNSSKLEGRPLSCRLSDKASDQLQTWFEDD  524

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            +ALERA+NGEWFL P  +      EPI L RDE  PC+VGS    +FPG S+V+SSP+VS
Sbjct  525  NALERALNGEWFLLPFGD--DAVQEPICLSRDENIPCMVGSESQEDFPGKSIVISSPQVS  582

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            ++HARISYKDG F+V DL+S+HGT+ITDN+GRR RV PNFPT FHPS+ +EFGS  KA F
Sbjct  583  KMHARISYKDGGFYVIDLQSEHGTFITDNDGRRSRVPPNFPTLFHPSEAIEFGSAGKAKF  642

Query  239  HVKVKVMKFPPFSGGKGEMEVLQAA  165
              +VKVMK P     KG  E+LQ+ 
Sbjct  643  --RVKVMKSPAKIKEKGGNEILQSV  665



>gb|KFK28343.1| hypothetical protein AALP_AA8G503900 [Arabis alpina]
Length=663

 Score =   263 bits (672),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 130/207 (63%), Positives = 164/207 (79%), Gaps = 5/207 (2%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FR+PHPGRVGGRFFID+AMPLML+WVLGGN EKLEGR   CRL+D+A+D+LR+WFDD+
Sbjct  460  TKFRVPHPGRVGGRFFIDIAMPLMLNWVLGGNSEKLEGRAPSCRLTDRADDRLREWFDDN  519

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            +ALER ++GEW+L P +      SE + L +DE  PCI+GS P  +FPG  +V+ S +VS
Sbjct  520  EALERTISGEWYLIP-QGDDCCVSETLCLTKDEDQPCIIGSEPDKDFPGMHIVIPSSQVS  578

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            ++HARI YKDGAFFV DLRS+HGT++ DNEG RYR +PNFP RF PSDI+EFGSD+KAAF
Sbjct  579  KMHARIIYKDGAFFVMDLRSEHGTYVVDNEGGRYRATPNFPARFRPSDILEFGSDKKAAF  638

Query  239  HVKVKVMKFPPFSGGKGEM--EVLQAA  165
              KVKV++  P S  K E   ++LQAA
Sbjct  639  --KVKVIRKTPKSTSKNESNGKLLQAA  663



>gb|ADP69105.1| zeaxanthin epoxidase [Cucumis sativus]
Length=665

 Score =   263 bits (673),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 129/184 (70%), Positives = 151/184 (82%), Gaps = 1/184 (1%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            TQFRIPHPG +GGRFFIDLAMPLML+WVLGGN  KLEGRP  CRLSDKANDQLRKWF+DD
Sbjct  467  TQFRIPHPGTLGGRFFIDLAMPLMLNWVLGGNSSKLEGRPPACRLSDKANDQLRKWFEDD  526

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALERA+NG+WFL P +   ++ S+PI LR+DE  PC++GSV      G SV +  P+VS
Sbjct  527  DALERAINGDWFLLP-QGGEASVSQPICLRKDENQPCLIGSVEKEVDSGLSVAIPLPQVS  585

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            E HARI YKDGAFF+TDLRS+HGTW++D+EGRRYR  PNFP RFH SD++EFG D+KA F
Sbjct  586  EKHARIYYKDGAFFLTDLRSEHGTWLSDHEGRRYRAPPNFPVRFHQSDLIEFGFDKKARF  645

Query  239  HVKV  228
             VKV
Sbjct  646  RVKV  649



>ref|XP_002865032.1| hypothetical protein ARALYDRAFT_496897 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41291.1| hypothetical protein ARALYDRAFT_496897 [Arabidopsis lyrata subsp. 
lyrata]
Length=667

 Score =   262 bits (670),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 129/207 (62%), Positives = 160/207 (77%), Gaps = 5/207 (2%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FR+PHPGRVGGRFF+D+AMPLML WVLGGN EKLEGRP  CRL+DKA+D+LR+WF+DD
Sbjct  464  TKFRVPHPGRVGGRFFVDIAMPLMLDWVLGGNSEKLEGRPPSCRLTDKADDRLREWFEDD  523

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALER + GEW+L P        SE + L  DE  PCIVGS P  +FPG  +V+ S +VS
Sbjct  524  DALERTIKGEWYLIP-HGEDCCVSETLCLTNDEDQPCIVGSEPDQDFPGMRIVIPSSQVS  582

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            ++HAR+ YKDG FF+ DLRS+HGT++TDNEGRRYR +PNFP RF  SDI+EFGSD+KAAF
Sbjct  583  KMHARVIYKDGVFFLMDLRSEHGTYVTDNEGRRYRATPNFPARFRSSDIIEFGSDKKAAF  642

Query  239  HVKVKVMKFPPFSGGKGEM--EVLQAA  165
              +VKV++  P S  K E   ++LQ A
Sbjct  643  --RVKVIRKTPKSTRKNESNDKLLQTA  667



>gb|KDO79217.1| hypothetical protein CISIN_1g005770mg [Citrus sinensis]
Length=365

 Score =   253 bits (645),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 133/208 (64%), Positives = 159/208 (76%), Gaps = 6/208 (3%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FRIPHPGRVGGRFFIDLAMPLMLSWVLGGN  KLEGR   C+LSDKA+D LR WF DD
Sbjct  161  TKFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNSSKLEGRSPCCKLSDKASDNLRTWFRDD  220

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLR-RDEKTPCIVGSVPHPNFPGTsvvvsspev  423
            DALERAMNGEWFL P   + +  S+PI L    E  P ++GS  H +F  TS+V+ S +V
Sbjct  221  DALERAMNGEWFLVP-SGSENVVSQPIYLSVSHENEPYLIGSESHEDFSRTSIVIPSAQV  279

Query  422  sELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAA  243
            S++HARISYKDGAF++ DL+S+HGT++TDNEGRRYRVS NFP RF PSD +EFGSD+KA 
Sbjct  280  SKMHARISYKDGAFYLIDLQSEHGTYVTDNEGRRYRVSSNFPARFRPSDTIEFGSDKKAI  339

Query  242  FHVKVKVMKFPPFSGG--KGEMEVLQAA  165
            F  +VKV+  PP +    K   E+LQA 
Sbjct  340  F--RVKVIGTPPNNNSERKEAGEILQAV  365



>dbj|BAA88842.1| zea-Xanthin epoxidase [Gentiana lutea]
 gb|ACF21781.1| zeaxanthin epoxidase [Gentiana lutea]
Length=662

 Score =   261 bits (666),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 132/191 (69%), Positives = 153/191 (80%), Gaps = 8/191 (4%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FRIPHPGRVGGR FID+ MPLMLSWVLGGNG KLEGRP QCRLSDKANDQL+ WF DD
Sbjct  464  TKFRIPHPGRVGGRVFIDIGMPLMLSWVLGGNGSKLEGRPLQCRLSDKANDQLQTWFVDD  523

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            D++ERA+  EWFL P+   T T+S  I L RDEK PC +GS    +      V+SS +VS
Sbjct  524  DSMERALKAEWFLFPIGPLT-TSSHTIFLNRDEKNPCTIGSESMLDV-----VISSAQVS  577

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            + HA+I YKDGAFFV DL+S+HGT+ITDNEGRRYRV+PN PTR HPSDI+EFGSD+KAAF
Sbjct  578  KQHAQIEYKDGAFFVVDLQSEHGTYITDNEGRRYRVTPNSPTRLHPSDIIEFGSDKKAAF  637

Query  239  HVKVKVMKFPP  207
              +VKVMK PP
Sbjct  638  --RVKVMKNPP  646



>gb|KDO79216.1| hypothetical protein CISIN_1g005770mg [Citrus sinensis]
Length=420

 Score =   253 bits (647),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 133/208 (64%), Positives = 159/208 (76%), Gaps = 6/208 (3%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FRIPHPGRVGGRFFIDLAMPLMLSWVLGGN  KLEGR   C+LSDKA+D LR WF DD
Sbjct  216  TKFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNSSKLEGRSPCCKLSDKASDNLRTWFRDD  275

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLR-RDEKTPCIVGSVPHPNFPGTsvvvsspev  423
            DALERAMNGEWFL P   + +  S+PI L    E  P ++GS  H +F  TS+V+ S +V
Sbjct  276  DALERAMNGEWFLVP-SGSENVVSQPIYLSVSHENEPYLIGSESHEDFSRTSIVIPSAQV  334

Query  422  sELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAA  243
            S++HARISYKDGAF++ DL+S+HGT++TDNEGRRYRVS NFP RF PSD +EFGSD+KA 
Sbjct  335  SKMHARISYKDGAFYLIDLQSEHGTYVTDNEGRRYRVSSNFPARFRPSDTIEFGSDKKAI  394

Query  242  FHVKVKVMKFPPFSGG--KGEMEVLQAA  165
            F  +VKV+  PP +    K   E+LQA 
Sbjct  395  F--RVKVIGTPPNNNSERKEAGEILQAV  420



>ref|XP_006280131.1| hypothetical protein CARUB_v10026026mg [Capsella rubella]
 gb|EOA13029.1| hypothetical protein CARUB_v10026026mg [Capsella rubella]
Length=669

 Score =   259 bits (663),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 129/207 (62%), Positives = 164/207 (79%), Gaps = 5/207 (2%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FR+PHPGRVGGRFFID+AMPLML+WVLGGN EKLEGRP  CRL+DKA+D+LR+WF++D
Sbjct  466  TKFRVPHPGRVGGRFFIDIAMPLMLNWVLGGNSEKLEGRPPSCRLTDKADDRLREWFEND  525

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALER +NGEW+L P  +     SE + L +DE  PCIVGS P  + PG  +V+ S +VS
Sbjct  526  DALERTINGEWYLIPHGDECCV-SETLCLTKDEDQPCIVGSEPDQDLPGKHIVIPSSQVS  584

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            ++HAR+ YKDGAFF+ DL S+HGT++TDNEGRRYR +PNFP RF  SDI+EFGSD+KAAF
Sbjct  585  KMHARVIYKDGAFFLMDLGSEHGTFVTDNEGRRYRATPNFPGRFRSSDIIEFGSDKKAAF  644

Query  239  HVKVKVMKFPPFSGGKGEM--EVLQAA  165
              +VKV++  P +  K E   ++LQAA
Sbjct  645  --RVKVIRKTPKATRKNESNDKLLQAA  669



>sp|O81360.1|ABA2_PRUAR RecName: Full=Zeaxanthin epoxidase, chloroplastic; AltName: Full=PA-ZE; 
Flags: Precursor [Prunus armeniaca]
 gb|AAD42899.1|AF159948_1 zeaxanthin epoxidase [Prunus armeniaca]
 gb|AAC24582.1| zeaxanthin epoxidase [Prunus armeniaca]
Length=661

 Score =   259 bits (661),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 137/206 (67%), Positives = 159/206 (77%), Gaps = 8/206 (4%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FRIPHPGRVGGR FID AMPLMLSWVLGGN  KLEGR   CRLSDKA+DQLR WF+DD
Sbjct  463  TKFRIPHPGRVGGRVFIDKAMPLMLSWVLGGNSSKLEGRSPSCRLSDKASDQLRNWFEDD  522

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALERA++GEW+L P     + AS+ I L RDEK PCI+GS PH +  G S+ +  P+VS
Sbjct  523  DALERAIDGEWYLIPC-GQDNDASQLICLNRDEKNPCIIGSAPHGDVSGISIAIPKPQVS  581

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            E+HARISYKDGAF++TDLRS+HGTWI D EG+RYRV PNFP RF PSD +E GS +K AF
Sbjct  582  EMHARISYKDGAFYLTDLRSEHGTWIADIEGKRYRVPPNFPARFRPSDAIEIGS-QKVAF  640

Query  239  HVKVKVMKFPPFSGGKGEME-VLQAA  165
              +VKVMK  P   G  E E +LQAA
Sbjct  641  --RVKVMKSSP---GSVEKEGILQAA  661



>gb|ADI56522.1| zeaxanthin epoxidase [Citrullus lanatus]
Length=665

 Score =   259 bits (661),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 128/184 (70%), Positives = 148/184 (80%), Gaps = 1/184 (1%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            TQFRIPHPG  GGRFFIDLAMPLML+WVLGGN  KLEGRP  CRLSDKANDQLRKWF+DD
Sbjct  467  TQFRIPHPGTFGGRFFIDLAMPLMLNWVLGGNSSKLEGRPPACRLSDKANDQLRKWFEDD  526

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALERA+NG+WFL P +   ++ S PI L RDE  PC++GSV      G S+ +  P+VS
Sbjct  527  DALERAINGDWFLLP-QGGEASVSHPICLPRDENQPCLIGSVEQEVDSGLSIAIPLPQVS  585

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            E HARI YKDGAFF+TDLRS+HGTW++D+EGRRYRV PNFP  FH  +I+E GSD+KAAF
Sbjct  586  EKHARIHYKDGAFFLTDLRSEHGTWLSDHEGRRYRVPPNFPVHFHQFNIIELGSDKKAAF  645

Query  239  HVKV  228
             VKV
Sbjct  646  RVKV  649



>gb|KDO79214.1| hypothetical protein CISIN_1g005770mg [Citrus sinensis]
 gb|KDO79215.1| hypothetical protein CISIN_1g005770mg [Citrus sinensis]
Length=475

 Score =   254 bits (648),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 133/208 (64%), Positives = 159/208 (76%), Gaps = 6/208 (3%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FRIPHPGRVGGRFFIDLAMPLMLSWVLGGN  KLEGR   C+LSDKA+D LR WF DD
Sbjct  271  TKFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNSSKLEGRSPCCKLSDKASDNLRTWFRDD  330

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLR-RDEKTPCIVGSVPHPNFPGTsvvvsspev  423
            DALERAMNGEWFL P   + +  S+PI L    E  P ++GS  H +F  TS+V+ S +V
Sbjct  331  DALERAMNGEWFLVP-SGSENVVSQPIYLSVSHENEPYLIGSESHEDFSRTSIVIPSAQV  389

Query  422  sELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAA  243
            S++HARISYKDGAF++ DL+S+HGT++TDNEGRRYRVS NFP RF PSD +EFGSD+KA 
Sbjct  390  SKMHARISYKDGAFYLIDLQSEHGTYVTDNEGRRYRVSSNFPARFRPSDTIEFGSDKKAI  449

Query  242  FHVKVKVMKFPPFSGG--KGEMEVLQAA  165
            F  +VKV+  PP +    K   E+LQA 
Sbjct  450  F--RVKVIGTPPNNNSERKEAGEILQAV  475



>gb|AAG17703.1|AF281655_1 zeaxanthin epoxidase [Arabidopsis thaliana]
 gb|AAG38877.1|AF283761_1 zeaxanthin epoxidase [Arabidopsis thaliana]
Length=667

 Score =   258 bits (660),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 128/208 (62%), Positives = 162/208 (78%), Gaps = 6/208 (3%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FR+PHPGRVGGRFF+D+AMP ML WVLGGN EKL+GRP  CRL+DKA+D+LR+WF+DD
Sbjct  463  TKFRVPHPGRVGGRFFVDIAMPSMLDWVLGGNSEKLQGRPPSCRLTDKADDRLREWFEDD  522

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALER + GEW+L P  +     SE + L +DE  PCIVGS P  +FPG  +V+ S +VS
Sbjct  523  DALERTIKGEWYLIPHGD-DCCVSETLCLTKDEDQPCIVGSEPDQDFPGMRIVIPSSQVS  581

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            ++HAR+ YKDGAFF+ DLRS+HGT++TDNEGRRYR +PNFP RF  SDI+EFGSD+KAAF
Sbjct  582  KMHARVIYKDGAFFLMDLRSEHGTYVTDNEGRRYRATPNFPARFRSSDIIEFGSDKKAAF  641

Query  239  HVKVKVMKFPPFSGGKGEM---EVLQAA  165
              +VKV++  P S  K E    ++LQ A
Sbjct  642  --RVKVIRKTPKSTRKNESNNDKLLQTA  667



>ref|XP_007204247.1| hypothetical protein PRUPE_ppa002248mg [Prunus persica]
 gb|EMJ05446.1| hypothetical protein PRUPE_ppa002248mg [Prunus persica]
Length=696

 Score =   259 bits (661),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 137/206 (67%), Positives = 159/206 (77%), Gaps = 8/206 (4%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FRIPHPGRVGGR FID AMPLMLSWVLGGN  KLEGR   CRLSDKA+DQLR WF+DD
Sbjct  498  TKFRIPHPGRVGGRVFIDKAMPLMLSWVLGGNSSKLEGRSPSCRLSDKASDQLRTWFEDD  557

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALERA++GEW+L P     + AS+ I L RDEK PCI+GS PH +  G S+ +  P+VS
Sbjct  558  DALERAIDGEWYLIPC-GQDNDASQLICLNRDEKNPCIIGSAPHGDVSGISIAIPKPQVS  616

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            E+HARISYKDGAF++TDLRS+HGTWI D EG+RYRV PNFP RF PSD +E GS +K AF
Sbjct  617  EMHARISYKDGAFYLTDLRSEHGTWIADIEGKRYRVPPNFPARFRPSDAIEIGS-QKVAF  675

Query  239  HVKVKVMKFPPFSGGKGEME-VLQAA  165
              +VKVMK  P   G  E E +LQAA
Sbjct  676  --RVKVMKSSP---GSVEKEGILQAA  696



>ref|NP_851285.1| zeaxanthin epoxidase [Arabidopsis thaliana]
 sp|Q9FGC7.1|ZEP_ARATH RecName: Full=Zeaxanthin epoxidase, chloroplastic; Short=AtZEP; 
AltName: Full=Protein ABA DEFICIENT 1; Short=AtABA1; AltName: 
Full=Protein IMPAIRED IN BABA-INDUCED STERILITY 3; AltName: 
Full=Protein LOW EXPRESSION OF OSMOTIC STRESS-RESPONSIVE 
GENES 6; AltName: Full=Protein NON-PHOTOCHEMICAL QUENCHING 
2; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB08942.1| zeaxanthin epoxidase precursor [Arabidopsis thaliana]
 gb|AAM13144.1| zeaxanthin epoxidase precursor [Arabidopsis thaliana]
 gb|AED98292.1| zeaxanthin epoxidase (ZEP) (ABA1) [Arabidopsis thaliana]
Length=667

 Score =   258 bits (660),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 128/208 (62%), Positives = 162/208 (78%), Gaps = 6/208 (3%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FR+PHPGRVGGRFF+D+AMP ML WVLGGN EKL+GRP  CRL+DKA+D+LR+WF+DD
Sbjct  463  TKFRVPHPGRVGGRFFVDIAMPSMLDWVLGGNSEKLQGRPPSCRLTDKADDRLREWFEDD  522

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALER + GEW+L P  +     SE + L +DE  PCIVGS P  +FPG  +V+ S +VS
Sbjct  523  DALERTIKGEWYLIPHGD-DCCVSETLCLTKDEDQPCIVGSEPDQDFPGMRIVIPSSQVS  581

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            ++HAR+ YKDGAFF+ DLRS+HGT++TDNEGRRYR +PNFP RF  SDI+EFGSD+KAAF
Sbjct  582  KMHARVIYKDGAFFLMDLRSEHGTYVTDNEGRRYRATPNFPARFRSSDIIEFGSDKKAAF  641

Query  239  HVKVKVMKFPPFSGGKGEM---EVLQAA  165
              +VKV++  P S  K E    ++LQ A
Sbjct  642  --RVKVIRKTPKSTRKNESNNDKLLQTA  667



>gb|AAF82390.1|AF134577_1 zeaxanthin epoxidase [Arabidopsis thaliana]
 gb|AAF82391.1|AF134578_1 zeaxanthin epoxidase [Arabidopsis thaliana]
Length=667

 Score =   258 bits (659),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 128/208 (62%), Positives = 162/208 (78%), Gaps = 6/208 (3%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FR+PHPGRVGGRFF+D+AMP ML WVLGGN EKL+GRP  CRL+DKA+D+LR+WF+DD
Sbjct  463  TKFRVPHPGRVGGRFFVDIAMPSMLDWVLGGNSEKLQGRPPSCRLTDKADDRLREWFEDD  522

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALER + GEW+L P  +     SE + L +DE  PCIVGS P  +FPG  +V+ S +VS
Sbjct  523  DALERTIKGEWYLIPHGD-DCCVSETLCLTKDEDQPCIVGSEPDQDFPGMRIVIPSSQVS  581

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            ++HAR+ YKDGAFF+ DLRS+HGT++TDNEGRRYR +PNFP RF  SDI+EFGSD+KAAF
Sbjct  582  KMHARVIYKDGAFFLMDLRSEHGTYVTDNEGRRYRATPNFPARFRSSDIIEFGSDKKAAF  641

Query  239  HVKVKVMKFPPFSGGKGEM---EVLQAA  165
              +VKV++  P S  K E    ++LQ A
Sbjct  642  --RVKVIRKTPKSTRKNESNNDKLLQTA  667



>dbj|BAB11935.1| AtABA1 [Arabidopsis thaliana]
Length=667

 Score =   258 bits (659),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 128/208 (62%), Positives = 162/208 (78%), Gaps = 6/208 (3%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FR+PHPGRVGGRFF+D+AMP ML WVLGGN EKL+GRP  CRL+DKA+D+LR+WF+DD
Sbjct  463  TKFRVPHPGRVGGRFFVDIAMPSMLDWVLGGNSEKLQGRPPSCRLTDKADDRLREWFEDD  522

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALER + GEW+L P  +     SE + L +DE  PCIVGS P  +FPG  +V+ S +VS
Sbjct  523  DALERTIKGEWYLIPHGD-DCCVSETLCLTKDEDQPCIVGSEPDQDFPGMRIVIPSSQVS  581

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            ++HAR+ YKDGAFF+ DLRS+HGT++TDNEGRRYR +PNFP RF  SDI+EFGSD+KAAF
Sbjct  582  KMHARVIYKDGAFFLMDLRSEHGTYVTDNEGRRYRATPNFPARFRSSDIIEFGSDKKAAF  641

Query  239  HVKVKVMKFPPFSGGKGEM---EVLQAA  165
              +VKV++  P S  K E    ++LQ A
Sbjct  642  --RVKVIRKTPKSTRKNESNNDKLLQTA  667



>gb|KDO79213.1| hypothetical protein CISIN_1g005770mg [Citrus sinensis]
Length=502

 Score =   254 bits (648),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 133/208 (64%), Positives = 159/208 (76%), Gaps = 6/208 (3%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FRIPHPGRVGGRFFIDLAMPLMLSWVLGGN  KLEGR   C+LSDKA+D LR WF DD
Sbjct  298  TKFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNSSKLEGRSPCCKLSDKASDNLRTWFRDD  357

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLR-RDEKTPCIVGSVPHPNFPGTsvvvsspev  423
            DALERAMNGEWFL P   + +  S+PI L    E  P ++GS  H +F  TS+V+ S +V
Sbjct  358  DALERAMNGEWFLVP-SGSENVVSQPIYLSVSHENEPYLIGSESHEDFSRTSIVIPSAQV  416

Query  422  sELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAA  243
            S++HARISYKDGAF++ DL+S+HGT++TDNEGRRYRVS NFP RF PSD +EFGSD+KA 
Sbjct  417  SKMHARISYKDGAFYLIDLQSEHGTYVTDNEGRRYRVSSNFPARFRPSDTIEFGSDKKAI  476

Query  242  FHVKVKVMKFPPFSGG--KGEMEVLQAA  165
            F  +VKV+  PP +    K   E+LQA 
Sbjct  477  F--RVKVIGTPPNNNSERKEAGEILQAV  502



>dbj|BAB78733.1| zeaxanthin epoxidase [Citrus unshiu]
Length=664

 Score =   258 bits (658),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 134/208 (64%), Positives = 160/208 (77%), Gaps = 6/208 (3%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FRIPHPGRVGGRFFIDLAMPLMLSWVLGGN  KLEGR   C+LSDKA+D LR WF DD
Sbjct  460  TKFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNSSKLEGRSPCCKLSDKASDNLRTWFRDD  519

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLR-RDEKTPCIVGSVPHPNFPGTsvvvsspev  423
            DALERAMNGEWFL P   + +  S+PI L    E  P ++GS  H +FP TS+V+ S +V
Sbjct  520  DALERAMNGEWFLVP-SGSENVVSQPIYLSGSHENEPYLIGSESHEDFPRTSIVIPSAQV  578

Query  422  sELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAA  243
            S++HARISYKDGAF++ DL+S+HGT++TDNEGRRYRVS NFP RF PSD +EFGSD+KA 
Sbjct  579  SKMHARISYKDGAFYLIDLQSEHGTYVTDNEGRRYRVSSNFPARFRPSDTIEFGSDKKAI  638

Query  242  FHVKVKVMKFPPFSGG--KGEMEVLQAA  165
            F  +VKV+  PP +    K   E+LQA 
Sbjct  639  F--RVKVIGTPPNNNSERKEAGEILQAV  664



>ref|XP_010484561.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Camelina 
sativa]
Length=668

 Score =   258 bits (658),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 127/207 (61%), Positives = 162/207 (78%), Gaps = 5/207 (2%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FR+PHPGRVGGRFFID+AMP+ML+WVLGGN EKLEGR   CRL+DKA+D+LR+WF+DD
Sbjct  465  TKFRVPHPGRVGGRFFIDIAMPMMLNWVLGGNSEKLEGRSPSCRLTDKADDRLREWFEDD  524

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALER + GEW+L P  +     SE + L +DE  PCI+GS P  + PG  +V+ S +VS
Sbjct  525  DALERTIKGEWYLIPHGDECCI-SETLCLTKDEDQPCIIGSKPDQDLPGKHIVIPSSQVS  583

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            ++HAR+ YKDGAFF+ DLRS+HGT++TDNEGRRYR +PN P RF  SDI+EFGSD+KAAF
Sbjct  584  KMHARVIYKDGAFFLMDLRSEHGTYVTDNEGRRYRATPNSPARFRTSDIIEFGSDKKAAF  643

Query  239  HVKVKVMKFPPFSGGKGEM--EVLQAA  165
              +VKV++  P S  K E   ++LQAA
Sbjct  644  --RVKVIRTTPKSTRKNESNDKLLQAA  668



>dbj|BAI79257.1| zeaxanthin epoxidase [Citrus unshiu]
Length=664

 Score =   257 bits (657),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 134/208 (64%), Positives = 160/208 (77%), Gaps = 6/208 (3%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FRIPHPGRVGGRFFIDLAMPLMLSWVLGGN  KLEGR   C+LSDKA+D LR WF DD
Sbjct  460  TKFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNSSKLEGRSPCCKLSDKASDNLRTWFRDD  519

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLR-RDEKTPCIVGSVPHPNFPGTsvvvsspev  423
            DALERAMNGEWFL P   + +  S+PI L    E  P ++GS  H +FP TS+V+ S +V
Sbjct  520  DALERAMNGEWFLVP-SGSENVVSQPIYLSVSHENEPYLIGSESHEDFPRTSIVIPSAQV  578

Query  422  sELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAA  243
            S++HARISYKDGAF++ DL+S+HGT++TDNEGRRYRVS NFP RF PSD +EFGSD+KA 
Sbjct  579  SKMHARISYKDGAFYLIDLQSEHGTYVTDNEGRRYRVSSNFPARFRPSDTIEFGSDKKAI  638

Query  242  FHVKVKVMKFPPFSGG--KGEMEVLQAA  165
            F  +VKV+  PP +    K   E+LQA 
Sbjct  639  F--RVKVIGTPPNNNSERKEAGEILQAV  664



>ref|XP_006466600.1| PREDICTED: zeaxanthin epoxidase, chloroplastic [Citrus sinensis]
 dbj|BAI79259.1| zeaxanthin epoxidase [Citrus sinensis]
Length=664

 Score =   257 bits (657),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 134/208 (64%), Positives = 160/208 (77%), Gaps = 6/208 (3%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FRIPHPGRVGGRFFIDLAMPLMLSWVLGGN  KLEGR   C+LSDKA+D LR WF DD
Sbjct  460  TKFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNSSKLEGRSPCCKLSDKASDNLRTWFRDD  519

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLR-RDEKTPCIVGSVPHPNFPGTsvvvsspev  423
            DALERAMNGEWFL P   + +  S+PI L    E  P ++GS  H +FP TS+V+ S +V
Sbjct  520  DALERAMNGEWFLVP-SGSENVVSQPIYLSVSHENEPYLIGSESHEDFPRTSIVIPSAQV  578

Query  422  sELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAA  243
            S++HARISYKDGAF++ DL+S+HGT++TDNEGRRYRVS NFP RF PSD +EFGSD+KA 
Sbjct  579  SKMHARISYKDGAFYLIDLQSEHGTYVTDNEGRRYRVSSNFPARFRPSDTIEFGSDKKAI  638

Query  242  FHVKVKVMKFPPFSGG--KGEMEVLQAA  165
            F  +VKV+  PP +    K   E+LQA 
Sbjct  639  F--RVKVIGTPPNNNSERKEAGEILQAV  664



>ref|XP_010444704.1| PREDICTED: zeaxanthin epoxidase, chloroplastic [Camelina sativa]
Length=665

 Score =   257 bits (657),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 127/207 (61%), Positives = 162/207 (78%), Gaps = 5/207 (2%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FR+PHPGRVGGRFFID+AMP+ML+WVLGGN EKLEGR   CRL+DKA+D+LR+WF+DD
Sbjct  462  TKFRVPHPGRVGGRFFIDIAMPMMLNWVLGGNSEKLEGRSPSCRLTDKADDRLREWFEDD  521

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALER + GEW+L P  +     SE + L +DE  PCI+GS P  + PG  +V+ S +VS
Sbjct  522  DALERTIKGEWYLIPHGD-DCCISETLCLTKDEDQPCIIGSEPDQDLPGKHIVIPSSQVS  580

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            ++HAR+ YKDGAFF+ DLRS+HGT++TDNEGRRYR +PN P RF  SDI+EFGSD+KAAF
Sbjct  581  KMHARVIYKDGAFFLMDLRSEHGTYVTDNEGRRYRATPNSPARFRTSDIIEFGSDKKAAF  640

Query  239  HVKVKVMKFPPFSGGKGEM--EVLQAA  165
              +VKV++  P S  K E   ++LQAA
Sbjct  641  --RVKVIRTTPKSTRKNESNDKLLQAA  665



>gb|ACE79170.1| zeaxanthin epoxidase [Citrus maxima]
Length=664

 Score =   257 bits (656),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 134/208 (64%), Positives = 160/208 (77%), Gaps = 6/208 (3%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FRIPHPGRVGGRFFIDLAMPLMLSWVLGGN  KLEGR   C+LSDKA+D LR WF DD
Sbjct  460  TKFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNSSKLEGRSPCCKLSDKASDNLRTWFRDD  519

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLR-RDEKTPCIVGSVPHPNFPGTsvvvsspev  423
            DALERAMNGEWFL P   + +  S+PI L    E  P ++GS  H +FP TS+V+ S +V
Sbjct  520  DALERAMNGEWFLVP-SGSENVVSQPIYLSVSHENEPYLIGSESHEDFPRTSIVIPSAQV  578

Query  422  sELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAA  243
            S++HARISYKDGAF++ DL+S+HGT++TDNEGRRYRVS NFP RF PSD +EFGSD+KA 
Sbjct  579  SKMHARISYKDGAFYLIDLQSEHGTYVTDNEGRRYRVSSNFPARFRPSDTIEFGSDKKAI  638

Query  242  FHVKVKVMKFPPFSGG--KGEMEVLQAA  165
            F  +VKV+  PP +    K   E+LQA 
Sbjct  639  F--RVKVIGTPPNNNSERKEAGEILQAV  664



>gb|KDO79163.1| hypothetical protein CISIN_1g0151672mg, partial [Citrus sinensis]
Length=276

 Score =   246 bits (627),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 128/208 (62%), Positives = 157/208 (75%), Gaps = 6/208 (3%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+F IPHPGRV  RFFIDLAMPLML+WVLGGN  KLEGR   CRLSDKA+DQLR W  D+
Sbjct  69   TKFWIPHPGRVVRRFFIDLAMPLMLNWVLGGNSSKLEGRSPCCRLSDKASDQLRTWLRDN  128

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRR-DEKTPCIVGSVPHPNFPGTsvvvsspev  423
            DALERAMNGEW L P   + +  S+PI L R DE  P ++GS    +FP TS+V+ S +V
Sbjct  129  DALERAMNGEWLLVP-SGSETVVSQPIYLSRSDENEPYLIGSESQEDFPRTSIVIPSAQV  187

Query  422  sELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAA  243
            S++HA I YKDGAF++ DLRS+HGT+ITDNEGRRYRVSPNFP RF PS+ ++FGSD+KA 
Sbjct  188  SKMHAHIRYKDGAFYLIDLRSEHGTYITDNEGRRYRVSPNFPARFRPSNSIQFGSDKKAT  247

Query  242  FHVKVKVMKFPPFSGGKGEM--EVLQAA  165
            F  +VKV++  P    + E+  E+LQA 
Sbjct  248  F--QVKVIRSTPKKNSEKEVEGEILQAV  273



>ref|XP_008340140.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Malus domestica]
Length=731

 Score =   258 bits (659),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 137/205 (67%), Positives = 161/205 (79%), Gaps = 6/205 (3%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FRIPHPGRVGGR FID AMPLMLSWVLGGN  KLEGR  +CRLSDKA+DQLR WF+DD
Sbjct  533  TKFRIPHPGRVGGRVFIDKAMPLMLSWVLGGNSSKLEGRSPRCRLSDKASDQLRTWFEDD  592

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALERA++GEW+L P     + AS+ I L RDEKT CI+GS+PH +  GTS+ + SP+VS
Sbjct  593  DALERAIDGEWYLIPC-GQDNDASQLICLNRDEKTSCIIGSIPHGDASGTSITIRSPQVS  651

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            E+HARISYKDGAF+VTDL+S+HGTWI D E +RYRV PNFP R HPSD +E GS +K AF
Sbjct  652  EMHARISYKDGAFYVTDLQSEHGTWIADIEEKRYRVPPNFPARIHPSDAIEIGS-QKVAF  710

Query  239  HVKVKVMKFPPFSGGKGEMEVLQAA  165
              +VKVMK  P   G  +  VLQAA
Sbjct  711  --RVKVMKSSP--KGAEKDGVLQAA  731



>ref|XP_006653464.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Oryza brachyantha]
Length=553

 Score =   254 bits (648),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 126/205 (61%), Positives = 154/205 (75%), Gaps = 2/205 (1%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+ RIPHPGRVGGRFFI   MPLML+WVLGGN  KLEGRP  CRLSDKANDQLR+WF+DD
Sbjct  351  TKLRIPHPGRVGGRFFIKYGMPLMLTWVLGGNSSKLEGRPLSCRLSDKANDQLRQWFEDD  410

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALE+AM GEWFL    +  + AS+PI L RDEK    +GS   P+   +S+ +  P++S
Sbjct  411  DALEQAMGGEWFLFSTSSGNTYASQPIRLIRDEKMSFSIGSRSDPSKSASSLSLPLPQIS  470

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            E HA I+ K+ A ++TD  S+HGTWITDNEGRRYRV PNFP RFHPSD++EFGSD+KA F
Sbjct  471  ESHATITCKNKALYLTDHGSEHGTWITDNEGRRYRVPPNFPVRFHPSDVIEFGSDKKAMF  530

Query  239  HVKVKVMKFPPFSGGKGEMEVLQAA  165
              +VKVM   P+   +G  ++LQAA
Sbjct  531  --RVKVMNTLPYESARGGQQILQAA  553



>ref|XP_006425899.1| hypothetical protein CICLE_v10025089mg [Citrus clementina]
 gb|ESR39139.1| hypothetical protein CICLE_v10025089mg [Citrus clementina]
Length=664

 Score =   256 bits (655),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 134/208 (64%), Positives = 159/208 (76%), Gaps = 6/208 (3%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FRIPHPGRVGGRFFIDLAMPLMLSWVLGGN  KLEGR   C+LSDKA+D LR WF DD
Sbjct  460  TKFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNSSKLEGRSPCCKLSDKASDNLRTWFRDD  519

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLR-RDEKTPCIVGSVPHPNFPGTsvvvsspev  423
            DALERAMNGEWFL P   + +  S+PI L    E  P ++GS  H +F  TS+V+ S +V
Sbjct  520  DALERAMNGEWFLVP-SGSENVVSQPIYLSGSHENEPYLIGSESHEDFSRTSIVIPSAQV  578

Query  422  sELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAA  243
            S++HARISYKDGAF++ DL+S+HGT++TDNEGRRYRVS NFP RF PSD +EFGSD+KA 
Sbjct  579  SKMHARISYKDGAFYLIDLQSEHGTYVTDNEGRRYRVSSNFPARFRPSDTIEFGSDKKAI  638

Query  242  FHVKVKVMKFPPFSGG--KGEMEVLQAA  165
            F  +VKVM  PP +    K   E+LQA 
Sbjct  639  F--RVKVMGTPPNNNSERKEAGEILQAV  664



>gb|KHN42080.1| Zeaxanthin epoxidase, chloroplastic [Glycine soja]
Length=654

 Score =   256 bits (653),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 125/184 (68%), Positives = 151/184 (82%), Gaps = 2/184 (1%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FRIPHPGRVGGRFFID  MPLML+WVLGGN  KLEGRP  CRLSDKANDQL +WF+D+
Sbjct  454  TKFRIPHPGRVGGRFFIDKMMPLMLNWVLGGNSSKLEGRPVCCRLSDKANDQLHRWFEDN  513

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALERA+NGEW L P  +     ++PI L +DE  PCI+GS+   + PG+S+++  P+VS
Sbjct  514  DALERAINGEWILLPCGDEAG-PTKPICLTQDEMKPCIIGSMQQKDHPGSSIIIPLPQVS  572

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            ++HARI+YKDGAFF+TDLRS HGTWITDNEGRRYRV PN+P R  PSD+VEFGSD KA++
Sbjct  573  QMHARINYKDGAFFLTDLRSLHGTWITDNEGRRYRVPPNYPARVRPSDVVEFGSD-KASY  631

Query  239  HVKV  228
             VKV
Sbjct  632  RVKV  635



>ref|NP_001241348.1| zeaxanthin epoxidase, chloroplastic-like [Glycine max]
 gb|AEK69512.1| zeaxanthin epoxidase 2 [Glycine max]
Length=654

 Score =   256 bits (653),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 125/184 (68%), Positives = 151/184 (82%), Gaps = 2/184 (1%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FRIPHPGRVGGRFFID  MPLML+WVLGGN  KLEGRP  CRLSDKANDQL +WF+D+
Sbjct  454  TKFRIPHPGRVGGRFFIDKMMPLMLNWVLGGNSSKLEGRPVCCRLSDKANDQLHRWFEDN  513

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALERA+NGEW L P  +     ++PI L +DE  PCI+GS+   + PG+S+++  P+VS
Sbjct  514  DALERAINGEWILLPCGDEAG-PTKPICLTQDEMKPCIIGSMQQKDHPGSSIIIPLPQVS  572

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            ++HARI+YKDGAFF+TDLRS HGTWITDNEGRRYRV PN+P R  PSD+VEFGSD KA++
Sbjct  573  QMHARINYKDGAFFLTDLRSLHGTWITDNEGRRYRVPPNYPARVRPSDVVEFGSD-KASY  631

Query  239  HVKV  228
             VKV
Sbjct  632  RVKV  635



>ref|XP_007047261.1| Zeaxanthin epoxidase (ZEP) (ABA1) isoform 2 [Theobroma cacao]
 gb|EOX91418.1| Zeaxanthin epoxidase (ZEP) (ABA1) isoform 2 [Theobroma cacao]
Length=665

 Score =   255 bits (652),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 135/205 (66%), Positives = 161/205 (79%), Gaps = 4/205 (2%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            ++FRIPHPGRVGGRFFIDLAMPLMLSWVLGGN  KLEGR   CRLSDKA+DQLR WF+D+
Sbjct  465  SKFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNSSKLEGRSLSCRLSDKASDQLRTWFEDN  524

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALE+ +NGEWFL P+ N    AS+PI L RDE  P ++GS    NFPG SVVV SP+VS
Sbjct  525  DALEQTINGEWFLFPVGNEV-VASQPICLSRDENKPFMIGSEKSENFPGASVVVPSPQVS  583

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            + HA+ISYKDGAFF+ DL+S+HGT+I D+ GRR RV PN  TR  PSD+++FGSD+KAAF
Sbjct  584  KTHAQISYKDGAFFLIDLQSEHGTYI-DHGGRRSRVPPNVSTRVRPSDVIQFGSDKKAAF  642

Query  239  HVKVKVMKFPPFSGGKGEMEVLQAA  165
              +VKVM+ PP    KGE  +LQA 
Sbjct  643  --RVKVMRSPPKIALKGEGGILQAV  665



>ref|XP_010547517.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Tarenaya 
hassleriana]
Length=665

 Score =   255 bits (652),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 129/207 (62%), Positives = 156/207 (75%), Gaps = 3/207 (1%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T  RIPHPG VGGRFFID+AMPLML+WVLGGN  KLEGR   CRLSDKA+DQL++WF D+
Sbjct  460  TMLRIPHPGTVGGRFFIDVAMPLMLNWVLGGNSSKLEGRLPCCRLSDKADDQLQRWFQDN  519

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALER + G+W+L P  N  S  SE + L +DE  PCI+GS P  +FPG  + + S +VS
Sbjct  520  DALERTVIGDWYLIPYGN-DSIVSETVRLDKDEDQPCIIGSEPDEDFPGMRIEIPSSQVS  578

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            ++HARI YKDGAFFV DLRS++GT+ITDNEGRRYRV+PNFP RF PSDI+E GSD+KAAF
Sbjct  579  KVHARIIYKDGAFFVMDLRSEYGTYITDNEGRRYRVTPNFPARFRPSDIIELGSDKKAAF  638

Query  239  HVKV--KVMKFPPFSGGKGEMEVLQAA  165
             VKV  K  K       +   ++LQAA
Sbjct  639  RVKVIRKTPKMTRRDDRESSSKLLQAA  665



>ref|XP_009345968.1| PREDICTED: zeaxanthin epoxidase, chloroplastic isoform X2 [Pyrus 
x bretschneideri]
Length=664

 Score =   255 bits (651),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 136/205 (66%), Positives = 159/205 (78%), Gaps = 6/205 (3%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FRIPHPGRVGGR FID AMPLMLSWVLGGN  KLEGR   CRLSDKA+DQLR WF+DD
Sbjct  466  TKFRIPHPGRVGGRVFIDKAMPLMLSWVLGGNSSKLEGRSPSCRLSDKASDQLRTWFEDD  525

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALERA++GEW+L P     + AS+ I L RDEKT CI+GSVPH +  GTS+ + SP+VS
Sbjct  526  DALERAIDGEWYLIPCGQ-DNDASQLICLNRDEKTSCIIGSVPHGDASGTSIAIRSPQVS  584

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            ++HARISYKDGAF+VTDL+S++GTWI D E +RYRV PN P R HPSD +E GS +K AF
Sbjct  585  DMHARISYKDGAFYVTDLQSEYGTWIADIEEKRYRVPPNSPARLHPSDAIEIGS-QKVAF  643

Query  239  HVKVKVMKFPPFSGGKGEMEVLQAA  165
              +VKVMK  P S  K    VLQAA
Sbjct  644  --RVKVMKSSPKSAEK--EGVLQAA  664



>gb|KDO79210.1| hypothetical protein CISIN_1g005770mg [Citrus sinensis]
 gb|KDO79211.1| hypothetical protein CISIN_1g005770mg [Citrus sinensis]
Length=664

 Score =   255 bits (651),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 133/208 (64%), Positives = 159/208 (76%), Gaps = 6/208 (3%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FRIPHPGRVGGRFFIDLAMPLMLSWVLGGN  KLEGR   C+LSDKA+D LR WF DD
Sbjct  460  TKFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNSSKLEGRSPCCKLSDKASDNLRTWFRDD  519

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLR-RDEKTPCIVGSVPHPNFPGTsvvvsspev  423
            DALERAMNGEWFL P   + +  S+PI L    E  P ++GS  H +F  TS+V+ S +V
Sbjct  520  DALERAMNGEWFLVP-SGSENVVSQPIYLSVSHENEPYLIGSESHEDFSRTSIVIPSAQV  578

Query  422  sELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAA  243
            S++HARISYKDGAF++ DL+S+HGT++TDNEGRRYRVS NFP RF PSD +EFGSD+KA 
Sbjct  579  SKMHARISYKDGAFYLIDLQSEHGTYVTDNEGRRYRVSSNFPARFRPSDTIEFGSDKKAI  638

Query  242  FHVKVKVMKFPPFSGG--KGEMEVLQAA  165
            F  +VKV+  PP +    K   E+LQA 
Sbjct  639  F--RVKVIGTPPNNNSERKEAGEILQAV  664



>ref|XP_007156802.1| hypothetical protein PHAVU_002G018700g [Phaseolus vulgaris]
 gb|ESW28796.1| hypothetical protein PHAVU_002G018700g [Phaseolus vulgaris]
Length=664

 Score =   254 bits (650),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 127/184 (69%), Positives = 151/184 (82%), Gaps = 3/184 (2%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FRIPHPGRVGGRFFID  MPLML+WVLGGN  KLEGRP  CRLSDKANDQL  WF+D+
Sbjct  465  TKFRIPHPGRVGGRFFIDKMMPLMLNWVLGGNSSKLEGRPICCRLSDKANDQLHTWFEDN  524

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALERA+NGEW L P   A S   +PI L +DE  PCI+GS  H + PG+S+++SSP+VS
Sbjct  525  DALERAINGEWMLLPCDEAGSV--KPISLSQDETKPCIIGSAQHKDHPGSSIIISSPKVS  582

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
             LHARI+YKDGAFF+TDLRS +GTWITDNEGRRYR+  N+P+R  PSD++EFGSD KA++
Sbjct  583  PLHARINYKDGAFFLTDLRSLYGTWITDNEGRRYRIPSNYPSRVRPSDVIEFGSD-KASY  641

Query  239  HVKV  228
             VKV
Sbjct  642  RVKV  645



>ref|XP_009343160.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Pyrus x 
bretschneideri]
Length=664

 Score =   254 bits (650),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 136/205 (66%), Positives = 159/205 (78%), Gaps = 6/205 (3%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FRIPHPGRVGGR FID AMPLMLSWVLGGN  KLEGR   CRLSDKA+DQLR WF+DD
Sbjct  466  TKFRIPHPGRVGGRVFIDKAMPLMLSWVLGGNSSKLEGRSPSCRLSDKASDQLRTWFEDD  525

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALERA++GEW+L P     + AS+ I L RDEKT CI+GSVPH +  GTS+ + SP+VS
Sbjct  526  DALERAIDGEWYLIPCGQ-DNDASQLICLNRDEKTSCIIGSVPHGDASGTSITIRSPQVS  584

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            ++HARISYKDGAF+VTDL+S++GTWI D E +RYRV PN P R HPSD +E GS +K AF
Sbjct  585  DMHARISYKDGAFYVTDLQSEYGTWIADIEEKRYRVPPNSPARLHPSDAIEIGS-QKVAF  643

Query  239  HVKVKVMKFPPFSGGKGEMEVLQAA  165
              +VKVMK  P S  K    VLQAA
Sbjct  644  --RVKVMKSSPKSAEK--EGVLQAA  664



>ref|XP_010939415.1| PREDICTED: zeaxanthin epoxidase, chloroplastic isoform X1 [Elaeis 
guineensis]
Length=657

 Score =   254 bits (650),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 129/205 (63%), Positives = 162/205 (79%), Gaps = 6/205 (3%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FRIPHPG+VGGRFFI LAMP MLSWVLGGN  KLEGR   CRLSDKA+DQL++WF+DD
Sbjct  459  TKFRIPHPGKVGGRFFIKLAMPSMLSWVLGGNSSKLEGRSLSCRLSDKASDQLKRWFNDD  518

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DA+ERA+ GEW+L P    TS + +PI L +DE+ P I+G+  H + PG SVV+ SP+V+
Sbjct  519  DAMERALTGEWYLFP----TSGSLQPIHLIKDEQIPIIIGNQSHADIPGVSVVIPSPQVA  574

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            ++HARIS KD AFF+TD++S++GTWITD EGRRYRV PNF  RFHPSD++EFGSD+KA F
Sbjct  575  DIHARISCKDNAFFLTDMQSQYGTWITDKEGRRYRVPPNFSVRFHPSDVIEFGSDKKAMF  634

Query  239  HVKVKVMKFPPFSGGKGEMEVLQAA  165
             VKV +   P    G+G  ++LQAA
Sbjct  635  RVKV-LKTLPETLTGEGR-QILQAA  657



>emb|CDY63427.1| BnaC08g48380D [Brassica napus]
Length=346

 Score =   246 bits (627),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 123/208 (59%), Positives = 158/208 (76%), Gaps = 6/208 (3%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
             + RI HPG +GGRF +D+ MPLML WVLGGN EKLEGR   CRL+DKA+D+LR+WF+DD
Sbjct  142  AKLRIQHPGIIGGRFLMDMTMPLMLDWVLGGNSEKLEGRSPNCRLTDKADDRLRQWFEDD  201

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            +ALER + GEW+L P  N  S  SE + L +DE  PCI+GS P  +  GT +++ SP+VS
Sbjct  202  EALERTIKGEWYLIPHGNKGSV-SETLCLTKDEDQPCIIGSEPDQDVSGTHIMIRSPQVS  260

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            ++HAR+ YKDGAFF+ DLRS+HGT++TDN+GRRYRV+P FP RF PSDI+EFGSD+KAAF
Sbjct  261  KMHARVIYKDGAFFLMDLRSEHGTYVTDNQGRRYRVTPKFPARFRPSDIIEFGSDKKAAF  320

Query  239  HVKVKVMKFPPFSGGKGEM---EVLQAA  165
              KVKV++  P    K E    ++LQAA
Sbjct  321  --KVKVIRSTPNLTRKDEKSNGKLLQAA  346



>emb|CAX36916.1| zeaxanthin epoxidase enzyme [Triticum aestivum]
Length=364

 Score =   246 bits (627),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 122/205 (60%), Positives = 153/205 (75%), Gaps = 2/205 (1%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+ RIPHPGRVGGRFFI + MPLMLSW+LGGN  KLEGRP  CRLSDKA++QL +WF DD
Sbjct  162  TKLRIPHPGRVGGRFFIKVGMPLMLSWILGGNSSKLEGRPLSCRLSDKASNQLGRWFQDD  221

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALE+AM GEW+L P+ +   +A +PI L RDE+    +GS P P+   +S+    P+VS
Sbjct  222  DALEQAMGGEWYLFPMSSGGDSALQPIRLIRDEQRTLSIGSKPDPSNSDSSLSFPLPQVS  281

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            E+HA I+ K+  F++TDL S+HGTW  DNEGRRYR+ PNFP RFHPSD +EFGSD+KA F
Sbjct  282  EIHATITCKNKGFYLTDLGSEHGTWFNDNEGRRYRLPPNFPVRFHPSDAIEFGSDKKAMF  341

Query  239  HVKVKVMKFPPFSGGKGEMEVLQAA  165
              +VKV+   P+   +G  EVLQAA
Sbjct  342  --RVKVLSTLPYDSARGGEEVLQAA  364



>gb|AFK33361.1| unknown [Lotus japonicus]
Length=223

 Score =   239 bits (611),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 121/184 (66%), Positives = 145/184 (79%), Gaps = 6/184 (3%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FRIPHPGRVGGRFF+D+ MP ML W+LGGN  KLEGRP  CRLSDKANDQLR+WF+DD
Sbjct  27   TKFRIPHPGRVGGRFFVDIFMPYMLDWILGGNSSKLEGRPLSCRLSDKANDQLRRWFEDD  86

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALE A+NGEW L P  + T   SEPI + ++E  PCI+GS       GTSV + SP+VS
Sbjct  87   DALESAINGEWTLLPCGDETG-HSEPIRISQNEMKPCIIGS----ELQGTSVTIPSPQVS  141

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
             +HARI+YKDG FF+ DLRS+HGTWI+D EG+RYRV PN+P R HPSD++EFGS RK +F
Sbjct  142  PMHARINYKDGGFFLIDLRSEHGTWISDIEGKRYRVPPNYPARIHPSDVLEFGS-RKVSF  200

Query  239  HVKV  228
             VKV
Sbjct  201  RVKV  204



>ref|XP_008338317.1| PREDICTED: zeaxanthin epoxidase, chloroplastic isoform X3 [Malus 
domestica]
Length=664

 Score =   252 bits (643),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 135/205 (66%), Positives = 158/205 (77%), Gaps = 6/205 (3%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FRIPHPGRVGGR FID AMPLMLSWVLGGN  KLEGR   CRLSDKA+DQLR WF+DD
Sbjct  466  TKFRIPHPGRVGGRVFIDKAMPLMLSWVLGGNSSKLEGRSPSCRLSDKASDQLRTWFEDD  525

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALE A++GEW+L P     + AS+ I L RDEKT CI+GSVPH +  GTS+ + SP+VS
Sbjct  526  DALECAIDGEWYLIPC-GQDNDASQLICLNRDEKTSCIIGSVPHGDASGTSITIRSPQVS  584

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            ++HARISYKDGAF+VTDL+S++GTWI D E +RYRV PN P R HPSD +E GS +K AF
Sbjct  585  DMHARISYKDGAFYVTDLQSEYGTWIADIEEKRYRVPPNSPARLHPSDAIEIGS-QKVAF  643

Query  239  HVKVKVMKFPPFSGGKGEMEVLQAA  165
              +VKVMK  P S  K    VLQAA
Sbjct  644  --RVKVMKSSPKSAEK--EGVLQAA  664



>gb|AEN94901.1| zeaxanthin epoxidase [Cucurbita moschata]
Length=665

 Score =   252 bits (643),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 126/184 (68%), Positives = 146/184 (79%), Gaps = 1/184 (1%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            TQFRIPHPGRVGGRFFIDLAMPLML+WVLGGN  KLEGRP  CRLSDKAND+LRKWF+DD
Sbjct  467  TQFRIPHPGRVGGRFFIDLAMPLMLNWVLGGNSSKLEGRPPACRLSDKANDELRKWFEDD  526

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DAL+RA+NGEWFL P  +  S  S+PI L RDE   C +GSV      G S+ +  P+VS
Sbjct  527  DALQRAINGEWFLLPQGDEASV-SQPIRLSRDENQACFIGSVEREVESGLSIALPLPQVS  585

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            E HAR+ YKDGAFF+TDL S+HGTW++D+EGR  RV  NFP RFH SD++EFGSD+KA F
Sbjct  586  EKHARVHYKDGAFFLTDLGSEHGTWLSDHEGRWSRVPQNFPVRFHHSDVIEFGSDKKAVF  645

Query  239  HVKV  228
             VKV
Sbjct  646  RVKV  649



>ref|XP_003579861.1| PREDICTED: zeaxanthin epoxidase, chloroplastic [Brachypodium 
distachyon]
Length=667

 Score =   251 bits (642),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 125/205 (61%), Positives = 154/205 (75%), Gaps = 2/205 (1%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+ RIPHPGRVGGRFFI   MPLMLSWVLGGN  KLEGRP  CRLSDKANDQL +WF DD
Sbjct  465  TKLRIPHPGRVGGRFFIKYGMPLMLSWVLGGNSSKLEGRPLSCRLSDKANDQLGQWFQDD  524

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALE+AM GEW+L P+ +   +AS+PI L RDE+    +GS P PN   +S+ +  P++S
Sbjct  525  DALEQAMGGEWYLFPVSSGNDSASQPIRLIRDEQRTLSIGSRPDPNNSDSSLALPLPQIS  584

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            E HA I+ K+ AF++TDL S+HGTW TDNEGRR+R+ PNFP RFHPSD +EFGSD+KA F
Sbjct  585  ETHATITCKNKAFYLTDLGSEHGTWFTDNEGRRFRLPPNFPVRFHPSDAIEFGSDKKAMF  644

Query  239  HVKVKVMKFPPFSGGKGEMEVLQAA  165
              +VKV+   P+   +   +VLQAA
Sbjct  645  --RVKVLNTLPYESARSGGQVLQAA  667



>dbj|BAN15741.1| zeaxanthin epoxydase [Dianthus caryophyllus]
Length=664

 Score =   251 bits (641),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 126/184 (68%), Positives = 152/184 (83%), Gaps = 1/184 (1%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FRIPHPGRVGGR FI  AMPLMLSW+LGGN E+LEGR  QCRLS++A+ QL++WF+DD
Sbjct  464  TKFRIPHPGRVGGRVFISQAMPLMLSWILGGNSERLEGRTPQCRLSERASTQLQRWFEDD  523

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALERA++GEWFL PL+  + T SE I L R+     IVGSV H +FPGTS+V++SP+VS
Sbjct  524  DALERAISGEWFLFPLEKNSQT-SESISLNRNGDKQYIVGSVSHDDFPGTSIVLNSPKVS  582

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
              HA IS K+G FF+TDL S+HGTWITDNEGRRYR+ PNFP+RFHPSD++EFG DRK AF
Sbjct  583  VKHAVISCKNGLFFLTDLGSEHGTWITDNEGRRYRLPPNFPSRFHPSDVLEFGPDRKVAF  642

Query  239  HVKV  228
             VKV
Sbjct  643  RVKV  646



>gb|AIP98334.1| ZEP [Medicago sativa]
Length=663

 Score =   251 bits (640),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 127/202 (63%), Positives = 153/202 (76%), Gaps = 4/202 (2%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T FRIPHPGRVGGRFF+D+ MP MLSW+LGGN +KLEGRP  CRLSDKAN QLR+WF+DD
Sbjct  463  TNFRIPHPGRVGGRFFVDILMPSMLSWILGGNSDKLEGRPISCRLSDKANGQLRQWFEDD  522

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALERA+NGEWFL P    T   S+PI L ++E  PCI+GS      PG+S+ ++SP+VS
Sbjct  523  DALERAINGEWFLLPCGEETGL-SKPIRLTQNEMKPCIIGSAVQEGDPGSSITITSPKVS  581

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
              HARI YKDGAFFVTD+RS+HGTWI D EG+RYRV PN+P R HP D+++FGS+ K +F
Sbjct  582  PTHARIYYKDGAFFVTDMRSEHGTWIADIEGKRYRVPPNYPARVHPYDVLQFGSE-KVSF  640

Query  239  HVKVKVMKFPPFSGGKGEMEVL  174
             VKVK     P    K E +VL
Sbjct  641  RVKVK--SSAPSIAKKDETQVL  660



>ref|XP_008241462.1| PREDICTED: zeaxanthin epoxidase, chloroplastic [Prunus mume]
Length=661

 Score =   251 bits (640),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 135/206 (66%), Positives = 157/206 (76%), Gaps = 8/206 (4%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FRIPHPGRVGGR FID AMPLMLSWVLGGN  KLEGR   CRLSDKA+D LR WF+DD
Sbjct  463  TKFRIPHPGRVGGRVFIDKAMPLMLSWVLGGNSSKLEGRSPSCRLSDKASDLLRTWFEDD  522

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALERA++GEW+L P     + AS+ I L RDEK P I+GS PH +  G S+ +  P+VS
Sbjct  523  DALERAIDGEWYLIPC-GQDNDASQLICLNRDEKNPFIIGSAPHGDVSGISIAIPKPQVS  581

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            E+HARISYKDGAF++TDLRS+HGTWI D EG+RYRV PNFP RF PSD +E GS +K AF
Sbjct  582  EMHARISYKDGAFYLTDLRSEHGTWIADIEGKRYRVPPNFPARFRPSDAIEIGS-QKVAF  640

Query  239  HVKVKVMKFPPFSGGKGEME-VLQAA  165
              +VKVMK  P   G  E E +LQAA
Sbjct  641  --RVKVMKSSP---GSVEKEGILQAA  661



>ref|XP_007047262.1| Zeaxanthin epoxidase (ZEP) (ABA1) isoform 3 [Theobroma cacao]
 gb|EOX91419.1| Zeaxanthin epoxidase (ZEP) (ABA1) isoform 3 [Theobroma cacao]
Length=666

 Score =   251 bits (640),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 135/206 (66%), Positives = 161/206 (78%), Gaps = 5/206 (2%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGE-KLEGRPKQCRLSDKANDQLRKWFDD  603
            ++FRIPHPGRVGGRFFIDLAMPLMLSWVLGGN   KLEGR   CRLSDKA+DQLR WF+D
Sbjct  465  SKFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNSSSKLEGRSLSCRLSDKASDQLRTWFED  524

Query  602  DDALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspev  423
            +DALE+ +NGEWFL P+ N    AS+PI L RDE  P ++GS    NFPG SVVV SP+V
Sbjct  525  NDALEQTINGEWFLFPVGNEV-VASQPICLSRDENKPFMIGSEKSENFPGASVVVPSPQV  583

Query  422  sELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAA  243
            S+ HA+ISYKDGAFF+ DL+S+HGT+I D+ GRR RV PN  TR  PSD+++FGSD+KAA
Sbjct  584  SKTHAQISYKDGAFFLIDLQSEHGTYI-DHGGRRSRVPPNVSTRVRPSDVIQFGSDKKAA  642

Query  242  FHVKVKVMKFPPFSGGKGEMEVLQAA  165
            F  +VKVM+ PP    KGE  +LQA 
Sbjct  643  F--RVKVMRSPPKIALKGEGGILQAV  666



>ref|XP_009345967.1| PREDICTED: zeaxanthin epoxidase, chloroplastic isoform X1 [Pyrus 
x bretschneideri]
Length=666

 Score =   250 bits (638),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 136/207 (66%), Positives = 159/207 (77%), Gaps = 8/207 (4%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FRIPHPGRVGGR FID AMPLMLSWVLGGN  KLEGR   CRLSDKA+DQLR WF+DD
Sbjct  466  TKFRIPHPGRVGGRVFIDKAMPLMLSWVLGGNSSKLEGRSPSCRLSDKASDQLRTWFEDD  525

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVG--SVPHPNFPGTsvvvsspe  426
            DALERA++GEW+L P     + AS+ I L RDEKT CI+G  SVPH +  GTS+ + SP+
Sbjct  526  DALERAIDGEWYLIPCGQ-DNDASQLICLNRDEKTSCIIGCRSVPHGDASGTSIAIRSPQ  584

Query  425  vsELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKA  246
            VS++HARISYKDGAF+VTDL+S++GTWI D E +RYRV PN P R HPSD +E GS +K 
Sbjct  585  VSDMHARISYKDGAFYVTDLQSEYGTWIADIEEKRYRVPPNSPARLHPSDAIEIGS-QKV  643

Query  245  AFHVKVKVMKFPPFSGGKGEMEVLQAA  165
            AF  +VKVMK  P S  K    VLQAA
Sbjct  644  AF--RVKVMKSSPKSAEK--EGVLQAA  666



>ref|XP_003638746.1| Zeaxanthin epoxidase [Medicago truncatula]
Length=663

 Score =   249 bits (637),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 126/202 (62%), Positives = 153/202 (76%), Gaps = 4/202 (2%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T FRIPHPGRVGGRFF+D+ MP ML+W+LGGN +KLEGRP  CRLSDKAN QLR+WF+DD
Sbjct  463  TNFRIPHPGRVGGRFFVDILMPSMLNWILGGNSDKLEGRPISCRLSDKANGQLRQWFEDD  522

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALERA+NGEWFL P    T   S+PI L ++E  PCI+GS      PG+S+ ++SP+VS
Sbjct  523  DALERAINGEWFLLPCGEETGL-SKPIRLTQNEMKPCIIGSAVQEGDPGSSITITSPKVS  581

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
              HARI YKDGAFFVTD+RS+HGTWI D EG+RYRV PN+P R HP D+++FGS+ K +F
Sbjct  582  PTHARIYYKDGAFFVTDMRSEHGTWIADIEGKRYRVPPNYPARVHPYDVLQFGSE-KVSF  640

Query  239  HVKVKVMKFPPFSGGKGEMEVL  174
             VKVK     P    K E +VL
Sbjct  641  RVKVK--SSAPSIAKKEETQVL  660



>dbj|BAK08085.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=659

 Score =   249 bits (637),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 124/205 (60%), Positives = 154/205 (75%), Gaps = 2/205 (1%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+ RIPHPGRVGGRFFI + MPLMLSWVLGGN  KLEGRP  CRLSDKA+DQL +WF DD
Sbjct  457  TKLRIPHPGRVGGRFFIKVGMPLMLSWVLGGNSSKLEGRPLSCRLSDKASDQLGRWFQDD  516

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALE+AM GEW+L P+ +   +A +PI L RDE+    +GS P P+   +S+ +  P+VS
Sbjct  517  DALEQAMGGEWYLFPMSSGDDSALQPIRLIRDEQRTLSIGSKPDPSNSDSSLSLPLPQVS  576

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            E+HA I+ K+  F++TDL S+HGTW  DNEGRRYR+ PNFP RFHPSD +EFGSD+KA F
Sbjct  577  EIHATITCKNKGFYLTDLGSEHGTWFNDNEGRRYRLPPNFPVRFHPSDAIEFGSDKKAMF  636

Query  239  HVKVKVMKFPPFSGGKGEMEVLQAA  165
              +VKV+   P+   +G  EVLQAA
Sbjct  637  --RVKVLSALPYDSARGGGEVLQAA  659



>dbj|BAB11934.1| CpABA1 [Vigna unguiculata]
Length=612

 Score =   248 bits (634),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 123/184 (67%), Positives = 149/184 (81%), Gaps = 2/184 (1%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FRIPHPGRVGGRFF+D+ MP MLSWVLGGN  KLEGRP  CRLSDKANDQLR+WF+DD
Sbjct  412  TKFRIPHPGRVGGRFFVDIMMPSMLSWVLGGNSSKLEGRPLSCRLSDKANDQLRQWFEDD  471

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            +ALERA+NGEW L P  + TS  S+PI+L R+E  P I+GS P  + PGTSV + SP+VS
Sbjct  472  EALERAINGEWILIPHGDGTSL-SKPIVLSRNEMKPFIIGSAPAEDHPGTSVTIPSPQVS  530

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
              HARI+YKDGAFF+ DLRS+HGTWI DNEG++YRV PN+P R  PS+ ++FGS+ K +F
Sbjct  531  PRHARINYKDGAFFLIDLRSEHGTWIIDNEGKQYRVPPNYPARIRPSEAIQFGSE-KVSF  589

Query  239  HVKV  228
             VKV
Sbjct  590  RVKV  593



>gb|AAN63502.2|AF384103_1 zeaxanthin epoxidase [Triticum aestivum]
Length=363

 Score =   241 bits (615),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 122/205 (60%), Positives = 153/205 (75%), Gaps = 3/205 (1%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+ RIPHPGRVGGRFFI + MPLMLSW+LGGN  KLEGRP  CRLSDKAN+QL +WF+DD
Sbjct  162  TKLRIPHPGRVGGRFFIKVGMPLMLSWILGGNSSKLEGRPLSCRLSDKANNQLGRWFEDD  221

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
             ALE+AM GEW+L P+ +   +A +PI L RDE+    +GS P P+   +S+    P+VS
Sbjct  222  -ALEQAMGGEWYLFPMSSGGDSALQPIRLIRDEQRTLSIGSKPDPSNSDSSLSFPLPQVS  280

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            E+HA I+ K+  F++TDL S+HGTW  DNEGRRYR+ PNFP RFHPSD +EFGSD+KA F
Sbjct  281  EIHATITCKNKGFYLTDLGSEHGTWFNDNEGRRYRLPPNFPVRFHPSDAIEFGSDKKAMF  340

Query  239  HVKVKVMKFPPFSGGKGEMEVLQAA  165
              +VKV+   P+   +G  EVLQAA
Sbjct  341  --RVKVLSTLPYDSARGGGEVLQAA  363



>gb|EAY94319.1| hypothetical protein OsI_16086 [Oryza sativa Indica Group]
Length=644

 Score =   248 bits (634),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 128/205 (62%), Positives = 154/205 (75%), Gaps = 5/205 (2%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+ RIPHPGRVGGRFFI   MPLMLSWVLGGN  KLEGRP  CRLSDKANDQLR+WF+DD
Sbjct  445  TKLRIPHPGRVGGRFFIKYGMPLMLSWVLGGNSTKLEGRPLSCRLSDKANDQLRRWFEDD  504

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALE+AM GEW+L P    +S  S+PI L RDEK    +GS   P+    S+ ++ P++S
Sbjct  505  DALEQAMGGEWYLLP---TSSGDSQPIRLIRDEKKSLSIGSRSDPSNSTASLALALPQIS  561

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            E HA I+ K+ AF+VTD  S+HGTWITDNEGRRYRV PNFP RFHPSD +EFGSD+KA F
Sbjct  562  ENHATITCKNKAFYVTDNGSEHGTWITDNEGRRYRVPPNFPVRFHPSDAIEFGSDKKAVF  621

Query  239  HVKVKVMKFPPFSGGKGEMEVLQAA  165
              +VKV+   P+   +G  ++LQAA
Sbjct  622  --RVKVLSTLPYESARGGPQILQAA  644



>ref|XP_007047260.1| Zeaxanthin epoxidase (ZEP) (ABA1) isoform 1 [Theobroma cacao]
 gb|EOX91417.1| Zeaxanthin epoxidase (ZEP) (ABA1) isoform 1 [Theobroma cacao]
Length=671

 Score =   249 bits (635),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 135/211 (64%), Positives = 161/211 (76%), Gaps = 10/211 (5%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            ++FRIPHPGRVGGRFFIDLAMPLMLSWVLGGN  KLEGR   CRLSDKA+DQLR WF+D+
Sbjct  465  SKFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNSSKLEGRSLSCRLSDKASDQLRTWFEDN  524

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALE+ +NGEWFL P+ N    AS+PI L RDE  P ++GS    NFPG SVVV SP+VS
Sbjct  525  DALEQTINGEWFLFPVGNEV-VASQPICLSRDENKPFMIGSEKSENFPGASVVVPSPQVS  583

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRK---  249
            + HA+ISYKDGAFF+ DL+S+HGT+I D+ GRR RV PN  TR  PSD+++FGSD+K   
Sbjct  584  KTHAQISYKDGAFFLIDLQSEHGTYI-DHGGRRSRVPPNVSTRVRPSDVIQFGSDKKFPS  642

Query  248  ---AAFHVKVKVMKFPPFSGGKGEMEVLQAA  165
               AAF  +VKVM+ PP    KGE  +LQA 
Sbjct  643  DVQAAF--RVKVMRSPPKIALKGEGGILQAV  671



>emb|CAD40867.2| OSJNBa0064H22.16 [Oryza sativa Japonica Group]
 emb|CAH67090.1| H0818E04.7 [Oryza sativa Indica Group]
 emb|CAH67204.1| OSIGBa0152K17.16 [Oryza sativa Indica Group]
Length=652

 Score =   248 bits (634),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 128/205 (62%), Positives = 153/205 (75%), Gaps = 5/205 (2%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+ RIPHPGRVGGRFFI   MPLMLSWVLGGN  KLEGRP  CRLSDKANDQLR+WF+DD
Sbjct  453  TKLRIPHPGRVGGRFFIKYGMPLMLSWVLGGNSTKLEGRPLSCRLSDKANDQLRRWFEDD  512

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALE+AM GEW+L P    +S  S+PI L RDEK    +GS   P+    S+ +  P++S
Sbjct  513  DALEQAMGGEWYLLP---TSSGDSQPIRLIRDEKKSLSIGSRSDPSNSTASLALPLPQIS  569

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            E HA I+ K+ AF+VTD  S+HGTWITDNEGRRYRV PNFP RFHPSD +EFGSD+KA F
Sbjct  570  ENHATITCKNKAFYVTDNGSEHGTWITDNEGRRYRVPPNFPVRFHPSDAIEFGSDKKAVF  629

Query  239  HVKVKVMKFPPFSGGKGEMEVLQAA  165
              +VKV+   P+   +G  ++LQAA
Sbjct  630  --RVKVLSTLPYESARGGPQILQAA  652



>ref|NP_001052926.1| Os04g0448900 [Oryza sativa Japonica Group]
 sp|Q0JCU7.1|ZEP_ORYSJ RecName: Full=Zeaxanthin epoxidase, chloroplastic; Short=OsZEP1; 
AltName: Full=Protein ABA DEFICIENT 1; Short=OsABA1; Flags: 
Precursor [Oryza sativa Japonica Group]
 dbj|BAF14840.1| Os04g0448900 [Oryza sativa Japonica Group]
Length=659

 Score =   248 bits (634),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 128/205 (62%), Positives = 153/205 (75%), Gaps = 5/205 (2%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+ RIPHPGRVGGRFFI   MPLMLSWVLGGN  KLEGRP  CRLSDKANDQLR+WF+DD
Sbjct  460  TKLRIPHPGRVGGRFFIKYGMPLMLSWVLGGNSTKLEGRPLSCRLSDKANDQLRRWFEDD  519

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALE+AM GEW+L P    +S  S+PI L RDEK    +GS   P+    S+ +  P++S
Sbjct  520  DALEQAMGGEWYLLP---TSSGDSQPIRLIRDEKKSLSIGSRSDPSNSTASLALPLPQIS  576

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            E HA I+ K+ AF+VTD  S+HGTWITDNEGRRYRV PNFP RFHPSD +EFGSD+KA F
Sbjct  577  ENHATITCKNKAFYVTDNGSEHGTWITDNEGRRYRVPPNFPVRFHPSDAIEFGSDKKAVF  636

Query  239  HVKVKVMKFPPFSGGKGEMEVLQAA  165
              +VKV+   P+   +G  ++LQAA
Sbjct  637  --RVKVLSTLPYESARGGPQILQAA  659



>gb|EAZ30898.1| hypothetical protein OsJ_14973 [Oryza sativa Japonica Group]
Length=629

 Score =   248 bits (632),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 128/205 (62%), Positives = 153/205 (75%), Gaps = 5/205 (2%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+ RIPHPGRVGGRFFI   MPLMLSWVLGGN  KLEGRP  CRLSDKANDQLR+WF+DD
Sbjct  430  TKLRIPHPGRVGGRFFIKYGMPLMLSWVLGGNSTKLEGRPLSCRLSDKANDQLRRWFEDD  489

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALE+AM GEW+L P    +S  S+PI L RDEK    +GS   P+    S+ +  P++S
Sbjct  490  DALEQAMGGEWYLLP---TSSGDSQPIRLIRDEKKSLSIGSRSDPSNSTASLALPLPQIS  546

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            E HA I+ K+ AF+VTD  S+HGTWITDNEGRRYRV PNFP RFHPSD +EFGSD+KA F
Sbjct  547  ENHATITCKNKAFYVTDNGSEHGTWITDNEGRRYRVPPNFPVRFHPSDAIEFGSDKKAVF  606

Query  239  HVKVKVMKFPPFSGGKGEMEVLQAA  165
              +VKV+   P+   +G  ++LQAA
Sbjct  607  --RVKVLSTLPYESARGGPQILQAA  629



>dbj|BAJ93704.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=695

 Score =   248 bits (634),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 124/205 (60%), Positives = 154/205 (75%), Gaps = 2/205 (1%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+ RIPHPGRVGGRFFI + MPLMLSWVLGGN  KLEGRP  CRLSDKA+DQL +WF DD
Sbjct  493  TKLRIPHPGRVGGRFFIKVGMPLMLSWVLGGNSSKLEGRPLSCRLSDKASDQLGRWFQDD  552

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALE+AM GEW+L P+ +   +A +PI L RDE+    +GS P P+   +S+ +  P+VS
Sbjct  553  DALEQAMGGEWYLFPMSSGDDSALQPIRLIRDEQRTLSIGSKPDPSNSDSSLSLPLPQVS  612

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            E+HA I+ K+  F++TDL S+HGTW  DNEGRRYR+ PNFP RFHPSD +EFGSD+KA F
Sbjct  613  EIHATITCKNKGFYLTDLGSEHGTWFNDNEGRRYRLPPNFPVRFHPSDAIEFGSDKKAMF  672

Query  239  HVKVKVMKFPPFSGGKGEMEVLQAA  165
              +VKV+   P+   +G  EVLQAA
Sbjct  673  --RVKVLSALPYDSARGGGEVLQAA  695



>ref|XP_009112352.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like isoform X1 
[Brassica rapa]
Length=654

 Score =   248 bits (632),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 122/207 (59%), Positives = 159/207 (77%), Gaps = 6/207 (3%)
 Frame = -3

Query  776  QFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDD  597
            + RI HPG +GGRF +D+ MPLML WVLGGN EKLEGR   CRL+DKA+D+LR+WF+DD+
Sbjct  451  KLRIQHPGIIGGRFLMDMTMPLMLDWVLGGNSEKLEGRSPSCRLTDKADDRLRQWFEDDE  510

Query  596  ALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevsE  417
            ALER +NGEW+L P   +  + SE + L +DE  PCI+GS P  +  GT +++ SP+VS+
Sbjct  511  ALERTINGEWYLIP-HGSKCSVSETLCLTKDEDQPCIIGSEPDQDVSGTHIMIRSPQVSK  569

Query  416  LHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAFH  237
            +HAR+ YKDGAFF+ DLRS+HGT++TDN+GRRYRV+P FP RF PSDI+EFGSD+KAAF 
Sbjct  570  MHARVIYKDGAFFLMDLRSEHGTYVTDNQGRRYRVTPKFPARFRPSDIIEFGSDKKAAF-  628

Query  236  VKVKVMKFPPFSGGKGEM---EVLQAA  165
             KVKV++  P    K E    ++LQAA
Sbjct  629  -KVKVIRSTPNLTRKDEKSNGKLLQAA  654



>ref|XP_006494451.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Citrus sinensis]
Length=667

 Score =   248 bits (632),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 130/206 (63%), Positives = 154/206 (75%), Gaps = 2/206 (1%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+F IPHPGRV  RFFIDLAMPLML+WVLGGN  KLEGR   CRLSDKA+DQLR WF D+
Sbjct  460  TKFPIPHPGRVVRRFFIDLAMPLMLNWVLGGNSSKLEGRSPCCRLSDKASDQLRTWFRDN  519

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRR-DEKTPCIVGSVPHPNFPGTsvvvsspev  423
            DALERAMNGEW L P   + +  S+PI L R DE  P ++GS    +FP TS+V+ S +V
Sbjct  520  DALERAMNGEWLLVP-SGSETVVSQPIYLSRSDENEPYLIGSESQEDFPRTSIVIPSAQV  578

Query  422  sELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAA  243
            S++HA I YKDGAF++ DLRSKHGT+ITDNEGRRYRVSPNFP RF PS+ ++FGSD+KA 
Sbjct  579  SKMHAHIRYKDGAFYLIDLRSKHGTYITDNEGRRYRVSPNFPARFRPSNSIQFGSDKKAT  638

Query  242  FHVKVKVMKFPPFSGGKGEMEVLQAA  165
            F VKV        S  + E E+LQA 
Sbjct  639  FRVKVIRSTPKKNSEKEEEGEILQAV  664



>ref|XP_008338316.1| PREDICTED: zeaxanthin epoxidase, chloroplastic isoform X2 [Malus 
domestica]
Length=665

 Score =   248 bits (632),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 135/206 (66%), Positives = 158/206 (77%), Gaps = 7/206 (3%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FRIPHPGRVGGR FID AMPLMLSWVLGGN  KLEGR   CRLSDKA+DQLR WF+DD
Sbjct  466  TKFRIPHPGRVGGRVFIDKAMPLMLSWVLGGNSSKLEGRSPSCRLSDKASDQLRTWFEDD  525

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVG-SVPHPNFPGTsvvvsspev  423
            DALE A++GEW+L P     + AS+ I L RDEKT CI+G SVPH +  GTS+ + SP+V
Sbjct  526  DALECAIDGEWYLIPC-GQDNDASQLICLNRDEKTSCIIGRSVPHGDASGTSITIRSPQV  584

Query  422  sELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAA  243
            S++HARISYKDGAF+VTDL+S++GTWI D E +RYRV PN P R HPSD +E GS +K A
Sbjct  585  SDMHARISYKDGAFYVTDLQSEYGTWIADIEEKRYRVPPNSPARLHPSDAIEIGS-QKVA  643

Query  242  FHVKVKVMKFPPFSGGKGEMEVLQAA  165
            F  +VKVMK  P S  K    VLQAA
Sbjct  644  F--RVKVMKSSPKSAEK--EGVLQAA  665



>gb|AHI87686.1| zeaxanthin epoxidase [Lupinus luteus]
Length=689

 Score =   248 bits (632),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 129/199 (65%), Positives = 153/199 (77%), Gaps = 4/199 (2%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FRIPHPGRVGGRFF+D+ MP MLSWVLGGN  KLEGRP  CRLSDKANDQLR+WF+DD
Sbjct  488  TKFRIPHPGRVGGRFFVDMFMPSMLSWVLGGNSSKLEGRPLSCRLSDKANDQLRRWFEDD  547

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALERA +GEW L P    T   S+PI L RDE  PC++GS    +F G S+ + SP+VS
Sbjct  548  DALERANSGEWTLLPQGEETGH-SKPISLSRDEMKPCMIGSAQENDFIGNSITIPSPQVS  606

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
              HARISYKDGAFFVTDLRS+HGT I D EGR+YRV PN+P + HP+D++EFGSD KA+F
Sbjct  607  PRHARISYKDGAFFVTDLRSQHGTSIIDIEGRKYRVPPNYPAQVHPTDVIEFGSD-KASF  665

Query  239  HVKVKVMKFPPFSGGKGEM  183
              +VKV++  P    K EM
Sbjct  666  --RVKVIRSAPRVSEKEEM  682



>ref|XP_010558547.1| PREDICTED: zeaxanthin epoxidase, chloroplastic [Tarenaya hassleriana]
Length=665

 Score =   247 bits (631),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 127/207 (61%), Positives = 155/207 (75%), Gaps = 4/207 (2%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+ RIPHPG V GRFFIDLA+PLML+WVLGGN  KLEGR  +CRLSDKANDQL++WF D+
Sbjct  461  TKLRIPHPGTVCGRFFIDLAIPLMLNWVLGGNSSKLEGRLPRCRLSDKANDQLQRWFQDN  520

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALERA+ G+W L P  N      E I L RDE  PCI+GS P  +FPG  + + + +VS
Sbjct  521  DALERAIIGDWHLIPCGN-DCIVRETICLNRDEDRPCIIGSEPDKDFPGMCIAIPTSQVS  579

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            + HARI+YKDGAFFVTDLRS++GT+IT N GRR RV+PNFP RF PSD +EFGSD+KAAF
Sbjct  580  KAHARITYKDGAFFVTDLRSEYGTFITHNVGRRCRVTPNFPARFRPSDTIEFGSDKKAAF  639

Query  239  HVKVKVMKFPPFS--GGKGEMEVLQAA  165
             VKV + K P  +    +   ++LQAA
Sbjct  640  RVKV-IRKTPKVTRRDTESSSKLLQAA  665



>gb|AFW58424.1| hypothetical protein ZEAMMB73_168386 [Zea mays]
 gb|AIB05371.1| FHA transcription factor, partial [Zea mays]
Length=260

 Score =   236 bits (601),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 123/213 (58%), Positives = 152/213 (71%), Gaps = 10/213 (5%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+ RIPHPGRVGGRFFI   MP MLSWVLGGN  KLEGRP  CRLSDKA+D+L +WFDDD
Sbjct  50   TKLRIPHPGRVGGRFFIKYGMPAMLSWVLGGNSSKLEGRPLSCRLSDKAHDELYRWFDDD  109

Query  599  DALERAMNGEWFLSPLKNATSTA-SEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspev  423
            DALE+AM GEW+L     A + +  +PI L RDE+    VGS    N   +S+ +  P++
Sbjct  110  DALEQAMGGEWYLFATSEANNNSLQQPIRLIRDEQRSLSVGSRSDANDSASSLSLPFPQI  169

Query  422  sELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAA  243
            SE HA I+ K+ AF++TDL S+HGTWITDNEGRRYRV PNFP RFHPSD++EFGSD+KA 
Sbjct  170  SERHATITCKNKAFYLTDLGSEHGTWITDNEGRRYRVPPNFPVRFHPSDVIEFGSDKKAM  229

Query  242  FHVKVKVMKFPPFSGGKG-------EMEVLQAA  165
            F  +VKV+   P+   +        + +VLQAA
Sbjct  230  F--RVKVLNTLPYESARSGKQQGLQQEQVLQAA  260



>ref|XP_007155924.1| hypothetical protein PHAVU_003G243800g [Phaseolus vulgaris]
 gb|ESW27918.1| hypothetical protein PHAVU_003G243800g [Phaseolus vulgaris]
Length=667

 Score =   247 bits (630),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 123/184 (67%), Positives = 148/184 (80%), Gaps = 2/184 (1%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FRIPHPGRVGGRFF+D+ MP MLSWVLGGN  KLEGRP  CRLSDKANDQLR+WF+DD
Sbjct  467  TKFRIPHPGRVGGRFFVDIMMPSMLSWVLGGNSSKLEGRPLSCRLSDKANDQLRQWFEDD  526

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            +ALERA+NGEW L P  + TS   +PI+L R+E  P I+GS P  + PGTSV + SP+VS
Sbjct  527  EALERAINGEWILLPHGDGTSLL-KPIVLSRNEMKPFIIGSAPTQDHPGTSVTIPSPQVS  585

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
              HARI+YKDGAFF+ DLRS+HGTWI DNEG++YRV PN+P R  PSD ++FGS+ K +F
Sbjct  586  PRHARINYKDGAFFLIDLRSEHGTWIIDNEGKQYRVPPNYPARIRPSDAIQFGSE-KVSF  644

Query  239  HVKV  228
             VKV
Sbjct  645  RVKV  648



>ref|XP_008338315.1| PREDICTED: zeaxanthin epoxidase, chloroplastic isoform X1 [Malus 
domestica]
Length=667

 Score =   246 bits (629),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 135/208 (65%), Positives = 158/208 (76%), Gaps = 9/208 (4%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FRIPHPGRVGGR FID AMPLMLSWVLGGN  KLEGR   CRLSDKA+DQLR WF+DD
Sbjct  466  TKFRIPHPGRVGGRVFIDKAMPLMLSWVLGGNSSKLEGRSPSCRLSDKASDQLRTWFEDD  525

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVG---SVPHPNFPGTsvvvssp  429
            DALE A++GEW+L P     + AS+ I L RDEKT CI+G   SVPH +  GTS+ + SP
Sbjct  526  DALECAIDGEWYLIPC-GQDNDASQLICLNRDEKTSCIIGRRRSVPHGDASGTSITIRSP  584

Query  428  evsELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRK  249
            +VS++HARISYKDGAF+VTDL+S++GTWI D E +RYRV PN P R HPSD +E GS +K
Sbjct  585  QVSDMHARISYKDGAFYVTDLQSEYGTWIADIEEKRYRVPPNSPARLHPSDAIEIGS-QK  643

Query  248  AAFHVKVKVMKFPPFSGGKGEMEVLQAA  165
             AF  +VKVMK  P S  K    VLQAA
Sbjct  644  VAF--RVKVMKSSPKSAEK--EGVLQAA  667



>ref|XP_004511928.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Cicer arietinum]
Length=661

 Score =   246 bits (628),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 122/205 (60%), Positives = 152/205 (74%), Gaps = 5/205 (2%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FRIPHPGRVGG F ID  MPLML+WVLGGN  KLEGRP  CRLSDKA+DQL +WF+DD
Sbjct  461  TKFRIPHPGRVGGMFLIDKVMPLMLNWVLGGNSSKLEGRPICCRLSDKASDQLHRWFEDD  520

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPH-PNFPGTsvvvsspev  423
            DALER +NGEW L P ++      +PI L RDE  PCI+GS+    ++PG+ + +  P+V
Sbjct  521  DALERTINGEWNLLPCRDEAGFL-KPICLSRDEANPCIIGSMQQQEDYPGSLITIPLPQV  579

Query  422  sELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAA  243
            S+LHARI+YKD AFF+TD+RS+HGTWITDNEGRRYRV PN+P R  PSD++EFGS++   
Sbjct  580  SQLHARINYKDDAFFLTDMRSQHGTWITDNEGRRYRVPPNYPARVRPSDVIEFGSNQ---  636

Query  242  FHVKVKVMKFPPFSGGKGEMEVLQA  168
               +VKV +  P    K   E+LQ 
Sbjct  637  VSYRVKVTRSSPRVSKKEGTEILQV  661



>gb|EMS59958.1| Zeaxanthin epoxidase, chloroplastic [Triticum urartu]
Length=676

 Score =   246 bits (629),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 122/205 (60%), Positives = 153/205 (75%), Gaps = 2/205 (1%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+ RIPHPGRVGGRFFI + MPLMLSW+LGGN  KLEGRP  CRLSDKA++QL +WF DD
Sbjct  474  TKLRIPHPGRVGGRFFIKVGMPLMLSWILGGNSSKLEGRPLSCRLSDKASNQLGRWFQDD  533

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALE+AM GEW+L P+ +   +A +PI L RDE+    +GS P P+   +S+    P+VS
Sbjct  534  DALEQAMGGEWYLFPMSSGGDSALQPIRLIRDEQRTLSIGSKPDPSNSDSSLSFPLPQVS  593

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            E+HA I+ K+  F++TDL S+HGTW  DNEGRRYR+ PNFP RFHPSD +EFGSD+KA F
Sbjct  594  EIHATITCKNKGFYLTDLGSEHGTWFNDNEGRRYRLPPNFPVRFHPSDAIEFGSDKKAMF  653

Query  239  HVKVKVMKFPPFSGGKGEMEVLQAA  165
              +VKV+   P+   +G  EVLQAA
Sbjct  654  --RVKVLSTLPYDSARGGGEVLQAA  676



>emb|CDY18634.1| BnaA09g07610D [Brassica napus]
Length=654

 Score =   246 bits (627),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 123/207 (59%), Positives = 158/207 (76%), Gaps = 6/207 (3%)
 Frame = -3

Query  776  QFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDD  597
            + RI HPG +GGRF +D+ MPLML WVLGGN EKLEGR   CRL+DKA+D+LR+WF+DD+
Sbjct  451  KLRIQHPGIIGGRFLMDMTMPLMLDWVLGGNSEKLEGRSPNCRLTDKADDRLRQWFEDDE  510

Query  596  ALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevsE  417
            ALER + GEW+L P  N  S  SE + L +DE  PCI+GS P  +  GT +++ SP+VS+
Sbjct  511  ALERTIKGEWYLIPHGNKGSV-SETLCLTKDEDQPCIIGSEPDQDVSGTHIMIRSPQVSK  569

Query  416  LHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAFH  237
            +HAR+ YKDGAFF+ DLRS+HGT++TDN+GRRYRV+P FP RF PSDI+EFGSD+KAAF 
Sbjct  570  MHARVIYKDGAFFLMDLRSEHGTYVTDNQGRRYRVTPKFPARFRPSDIIEFGSDKKAAF-  628

Query  236  VKVKVMKFPPFSGGKGEM---EVLQAA  165
             KVKV++  P    K E    ++LQAA
Sbjct  629  -KVKVIRSTPNLTRKDEKSNGKLLQAA  654



>ref|XP_008663244.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Zea mays]
Length=296

 Score =   236 bits (601),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 123/213 (58%), Positives = 152/213 (71%), Gaps = 10/213 (5%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+ RIPHPGRVGGRFFI   MP MLSWVLGGN  KLEGRP  CRLSDKA+D+L +WFDDD
Sbjct  86   TKLRIPHPGRVGGRFFIKYGMPAMLSWVLGGNSSKLEGRPLSCRLSDKAHDELYRWFDDD  145

Query  599  DALERAMNGEWFLSPLKNATSTA-SEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspev  423
            DALE+AM GEW+L     A + +  +PI L RDE+    VGS    N   +S+ +  P++
Sbjct  146  DALEQAMGGEWYLFATSEANNNSLQQPIRLIRDEQRSLSVGSRSDANDSASSLSLPFPQI  205

Query  422  sELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAA  243
            SE HA I+ K+ AF++TDL S+HGTWITDNEGRRYRV PNFP RFHPSD++EFGSD+KA 
Sbjct  206  SERHATITCKNKAFYLTDLGSEHGTWITDNEGRRYRVPPNFPVRFHPSDVIEFGSDKKAM  265

Query  242  FHVKVKVMKFPPFSGGKG-------EMEVLQAA  165
            F  +VKV+   P+   +        + +VLQAA
Sbjct  266  F--RVKVLNTLPYESARSGKQQGLQQEQVLQAA  296



>gb|KDO79209.1| hypothetical protein CISIN_1g005770mg [Citrus sinensis]
Length=678

 Score =   245 bits (626),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 133/222 (60%), Positives = 159/222 (72%), Gaps = 20/222 (9%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNG--------------EKLEGRPKQCRLS  642
            T+FRIPHPGRVGGRFFIDLAMPLMLSWVLGGN                KLEGR   C+LS
Sbjct  460  TKFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNSIGQLVISYDHICISSKLEGRSPCCKLS  519

Query  641  DKANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTASEPILLR-RDEKTPCIVGSVPHP  465
            DKA+D LR WF DDDALERAMNGEWFL P   + +  S+PI L    E  P ++GS  H 
Sbjct  520  DKASDNLRTWFRDDDALERAMNGEWFLVP-SGSENVVSQPIYLSVSHENEPYLIGSESHE  578

Query  464  NFPGTsvvvsspevsELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFH  285
            +F  TS+V+ S +VS++HARISYKDGAF++ DL+S+HGT++TDNEGRRYRVS NFP RF 
Sbjct  579  DFSRTSIVIPSAQVSKMHARISYKDGAFYLIDLQSEHGTYVTDNEGRRYRVSSNFPARFR  638

Query  284  PSDIVEFGSDRKAAFHVKVKVMKFPPFSGG--KGEMEVLQAA  165
            PSD +EFGSD+KA F  +VKV+  PP +    K   E+LQA 
Sbjct  639  PSDTIEFGSDKKAIF--RVKVIGTPPNNNSERKEAGEILQAV  678



>gb|KHN26473.1| Zeaxanthin epoxidase, chloroplastic [Glycine soja]
Length=669

 Score =   244 bits (623),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 121/184 (66%), Positives = 149/184 (81%), Gaps = 2/184 (1%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FRIPHPGRVGGRFF+D+ MP MLSWVLGGN +KLEGRP  CRL+DKANDQLR+WF+DD
Sbjct  469  TKFRIPHPGRVGGRFFVDIMMPSMLSWVLGGNSDKLEGRPLSCRLTDKANDQLRRWFEDD  528

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            +ALERA+NGEW L P  + T   S+PI L R+E  P I+GS P  +  G+SV +SSP+VS
Sbjct  529  EALERAINGEWILLPHGDGTGL-SKPISLSRNEMKPFIIGSAPMQDNSGSSVTISSPQVS  587

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
              HARI+YKDGAFF+ DLRS+HGTWI DNEG++YRV PN+P R  PSD+++FGS+ K +F
Sbjct  588  PTHARINYKDGAFFLIDLRSEHGTWIIDNEGKQYRVPPNYPARIRPSDVIQFGSE-KVSF  646

Query  239  HVKV  228
             VKV
Sbjct  647  RVKV  650



>ref|NP_001276261.1| zeaxanthin epoxidase [Glycine max]
 gb|ADK26569.1| zeaxanthin epoxidase [Glycine max]
Length=669

 Score =   244 bits (623),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 121/184 (66%), Positives = 149/184 (81%), Gaps = 2/184 (1%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FRIPHPGRVGGRFF+D+ MP MLSWVLGGN +KLEGRP  CRL+DKANDQLR+WF+DD
Sbjct  469  TKFRIPHPGRVGGRFFVDIMMPSMLSWVLGGNSDKLEGRPLSCRLTDKANDQLRRWFEDD  528

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            +ALERA+NGEW L P  + T   S+PI L R+E  P I+GS P  +  G+SV +SSP+VS
Sbjct  529  EALERAINGEWILLPHGDGTGL-SKPISLSRNEMKPFIIGSAPMQDNSGSSVTISSPQVS  587

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
              HARI+YKDGAFF+ DLRS+HGTWI DNEG++YRV PN+P R  PSD+++FGS+ K +F
Sbjct  588  PTHARINYKDGAFFLIDLRSEHGTWIIDNEGKQYRVPPNYPARIRPSDVIQFGSE-KVSF  646

Query  239  HVKV  228
             VKV
Sbjct  647  RVKV  650



>gb|KDO79212.1| hypothetical protein CISIN_1g005770mg [Citrus sinensis]
Length=645

 Score =   243 bits (621),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 121/179 (68%), Positives = 143/179 (80%), Gaps = 2/179 (1%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FRIPHPGRVGGRFFIDLAMPLMLSWVLGGN  KLEGR   C+LSDKA+D LR WF DD
Sbjct  460  TKFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNSSKLEGRSPCCKLSDKASDNLRTWFRDD  519

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLR-RDEKTPCIVGSVPHPNFPGTsvvvsspev  423
            DALERAMNGEWFL P   + +  S+PI L    E  P ++GS  H +F  TS+V+ S +V
Sbjct  520  DALERAMNGEWFLVP-SGSENVVSQPIYLSVSHENEPYLIGSESHEDFSRTSIVIPSAQV  578

Query  422  sELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKA  246
            S++HARISYKDGAF++ DL+S+HGT++TDNEGRRYRVS NFP RF PSD +EFGSD+K 
Sbjct  579  SKMHARISYKDGAFYLIDLQSEHGTYVTDNEGRRYRVSSNFPARFRPSDTIEFGSDKKV  637



>tpg|DAA37569.1| TPA: hypothetical protein ZEAMMB73_483204 [Zea mays]
Length=570

 Score =   242 bits (617),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 127/209 (61%), Positives = 153/209 (73%), Gaps = 6/209 (3%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+ RIPHPGRVGGRFFI   MP MLSWVLGGN  KLEGR   CRLSDKANDQL +WF+DD
Sbjct  364  TKLRIPHPGRVGGRFFIKYGMPTMLSWVLGGNSSKLEGRLLSCRLSDKANDQLYQWFEDD  423

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALE AM GEW+L         + +PI L RDE+    VGS   PN   +S+ +SSP++S
Sbjct  424  DALEEAMGGEWYLIATSEGNCNSLQPIHLIRDEQRSLFVGSRSDPNDSASSLSLSSPQIS  483

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            E HA I+ K+ AF++TDL S+HGTWITDNEGRRYRV PNFP RFHPSD++EFGSD+KA F
Sbjct  484  ERHATITCKNKAFYLTDLGSEHGTWITDNEGRRYRVPPNFPVRFHPSDVIEFGSDKKAMF  543

Query  239  HVKVKVMKFPPF----SGGKGEMEVLQAA  165
              +VKV+   P+    SG + + +VLQAA
Sbjct  544  --RVKVLNTLPYESARSGNRQQQQVLQAA  570



>ref|XP_008797271.1| PREDICTED: zeaxanthin epoxidase, chloroplastic [Phoenix dactylifera]
Length=657

 Score =   243 bits (620),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 125/205 (61%), Positives = 160/205 (78%), Gaps = 6/205 (3%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FRIPHPG+VGGRFFI LAMP MLSWVLGGN  KLEGR   CRLSD+A+DQL++WF DD
Sbjct  459  TKFRIPHPGKVGGRFFIKLAMPAMLSWVLGGNSSKLEGRSLSCRLSDRASDQLQRWFKDD  518

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALERA++GEW+L P    T+ + +PI L +DEK P I+G+  H + PG SVV+ SPEV+
Sbjct  519  DALERALSGEWYLFP----TNGSLQPIHLIKDEKMPIIIGNQSHADMPGVSVVLPSPEVA  574

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            ++HA IS K+ AFF+T+++S++GTWI DNEGRRY V PNF  RFHPS+++EFGSD+KA F
Sbjct  575  DIHACISCKENAFFLTNMQSQYGTWIIDNEGRRYLVPPNFSVRFHPSNVIEFGSDKKAIF  634

Query  239  HVKVKVMKFPPFSGGKGEMEVLQAA  165
             VKV +   P    G+G  ++LQAA
Sbjct  635  RVKV-LKTLPENLTGEGR-QILQAA  657



>emb|CDX81344.1| BnaC09g07550D [Brassica napus]
Length=657

 Score =   243 bits (619),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 122/207 (59%), Positives = 157/207 (76%), Gaps = 6/207 (3%)
 Frame = -3

Query  776  QFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDD  597
            +FRI HPG +GGRF +D+ MPLML WVLGGN EKLEGR   CRL+DKA+D+LR+WF+DD+
Sbjct  454  KFRIQHPGIIGGRFLMDMTMPLMLDWVLGGNSEKLEGRSPSCRLTDKADDRLRQWFEDDE  513

Query  596  ALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevsE  417
            ALER + GEW+L P  +  S  SE + L +DE  PCI+GS    + PGT +V+ SP+VS+
Sbjct  514  ALERTIIGEWYLIPYGSKCSV-SETLCLTKDEDQPCIIGSELDQDVPGTHIVIPSPQVSK  572

Query  416  LHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAFH  237
            +HAR+ YKDGAF + DLRS+HGT++TDN+GRRYRV+PNFP RF PSDI+EFGSD+K  F 
Sbjct  573  MHARVIYKDGAFVLMDLRSQHGTYVTDNQGRRYRVTPNFPARFRPSDIIEFGSDKKVGF-  631

Query  236  VKVKVMKFPPFSGGKGEM---EVLQAA  165
             KVKV++  P    K E    ++LQAA
Sbjct  632  -KVKVIRTTPNLTRKDEKSNGKLLQAA  657



>ref|XP_011457329.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=283

 Score =   233 bits (593),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 126/205 (61%), Positives = 149/205 (73%), Gaps = 7/205 (3%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FRIPHPGRVGGR FID AMPLMLSWVLGGN  KLEGRP  CRLSDKA+DQLR WF+DD
Sbjct  86   TKFRIPHPGRVGGRIFIDKAMPLMLSWVLGGNSSKLEGRPPSCRLSDKADDQLRSWFEDD  145

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALERA++GEW+L P       AS+ I L RDEK  CI+G+    N   + + V  P+VS
Sbjct  146  DALERAIDGEWYLIPCGQENG-ASQLIRLNRDEKITCIIGNT--SNGDSSRITVPLPQVS  202

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            E HA I+YKDG F+V+DL SKHGTW+ D E +RYRV PNF  RFHPSD++E G  +K AF
Sbjct  203  ENHACITYKDGGFYVSDLGSKHGTWLADIEEKRYRVPPNFAVRFHPSDVIEIGPGQKVAF  262

Query  239  HVKVKVMKFPPFSGGKGEMEVLQAA  165
              +VKVM+  P S  K    +LQAA
Sbjct  263  --RVKVMQATPRSPEKD--GILQAA  283



>ref|XP_003611740.1| Zeaxanthin epoxidase [Medicago truncatula]
Length=350

 Score =   234 bits (598),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/208 (57%), Positives = 151/208 (73%), Gaps = 9/208 (4%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FRIPHPGRVGGRFFI  +MPLML+WVLGGN  KLEGRP  CRLSDKA+DQL  WF+DD
Sbjct  145  TKFRIPHPGRVGGRFFIQKSMPLMLNWVLGGNSSKLEGRPLCCRLSDKASDQLHTWFEDD  204

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVG-----SVPHPNFPGTsvvvs  435
            DALER +NGEW L P  +      +PI L +D+  P I+G     S+   ++PG+ + + 
Sbjct  205  DALERTINGEWILLPCGDVPGHV-KPISLNQDDTKPYIIGNTSAMSIEQEDYPGSLITIP  263

Query  434  spevsELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSD  255
             P+VS+LHARI++KDGAFF+TDLRS+HGTWITDNEGRRY VSPN+P R  PS ++EFG +
Sbjct  264  LPQVSQLHARINFKDGAFFLTDLRSQHGTWITDNEGRRYMVSPNYPARIRPSHVIEFGCN  323

Query  254  RKAAFHVKVKVMKFPPFSGGKGEMEVLQ  171
            + +    +VKV +  P    K   ++LQ
Sbjct  324  QAS---YRVKVTRSAPRVAQKEGAQILQ  348



>ref|XP_008668109.1| PREDICTED: zeaxanthin epoxidase isoform X1 [Zea mays]
Length=664

 Score =   243 bits (619),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 127/209 (61%), Positives = 153/209 (73%), Gaps = 6/209 (3%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+ RIPHPGRVGGRFFI   MP MLSWVLGGN  KLEGR   CRLSDKANDQL +WF+DD
Sbjct  458  TKLRIPHPGRVGGRFFIKYGMPTMLSWVLGGNSSKLEGRLLSCRLSDKANDQLYQWFEDD  517

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALE AM GEW+L         + +PI L RDE+    VGS   PN   +S+ +SSP++S
Sbjct  518  DALEEAMGGEWYLIATSEGNCNSLQPIHLIRDEQRSLFVGSRSDPNDSASSLSLSSPQIS  577

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            E HA I+ K+ AF++TDL S+HGTWITDNEGRRYRV PNFP RFHPSD++EFGSD+KA F
Sbjct  578  ERHATITCKNKAFYLTDLGSEHGTWITDNEGRRYRVPPNFPVRFHPSDVIEFGSDKKAMF  637

Query  239  HVKVKVMKFPPF----SGGKGEMEVLQAA  165
              +VKV+   P+    SG + + +VLQAA
Sbjct  638  --RVKVLNTLPYESARSGNRQQQQVLQAA  664



>ref|XP_004509142.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Cicer arietinum]
Length=662

 Score =   242 bits (618),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 122/202 (60%), Positives = 154/202 (76%), Gaps = 4/202 (2%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T FRIPHPGRVGGRFF+D+ MP ML+W+LGGN +KLEGRP  CRLSDKAN +LR+WF+DD
Sbjct  462  TNFRIPHPGRVGGRFFVDILMPSMLNWILGGNSDKLEGRPLSCRLSDKANGELRRWFEDD  521

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALERA+NGEWFL P  + T   S+PI L ++E   CI+GS    ++PG+S+ + SP+VS
Sbjct  522  DALERAINGEWFLLPCGDGTGL-SKPIRLTQNEMKSCIIGSELQEDYPGSSITIPSPQVS  580

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
              HARI YKDGAFFVTDLRS+HGTWI D EG++YRV PN+P R HP D++ FGS+ K +F
Sbjct  581  PKHARIYYKDGAFFVTDLRSEHGTWIVDIEGKQYRVPPNYPARVHPFDVLVFGSE-KVSF  639

Query  239  HVKVKVMKFPPFSGGKGEMEVL  174
              +VKV +  P    + E +VL
Sbjct  640  --RVKVTRSAPTISKREETQVL  659



>tpg|DAA37570.1| TPA: zeaxanthin epoxidase [Zea mays]
Length=669

 Score =   242 bits (618),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 127/209 (61%), Positives = 153/209 (73%), Gaps = 6/209 (3%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+ RIPHPGRVGGRFFI   MP MLSWVLGGN  KLEGR   CRLSDKANDQL +WF+DD
Sbjct  463  TKLRIPHPGRVGGRFFIKYGMPTMLSWVLGGNSSKLEGRLLSCRLSDKANDQLYQWFEDD  522

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALE AM GEW+L         + +PI L RDE+    VGS   PN   +S+ +SSP++S
Sbjct  523  DALEEAMGGEWYLIATSEGNCNSLQPIHLIRDEQRSLFVGSRSDPNDSASSLSLSSPQIS  582

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            E HA I+ K+ AF++TDL S+HGTWITDNEGRRYRV PNFP RFHPSD++EFGSD+KA F
Sbjct  583  ERHATITCKNKAFYLTDLGSEHGTWITDNEGRRYRVPPNFPVRFHPSDVIEFGSDKKAMF  642

Query  239  HVKVKVMKFPPF----SGGKGEMEVLQAA  165
              +VKV+   P+    SG + + +VLQAA
Sbjct  643  --RVKVLNTLPYESARSGNRQQQQVLQAA  669



>ref|NP_001151443.1| zeaxanthin epoxidase [Zea mays]
 gb|ACG42893.1| zeaxanthin epoxidase [Zea mays]
Length=669

 Score =   242 bits (617),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 127/209 (61%), Positives = 153/209 (73%), Gaps = 6/209 (3%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+ RIPHPGRVGGRFFI   MP MLSWVLGGN  KLEGR   CRLSDKANDQL +WF+DD
Sbjct  463  TKLRIPHPGRVGGRFFIKYGMPAMLSWVLGGNSSKLEGRLLSCRLSDKANDQLYQWFEDD  522

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALE AM GEW+L         + +PI L RDE+    VGS   PN   +S+ +SSP++S
Sbjct  523  DALEEAMGGEWYLIATSEGNCNSLQPIHLIRDEQRSLFVGSRSDPNDSASSLSLSSPQIS  582

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            E HA I+ K+ AF++TDL S+HGTWITDNEGRRYRV PNFP RFHPSD++EFGSD+KA F
Sbjct  583  ERHATITCKNKAFYLTDLGSEHGTWITDNEGRRYRVPPNFPVRFHPSDVIEFGSDKKAMF  642

Query  239  HVKVKVMKFPPF----SGGKGEMEVLQAA  165
              +VKV+   P+    SG + + +VLQAA
Sbjct  643  --RVKVLNTLPYESARSGNRQQQQVLQAA  669



>ref|XP_004975770.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Setaria 
italica]
Length=661

 Score =   239 bits (611),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 123/209 (59%), Positives = 154/209 (74%), Gaps = 5/209 (2%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+ RIPHPGRVGGRFFI + MP MLSWVLGGN  KLEGRP  CRLSDKANDQL +WF+DD
Sbjct  454  TKLRIPHPGRVGGRFFIMIGMPAMLSWVLGGNSSKLEGRPLSCRLSDKANDQLYRWFEDD  513

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALE+AM GEW+L P+    S + +P+ L RDE+     G+   P+   +S+ +  P++S
Sbjct  514  DALEQAMGGEWYLFPISEGNSNSLQPVRLIRDEQRAISFGNRSDPSDSASSLALPMPQIS  573

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            E HA I+ K+ AF++TDL S+HGTWITDNEGRRYRV PN+P RFHPSD++EFGSD+KA F
Sbjct  574  ERHATITCKNKAFYLTDLGSEHGTWITDNEGRRYRVPPNYPVRFHPSDVIEFGSDQKAMF  633

Query  239  HVKVKVMKFPPFSGGKGE----MEVLQAA  165
             VKV +   P  S  +G+     +VLQAA
Sbjct  634  RVKV-LNTLPYESARRGKQQQQQQVLQAA  661



>dbj|BAI79258.1| zeaxanthin epoxidase [Citrus unshiu]
Length=664

 Score =   238 bits (608),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 127/208 (61%), Positives = 154/208 (74%), Gaps = 6/208 (3%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FRIPHPGRVGGRFFIDLAMPLMLSWVLGGN  KL+   +      KA+D LR WF DD
Sbjct  460  TKFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNSSKLKVGHRVASSRTKASDNLRTWFRDD  519

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLR-RDEKTPCIVGSVPHPNFPGTsvvvsspev  423
            DALERAMNGEWFL P   + +  S+PI L    E  P ++GS  H +FP TS+V+ S +V
Sbjct  520  DALERAMNGEWFLVP-SGSENVVSQPIYLSGSHENEPYLIGSESHEDFPRTSIVIPSAQV  578

Query  422  sELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAA  243
            S++HARISYKDGAF++ DL+S+HGT++TDNEGRRYRVS NFP RF PSD +EFGSD+KA 
Sbjct  579  SKMHARISYKDGAFYLIDLQSEHGTYVTDNEGRRYRVSSNFPARFRPSDTIEFGSDKKAI  638

Query  242  FHVKVKVMKFPPFSGG--KGEMEVLQAA  165
            F  +VKV+  PP +    K   E+LQA 
Sbjct  639  F--RVKVIGTPPNNNSERKEAGEILQAV  664



>dbj|BAI79260.1| zeaxanthin epoxidase [Citrus sinensis]
Length=664

 Score =   238 bits (606),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 127/208 (61%), Positives = 153/208 (74%), Gaps = 6/208 (3%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FRIPHPGRVGGRFFIDLAMPLMLSWVLGGN  KL+   +      KA+D LR WF DD
Sbjct  460  TKFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNSSKLKVGHRVASSRTKASDNLRTWFRDD  519

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLR-RDEKTPCIVGSVPHPNFPGTsvvvsspev  423
            DALERAMNGEWFL P   + +  S+PI L    E  P ++GS  H +F  TS+V+ S +V
Sbjct  520  DALERAMNGEWFLVP-SGSENVVSQPIYLSGSHENEPYLIGSESHEDFSRTSIVIPSAQV  578

Query  422  sELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAA  243
            S++HARISYKDGAF++ DL+S+HGT++TDNEGRRYRVS NFP RF PSD +EFGSD+KA 
Sbjct  579  SKMHARISYKDGAFYLIDLQSEHGTYVTDNEGRRYRVSSNFPARFRPSDTIEFGSDKKAI  638

Query  242  FHVKVKVMKFPPFSGG--KGEMEVLQAA  165
            F  +VKVM  PP +    K   E+LQA 
Sbjct  639  F--RVKVMGTPPNNNSERKEAGEILQAV  664



>gb|AFR11774.2| zeaxanthin epoxidase [Fragaria x ananassa]
Length=660

 Score =   237 bits (604),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 127/205 (62%), Positives = 151/205 (74%), Gaps = 7/205 (3%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FRIPHPGRVGGR FID AMPLMLSWVLGGN  KLEGRP  CRLSDKA+DQLR WF+DD
Sbjct  463  TKFRIPHPGRVGGRIFIDKAMPLMLSWVLGGNSSKLEGRPPSCRLSDKADDQLRSWFEDD  522

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALERA++GEW+L P  +    AS+ I L RDEKT CI+G+    N   + + V  P+VS
Sbjct  523  DALERAIDGEWYLIPCGHENG-ASQLIRLNRDEKTTCIIGTT--SNGDSSRITVPLPQVS  579

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            E HA I+YKDG F+V+DL SKHGTW+ D E +RYRV PNF  RFHPSD++E G  +K AF
Sbjct  580  ENHACITYKDGGFYVSDLGSKHGTWLADIEEKRYRVPPNFAVRFHPSDVIEIGPGQKVAF  639

Query  239  HVKVKVMKFPPFSGGKGEMEVLQAA  165
              +VKVM+  P S  K    +LQAA
Sbjct  640  --RVKVMQATPRSPEKD--GILQAA  660



>gb|KEH27527.1| zeaxanthin epoxidase [Medicago truncatula]
Length=663

 Score =   236 bits (602),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 118/208 (57%), Positives = 151/208 (73%), Gaps = 9/208 (4%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FRIPHPGRVGGRFFI  +MPLML+WVLGGN  KLEGRP  CRLSDKA+DQL  WF+DD
Sbjct  458  TKFRIPHPGRVGGRFFIQKSMPLMLNWVLGGNSSKLEGRPLCCRLSDKASDQLHTWFEDD  517

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVG-----SVPHPNFPGTsvvvs  435
            DALER +NGEW L P  +      +PI L +D+  P I+G     S+   ++PG+ + + 
Sbjct  518  DALERTINGEWILLPCGDVPGHV-KPISLNQDDTKPYIIGNTSAMSIEQEDYPGSLITIP  576

Query  434  spevsELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSD  255
             P+VS+LHARI++KDGAFF+TDLRS+HGTWITDNEGRRY VSPN+P R  PS ++EFG +
Sbjct  577  LPQVSQLHARINFKDGAFFLTDLRSQHGTWITDNEGRRYMVSPNYPARIRPSHVIEFGCN  636

Query  254  RKAAFHVKVKVMKFPPFSGGKGEMEVLQ  171
            + +    +VKV +  P    K   ++LQ
Sbjct  637  QAS---YRVKVTRSAPRVAQKEGAQILQ  661



>ref|XP_010028251.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like isoform X3 
[Eucalyptus grandis]
 ref|XP_010028252.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like isoform X3 
[Eucalyptus grandis]
Length=487

 Score =   231 bits (589),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 117/182 (64%), Positives = 140/182 (77%), Gaps = 2/182 (1%)
 Frame = -3

Query  773  FRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDA  594
             +IPH G VG RFFI +AMPL+L+ VL GN  KLEGR   CRLSDKANDQLR+WF+DDDA
Sbjct  289  LQIPHAGTVG-RFFIAIAMPLILNCVLVGNSLKLEGRTLCCRLSDKANDQLRRWFEDDDA  347

Query  593  LERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevsEL  414
            LERAMNGEW L P    TS   +PI L RDE T CI+GS  + + PG  V +  P++S++
Sbjct  348  LERAMNGEWLLLPSGKETS-PQQPICLGRDESTGCIIGSEQNDDLPGVPVTIPLPQISKV  406

Query  413  HARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAFHV  234
            HA+ISYKDGAFFVTDLRS+HGTWIT+N   RYR +PNFP R HPSDI+EFGSD++A + V
Sbjct  407  HAQISYKDGAFFVTDLRSEHGTWITNNARHRYRATPNFPARIHPSDIIEFGSDKRATYRV  466

Query  233  KV  228
            KV
Sbjct  467  KV  468



>gb|KHG01019.1| Zeaxanthin epoxidase, chloroplastic -like protein [Gossypium 
arboreum]
Length=589

 Score =   231 bits (590),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 121/205 (59%), Positives = 156/205 (76%), Gaps = 4/205 (2%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FRIPHPGRVGGRFFI+LAMP+ML+WVLGGN   LEGR   CRLSDKA+DQLR WF+D+
Sbjct  389  TKFRIPHPGRVGGRFFINLAMPIMLNWVLGGNSSNLEGRSLSCRLSDKASDQLRTWFEDN  448

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALE+ +NGEWFL  + +  + AS+ I L RDE    ++GS  + NFPG SVV+ SP+VS
Sbjct  449  DALEQTINGEWFLLSVGD-EAAASQHICLSRDENKSFVIGSEKNENFPGKSVVIRSPQVS  507

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            + HA+I YK+GAFF+ D++S+HGT+I ++EGRR RV  N  TR  PSD++EFGSD+KAA 
Sbjct  508  KTHAQIIYKEGAFFLIDMQSEHGTYI-EHEGRRSRVPSNVATRLRPSDVIEFGSDKKAAL  566

Query  239  HVKVKVMKFPPFSGGKGEMEVLQAA  165
              +VKVM+ PP      E ++LQA 
Sbjct  567  --RVKVMRSPPKIAYNEEGQLLQAV  589



>ref|XP_010028249.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like isoform X1 
[Eucalyptus grandis]
Length=674

 Score =   233 bits (593),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 117/182 (64%), Positives = 140/182 (77%), Gaps = 2/182 (1%)
 Frame = -3

Query  773  FRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDA  594
             +IPH G VG RFFI +AMPL+L+ VL GN  KLEGR   CRLSDKANDQLR+WF+DDDA
Sbjct  476  LQIPHAGTVG-RFFIAIAMPLILNCVLVGNSLKLEGRTLCCRLSDKANDQLRRWFEDDDA  534

Query  593  LERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevsEL  414
            LERAMNGEW L P    TS   +PI L RDE T CI+GS  + + PG  V +  P++S++
Sbjct  535  LERAMNGEWLLLPSGKETS-PQQPICLGRDESTGCIIGSEQNDDLPGVPVTIPLPQISKV  593

Query  413  HARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAFHV  234
            HA+ISYKDGAFFVTDLRS+HGTWIT+N   RYR +PNFP R HPSDI+EFGSD++A + V
Sbjct  594  HAQISYKDGAFFVTDLRSEHGTWITNNARHRYRATPNFPARIHPSDIIEFGSDKRATYRV  653

Query  233  KV  228
            KV
Sbjct  654  KV  655



>dbj|BAF49058.1| zeaxanthin epoxidase [Prunus mume]
Length=492

 Score =   228 bits (580),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 131/164 (80%), Gaps = 1/164 (1%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FRIPHPGRVGGR FID AMPLMLSWVLGGN  KLEGR   CRLSDKA+D LR WF+DD
Sbjct  330  TKFRIPHPGRVGGRVFIDKAMPLMLSWVLGGNSSKLEGRSPSCRLSDKASDLLRTWFEDD  389

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALERA++GEW+L P     S AS+ I L RDEK P I+GS PH +  G S+ +  P+VS
Sbjct  390  DALERAIDGEWYLIPCGQ-DSDASQLICLNRDEKNPFIIGSAPHGDVSGISIAIPKPQVS  448

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRF  288
            E+HARISYKDGAF++TDLRS+HGTWI D EG+RYRV PNFP RF
Sbjct  449  EMHARISYKDGAFYLTDLRSEHGTWIADIEGKRYRVPPNFPARF  492



>ref|XP_010028250.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like isoform X2 
[Eucalyptus grandis]
 gb|KCW54950.1| hypothetical protein EUGRSUZ_I00923 [Eucalyptus grandis]
Length=672

 Score =   231 bits (590),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 117/180 (65%), Positives = 139/180 (77%), Gaps = 2/180 (1%)
 Frame = -3

Query  767  IPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALE  588
            IPH G VG RFFI +AMPL+L+ VL GN  KLEGR   CRLSDKANDQLR+WF+DDDALE
Sbjct  476  IPHAGTVG-RFFIAIAMPLILNCVLVGNSLKLEGRTLCCRLSDKANDQLRRWFEDDDALE  534

Query  587  RAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevsELHA  408
            RAMNGEW L P    TS   +PI L RDE T CI+GS  + + PG  V +  P++S++HA
Sbjct  535  RAMNGEWLLLPSGKETS-PQQPICLGRDESTGCIIGSEQNDDLPGVPVTIPLPQISKVHA  593

Query  407  RISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAFHVKV  228
            +ISYKDGAFFVTDLRS+HGTWIT+N   RYR +PNFP R HPSDI+EFGSD++A + VKV
Sbjct  594  QISYKDGAFFVTDLRSEHGTWITNNARHRYRATPNFPARIHPSDIIEFGSDKRATYRVKV  653



>ref|XP_009410101.1| PREDICTED: zeaxanthin epoxidase, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=664

 Score =   231 bits (589),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 116/205 (57%), Positives = 147/205 (72%), Gaps = 2/205 (1%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+F+IPHPGRVGGRF I  AMPLML+WVLGGN   L GRP  CRL+DKA+DQL++WF+DD
Sbjct  462  TKFQIPHPGRVGGRFIIQFAMPLMLNWVLGGNSSNLSGRPLSCRLTDKASDQLQRWFEDD  521

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DA+ERAM GEW+L P      +A +PI L +D   P I+G+       G S V+ SP+V+
Sbjct  522  DAMERAMGGEWYLLPAVTGNDSALKPIHLVKDMHRPLIIGNRAQTGKEGESFVIPSPQVA  581

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
              H  ISYKD AFF+TDL+S++GTWIT+NE R+YRV PNFP R HPSD++E GSD+K  F
Sbjct  582  VEHICISYKDNAFFLTDLQSQYGTWITNNERRKYRVPPNFPVRIHPSDVIELGSDKKVTF  641

Query  239  HVKVKVMKFPPFSGGKGEMEVLQAA  165
              +VKV+K  P +   G   +LQA 
Sbjct  642  --RVKVLKTVPETFPNGGQPILQAV  664



>gb|KJB43726.1| hypothetical protein B456_007G213500 [Gossypium raimondii]
Length=667

 Score =   230 bits (587),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 119/205 (58%), Positives = 157/205 (77%), Gaps = 4/205 (2%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FRIPHPGRVGGRFFI+LAMP+ML+WVLGGN   LEGR   CRLSDKA+DQL+ WF+D+
Sbjct  467  TKFRIPHPGRVGGRFFINLAMPIMLNWVLGGNSSNLEGRSLSCRLSDKASDQLQTWFEDN  526

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALE+ +NGEWFL  + N  +T S+PI L RDE    ++GS  + NFPG SVV+ SP+VS
Sbjct  527  DALEQTINGEWFLLSVGNEAAT-SQPICLSRDENKSFVIGSEKNENFPGRSVVIRSPQVS  585

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            + HA+I YK+GAFF+ D++S+HGT+I ++EGRR  +  N  TR  PSD++EFGSD+KAA 
Sbjct  586  KTHAQIIYKEGAFFLIDMQSEHGTYI-EHEGRRSWIPSNVATRLRPSDVIEFGSDKKAA-  643

Query  239  HVKVKVMKFPPFSGGKGEMEVLQAA  165
             ++VKVM+ PP      + ++LQA 
Sbjct  644  -LRVKVMRSPPKIAYNEDGQLLQAV  667



>ref|XP_002310139.1| zeaxanthin epoxidase family protein [Populus trichocarpa]
 gb|EEE90589.1| zeaxanthin epoxidase family protein [Populus trichocarpa]
Length=643

 Score =   225 bits (574),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 122/206 (59%), Positives = 147/206 (71%), Gaps = 23/206 (11%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T FRIPHPGRVGG                     KLEGR   CRLSDKANDQLR+WF DD
Sbjct  460  TNFRIPHPGRVGG-------------------SSKLEGRSLSCRLSDKANDQLRRWFVDD  500

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALER++NGEWFL P  N  + AS+PI L RDE  PC+VGSV   +FPG S+V+ +P+VS
Sbjct  501  DALERSLNGEWFLLPCGN-DAVASQPIGLSRDENKPCVVGSVSQEDFPGMSIVIPAPQVS  559

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAF  240
            + HARI+ KDGAF++ DLRS+HG++ITD EGRRYR  PNFPTRFHPSD++EFGSD+K  F
Sbjct  560  KTHARITCKDGAFYLIDLRSEHGSFITDIEGRRYRAPPNFPTRFHPSDMIEFGSDKKVIF  619

Query  239  HVKVKVMKFPP-FSGGKGEMEVLQAA  165
              +VKVM+ PP  S  K E +VLQ+ 
Sbjct  620  --RVKVMRSPPKISEKKDEGQVLQSV  643



>gb|KEH27529.1| zeaxanthin epoxidase [Medicago truncatula]
Length=699

 Score =   218 bits (555),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 118/244 (48%), Positives = 151/244 (62%), Gaps = 45/244 (18%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FRIPHPGRVGGRFFI  +MPLML+WVLGGN  KLEGRP  CRLSDKA+DQL  WF+DD
Sbjct  458  TKFRIPHPGRVGGRFFIQKSMPLMLNWVLGGNSSKLEGRPLCCRLSDKASDQLHTWFEDD  517

Query  599  DALERAMNGE------------------------------------WFLSPLKNATSTAS  528
            DALER +NGE                                    W L P  +      
Sbjct  518  DALERTINGEYVSGLILMNINLSIYISCHIYRSYYSVSFPLCLNCRWILLPCGDVPGHV-  576

Query  527  EPILLRRDEKTPCIVG-----SVPHPNFPGTsvvvsspevsELHARISYKDGAFFVTDLR  363
            +PI L +D+  P I+G     S+   ++PG+ + +  P+VS+LHARI++KDGAFF+TDLR
Sbjct  577  KPISLNQDDTKPYIIGNTSAMSIEQEDYPGSLITIPLPQVSQLHARINFKDGAFFLTDLR  636

Query  362  SKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAFHVKVKVMKFPPFSGGKGEM  183
            S+HGTWITDNEGRRY VSPN+P R  PS ++EFG ++ +    +VKV +  P    K   
Sbjct  637  SQHGTWITDNEGRRYMVSPNYPARIRPSHVIEFGCNQAS---YRVKVTRSAPRVAQKEGA  693

Query  182  EVLQ  171
            ++LQ
Sbjct  694  QILQ  697



>sp|C3VEQ2.1|ZEP_ONCHC RecName: Full=Zeaxanthin epoxidase, chloroplastic; Short=OgZEP; 
Flags: Precursor [Oncidium hybrid cultivar]
 gb|ACP27627.1| zeaxanthin epoxidase [Oncidium hybrid cultivar]
Length=661

 Score =   211 bits (536),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 105/175 (60%), Positives = 129/175 (74%), Gaps = 3/175 (2%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+++IPHPGR  GR  I  AMPLMLSWVLGGN  KLEGR   CRLSDKA+DQLRKWF+DD
Sbjct  462  TKYKIPHPGRTSGRLVIKYAMPLMLSWVLGGNSSKLEGRSLTCRLSDKASDQLRKWFEDD  521

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALERA+ GEW+L PL N      +PI L RD+K   I+GS+ H +  G S+ +  P+V 
Sbjct  522  DALERALGGEWYLFPLNNGD---IQPIRLVRDDKRFHIIGSISHDDSEGISIHLPFPQVH  578

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSD  255
            + HARI+ KD  F++TDL+S++GTWITDNEGRRY+  PN P RF  S  +EFGSD
Sbjct  579  KTHARIACKDNIFYLTDLQSQYGTWITDNEGRRYQAPPNVPVRFRSSYSIEFGSD  633



>ref|XP_006425928.1| hypothetical protein CICLE_v10027323mg [Citrus clementina]
 gb|ESR39168.1| hypothetical protein CICLE_v10027323mg [Citrus clementina]
Length=682

 Score =   206 bits (524),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 110/202 (54%), Positives = 132/202 (65%), Gaps = 28/202 (14%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDK------------  636
            T+F IPHPGRV  RFFIDLAMPLML+WVLGGN  KLEGR   CRLSDK            
Sbjct  454  TKFWIPHPGRVVRRFFIDLAMPLMLNWVLGGNSSKLEGRSPCCRLSDKVHCFVTIIFAFI  513

Query  635  ----------ANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTASEPILLRR-DEKTPC  489
                      A+DQLR W  D+DALERAMNGEW L P   + +  S+PI L R DE  P 
Sbjct  514  TLRNSEFAVEASDQLRTWLRDNDALERAMNGEWLLVP-SGSETVVSQPIYLSRSDENEPY  572

Query  488  IVGSVPHPNFPGTsvvvsspevsELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVS  309
            ++G            ++   +VS++HA I YKDGAF++ DLRS+HGT+ITDNEGRRYRVS
Sbjct  573  LIGLTE----SALINLICMSQVSKMHAHIRYKDGAFYLIDLRSEHGTYITDNEGRRYRVS  628

Query  308  PNFPTRFHPSDIVEFGSDRKAA  243
            PNFP RF PS+ ++FGSD+K  
Sbjct  629  PNFPARFRPSNSIQFGSDKKVC  650



>gb|AHE41420.1| zeaxanthin epoxidase, partial [Lycium chinense]
Length=178

 Score =   184 bits (468),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 93/134 (69%), Positives = 108/134 (81%), Gaps = 1/134 (1%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T++RIPHPGRVGGR FIDL MPLMLSWVLGGNG+KLEGR + CRLS+KANDQLRKWF+DD
Sbjct  46   TKYRIPHPGRVGGRVFIDLGMPLMLSWVLGGNGDKLEGRIQHCRLSEKANDQLRKWFEDD  105

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALERA + EW L P  N  + A +PI+L RDE   C +GSV H N PG S+VV  P+VS
Sbjct  106  DALERATDAEWLLLPAGNGNA-ALQPIVLSRDEGISCTIGSVSHTNIPGKSIVVPLPQVS  164

Query  419  ELHARISYKDGAFF  378
            ++HARIS KDGAFF
Sbjct  165  QIHARISCKDGAFF  178



>dbj|BAB39765.1| zeaxanthin epoxidase [Oryza sativa Japonica Group]
Length=626

 Score =   195 bits (495),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 102/164 (62%), Positives = 120/164 (73%), Gaps = 3/164 (2%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+ RIPHPGRVGGRFFI   MPLMLSWVLGGN  KLEGRP  CRLSDKANDQLR+WF+DD
Sbjct  460  TKLRIPHPGRVGGRFFIKYGMPLMLSWVLGGNSTKLEGRPLSCRLSDKANDQLRRWFEDD  519

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALE+AM GEW+L P    +S  S+PI L RDEK    +GS   P+    S+ +  P++S
Sbjct  520  DALEQAMGGEWYLLP---TSSGDSQPIRLIRDEKKSLSIGSRSDPSNSTASLALPLPQIS  576

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRF  288
            E HA I+ K+ AF+VTD  S+HGTWITDNEGRRYR +   P  F
Sbjct  577  ENHATITCKNKAFYVTDNGSEHGTWITDNEGRRYRRTSELPCPF  620



>ref|XP_010939416.1| PREDICTED: zeaxanthin epoxidase, chloroplastic isoform X2 [Elaeis 
guineensis]
Length=606

 Score =   189 bits (481),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 121/148 (82%), Gaps = 4/148 (3%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FRIPHPG+VGGRFFI LAMP MLSWVLGGN  KLEGR   CRLSDKA+DQL++WF+DD
Sbjct  459  TKFRIPHPGKVGGRFFIKLAMPSMLSWVLGGNSSKLEGRSLSCRLSDKASDQLKRWFNDD  518

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DA+ERA+ GEW+L P    TS + +PI L +DE+ P I+G+  H + PG SVV+ SP+V+
Sbjct  519  DAMERALTGEWYLFP----TSGSLQPIHLIKDEQIPIIIGNQSHADIPGVSVVIPSPQVA  574

Query  419  ELHARISYKDGAFFVTDLRSKHGTWITD  336
            ++HARIS KD AFF+TD++S++GTWIT+
Sbjct  575  DIHARISCKDNAFFLTDMQSQYGTWITE  602



>gb|AFA36620.1| zeaxanthin epoxidase enzyme, partial [Lolium perenne]
Length=240

 Score =   177 bits (448),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 110/143 (77%), Gaps = 0/143 (0%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T  RIPHPGRVGGRFFI + MPLMLSWVLGGN  KLEGRP  CRLSDKANDQL +WF DD
Sbjct  98   TSLRIPHPGRVGGRFFIKIGMPLMLSWVLGGNSSKLEGRPLSCRLSDKANDQLGQWFQDD  157

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALE+AM GEWFL P+ +  ++AS+PI L RDE+    +GS P P+   +S+ +  P++S
Sbjct  158  DALEQAMGGEWFLFPMSSGDNSASQPIRLIRDEQRTLSIGSRPDPSNSDSSLSLPLPQIS  217

Query  419  ELHARISYKDGAFFVTDLRSKHG  351
            E+HA I+ K+ AF++TDL S+HG
Sbjct  218  EIHATITCKNKAFYLTDLGSEHG  240



>ref|XP_001767201.1| predicted protein [Physcomitrella patens]
 gb|EDQ67882.1| predicted protein [Physcomitrella patens]
Length=668

 Score =   182 bits (463),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 95/191 (50%), Positives = 123/191 (64%), Gaps = 7/191 (4%)
 Frame = -3

Query  776  QFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDD  597
            Q +IPHPGRVGGRFFI + MP MLSW+LGGN   LEGR   C L DKA+  L+KWF +DD
Sbjct  458  QLKIPHPGRVGGRFFITIGMPTMLSWILGGNSFALEGRAPYCSLEDKADSNLKKWFWNDD  517

Query  596  ALERAMNGEWFLS------PLKNATSTASEPIL-LRRDEKTPCIVGSVPHPNFPGTsvvv  438
            ALERA N +W+L       P+    + +  P+L L R++  P IVG        G    V
Sbjct  518  ALERATNADWYLVPASERMPIDGDVTESGRPLLRLCREDSKPTIVGCESCEIELGEFRAV  577

Query  437  sspevsELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGS  258
            + PEV+  HA++ +KDGA FVTDL SK GTWIT   G R +++P  PTR HP DI+EFG 
Sbjct  578  TEPEVAPQHAKLVFKDGALFVTDLDSKTGTWITSISGGRCKLTPKMPTRVHPEDIIEFGP  637

Query  257  DRKAAFHVKVK  225
             ++A + VK++
Sbjct  638  AKEAQYKVKLR  648



>ref|XP_004975774.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Setaria 
italica]
Length=635

 Score =   180 bits (457),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 96/185 (52%), Positives = 125/185 (68%), Gaps = 1/185 (1%)
 Frame = -3

Query  740  RFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDDALERAMNGEWFL  561
            +F I   + +MLSWVL GN  KLEG+P  CRLSDKANDQL +W +DDDALE AM GEW+L
Sbjct  441  KFSIKYGVDMMLSWVLSGNSSKLEGKPLSCRLSDKANDQLYRWLEDDDALEEAMCGEWYL  500

Query  560  SPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevsELHARISYKDGAF  381
             P     +T+ +P+ L R+E+    VGS       G+S+ +S P++S+ HA I+ K+ AF
Sbjct  501  FPASGGNNTSLQPVRLFRNEQWSLSVGSQSDHCDYGSSLSLSLPQISQRHATITCKNKAF  560

Query  380  FVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAFHVKVKVMKFPPFS  201
            +VTDL S+HGTWITDN GR  RV P  P  FHPSD++EFG D+KA F +KV +   P  S
Sbjct  561  YVTDLGSEHGTWITDNVGRLSRVPPYLPVHFHPSDVIEFGYDKKAMFRLKV-LNTLPYES  619

Query  200  GGKGE  186
              KG+
Sbjct  620  ARKGK  624



>ref|XP_002972237.1| zeaxanthin epoxidase [Selaginella moellendorffii]
 gb|EFJ26323.1| zeaxanthin epoxidase [Selaginella moellendorffii]
Length=679

 Score =   168 bits (426),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 89/200 (45%), Positives = 123/200 (62%), Gaps = 5/200 (3%)
 Frame = -3

Query  776  QFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDD  597
            + RIPHPGRV GRFF+++AMP+MLSWVLGGN   LEGR   CRL+DKA+D+L +W  +DD
Sbjct  470  KLRIPHPGRVFGRFFVNIAMPMMLSWVLGGNSAALEGRTPSCRLTDKASDKLPEWLRNDD  529

Query  596  ALERAMNGEWFLSPLK-----NATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvss  432
            ALERA + EW+L P           TAS   L R ++    I+G     N  G   V+ S
Sbjct  530  ALERATSAEWYLVPDGEQMPFQGDITASGKKLFRLEQGLSNIIGRRMPANKEGNVFVIDS  589

Query  431  pevsELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDR  252
             +V++ HA I++ +GA F+TD  S  GTWIT+  G RY+   + P R H  +++EFG  +
Sbjct  590  SQVADKHAEITFVNGAVFLTDFGSGKGTWITNVNGGRYKAPHHVPVRLHAGELLEFGEGK  649

Query  251  KAAFHVKVKVMKFPPFSGGK  192
            +AAF +K +    P  +  K
Sbjct  650  EAAFGIKQRKESMPSVARSK  669



>ref|XP_002984150.1| hypothetical protein SELMODRAFT_234460 [Selaginella moellendorffii]
 gb|EFJ14660.1| hypothetical protein SELMODRAFT_234460 [Selaginella moellendorffii]
Length=679

 Score =   168 bits (425),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 89/200 (45%), Positives = 123/200 (62%), Gaps = 5/200 (3%)
 Frame = -3

Query  776  QFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDDD  597
            + RIPHPGRV GRFF+++AMP+MLSWVLGGN   LEGR   CRL+DKA+D+L +W  +DD
Sbjct  470  KLRIPHPGRVFGRFFVNIAMPVMLSWVLGGNSAALEGRTPSCRLTDKASDKLPEWLRNDD  529

Query  596  ALERAMNGEWFLSPLK-----NATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvss  432
            ALERA + EW+L P           TAS   L R ++    I+G     N  G   V+ S
Sbjct  530  ALERATSAEWYLVPDGEQMPFQGDITASGKKLFRLEQGLSNIIGRRMPANKEGNVFVIDS  589

Query  431  pevsELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDR  252
             +V++ HA I++ +GA F+TD  S  GTWIT+  G RY+   + P R H  +++EFG  +
Sbjct  590  SQVADKHAEITFVNGAVFLTDFGSGKGTWITNVNGGRYKAPHHVPVRLHAGELLEFGEGK  649

Query  251  KAAFHVKVKVMKFPPFSGGK  192
            +AAF +K +    P  +  K
Sbjct  650  EAAFGIKQRKESMPSVARSK  669



>gb|EPS62910.1| zeaxanthin epoxidase, chloroplastic, partial [Genlisea aurea]
Length=514

 Score =   165 bits (418),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/112 (68%), Positives = 88/112 (79%), Gaps = 2/112 (2%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            TQFRIPHPGRVGGR FID+AMPLMLSWVLGGNG  LEGR  QCRLSDKA+DQLR WF DD
Sbjct  394  TQFRIPHPGRVGGRLFIDIAMPLMLSWVLGGNGSNLEGRALQCRLSDKADDQLRTWFTDD  453

Query  599  DALERAMNGEWFLSPLKNATSTAS--EPILLRRDEKTPCIVGSVPHPNFPGT  450
            DALERA++ +WF+ P  + T++ +  E I L RD K P ++GSV H NFPG 
Sbjct  454  DALERALDADWFMLPNGDRTTSGAEMETIFLSRDAKKPYLIGSVAHSNFPGV  505



>ref|NP_201504.2| zeaxanthin epoxidase [Arabidopsis thaliana]
 gb|AED98293.1| zeaxanthin epoxidase (ZEP) (ABA1) [Arabidopsis thaliana]
Length=610

 Score =   157 bits (398),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 95/124 (77%), Gaps = 1/124 (1%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FR+PHPGRVGGRFF+D+AMP ML WVLGGN EKL+GRP  CRL+DKA+D+LR+WF+DD
Sbjct  463  TKFRVPHPGRVGGRFFVDIAMPSMLDWVLGGNSEKLQGRPPSCRLTDKADDRLREWFEDD  522

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGTsvvvsspevs  420
            DALER + GEW+L P        SE + L +DE  PCIVGS P  +FPG  +V+ S +V 
Sbjct  523  DALERTIKGEWYLIP-HGDDCCVSETLCLTKDEDQPCIVGSEPDQDFPGMRIVIPSSQVY  581

Query  419  ELHA  408
            +L+A
Sbjct  582  KLYA  585



>ref|XP_006842967.1| hypothetical protein AMTR_s00076p00039590, partial [Amborella 
trichopoda]
 gb|ERN04642.1| hypothetical protein AMTR_s00076p00039590, partial [Amborella 
trichopoda]
Length=550

 Score =   151 bits (382),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 80/106 (75%), Gaps = 0/106 (0%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FRIPHPGRVGGRF   L MPLML+WVLGGN  KLEGR   CR+SDKA+D+L++WF DD
Sbjct  433  TKFRIPHPGRVGGRFVFKLVMPLMLNWVLGGNSSKLEGRSLSCRISDKASDELKRWFQDD  492

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPN  462
            DALERA++GEWFL P  N      EPI L +DE  PCI+G+  H +
Sbjct  493  DALERALSGEWFLLPANNEGKDVMEPIHLSKDEHKPCIIGNNSHAS  538



>gb|KHN36228.1| Zeaxanthin epoxidase, chloroplastic [Glycine soja]
Length=426

 Score =   146 bits (368),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 92/129 (71%), Gaps = 16/129 (12%)
 Frame = -3

Query  638  KANDQLRKWFDDDDALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNF  459
            +AN QL +WF+ ++ALERA+NGEW L P  +   T ++PI L +DE  PC +G +     
Sbjct  296  EANGQLHRWFEANNALERAINGEWILLPCGDEAGT-TKPICLSQDEIKPCTIGFLK----  350

Query  458  PGTsvvvsspevsELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPS  279
                       VS++HARI+YKDGAFF+TDLRS+HGTWITDNEGRRY+V PN+P R  PS
Sbjct  351  -----------VSQIHARINYKDGAFFLTDLRSQHGTWITDNEGRRYKVPPNYPARVRPS  399

Query  278  DIVEFGSDR  252
            D++EFGSD+
Sbjct  400  DVIEFGSDK  408



>ref|XP_010939417.1| PREDICTED: zeaxanthin epoxidase, chloroplastic isoform X3 [Elaeis 
guineensis]
Length=554

 Score =   145 bits (365),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 81/100 (81%), Gaps = 4/100 (4%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FRIPHPG+VGGRFFI LAMP MLSWVLGGN  KLEGR   CRLSDKA+DQL++WF+DD
Sbjct  459  TKFRIPHPGKVGGRFFIKLAMPSMLSWVLGGNSSKLEGRSLSCRLSDKASDQLKRWFNDD  518

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVG  480
            DA+ERA+ GEW+L P    TS + +PI L +DE+ P I+G
Sbjct  519  DAMERALTGEWYLFP----TSGSLQPIHLIKDEQIPIIIG  554



>ref|XP_009112353.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like isoform X2 
[Brassica rapa]
Length=590

 Score =   144 bits (363),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 81/110 (74%), Gaps = 1/110 (1%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
             + RI HPG +GGRF +D+ MPLML WVLGGN EKLEGR   CRL+DKA+D+LR+WF+DD
Sbjct  450  AKLRIQHPGIIGGRFLMDMTMPLMLDWVLGGNSEKLEGRSPSCRLTDKADDRLRQWFEDD  509

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGSVPHPNFPGT  450
            +ALER +NGEW+L P   +  + SE + L +DE  PCI+GS P  +  GT
Sbjct  510  EALERTINGEWYLIP-HGSKCSVSETLCLTKDEDQPCIIGSEPDQDVSGT  558



>gb|KCW54949.1| hypothetical protein EUGRSUZ_I00922 [Eucalyptus grandis]
Length=586

 Score =   141 bits (356),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FRIPHPGRVGGRFFID+AMPLML+WVLGGN  KLEGRP  CRLSDKANDQLR+WF+DD
Sbjct  466  TKFRIPHPGRVGGRFFIDIAMPLMLNWVLGGNSSKLEGRPPSCRLSDKANDQLRRWFEDD  525

Query  599  DALERAMNGEWFLSP  555
            DALERAMNGE+   P
Sbjct  526  DALERAMNGEYVFEP  540



>gb|KEH27528.1| zeaxanthin epoxidase [Medicago truncatula]
Length=561

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 77/101 (76%), Gaps = 1/101 (1%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FRIPHPGRVGGRFFI  +MPLML+WVLGGN  KLEGRP  CRLSDKA+DQL  WF+DD
Sbjct  458  TKFRIPHPGRVGGRFFIQKSMPLMLNWVLGGNSSKLEGRPLCCRLSDKASDQLHTWFEDD  517

Query  599  DALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCIVGS  477
            DALER +NGEW L P  +      +PI L +D+  P I+G+
Sbjct  518  DALERTINGEWILLPCGDVPGHV-KPISLNQDDTKPYIIGN  557



>gb|EPS69457.1| zeaxanthin epoxidase, chloroplastic, partial [Genlisea aurea]
Length=84

 Score =   120 bits (300),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 63/74 (85%), Gaps = 2/74 (3%)
 Frame = -3

Query  416  LHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAFH  237
            +HARISYKDGAFF+TDLRS+HGTW+TDNEG+RYRVSPNFPTRF P+D +EFGSDRK  F 
Sbjct  4    IHARISYKDGAFFITDLRSEHGTWLTDNEGKRYRVSPNFPTRFRPTDAIEFGSDRKVCF-  62

Query  236  VKVKVMKFPPFSGG  195
             +VK MK PP   G
Sbjct  63   -RVKTMKLPPRKNG  75



>gb|AET07431.1| zeaxanthin epoxidase, partial [Ipomoea batatas]
Length=63

 Score =   113 bits (283),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/66 (85%), Positives = 62/66 (94%), Gaps = 3/66 (5%)
 Frame = -3

Query  362  SKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAFHVKVKVMKFPPFSGGKGEM  183
            SKHGTWITDNEGRRYR+SPNFPTRFHPSDI+EFGSDRKAAF  +VKVM+FPPFS G+ EM
Sbjct  1    SKHGTWITDNEGRRYRLSPNFPTRFHPSDIIEFGSDRKAAF--RVKVMRFPPFS-GEEEM  57

Query  182  EVLQAA  165
            +VLQAA
Sbjct  58   KVLQAA  63



>ref|XP_008358098.1| PREDICTED: LOW QUALITY PROTEIN: zeaxanthin epoxidase, chloroplastic-like 
[Malus domestica]
Length=584

 Score =   119 bits (297),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 60/72 (83%), Gaps = 0/72 (0%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+F IPHPGRVGGR FID A+PLMLSWV GGN  KLEGR   CRL DKA+DQL+ WF+DD
Sbjct  502  TKFLIPHPGRVGGRVFIDKAIPLMLSWVSGGNSSKLEGRSHSCRLLDKASDQLQTWFEDD  561

Query  599  DALERAMNGEWF  564
            DALE A++GEWF
Sbjct  562  DALEHAVDGEWF  573



>ref|XP_010939418.1| PREDICTED: zeaxanthin epoxidase, chloroplastic isoform X4 [Elaeis 
guineensis]
Length=541

 Score =   118 bits (295),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T+FRIPHPG+VGGRFFI LAMP MLSWVLGGN  KLEGR   CRLSDKA+DQL++WF+DD
Sbjct  459  TKFRIPHPGKVGGRFFIKLAMPSMLSWVLGGNSSKLEGRSLSCRLSDKASDQLKRWFNDD  518

Query  599  DALERAMN  576
            DA+ERA+ 
Sbjct  519  DAMERALT  526



>gb|AGT01911.1| putative zeaxanthin epoxidase, partial [Vaccinium myrtillus]
Length=69

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 55/70 (79%), Gaps = 3/70 (4%)
 Frame = -3

Query  371  DLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAFHVKVKVMKFPPFSGGK  192
            DLRS+HGTWI+DNEG+RYRV PNFP RFHPSD++EFGSDRK AF  +VKVMK P     +
Sbjct  1    DLRSEHGTWISDNEGKRYRVPPNFPARFHPSDVIEFGSDRKVAF--RVKVMKDPRKIAEQ  58

Query  191  GEME-VLQAA  165
             E+  +LQA 
Sbjct  59   KELTGILQAV  68



>gb|AGS79171.1| zeaxanthin epoxidase, partial [Fagopyrum tataricum]
Length=149

 Score = 93.2 bits (230),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDD  603
             + RIPHPG VG RF ID  MPLMLSWVLGGN   LEGR   CRLSDKANDQL +WF+D
Sbjct  91   MKLRIPHPGIVGARFVIDRVMPLMLSWVLGGNSSNLEGRSLCCRLSDKANDQLGRWFED  149



>gb|ACL27574.1| zeaxanthin epoxidase [Cucumis melo]
Length=202

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDK  636
            TQFRIPHPG  GGRFFIDLAMPLML+WVLGGN  KLEGRP  CRLSDK
Sbjct  155  TQFRIPHPGTFGGRFFIDLAMPLMLNWVLGGNSSKLEGRPPACRLSDK  202



>gb|EYU39329.1| hypothetical protein MIMGU_mgv1a005544mg [Erythranthe guttata]
Length=473

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKANDQLRKWFDDD  600
            T++RIPHPGR+ G   +++AMP MLSWVLGGN  KLEGR   CR+SDKA+DQL     DD
Sbjct  401  TKYRIPHPGRIAGGIMLEIAMPSMLSWVLGGNRSKLEGRAPHCRISDKASDQLLTCIRDD  460

Query  599  DALERAM  579
             AL RA+
Sbjct  461  YALGRAV  467



>gb|ADJ55721.1| zeaxanthin epoxidase, partial [Ensete ventricosum]
Length=88

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDK  636
            T+FRIPHPGRVGGRF I   MPLML+WVLGGN  KL GRP  CRL+DK
Sbjct  41   TKFRIPHPGRVGGRFLIQFTMPLMLNWVLGGNSSKLSGRPLSCRLTDK  88



>gb|ADJ55718.1| zeaxanthin epoxidase, partial [Musa beccarii]
 gb|ADJ55719.1| zeaxanthin epoxidase, partial [Musa coccinea]
Length=88

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDK  636
            T+FRIPHPGRVGGRF I  AMPLML+WVLGGN   L GRP  CRL+DK
Sbjct  41   TKFRIPHPGRVGGRFVIQFAMPLMLNWVLGGNSSNLSGRPLSCRLTDK  88



>gb|AES94698.2| zeaxanthin epoxidase [Medicago truncatula]
Length=507

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/49 (80%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDKA  633
            T+FRIPHPGRVGGRFFI  +MPLML+WVLGGN  KLEGRP  CRLSDK 
Sbjct  458  TKFRIPHPGRVGGRFFIQKSMPLMLNWVLGGNSSKLEGRPLCCRLSDKV  506



>gb|ADJ55709.1| zeaxanthin epoxidase, partial [Musa acuminata]
 gb|ADJ55710.1| zeaxanthin epoxidase, partial [Musa acuminata var. zebrina]
Length=88

 Score = 81.3 bits (199),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDK  636
            T+F+IPHPGRVGGRF I  AMPLML+WVLGGN   L GRP  CRL+DK
Sbjct  41   TKFQIPHPGRVGGRFIIQFAMPLMLNWVLGGNSSNLSGRPLSCRLTDK  88



>gb|ADJ55713.1| zeaxanthin epoxidase, partial [Musa ornata]
Length=88

 Score = 81.3 bits (199),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDK  636
            T+F+IPHPGRVGGRF I  AMPLML+WVLGGN   L GRP  CRL+DK
Sbjct  41   TKFQIPHPGRVGGRFIIQFAMPLMLNWVLGGNSSNLSGRPLSCRLTDK  88



>gb|ADJ55711.1| zeaxanthin epoxidase, partial [Musa balbisiana]
 gb|ADJ55712.1| zeaxanthin epoxidase, partial [Musa balbisiana]
 gb|ADJ55714.1| zeaxanthin epoxidase, partial [Musa mannii]
Length=88

 Score = 81.3 bits (199),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDK  636
            T+F+IPHPGRVGGRF I  AMPLML+WVLGGN   L GRP  CRL+DK
Sbjct  41   TKFQIPHPGRVGGRFIIQFAMPLMLNWVLGGNSSNLSGRPLSCRLTDK  88



>gb|ADJ55720.1| zeaxanthin epoxidase, partial [Musella lasiocarpa]
Length=88

 Score = 81.3 bits (199),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDK  636
            T+FRIPHPGRVGGRF I   MPLML+WVLGGN   L GRP  CRL+DK
Sbjct  41   TKFRIPHPGRVGGRFLIQFTMPLMLNWVLGGNSSNLSGRPLSCRLTDK  88



>ref|XP_011399382.1| Zeaxanthin epoxidase, chloroplastic [Auxenochlorella protothecoides]
 gb|KFM26450.1| Zeaxanthin epoxidase, chloroplastic [Auxenochlorella protothecoides]
Length=617

 Score = 87.0 bits (214),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 63/203 (31%), Positives = 93/203 (46%), Gaps = 23/203 (11%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEG--RPKQCRLSDKAN----DQLR  618
            T +RIPHPGRV G+  +  +MP +L WVLGGNG  L    R  +C L D+ +     Q  
Sbjct  396  TAWRIPHPGRVMGQVVMKASMPAVLGWVLGGNGSSLASAERVPRCMLRDRPSGFEPGQFD  455

Query  617  KWFDDDDALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPCI-----------VGSVP  471
                DD AL RA    W L+P+    + A + +    +                 +G+  
Sbjct  456  TLLRDDAALLRAAKAHWVLAPMAGTGAGAGKGVSCAGNGAGSGAGSGAAGQPWTRLGADG  515

Query  470  HPNFPGTsvvvsspevsELHARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTR  291
                 G    V  P  +  HA +   +G + VTDL S  GT++ D      R+ PN P R
Sbjct  516  LVMGSGGDAGVRDPAAALRHAWVQSHEGDYLVTDLGSGQGTFLNDR-----RLVPNVPVR  570

Query  290  FHPSDIVEFGSDRKA-AFHVKVK  225
              P D++  G+ + + AF VK++
Sbjct  571  LQPGDLIRLGAAKDSPAFRVKLQ  593



>ref|XP_005844735.1| hypothetical protein CHLNCDRAFT_138731 [Chlorella variabilis]
 gb|EFN52633.1| hypothetical protein CHLNCDRAFT_138731 [Chlorella variabilis]
Length=705

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 66/195 (34%), Positives = 100/195 (51%), Gaps = 16/195 (8%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKL--EGRPKQCRLSDK----ANDQLR  618
            T+F+IPHPGRV G+  +   MP  +S VLGG  + L    R   C L+D+          
Sbjct  484  TKFKIPHPGRVVGQVIMKATMPGTMSRVLGGYRKSLAQSDRVPVCHLADQPRGFPESLFP  543

Query  617  KWFDDDDALERAMNGEWFLSPLKNATSTASEPILLRRD---EKTPCIV-GSVPHPNFPGT  450
             + +DDDAL RA +  W L+P+ + +S + E + L  +    ++P I    V      G 
Sbjct  544  LYMEDDDALLRASHAYWVLTPVTDGSSASPEALHLEFEAAKHQSPVISREGVTVGTGAGC  603

Query  449  svvvsspevsELHARI-SYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDI  273
             +V+++P VSE HAR+   + G + VTDL S+ GTW+        R+    P R  P D+
Sbjct  604  DMVLTAPTVSEQHARLHQCEAGDYHVTDLDSQLGTWVNSR-----RLPARVPQRLRPDDV  658

Query  272  VEFGSDRKAAFHVKV  228
            V FG+  + +   KV
Sbjct  659  VSFGAPGQGSLDFKV  673



>gb|ADJ55715.1| zeaxanthin epoxidase, partial [Musa troglodytarum]
 gb|ADJ55716.1| zeaxanthin epoxidase, partial [Musa textilis]
 gb|ADJ55717.1| zeaxanthin epoxidase, partial [Musa maclayi]
Length=88

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDK  636
            T+FRIPHPGRVGGRF I  AMPLML+WVLGGN   L GR   CRL+DK
Sbjct  41   TKFRIPHPGRVGGRFVIQFAMPLMLNWVLGGNSSNLSGRLLSCRLTDK  88



>ref|XP_005646300.1| FAD/NAD(P)-binding domain-containing protein [Coccomyxa subellipsoidea 
C-169]
 gb|EIE21756.1| FAD/NAD(P)-binding domain-containing protein [Coccomyxa subellipsoidea 
C-169]
Length=626

 Score = 81.3 bits (199),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 66/210 (31%), Positives = 96/210 (46%), Gaps = 29/210 (14%)
 Frame = -3

Query  776  QFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEG--RPKQCRLSDKA----NDQLRK  615
            Q +IPHPGRVGG F +++ MP ML WVLGGN   L G  R   CR++DK          K
Sbjct  391  QLKIPHPGRVGGYFAMNMMMPSMLGWVLGGNTSALRGADRAPHCRVNDKPKAFHEQDFWK  450

Query  614  WFDDDDALERAMNGEWFLSPLKNATSTA---SEPILLRRDEKTPCIVGSVPHPNF-----  459
            +  DD AL RA   +W L P  +  + A   S+ I    + +       + +P       
Sbjct  451  FLSDDMALLRAARAKWTLVPAASVATAAQAHSDSIDAAENGERHQFGLRIAYPEAALEIC  510

Query  458  -PGTsvvvsspevsEL--------HARI-SYKDGAFFVTDLRSKHGTWITDNEGRRYRVS  309
              G  +   +    +L        HAR+ + + G + V DL S  GTW+    GR  R+ 
Sbjct  511  TAGVLIGSGADADVKLDSPVVAEAHARLRNSEAGGYTVEDLASPSGTWLN---GR--RLQ  565

Query  308  PNFPTRFHPSDIVEFGSDRKAAFHVKVKVM  219
            P  P +  P D + FG     A   ++K++
Sbjct  566  PRQPAQLCPGDELCFGCRETEAVRYRIKMV  595



>gb|EYU39330.1| hypothetical protein MIMGU_mgv1a005544mg [Erythranthe guttata]
Length=479

 Score = 74.7 bits (182),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEGRPKQCRLSDK  636
            T++RIPHPGR+ G   +++AMP MLSWVLGGN  KLEGR   CR+SDK
Sbjct  425  TKYRIPHPGRIAGGIMLEIAMPSMLSWVLGGNRSKLEGRAPHCRISDK  472



>gb|AAO48941.1| zeaxanthin epoxidase precursor [Chlamydomonas sp. W80]
Length=727

 Score = 69.3 bits (168),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 64/219 (29%), Positives = 98/219 (45%), Gaps = 45/219 (21%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLE-GRPKQCRLSDK----ANDQLRK  615
            T+ +I HPGRV GR  ++L MP +L WVLGGN E L+  R   CR++D+       Q   
Sbjct  487  TKLKIHHPGRVVGRLVMNLTMPQVLGWVLGGNTENLDKSRVGHCRIADQPKAFHESQFSY  546

Query  614  WFDDDDALERAMNGEWFL-----------------SPLKNATSTASEPILLRRDEKTPCI  486
              ++D+A+ ++ + +W L                     +ATST+    +   DE  P I
Sbjct  547  LMENDEAIIQSSHADWMLMTSREAGSGSSDSNARVDATADATSTSECKGIYIGDE--PSI  604

Query  485  VG--------SVPHPNFPGTsvvvsspevsELHAR--ISYKDGAFFVTDLRSKHGTWITD  336
            +G        S+           V   E S +  R  ++Y+   + V DL S  GTW+  
Sbjct  605  IGRKSESADLSINDGQVAPQHARVWRTETSSVSGRDVVAYE---YHVQDLGSDAGTWLNG  661

Query  335  NEGRRYRVSPNFPT-RFHPSDIVEFG-SDRKAAFHVKVK  225
                  R  P   T + H  D++EFG S  K  + VK++
Sbjct  662  ------RPMPRGGTCQLHAGDVLEFGQSPSKEVYRVKMQ  694



>gb|AGK25933.1| zeaxanthin epoxidase, partial [Eriobotrya japonica]
Length=351

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGN  684
            T+FRIPHPGRVGGR FID AMPLMLSWVLGGN
Sbjct  320  TKFRIPHPGRVGGRVFIDKAMPLMLSWVLGGN  351



>gb|AAL91193.1| zeaxanthin epoxidase precursor [Arabidopsis thaliana]
 gb|AAO00920.1| zeaxanthin epoxidase precursor [Arabidopsis thaliana]
Length=503

 Score = 65.5 bits (158),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGGN  684
            T+FR+PHPGRVGGRFF+D+AMP ML WVLGGN
Sbjct  463  TKFRVPHPGRVGGRFFVDIAMPSMLDWVLGGN  494



>gb|KIZ01704.1| zeaxanthin epoxidase [Monoraphidium neglectum]
Length=330

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 55/194 (28%), Positives = 86/194 (44%), Gaps = 28/194 (14%)
 Frame = -3

Query  776  QFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLEG--RPKQCRLSDK----ANDQLRK  615
            ++++PHPGRV G+  +   MP +L+WVLGGN   L G  RP  CR++D     +  +   
Sbjct  87   RWKLPHPGRVTGQVALLATMPAVLAWVLGGNIGALVGAERPGACRITDGLKFFSEKEFEL  146

Query  614  WFDDDDALERAMNGEWFL---------SPLKNATSTASEPILLRRDEKTPCIVGSVPHPN  462
            +  D+DAL RA +  W L         S     + + ++ I L  D +      +     
Sbjct  147  FMRDNDALLRATHARWMLLAERVPAEGSGADATSCSEAKGIYLTADNEAVISGAAAADSA  206

Query  461  FPGTsvvvs---spevsELHARISYKDGA----FFVTDLRSKHGTWITDNEGRRYRVSPN  303
                  ++    +   S  HAR +++DG     F      +  GTW+    GR  R+   
Sbjct  207  DAAAGSLLLVDDAAVSSARHAR-AWRDGPAGDHFLQHLAGAGEGTWVN---GR--RLGDG  260

Query  302  FPTRFHPSDIVEFG  261
               R  P D+VEFG
Sbjct  261  ETVRLLPGDLVEFG  274



>emb|CCI79384.1| zeaxanthin epoxidase [Chromochloris zofingiensis]
 emb|CCI79385.1| zeaxanthin epoxidase [Chromochloris zofingiensis]
Length=596

 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 34/48 (71%), Gaps = 1/48 (2%)
 Frame = -3

Query  776  QFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLE-GRPKQCRLSDK  636
            +++IPHPGRV GR  + L MP +L WVLGGN +K+E  R   CR+ DK
Sbjct  538  KYQIPHPGRVAGRIAMTLTMPAVLQWVLGGNTDKIEKARVGSCRIEDK  585



>ref|XP_002953670.1| hypothetical protein VOLCADRAFT_75879 [Volvox carteri f. nagariensis]
 gb|EFJ45294.1| hypothetical protein VOLCADRAFT_75879 [Volvox carteri f. nagariensis]
Length=727

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 57/199 (29%), Positives = 81/199 (41%), Gaps = 36/199 (18%)
 Frame = -3

Query  773  FRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLE-GRPKQCRLSD--KANDQLR--KWF  609
            FRIPHPGRV GR  + L MP +L WVLGGN + +   R   C L D  KA D+ R  ++ 
Sbjct  476  FRIPHPGRVIGRLVMLLTMPAVLDWVLGGNTDHVAPNRVPYCSLGDKPKAFDESRFGEFM  535

Query  608  DDDDALERAMNGEWFLSPLKNATSTASEPILLRRDEKTPC------------IVGSVPHP  465
             +D ++  + + +W L   + A+  A+       D  + C            +VG    P
Sbjct  536  SNDASIVYSSHADWILVSERTASGAAAA---AGGDVNSFCECKGIYMATQQALVGRSGSP  592

Query  464  NFPGTsvvvsspevsELHA-----------RISYKDGAFFVTDLRSKHGTWITDNEGRRY  318
              P  SV          H              S     +F+ DL +  GTW+        
Sbjct  593  AEPALSVDDVHVHDRHAHVWREASGNGNGDGSSSGGSDYFLQDLGTGRGTWVNGQ-----  647

Query  317  RVSPNFPTRFHPSDIVEFG  261
            R+      +  P D VEFG
Sbjct  648  RIQDGAKVQLWPGDTVEFG  666



>ref|XP_001701701.1| zeaxanthin epoxidase [Chlamydomonas reinhardtii]
 gb|AAO34404.1| zeaxanthin epoxidase precursor [Chlamydomonas reinhardtii]
 gb|AAO48940.1| zeaxanthin epoxidase precursor [Chlamydomonas reinhardtii]
 gb|EDP06676.1| zeaxanthin epoxidase [Chlamydomonas reinhardtii]
Length=763

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 43/76 (57%), Gaps = 5/76 (7%)
 Frame = -3

Query  773  FRIPHPGRVGGRFFIDLAMPLMLSWVLGGNGEKLE-GRPKQCRLSDK----ANDQLRKWF  609
             RIPHPGRV GR  + L MP +L WVLGGN + +   R   C L DK       +  ++ 
Sbjct  479  LRIPHPGRVVGRLVMLLTMPSVLEWVLGGNTDHVAPHRTSYCSLGDKPKAFPESRFPEFM  538

Query  608  DDDDALERAMNGEWFL  561
            ++D ++ R+ + +W L
Sbjct  539  NNDASIIRSSHADWLL  554



>gb|AEK69513.1| zeaxanthin epoxidase 3 [Glycine max]
Length=564

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = -3

Query  779  TQFRIPHPGRVGGRFFIDLAMPLMLSWVLGG  687
            T+F IPHPGRVGGRFF D  +PLML+W+LGG
Sbjct  453  TKFWIPHPGRVGGRFFTDKMIPLMLNWILGG  483



>ref|NP_001066037.1| Os12g0124000 [Oryza sativa Japonica Group]
 gb|ABA95710.2| FHA domain containing protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF29056.1| Os12g0124000 [Oryza sativa Japonica Group]
Length=228

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 43/83 (52%), Gaps = 6/83 (7%)
 Frame = -3

Query  413  HARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAFHV  234
            HAR+  K+G+  VTDL S +GT+I +      R+SP FPT   P  ++ FG    A F V
Sbjct  142  HARLEKKEGSLLVTDLESTNGTYINER-----RLSPGFPTPIDPGSLLIFGDIHLAMFRV  196

Query  233  KVKVMKFPPFSGGKGEMEVLQAA  165
               V+  P  + G  E E  + A
Sbjct  197  SKMVVDVPSDASG-AEQEAAETA  218



>gb|ABA95708.2| FHA domain containing protein, expressed [Oryza sativa Japonica 
Group]
Length=278

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 43/83 (52%), Gaps = 6/83 (7%)
 Frame = -3

Query  413  HARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAFHV  234
            HAR+  K+G+  VTDL S +GT+I +      R+SP FPT   P  ++ FG    A F V
Sbjct  192  HARLEKKEGSLLVTDLESTNGTYINER-----RLSPGFPTPIDPGSLLIFGDIHLAMFRV  246

Query  233  KVKVMKFPPFSGGKGEMEVLQAA  165
               V+  P  + G  E E  + A
Sbjct  247  SKMVVDVPSDASG-AEQEAAETA  268



>ref|XP_006662695.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Oryza brachyantha]
Length=218

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 44/84 (52%), Gaps = 6/84 (7%)
 Frame = -3

Query  413  HARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAFHV  234
            HAR+  K+G   VTDL S +GT+I +      R++P FPT   P  ++ FG    A F V
Sbjct  133  HARLEKKEGRLLVTDLDSTNGTYINER-----RLTPGFPTPIDPGSLLIFGDIHLAMFRV  187

Query  233  KVKVMKFPP-FSGGKGEMEVLQAA  165
               V+  P   +G + E E+ Q +
Sbjct  188  SKMVIDVPSDTNGAEQEAEIAQVS  211



>ref|XP_004978482.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Setaria 
italica]
Length=226

 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 45/86 (52%), Gaps = 8/86 (9%)
 Frame = -3

Query  413  HARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAFHV  234
            HAR+  KDG  FVTDL S +GT+I +      R++P FP    P  ++ FG    A F V
Sbjct  140  HARLEKKDGRLFVTDLDSTNGTYINER-----RLNPGFPIPIDPGSLIIFGDIHLAMFRV  194

Query  233  KVKVMKFPPFSGGKGE---MEVLQAA  165
            +  +++ P  + G  +    EV+  A
Sbjct  195  RKMIVEVPSETQGAQQETNTEVVSTA  220



>ref|XP_006663771.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Oryza brachyantha]
Length=218

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 43/84 (51%), Gaps = 6/84 (7%)
 Frame = -3

Query  413  HARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAFHV  234
            HAR+  K+G   VTDL S +GT+I +      R++P FPT   P  ++ FG    A F V
Sbjct  133  HARLEKKEGRLLVTDLDSTNGTYINER-----RLTPGFPTPIDPGSLLIFGDIHLAMFRV  187

Query  233  KVKVMKFPP-FSGGKGEMEVLQAA  165
                +  P   +G + E E+ Q +
Sbjct  188  SKMAIDVPSDTNGAEQEAEIAQVS  211



>gb|EEC67581.1| hypothetical protein OsI_34939 [Oryza sativa Indica Group]
Length=230

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 43/84 (51%), Gaps = 6/84 (7%)
 Frame = -3

Query  413  HARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAFHV  234
            HAR+  K+G+  VTDL S +GT+I +      R++P FPT   P  ++ FG    A F V
Sbjct  145  HARLEKKEGSLLVTDLESTNGTYINER-----RLTPGFPTPIDPGSLLIFGDIHLAMFRV  199

Query  233  KVKVMKFPP-FSGGKGEMEVLQAA  165
               ++      +G + E E  Q +
Sbjct  200  SKMIVDVSSDTNGAEQEAETAQVS  223



>ref|XP_004977424.1| PREDICTED: zeaxanthin epoxidase, chloroplastic-like [Setaria 
italica]
Length=220

 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 44/86 (51%), Gaps = 8/86 (9%)
 Frame = -3

Query  413  HARISYKDGAFFVTDLRSKHGTWITDNEGRRYRVSPNFPTRFHPSDIVEFGSDRKAAFHV  234
            HAR+  KDG  FVTDL S +GT+I +      R++P FP    P  ++ FG    A F V
Sbjct  138  HARLEKKDGRLFVTDLDSTNGTYINER-----RLNPGFPIPIDPGSLIIFGDIHLAMFRV  192

Query  233  KVKVMKFPPFSGGKGE---MEVLQAA  165
            +  +++    +    E    EV+ AA
Sbjct  193  RKMIVEATSETDAAREETKTEVVSAA  218



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1521097577940