BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF009N06

Length=764
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004252814.1|  PREDICTED: tubulin alpha-2 chain-like              395   3e-136   Solanum lycopersicum
emb|CAJ38386.1|  alpha tubulin                                          396   7e-136   Plantago major [cart-track plant]
gb|AHM93474.1|  alpha-tubulin                                           398   8e-136   Camellia chekiangoleosa
gb|EYU34085.1|  hypothetical protein MIMGU_mgv1a0196712mg               393   1e-135   Erythranthe guttata [common monkey flower]
gb|KJB58759.1|  hypothetical protein B456_009G224800                    395   1e-134   Gossypium raimondii
gb|AFR42026.1|  alpha-tubulin                                           390   1e-134   Populus trichocarpa [western balsam poplar]
gb|AFR42020.1|  alpha-tubulin                                           390   1e-134   Populus trichocarpa [western balsam poplar]
gb|AFR42035.1|  alpha-tubulin                                           390   1e-134   Populus alba [abele]
gb|AFR42036.1|  alpha-tubulin                                           389   2e-134   Populus alba [abele]
gb|AFR42042.1|  alpha-tubulin                                           389   2e-134   Populus fremontii
gb|EPS62716.1|  alpha-tubulin                                           397   3e-134   Genlisea aurea
ref|XP_006433708.1|  hypothetical protein CICLE_v100015522mg            389   4e-134   
gb|AHJ80819.1|  Tua1                                                    390   6e-134   Eragrostis tef [tef]
gb|KJB32211.1|  hypothetical protein B456_005G229600                    394   8e-134   Gossypium raimondii
gb|AAW57305.1|  alpha-tubulin                                           392   9e-134   Ceratopteris richardii
ref|XP_009614122.1|  PREDICTED: tubulin alpha-3 chain                   397   1e-133   Nicotiana tomentosiformis
ref|XP_004238046.1|  PREDICTED: tubulin alpha chain                     397   1e-133   
gb|AAW57309.1|  alpha-tubulin                                           390   1e-133   Ceratopteris richardii
ref|XP_009790136.1|  PREDICTED: tubulin alpha chain                     397   1e-133   Nicotiana sylvestris
gb|AAW57310.1|  alpha-tubulin                                           390   1e-133   Ceratopteris richardii
ref|XP_009620798.1|  PREDICTED: tubulin alpha chain                     397   1e-133   Nicotiana tomentosiformis
emb|CAD13176.1|  alpha-tubulin                                          397   1e-133   Nicotiana tabacum [American tobacco]
ref|XP_006356798.1|  PREDICTED: tubulin alpha chain-like                397   2e-133   Solanum tuberosum [potatoes]
ref|NP_001275271.1|  alpha-tubulin-like protein                         397   2e-133   Solanum tuberosum [potatoes]
gb|ABB02631.1|  unknown                                                 397   2e-133   Solanum tuberosum [potatoes]
gb|ABP65320.1|  alpha tubulin                                           397   2e-133   Capsicum annuum
gb|ACH68563.1|  alpha-tubulin                                           396   2e-133   Solanum tuberosum [potatoes]
ref|XP_006362511.1|  PREDICTED: tubulin alpha-1 chain-like              396   2e-133   
ref|XP_004244533.1|  PREDICTED: tubulin alpha-3 chain-like              396   2e-133   Solanum lycopersicum
gb|ABC59068.2|  alpha tubulin 1                                         396   2e-133   Camellia sinensis [black tea]
ref|XP_009605705.1|  PREDICTED: tubulin alpha-2 chain-like              396   2e-133   Nicotiana tomentosiformis
emb|CAB76917.1|  alpha-tubulin 4                                        390   2e-133   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAA52158.1|  alpha tubulin                                          389   3e-133   Zea mays [maize]
ref|WP_039310890.1|  hypothetical protein                               396   3e-133   
gb|EYU34660.1|  hypothetical protein MIMGU_mgv1a006269mg                395   5e-133   Erythranthe guttata [common monkey flower]
gb|AFR42054.1|  alpha-tubulin                                           386   5e-133   Populus fremontii
gb|AFR42049.1|  alpha-tubulin                                           386   5e-133   Populus fremontii
gb|KJB58756.1|  hypothetical protein B456_009G224800                    394   5e-133   Gossypium raimondii
dbj|BAB19779.1|  alpha tubulin                                          395   6e-133   Nicotiana tabacum [American tobacco]
dbj|BAH19954.1|  AT1G50010                                              387   7e-133   Arabidopsis thaliana [mouse-ear cress]
gb|KGN48654.1|  hypothetical protein Csa_6G497050                       394   8e-133   Cucumis sativus [cucumbers]
gb|AAW57306.1|  alpha-tubulin                                           387   9e-133   Ceratopteris richardii
ref|NP_001291325.1|  tubulin alpha chain-like                           395   9e-133   Sesamum indicum [beniseed]
gb|KIY91712.1|  Tubulin alpha chain                                     387   9e-133   Monoraphidium neglectum
gb|AFR42047.1|  alpha-tubulin                                           385   1e-132   Populus fremontii
emb|CDP02221.1|  unnamed protein product                                394   1e-132   Coffea canephora [robusta coffee]
gb|KDO81349.1|  hypothetical protein CISIN_1g013037mg                   391   1e-132   Citrus sinensis [apfelsine]
ref|XP_011098608.1|  PREDICTED: tubulin alpha chain                     394   1e-132   Sesamum indicum [beniseed]
ref|XP_004232226.1|  PREDICTED: tubulin alpha chain-like                394   1e-132   Solanum lycopersicum
ref|XP_009626810.1|  PREDICTED: tubulin alpha chain-like                394   1e-132   Nicotiana tomentosiformis
gb|AFW67749.1|  alpha tubulin4                                          389   2e-132   
gb|ADW83724.1|  alpha-tubulin                                           392   3e-132   Musa acuminata AAA Group [Cavendish banana]
gb|AAX96763.1|  Tubulin/FtsZ family, GTPase domain, putative            390   3e-132   Oryza sativa Japonica Group [Japonica rice]
gb|KDO49533.1|  hypothetical protein CISIN_1g013062mg                   392   5e-132   Citrus sinensis [apfelsine]
gb|EYU37544.1|  hypothetical protein MIMGU_mgv1a007145mg                391   5e-132   Erythranthe guttata [common monkey flower]
ref|XP_003608582.1|  Tubulin alpha-5 chain                              392   6e-132   Medicago truncatula
ref|XP_002959708.1|  alpha tubulin                                      385   6e-132   Volvox carteri f. nagariensis
ref|XP_010245599.1|  PREDICTED: tubulin alpha chain-like                392   6e-132   Nelumbo nucifera [Indian lotus]
ref|XP_002510010.1|  tubulin alpha chain, putative                      392   7e-132   Ricinus communis
gb|KDP44552.1|  hypothetical protein JCGZ_16385                         392   7e-132   Jatropha curcas
gb|ACJ60905.1|  alpha tubulin                                           392   7e-132   Betula pendula [white birch]
gb|ABX57816.1|  alpha tubulin                                           392   7e-132   Picea wilsonii
gb|AIX10966.1|  tubulin                                                 392   7e-132   Ornithogalum longebracteatum [sea-onion]
gb|AAV92352.1|  alpha tubulin 1                                         392   7e-132   Pseudotsuga menziesii var. menziesii
ref|XP_006422747.1|  hypothetical protein CICLE_v10028426mg             392   7e-132   Citrus clementina [clementine]
ref|XP_010936237.1|  PREDICTED: tubulin alpha chain-like                392   7e-132   Elaeis guineensis
ref|XP_010943272.1|  PREDICTED: tubulin alpha chain-like                392   7e-132   Elaeis guineensis
ref|XP_003635553.2|  PREDICTED: tubulin alpha chain-like                392   7e-132   Vitis vinifera
ref|XP_011457777.1|  PREDICTED: tubulin alpha chain                     392   7e-132   Fragaria vesca subsp. vesca
ref|XP_009335354.1|  PREDICTED: tubulin alpha chain                     392   7e-132   Pyrus x bretschneideri [bai li]
ref|XP_010266793.1|  PREDICTED: tubulin alpha chain                     392   7e-132   Nelumbo nucifera [Indian lotus]
ref|XP_001764722.1|  predicted protein                                  392   7e-132   
ref|XP_007199840.1|  hypothetical protein PRUPE_ppa005633mg             392   7e-132   Prunus persica
ref|XP_010939312.1|  PREDICTED: tubulin alpha chain-like                392   7e-132   Elaeis guineensis
ref|XP_006426173.1|  hypothetical protein CICLE_v10025588mg             392   7e-132   Citrus clementina [clementine]
ref|XP_007018369.1|  Tubulin alpha-2 chain                              392   7e-132   Theobroma cacao [chocolate]
gb|ABO47740.1|  alpha-tubulin                                           392   7e-132   Gossypium hirsutum [American cotton]
ref|NP_001289660.1|  tubulin alpha chain-like                           392   8e-132   Eucalyptus grandis [rose gum]
ref|XP_004288297.1|  PREDICTED: tubulin alpha-3 chain                   392   8e-132   Fragaria vesca subsp. vesca
gb|ABO47739.1|  alpha-tubulin                                           392   8e-132   Gossypium hirsutum [American cotton]
ref|XP_008787237.1|  PREDICTED: tubulin alpha chain                     392   8e-132   Phoenix dactylifera
ref|XP_008372961.1|  PREDICTED: tubulin alpha chain isoform X1          392   8e-132   Malus domestica [apple tree]
gb|ACN40181.1|  unknown                                                 392   8e-132   Picea sitchensis
ref|XP_002283198.1|  PREDICTED: tubulin alpha chain                     392   8e-132   Vitis vinifera
ref|XP_009335355.1|  PREDICTED: tubulin alpha chain-like                392   8e-132   Pyrus x bretschneideri [bai li]
ref|XP_002522104.1|  tubulin alpha chain, putative                      392   8e-132   Ricinus communis
sp|P33629.1|TBA_PRUDU  RecName: Full=Tubulin alpha chain                392   8e-132   Prunus dulcis [sweet almond]
gb|KDP32140.1|  hypothetical protein JCGZ_12601                         392   8e-132   Jatropha curcas
ref|XP_004150268.1|  PREDICTED: tubulin alpha chain-like                392   8e-132   Cucumis sativus [cucumbers]
ref|XP_010242419.1|  PREDICTED: tubulin alpha-1 chain                   392   8e-132   Nelumbo nucifera [Indian lotus]
sp|Q6VAF9.1|TBA4_GOSHI  RecName: Full=Tubulin alpha-4 chain; AltN...    392   8e-132   Gossypium hirsutum [American cotton]
ref|XP_004136930.1|  PREDICTED: tubulin alpha-4 chain-like              392   9e-132   Cucumis sativus [cucumbers]
ref|XP_010093625.1|  Tubulin alpha chain                                392   9e-132   Morus notabilis
ref|XP_006466394.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    392   9e-132   Citrus sinensis [apfelsine]
ref|XP_008804464.1|  PREDICTED: tubulin alpha chain-like                392   9e-132   Phoenix dactylifera
gb|AFW67748.1|  alpha tubulin4                                          389   9e-132   
ref|XP_007032501.1|  Tubulin alpha-2 chain                              392   9e-132   
ref|XP_004143417.1|  PREDICTED: tubulin alpha chain-like                392   9e-132   Cucumis sativus [cucumbers]
gb|KHG18997.1|  Tubulin alpha chain                                     392   9e-132   Gossypium arboreum [tree cotton]
ref|XP_002275973.1|  PREDICTED: tubulin alpha chain                     392   9e-132   Vitis vinifera
emb|CAN62392.1|  hypothetical protein VITISV_016172                     392   9e-132   Vitis vinifera
ref|XP_008455054.1|  PREDICTED: tubulin alpha-4 chain isoform X1        392   1e-131   Cucumis melo [Oriental melon]
sp|P46259.1|TBA1_PEA  RecName: Full=Tubulin alpha-1 chain               392   1e-131   Pisum sativum [garden pea]
gb|ABO47736.1|  alpha-tubulin                                           392   1e-131   Gossypium hirsutum [American cotton]
gb|AID52921.1|  tubulin alpha chain                                     392   1e-131   Carthamus tinctorius
ref|XP_008621874.1|  tubulin alpha                                      385   1e-131   Saprolegnia diclina VS20
gb|KDP41548.1|  hypothetical protein JCGZ_15955                         392   1e-131   Jatropha curcas
ref|XP_002981542.1|  hypothetical protein SELMODRAFT_178975             392   1e-131   Selaginella moellendorffii
ref|XP_010531321.1|  PREDICTED: tubulin alpha chain isoform X1          392   1e-131   Tarenaya hassleriana [spider flower]
ref|XP_010256937.1|  PREDICTED: tubulin alpha chain-like                392   1e-131   Nelumbo nucifera [Indian lotus]
ref|XP_010099392.1|  Tubulin alpha chain                                392   1e-131   
ref|XP_010065856.1|  PREDICTED: tubulin alpha chain                     392   1e-131   Eucalyptus grandis [rose gum]
ref|XP_008440459.1|  PREDICTED: tubulin alpha chain-like isoform X1     392   1e-131   Cucumis melo [Oriental melon]
gb|AGG37283.1|  alpha-tubulin 1                                         392   1e-131   Salix arbutifolia
ref|XP_010555432.1|  PREDICTED: tubulin alpha chain-like                392   1e-131   Tarenaya hassleriana [spider flower]
ref|XP_010526692.1|  PREDICTED: tubulin alpha chain-like                392   1e-131   Tarenaya hassleriana [spider flower]
ref|XP_003522731.1|  PREDICTED: tubulin alpha-4 chain isoform X1        392   1e-131   Glycine max [soybeans]
ref|XP_007137281.1|  hypothetical protein PHAVU_009G114100g             392   1e-131   Phaseolus vulgaris [French bean]
ref|XP_007205183.1|  hypothetical protein PRUPE_ppa005613mg             392   1e-131   Prunus persica
ref|XP_002301128.1|  hypothetical protein POPTR_0002s11250g             392   1e-131   Populus trichocarpa [western balsam poplar]
ref|XP_004501073.1|  PREDICTED: tubulin alpha chain-like                392   1e-131   Cicer arietinum [garbanzo]
ref|XP_003603670.1|  Tubulin alpha-7 chain                              392   1e-131   Medicago truncatula
gb|AHJ80823.1|  Tua1                                                    392   1e-131   Eragrostis tef [tef]
ref|XP_007042689.1|  Tubulin alpha-2 chain                              392   1e-131   Theobroma cacao [chocolate]
gb|AEQ75493.1|  alpha-tubulin                                           391   1e-131   Rosa multiflora [Japanese rose]
gb|AGG37289.1|  alpha-tubulin 7                                         391   2e-131   Salix arbutifolia
ref|XP_011008936.1|  PREDICTED: tubulin alpha chain                     392   2e-131   Populus euphratica
gb|AIX10773.1|  alpha tubulin                                           391   2e-131   Panax notoginseng [san-qi]
ref|XP_008665337.1|  PREDICTED: tubulin alpha-1 chain-like              391   2e-131   
ref|XP_008665339.1|  PREDICTED: tubulin alpha-2 chain                   391   2e-131   Zea mays [maize]
sp|O22347.1|TBA1_ELEIN  RecName: Full=Tubulin alpha-1 chain; AltN...    391   2e-131   Eleusine indica [crabgrass]
gb|AFC88832.1|  putative tubulin alpha-3 chain                          391   2e-131   Miscanthus sinensis
ref|XP_002324047.2|  hypothetical protein POPTR_0017s11740g             391   2e-131   
gb|KHN08201.1|  Tubulin alpha chain                                     392   2e-131   Glycine soja [wild soybean]
ref|XP_010680774.1|  PREDICTED: tubulin alpha-2 chain                   391   2e-131   Beta vulgaris subsp. vulgaris [field beet]
sp|P33623.1|TBA1_ANEPH  RecName: Full=Tubulin alpha-1 chain             391   2e-131   Anemia phyllitidis
dbj|BAJ06362.1|  alpha-tubulin                                          391   2e-131   Alopecurus aequalis
ref|NP_001167663.1|  tubulin alpha-3 chain                              391   2e-131   Zea mays [maize]
ref|XP_003560377.1|  PREDICTED: tubulin alpha-1 chain                   391   2e-131   Brachypodium distachyon [annual false brome]
gb|AGG37285.1|  alpha-tubulin 3                                         391   2e-131   Salix arbutifolia
ref|XP_004981922.1|  PREDICTED: tubulin alpha-1 chain-like              391   2e-131   Setaria italica
ref|XP_009402887.1|  PREDICTED: tubulin alpha chain                     391   2e-131   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008787760.1|  PREDICTED: tubulin alpha chain-like                391   2e-131   Phoenix dactylifera
ref|XP_002298794.2|  TUBULIN ALPHA CHAIN family protein                 391   2e-131   Populus trichocarpa [western balsam poplar]
emb|CAA06619.1|  alpha-tubulin 1                                        391   2e-131   Eleusine indica [crabgrass]
ref|XP_002466535.1|  hypothetical protein SORBIDRAFT_01g009570          391   2e-131   
ref|XP_011030289.1|  PREDICTED: tubulin alpha-4 chain                   391   2e-131   Populus euphratica
ref|XP_006404742.1|  hypothetical protein EUTSA_v10000161mg             391   2e-131   Eutrema salsugineum [saltwater cress]
gb|AHJ80815.1|  Tua1                                                    391   2e-131   Eragrostis tef [tef]
ref|XP_006650518.1|  PREDICTED: tubulin alpha-1 chain-like              391   2e-131   Oryza brachyantha
ref|XP_004299843.1|  PREDICTED: tubulin alpha chain-like                391   2e-131   Fragaria vesca subsp. vesca
gb|ABK92520.1|  unknown                                                 391   2e-131   Populus trichocarpa [western balsam poplar]
ref|XP_007223365.1|  hypothetical protein PRUPE_ppa005617mg             391   3e-131   Prunus persica
ref|XP_006581474.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    391   3e-131   
gb|ABQ59633.1|  alpha-tubulin 3                                         391   3e-131   Populus tremuloides
tpg|DAA51109.1|  TPA: alpha tubulin                                     391   3e-131   
ref|XP_007215369.1|  hypothetical protein PRUPE_ppa005626mg             391   3e-131   Prunus persica
gb|AAB36609.1|  alpha-tubulin                                           388   3e-131   Eucalyptus globulus subsp. bicostata
gb|ABR25378.1|  tubulin alpha 3 chain                                   382   3e-131   Oryza sativa Indica Group [Indian rice]
gb|ABO47742.1|  alpha-tubulin                                           391   3e-131   Gossypium hirsutum [American cotton]
ref|XP_004304311.1|  PREDICTED: tubulin alpha-2 chain-like              391   3e-131   Fragaria vesca subsp. vesca
gb|KDO81348.1|  hypothetical protein CISIN_1g013037mg                   390   3e-131   Citrus sinensis [apfelsine]
ref|XP_009388502.1|  PREDICTED: tubulin alpha-2 chain isoform X1        391   3e-131   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003556001.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    390   3e-131   Glycine max [soybeans]
ref|XP_009409992.1|  PREDICTED: tubulin alpha chain-like                391   3e-131   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006662856.1|  PREDICTED: tubulin alpha-3 chain-like              391   3e-131   Oryza brachyantha
sp|Q9ZRR5.1|TBA3_HORVU  RecName: Full=Tubulin alpha-3 chain             390   3e-131   Hordeum vulgare [barley]
ref|XP_002517492.1|  tubulin alpha chain, putative                      390   3e-131   Ricinus communis
ref|XP_008379344.1|  PREDICTED: tubulin alpha-2 chain                   390   4e-131   Malus domestica [apple tree]
gb|ABF98641.1|  Tubulin alpha-1 chain, putative, expressed              389   4e-131   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006472372.1|  PREDICTED: tubulin alpha chain isoform X1          390   4e-131   Citrus sinensis [apfelsine]
dbj|BAG99724.1|  unnamed protein product                                389   4e-131   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007156677.1|  hypothetical protein PHAVU_002G007900g             390   4e-131   Phaseolus vulgaris [French bean]
ref|XP_011014531.1|  PREDICTED: tubulin alpha-4 chain-like              390   4e-131   Populus euphratica
gb|KDO81347.1|  hypothetical protein CISIN_1g013037mg                   390   4e-131   Citrus sinensis [apfelsine]
sp|Q6VAG0.1|TBA2_GOSHI  RecName: Full=Tubulin alpha-2 chain; AltN...    390   4e-131   Gossypium hirsutum [American cotton]
gb|KHN42598.1|  Tubulin alpha-2 chain                                   390   4e-131   Glycine soja [wild soybean]
ref|XP_006650524.1|  PREDICTED: tubulin alpha-1 chain-like              390   5e-131   Oryza brachyantha
ref|XP_003517369.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    390   5e-131   Glycine max [soybeans]
ref|XP_010104543.1|  Tubulin alpha chain                                390   5e-131   
ref|XP_003536570.1|  PREDICTED: tubulin alpha chain-like isoform X1     390   5e-131   Glycine max [soybeans]
ref|XP_007515802.1|  alpha-tubulin                                      389   5e-131   Bathycoccus prasinos
ref|XP_003539228.1|  PREDICTED: tubulin alpha-2 chain-like              390   5e-131   Glycine max [soybeans]
gb|AAO73546.1|  alpha-tubulin                                           390   5e-131   Ceratopteris richardii
gb|AAB08791.1|  alpha tubulin                                           390   6e-131   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007143142.1|  hypothetical protein PHAVU_007G047300g             390   6e-131   Phaseolus vulgaris [French bean]
ref|XP_002964078.1|  hypothetical protein SELMODRAFT_405729             390   6e-131   Selaginella moellendorffii
gb|KEH43997.1|  tubulin beta-1 chain                                    390   6e-131   Medicago truncatula
ref|XP_004496862.1|  PREDICTED: tubulin alpha chain-like                390   6e-131   Cicer arietinum [garbanzo]
ref|XP_002962630.1|  hypothetical protein SELMODRAFT_230143             390   6e-131   
sp|Q96460.1|TBA2_HORVU  RecName: Full=Tubulin alpha-2 chain             390   7e-131   Hordeum vulgare [barley]
emb|CDO97305.1|  unnamed protein product                                390   7e-131   Coffea canephora [robusta coffee]
ref|XP_011088040.1|  PREDICTED: tubulin alpha chain                     390   7e-131   Sesamum indicum [beniseed]
gb|ABD92930.1|  alpha tubulin-2A                                        390   7e-131   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010557535.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    390   8e-131   Tarenaya hassleriana [spider flower]
emb|CAB66336.1|  alpha-tubulin                                          390   8e-131   Betula pendula [white birch]
dbj|BAJ06364.1|  alpha-tubulin                                          390   8e-131   Alopecurus aequalis
sp|Q9ZRB7.1|TBA_WHEAT  RecName: Full=Tubulin alpha chain                390   8e-131   Triticum aestivum [Canadian hard winter wheat]
dbj|BAC24800.1|  alpha tubulin                                          390   8e-131   Physcomitrella patens
gb|AHJ80817.1|  Tua1                                                    390   9e-131   Eragrostis tef [tef]
ref|XP_003558668.1|  PREDICTED: tubulin alpha-2 chain-like              389   9e-131   Brachypodium distachyon [annual false brome]
ref|XP_010664458.1|  PREDICTED: tubulin alpha-4 chain                   389   1e-130   Vitis vinifera
ref|XP_010060142.1|  PREDICTED: tubulin alpha chain-like                389   1e-130   Eucalyptus grandis [rose gum]
gb|ABD92937.1|  alpha tubulin-4A                                        389   1e-130   Triticum aestivum [Canadian hard winter wheat]
gb|ABD92936.1|  alpha tubulin-4D                                        389   1e-130   Triticum aestivum [Canadian hard winter wheat]
gb|KIZ01406.1|  Tubulin alpha-1 chain                                   389   1e-130   Monoraphidium neglectum
gb|ABQ59634.1|  alpha-tubulin 5                                         389   1e-130   Populus tremuloides
ref|XP_006307493.1|  hypothetical protein CARUB_v10009117mg             389   1e-130   Capsella rubella
ref|XP_007047652.1|  Tubulin alpha-2 chain                              391   1e-130   
dbj|BAP59012.1|  alpha tubulin                                          389   1e-130   Taxus cuspidata [ichii]
ref|XP_002313194.1|  hypothetical protein POPTR_0009s08850g             389   1e-130   Populus trichocarpa [western balsam poplar]
gb|ABL61201.1|  alpha-tubulin                                           384   2e-130   Oxymonadida environmental sample
gb|KHG20487.1|  Tubulin alpha chain                                     389   2e-130   Gossypium arboreum [tree cotton]
sp|Q6VAG1.1|TBA1_GOSHI  RecName: Full=Tubulin alpha-1 chain; AltN...    389   2e-130   Gossypium hirsutum [American cotton]
ref|XP_009407690.1|  PREDICTED: tubulin alpha chain-like                389   2e-130   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010096739.1|  Tubulin alpha chain                                389   2e-130   
emb|CAD20821.1|  alpha tubulin                                          382   2e-130   Zea mays [maize]
gb|AEW46684.1|  beta-tubulin                                            389   2e-130   Ulva linza
emb|CAA62916.1|  alpha-tubulin                                          389   2e-130   Oryza sativa Japonica Group [Japonica rice]
gb|ACU20294.1|  unknown                                                 385   2e-130   Glycine max [soybeans]
emb|CDY29334.1|  BnaA05g16010D                                          388   2e-130   Brassica napus [oilseed rape]
gb|AAO46127.1|  alpha-tubulin                                           381   2e-130   Streblomastix strix
gb|AGG37287.1|  alpha-tubulin 5                                         389   2e-130   Salix arbutifolia
gb|ABV55999.1|  alpha-tubulin 7                                         389   2e-130   Populus tremuloides
ref|XP_011398411.1|  Tubulin alpha chain                                387   2e-130   Auxenochlorella protothecoides
gb|ABL61216.1|  alpha-tubulin                                           384   2e-130   Oxymonadida environmental sample
ref|XP_011002356.1|  PREDICTED: tubulin alpha chain-like                389   2e-130   Populus euphratica
gb|KFK32793.1|  hypothetical protein AALP_AA6G289100                    388   3e-130   Arabis alpina [alpine rockcress]
ref|NP_001051132.1|  Os03g0726100                                       388   3e-130   
gb|ACK76232.1|  alpha-tubulin                                           388   3e-130   Dimocarpus longan [longan]
ref|NP_171974.1|  tubulin alpha-4 chain                                 388   3e-130   Arabidopsis thaliana [mouse-ear cress]
gb|ABR25510.1|  tubulin alpha-1 chain                                   381   4e-130   Oryza sativa Indica Group [Indian rice]
emb|CDY66630.1|  BnaCnng51680D                                          387   4e-130   Brassica napus [oilseed rape]
dbj|BAE99023.1|  tubulin alpha-2/alpha-4 chain                          388   4e-130   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010500555.1|  PREDICTED: tubulin alpha-6 chain isoform X1        388   4e-130   Camelina sativa [gold-of-pleasure]
ref|NP_193232.1|  tubulin alpha-6 chain                                 388   4e-130   Arabidopsis thaliana [mouse-ear cress]
gb|AAL16174.1|AF428406_1  AT4g14960/dl3520c                             388   4e-130   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001777110.1|  predicted protein                                  384   5e-130   
gb|ABL61224.1|  alpha-tubulin                                           383   5e-130   Oxymonadida environmental sample
gb|ABL61215.1|  alpha-tubulin                                           383   5e-130   Oxymonadida environmental sample
gb|ABL61212.1|  alpha-tubulin                                           383   5e-130   Oxymonadida environmental sample
gb|AFK33477.1|  unknown                                                 384   6e-130   Lotus japonicus
gb|ETM52928.1|  tubulin alpha chain                                     385   6e-130   Phytophthora parasitica
gb|KJB29387.1|  hypothetical protein B456_005G097800                    387   6e-130   Gossypium raimondii
ref|XP_005851144.1|  alpha-tubulin                                      387   6e-130   Chlorella variabilis
ref|XP_009124556.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    387   7e-130   Brassica rapa
gb|ACU19580.1|  unknown                                                 387   8e-130   Glycine max [soybeans]
ref|XP_008341563.1|  PREDICTED: tubulin alpha-2 chain-like              387   8e-130   
emb|CAL35827.1|  alpha-2 tubulin                                        380   9e-130   Plantago major [cart-track plant]
gb|KIZ03400.1|  Tubulin alpha chain                                     387   9e-130   Monoraphidium neglectum
ref|XP_010507910.1|  PREDICTED: tubulin alpha-2 chain-like              387   9e-130   Camelina sativa [gold-of-pleasure]
ref|XP_002508010.1|  alpha tubulin 2                                    387   1e-129   Micromonas commoda
gb|KDD76276.1|  tubulin/FtsZ GTPase                                     387   1e-129   Helicosporidium sp. ATCC 50920
gb|ABL61202.1|  alpha-tubulin                                           381   1e-129   Oxymonadida environmental sample
ref|XP_005651460.1|  tubulin alpha chain                                387   1e-129   Coccomyxa subellipsoidea C-169
ref|XP_005643073.1|  tubulin alpha chain                                387   1e-129   Coccomyxa subellipsoidea C-169
gb|ABK92552.1|  unknown                                                 387   1e-129   Populus trichocarpa [western balsam poplar]
gb|ADJ00012.1|  tubulin alpha chain                                     379   1e-129   Chromera velia
gb|ABL61203.1|  alpha-tubulin                                           381   1e-129   Oxymonadida environmental sample
gb|AAO46130.1|  alpha-tubulin                                           379   2e-129   Streblomastix strix
gb|ABL61219.1|  alpha-tubulin                                           381   2e-129   Oxymonadida environmental sample
ref|NP_001067613.1|  Os11g0247300                                       386   2e-129   
gb|AAO46128.1|  alpha-tubulin                                           379   2e-129   Streblomastix strix
gb|ABL61213.1|  alpha-tubulin                                           381   2e-129   Oxymonadida environmental sample
ref|XP_003058621.1|  alpha tubulin                                      386   2e-129   Micromonas pusilla CCMP1545
gb|ABG78593.1|  alpha-tubulin                                           386   2e-129   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003080933.1|  TBA_CHLVU Tubulin alpha chain (ISS)                387   2e-129   
emb|CEG01594.1|  Tubulin/FtsZ, 2-layer sandwich domain                  386   2e-129   Ostreococcus tauri
gb|ABL61217.1|  alpha-tubulin                                           381   2e-129   Oxymonadida environmental sample
gb|AAT09063.1|  alpha tubulin 1                                         386   2e-129   Bigelowiella natans
ref|XP_002951007.1|  alpha tubulin                                      386   2e-129   Volvox carteri f. nagariensis
ref|XP_001770881.1|  predicted protein                                  386   3e-129   
gb|EJY81124.1|  Alpha tubulin,putative                                  386   3e-129   Oxytricha trifallax
gb|ABL61227.1|  alpha-tubulin                                           380   3e-129   Oxymonadida environmental sample
emb|CDW82295.1|  alpha tubulin                                          385   3e-129   Stylonychia lemnae
gb|KHN01709.1|  Tubulin alpha chain                                     385   3e-129   Glycine soja [wild soybean]
sp|P28287.1|TBA_OXYGR  RecName: Full=Tubulin alpha chain                385   3e-129   Oxytricha granulifera
ref|XP_008384431.1|  PREDICTED: tubulin alpha-3 chain-like              379   3e-129   
ref|XP_001419217.1|  predicted protein                                  385   3e-129   Ostreococcus lucimarinus CCE9901
ref|XP_009147859.1|  PREDICTED: tubulin alpha-6 chain                   385   4e-129   
emb|CDP12358.1|  unnamed protein product                                385   4e-129   
gb|AAD11425.1|  alpha tubulin                                           382   4e-129   
gb|AIA82435.1|  alpha-tubulin-like protein 03                           385   4e-129   
ref|XP_003524707.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    385   4e-129   
gb|ABL61214.1|  alpha-tubulin                                           380   4e-129   
gb|ETW27380.1|  tubulin alpha chain                                     380   4e-129   
ref|XP_007155784.1|  hypothetical protein PHAVU_003G231500g             385   5e-129   
gb|KJB34154.1|  hypothetical protein B456_006G050600                    377   5e-129   
gb|AIA82433.1|  alpha-tubulin-like protein 01                           385   5e-129   
ref|XP_010461854.1|  PREDICTED: tubulin alpha-6 chain-like              385   5e-129   
gb|AEF79970.1|  alpha-tubulin protein                                   385   6e-129   
emb|CDJ60085.1|  tubulin alpha chain, putative                          384   6e-129   
ref|XP_006431130.1|  hypothetical protein CICLE_v10011709mg             385   6e-129   
ref|XP_002782100.1|  Tubulin alpha chain, putative                      380   7e-129   
ref|XP_007512064.1|  alpha-tubulin                                      385   7e-129   
gb|ABL61218.1|  alpha-tubulin                                           380   8e-129   
ref|XP_001691876.1|  alpha tubulin 1                                    385   8e-129   
gb|AAQ81585.1|  putative tubulin alpha-2/alpha-4 chain                  385   8e-129   
emb|CAA62917.1|  alfa-tubulin                                           385   8e-129   
ref|XP_004981594.1|  PREDICTED: tubulin alpha-3 chain-like              384   9e-129   
gb|ABL61226.1|  alpha-tubulin                                           379   9e-129   
gb|ABL61204.1|  alpha-tubulin                                           379   9e-129   
gb|ABO47737.1|  alpha-tubulin                                           384   9e-129   
gb|AHJ80816.1|  Tua1                                                    384   1e-128   
emb|CAE52514.1|  alpha tubulin                                          384   1e-128   
gb|EPR58771.1|  alpha tubulin TUBA1                                     384   1e-128   
gb|AAO46126.1|  alpha-tubulin                                           377   1e-128   
tpg|DAA41189.1|  TPA: alpha tubulin5                                    379   1e-128   
gb|ETM30643.1|  tubulin alpha chain                                     384   1e-128   
gb|KJB83378.1|  hypothetical protein B456_013G244600                    382   1e-128   
sp|Q9FT36.1|TBA_DAUCA  RecName: Full=Tubulin alpha chain                384   1e-128   
gb|EWC76931.1|  tubulin alpha chain                                     379   1e-128   
tpg|DAA63280.1|  TPA: alpha tubulin6                                    379   1e-128   
sp|Q25563.1|TBA13_NAEGR  RecName: Full=Tubulin alpha-13 chain           384   1e-128   
ref|XP_002980240.1|  hypothetical protein SELMODRAFT_419896             383   1e-128   
dbj|BAH20267.1|  AT5G19780                                              378   1e-128   
gb|ABP65323.1|  alpha tubulin                                           384   1e-128   
gb|AHJ80821.1|  Tua3                                                    382   1e-128   
ref|XP_002675196.1|  alpha-tubulin                                      384   2e-128   
gb|ABU93324.1|  tubulin alpha subunit                                   384   2e-128   
gb|AAT09064.1|  alpha tubulin 2                                         384   2e-128   
gb|AHZ58481.1|  alpha-tubulin                                           374   2e-128   
ref|XP_008872990.1|  tubulin alpha chain                                384   2e-128   
emb|CCI41153.1|  unnamed protein product                                384   2e-128   
ref|XP_008900864.1|  tubulin alpha chain                                384   2e-128   
gb|ETO82054.1|  tubulin alpha chain                                     384   2e-128   
ref|XP_002904195.1|  alpha-tubulin, putative                            384   2e-128   
ref|XP_009537046.1|  hypothetical protein PHYSODRAFT_340566             379   2e-128   
dbj|BAF01952.1|  putative tubulin alpha-2/alpha-4 chain                 374   2e-128   
emb|CBH08958.1|  alpha tubulin, (fragment)                              378   2e-128   
ref|XP_002976230.1|  hypothetical protein SELMODRAFT_105136             384   2e-128   
gb|ABU93323.1|  tubulin alpha subunit                                   384   2e-128   
gb|KHG14074.1|  Tubulin alpha-2 chain                                   381   2e-128   
gb|ETM52951.1|  tubulin alpha chain                                     383   2e-128   
emb|CDJ53173.1|  tubulin alpha chain, putative                          384   2e-128   
gb|EKF29047.1|  epsilon tubulin, putative                               375   2e-128   
ref|XP_002364807.1|  tubulin alpha chain                                384   2e-128   
ref|XP_002972670.1|  hypothetical protein SELMODRAFT_231979             383   2e-128   
gb|AIA82436.1|  alpha-tubulin-like protein 04                           384   2e-128   
gb|EKF28172.1|  epsilon tubulin, putative                               376   3e-128   
gb|ETM53018.1|  tubulin alpha chain                                     376   3e-128   
ref|XP_009842456.1|  tubulin alpha chain                                383   3e-128   
ref|XP_009400845.1|  PREDICTED: tubulin alpha-3 chain                   383   3e-128   
gb|AEG74028.1|  alpha-tubulin                                           383   3e-128   
ref|XP_002904194.1|  alpha-tubulin                                      383   3e-128   
gb|ABL61086.1|  alpha-tubulin                                           378   3e-128   
gb|KCW87067.1|  hypothetical protein EUGRSUZ_B03604                     380   3e-128   
emb|CCD11782.1|  unnamed protein product                                376   3e-128   
ref|XP_001777081.1|  predicted protein                                  383   3e-128   
gb|AHJ80820.1|  Tua3                                                    381   3e-128   
gb|ADP08782.1|  alpha tubulin                                           383   3e-128   
emb|CDI81818.1|  tubulin alpha chain, putative                          383   3e-128   
gb|ABL61228.1|  alpha-tubulin                                           378   3e-128   
sp|P33625.1|TBA_EUGGR  RecName: Full=Tubulin alpha chain                383   4e-128   
gb|AAK37831.1|AF182309_1  alpha-tubulin                                 383   4e-128   
gb|AAZ23863.1|  alpha-tubulin                                           383   4e-128   
ref|XP_001782790.1|  predicted protein                                  383   4e-128   
gb|ACN40824.1|  unknown                                                 383   4e-128   
ref|XP_002989731.1|  hypothetical protein SELMODRAFT_130285             383   4e-128   
emb|CDJ42547.1|  tubulin alpha chain, putative                          383   4e-128   
gb|AAB86649.1|  alpha-tubulin                                           383   4e-128   
ref|XP_008877307.1|  tubulin alpha chain                                379   5e-128   
ref|XP_009406530.1|  PREDICTED: tubulin alpha-3 chain-like              382   5e-128   
ref|XP_008804327.1|  PREDICTED: tubulin alpha-1 chain-like              382   5e-128   
gb|AAX63396.1|  alpha-tubulin                                           382   5e-128   
gb|ABL61205.1|  alpha-tubulin                                           382   5e-128   
gb|ABL61209.1|  alpha-tubulin                                           382   5e-128   
ref|XP_002962209.1|  hypothetical protein SELMODRAFT_230058             382   5e-128   
gb|ETP23198.1|  tubulin alpha chain                                     379   6e-128   
ref|XP_010673470.1|  PREDICTED: tubulin alpha-3 chain                   382   6e-128   
gb|ABL61208.1|  alpha-tubulin                                           382   6e-128   
ref|XP_006858944.1|  hypothetical protein AMTR_s00068p00090790          382   6e-128   
ref|XP_002963093.1|  hypothetical protein SELMODRAFT_404672             382   6e-128   
ref|XP_010695478.1|  PREDICTED: tubulin alpha-2 chain-like              382   6e-128   
gb|ABL61206.1|  alpha-tubulin                                           382   6e-128   
gb|EYU23006.1|  hypothetical protein MIMGU_mgv1a006283mg                382   7e-128   
gb|ABL61210.1|  alpha-tubulin                                           381   7e-128   
gb|AAB86648.1|  alpha-tubulin                                           382   7e-128   
emb|CDP17586.1|  unnamed protein product                                382   7e-128   
ref|XP_009408459.1|  PREDICTED: tubulin alpha-3 chain-like              382   7e-128   
ref|XP_002285721.1|  PREDICTED: tubulin alpha-3 chain                   382   8e-128   
ref|XP_006445597.1|  hypothetical protein CICLE_v10015224mg             382   8e-128   
gb|EPY33355.1|  tubulin alpha                                           377   9e-128   
ref|XP_009413318.1|  PREDICTED: tubulin alpha-3 chain-like              382   1e-127   
dbj|BAJ06363.1|  alpha-tubulin                                          382   1e-127   
ref|XP_003562846.1|  PREDICTED: tubulin alpha-1 chain                   382   1e-127   
ref|XP_008813089.1|  PREDICTED: tubulin alpha-3 chain                   382   1e-127   
ref|XP_002989721.1|  hypothetical protein SELMODRAFT_235864             382   1e-127   
ref|NP_001105324.1|  tubulin alpha-5 chain                              382   1e-127   
ref|XP_004958110.1|  PREDICTED: tubulin alpha-3 chain-like              382   1e-127   
gb|KHG06160.1|  Tubulin alpha-3/alpha-5 chain -like protein             381   1e-127   
ref|XP_002904167.1|  cleavage induced tubulin alpha chain               377   1e-127   
gb|ABD92942.1|  alpha tubulin-1D                                        381   1e-127   
ref|NP_001105588.1|  tubulin alpha-6 chain                              381   1e-127   
sp|Q43473.1|TBA1_HORVU  RecName: Full=Tubulin alpha-1 chain             381   1e-127   
gb|AGY80453.1|  tubulin                                                 381   1e-127   
ref|XP_002963092.1|  hypothetical protein SELMODRAFT_78469              381   1e-127   
emb|CAD24765.1|  alpha-tubulin                                          381   1e-127   
gb|ETW61813.1|  tubulin alpha chain                                     379   1e-127   
emb|CAL80740.1|  alpha-tubulin                                          381   1e-127   
ref|XP_011025144.1|  PREDICTED: tubulin alpha-3 chain                   381   1e-127   
ref|XP_010934670.1|  PREDICTED: tubulin alpha-3 chain-like              381   2e-127   
gb|AAL73386.1|AF408404_1  alpha-tubulin                                 381   2e-127   
ref|NP_001060075.1|  Os07g0574800                                       381   2e-127   
gb|AGD80034.1|  alpha-tubulin 1                                         381   2e-127   
gb|ABB16994.1|  unknown                                                 382   2e-127   
ref|XP_002303998.1|  alpha-tubulin 2 family protein                     381   2e-127   
sp|O22349.1|TBA3_ELEIN  RecName: Full=Tubulin alpha-3 chain; AltN...    381   2e-127   
emb|CAD26891.1|  alpha-tubulin                                          381   2e-127   
emb|CAA61255.1|  alpha tubulin                                          381   2e-127   
ref|XP_006657877.1|  PREDICTED: tubulin alpha-3 chain-like              381   2e-127   
emb|CDP00974.1|  unnamed protein product                                381   2e-127   
gb|AAU10519.1|  alpha tubulin                                           374   2e-127   
gb|KJB83375.1|  hypothetical protein B456_013G244600                    381   2e-127   
gb|AGG37284.1|  alpha-tubulin 2                                         381   2e-127   
ref|XP_010044940.1|  PREDICTED: tubulin alpha-3 chain                   381   2e-127   
gb|ABU93321.1|  tubulin alpha subunit                                   381   2e-127   
ref|XP_010257632.1|  PREDICTED: tubulin alpha-3 chain                   381   2e-127   
emb|CAD24768.1|  alpha-tubulin                                          381   2e-127   
dbj|BAJ98211.1|  predicted protein                                      381   2e-127   
gb|AHJ80822.1|  Tua1                                                    381   2e-127   
gb|ABC97356.1|  alpha tubulin                                           380   2e-127   
ref|XP_007205189.1|  hypothetical protein PRUPE_ppa005642mg             381   2e-127   
ref|XP_002532068.1|  tubulin alpha chain, putative                      381   2e-127   
sp|P33624.1|TBA2_ANEPH  RecName: Full=Tubulin alpha-2 chain             378   2e-127   
gb|ABO47735.1|  alpha-tubulin                                           381   3e-127   
ref|XP_010923361.1|  PREDICTED: tubulin alpha-3 chain                   381   3e-127   
gb|ETW20218.1|  tubulin alpha chain                                     379   3e-127   
ref|XP_008223650.1|  PREDICTED: tubulin alpha-3 chain-like              381   3e-127   
ref|XP_002779172.1|  Tubulin alpha chain, putative                      380   3e-127   
sp|Q08114.1|TBA_EUPOC  RecName: Full=Tubulin alpha chain                380   3e-127   
ref|XP_010112637.1|  Tubulin alpha-3 chain                              380   3e-127   
emb|CCI45804.1|  unnamed protein product                                380   3e-127   
gb|EPY40479.1|  tubulin alpha                                           373   3e-127   
gb|EPY39349.1|  tubulin alpha                                           375   3e-127   
gb|ETW45898.1|  tubulin alpha chain                                     379   3e-127   
ref|XP_009389058.1|  PREDICTED: tubulin alpha-3 chain-like              380   3e-127   
gb|ABO47741.1|  alpha-tubulin                                           380   3e-127   
gb|EUT86396.1|  tubulin alpha chain                                     379   3e-127   
gb|KCW87065.1|  hypothetical protein EUGRSUZ_B03604                     380   3e-127   
gb|EUR72656.1|  hypothetical protein PFBG_02365                         379   4e-127   
emb|CCA20146.1|  alpha tubulin 1 putative                               380   4e-127   
gb|KHG06861.1|  Tubulin alpha-6 chain                                   380   5e-127   
ref|XP_006650667.1|  PREDICTED: tubulin alpha-2 chain-like              380   5e-127   
ref|XP_001420620.1|  predicted protein                                  380   5e-127   
ref|XP_009622332.1|  PREDICTED: tubulin alpha-3 chain                   380   5e-127   
ref|XP_010276368.1|  PREDICTED: tubulin alpha-3 chain-like              380   6e-127   
ref|XP_001427643.1|  hypothetical protein                               372   6e-127   
gb|AAO23139.1|  alpha tubulin                                           380   6e-127   
gb|KJB48791.1|  hypothetical protein B456_008G087400                    378   6e-127   
emb|CEF99848.1|  Tubulin/FtsZ, 2-layer sandwich domain                  380   6e-127   
gb|AGG37286.1|  alpha-tubulin 4                                         380   7e-127   
ref|XP_011089722.1|  PREDICTED: tubulin alpha-3 chain                   380   7e-127   
gb|ETW56906.1|  tubulin alpha chain                                     379   7e-127   
ref|XP_011048194.1|  PREDICTED: tubulin alpha-6 chain-like              380   7e-127   
ref|XP_002297631.1|  alpha-tubulin 2 family protein                     380   7e-127   
ref|XP_003082284.1|  TBA_CHLVU Tubulin alpha chain (ISS)                380   7e-127   
ref|XP_004149645.1|  PREDICTED: tubulin alpha-3 chain-like              379   8e-127   
ref|XP_002980239.1|  hypothetical protein SELMODRAFT_233509             379   8e-127   
gb|ETW57405.1|  tubulin alpha chain                                     378   9e-127   
ref|XP_008449885.1|  PREDICTED: tubulin alpha-3 chain isoform X1        379   9e-127   
ref|XP_002973792.1|  hypothetical protein SELMODRAFT_100162             379   1e-126   
gb|ACJ04933.1|  alpha tubulin                                           371   1e-126   
gb|ABR67425.1|  alpha-tubulin 4                                         379   1e-126   
emb|CAD26887.1|  alpha-tubulin                                          379   1e-126   
emb|CCW60849.1|  unnamed protein product                                377   1e-126   
ref|XP_009353129.1|  PREDICTED: tubulin alpha-3 chain-like              379   1e-126   
ref|XP_008464962.1|  PREDICTED: tubulin alpha-3 chain-like              379   1e-126   
ref|XP_004141134.1|  PREDICTED: tubulin alpha-3 chain-like              379   1e-126   
ref|XP_008818311.1|  tubulin alpha chain                                379   1e-126   
ref|XP_008349406.1|  PREDICTED: tubulin alpha-3 chain                   379   1e-126   
emb|CAA65330.1|  alpha-tubulin                                          379   1e-126   
ref|XP_002788269.1|  Tubulin alpha chain, putative                      379   1e-126   
gb|ETW30983.1|  tubulin alpha chain                                     381   2e-126   
ref|XP_009375870.1|  PREDICTED: tubulin alpha-3 chain                   379   2e-126   
ref|XP_008351479.1|  PREDICTED: tubulin alpha-3 chain                   379   2e-126   
gb|EUD70907.1|  tubulin alpha chain                                     379   2e-126   
ref|XP_005839726.1|  hypothetical protein GUITHDRAFT_150645             379   2e-126   
ref|XP_004295008.1|  PREDICTED: tubulin alpha-3 chain isoform X1        379   2e-126   
emb|CAD26886.1|  alpha-tubulin                                          379   2e-126   
ref|XP_006286664.1|  hypothetical protein CARUB_v10002583mg             378   2e-126   
gb|EYU31677.1|  hypothetical protein MIMGU_mgv1a006281mg                378   2e-126   
gb|ETW38327.1|  tubulin alpha chain                                     378   2e-126   
ref|XP_008625823.1|  tubulin alpha chain                                378   2e-126   
gb|KHN06388.1|  Tubulin alpha-3 chain                                   377   3e-126   
ref|XP_724313.1|  hypothetical protein                                  378   3e-126   
ref|XP_004221286.1|  tubulin alpha chain                                378   3e-126   
gb|AGI78243.1|  alpha tubulin 5                                         370   3e-126   
ref|XP_001351526.1|  alpha-tubulin ii                                   378   3e-126   
gb|ABL61230.1|  alpha-tubulin                                           377   3e-126   
ref|XP_002786953.1|  Tubulin alpha chain, putative                      378   3e-126   
gb|AAO63773.2|  alpha-tubulin 2                                         378   3e-126   
ref|XP_008900811.1|  tubulin alpha chain                                378   3e-126   
sp|P09205.1|TBA2_CHLRE  RecName: Full=Tubulin alpha-2 chain             378   3e-126   
ref|XP_007014666.1|  Tubulin alpha-5                                    378   3e-126   
ref|XP_002904166.1|  alpha-tubulin, putative                            378   3e-126   
emb|CAA65329.1|  alpha-tubulin                                          378   4e-126   
ref|XP_001351911.1|  alpha tubulin                                      378   4e-126   
ref|XP_001615123.1|  tubulin alpha chain                                378   4e-126   
emb|CDU16580.1|  alpha tubulin 1                                        377   4e-126   



>ref|XP_004252814.1| PREDICTED: tubulin alpha-2 chain-like [Solanum lycopersicum]
Length=227

 Score =   395 bits (1015),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 186/188 (99%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV
Sbjct  20   FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  79

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  80   KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  139

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQ+AVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  140  PGGDLAKVQKAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  199

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  200  DLAALEKD  207



>emb|CAJ38386.1| alpha tubulin [Plantago major]
Length=270

 Score =   396 bits (1017),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 185/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITN+AFEPSSMMV
Sbjct  64   FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNTAFEPSSMMV  123

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  124  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  183

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  184  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  243

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  244  DLAALEKD  251



>gb|AHM93474.1| alpha-tubulin, partial [Camellia chekiangoleosa]
Length=327

 Score =   398 bits (1022),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 186/188 (99%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV
Sbjct  121  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  180

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  181  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  240

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  241  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  300

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  301  DLAALEKD  308



>gb|EYU34085.1| hypothetical protein MIMGU_mgv1a0196712mg, partial [Erythranthe 
guttata]
Length=217

 Score =   393 bits (1010),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSV+EITN+AFEPSSMMV
Sbjct  11   FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVSEITNTAFEPSSMMV  70

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  71   KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  130

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  131  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  190

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  191  DLAALEKD  198



>gb|KJB58759.1| hypothetical protein B456_009G224800 [Gossypium raimondii]
Length=340

 Score =   395 bits (1016),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  134  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  193

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  194  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  253

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  254  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  313

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  314  DLAALEKD  321



>gb|AFR42026.1| alpha-tubulin, partial [Populus trichocarpa]
Length=196

 Score =   390 bits (1002),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  5    FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  64

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  65   KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  124

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  125  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  184

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  185  DLAALEKD  192



>gb|AFR42020.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42021.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42022.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42023.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42024.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42025.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42027.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42028.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42029.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42030.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42031.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42032.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42033.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42034.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42037.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42038.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42039.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42041.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42045.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42046.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42048.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42056.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42057.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42058.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42059.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42060.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42061.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42062.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42063.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42064.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42065.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42066.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42067.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42068.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42069.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42070.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42071.1| alpha-tubulin, partial [Populus nigra]
Length=197

 Score =   390 bits (1001),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  5    FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  64

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  65   KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  124

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  125  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  184

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  185  DLAALEKD  192



>gb|AFR42035.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42040.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42044.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42052.1| alpha-tubulin, partial [Populus fremontii]
Length=196

 Score =   390 bits (1001),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  4    FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  63

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  64   KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  123

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  124  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  183

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  184  DLAALEKD  191



>gb|AFR42036.1| alpha-tubulin, partial [Populus alba]
Length=195

 Score =   389 bits (999),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  3    FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  62

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  63   KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  122

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  123  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  182

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  183  DLAALEKD  190



>gb|AFR42042.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42043.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42050.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42051.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42053.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42055.1| alpha-tubulin, partial [Populus fremontii]
Length=194

 Score =   389 bits (999),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  2    FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  61

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  62   KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  121

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  122  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  181

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  182  DLAALEKD  189



>gb|EPS62716.1| alpha-tubulin, partial [Genlisea aurea]
Length=404

 Score =   397 bits (1019),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 185/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITN+AFEPSSMMV
Sbjct  198  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNTAFEPSSMMV  257

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  258  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  317

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  318  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  377

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  378  DLAALEKD  385



>ref|XP_006433708.1| hypothetical protein CICLE_v100015522mg, partial [Citrus clementina]
 gb|ESR46948.1| hypothetical protein CICLE_v100015522mg, partial [Citrus clementina]
Length=218

 Score =   389 bits (1000),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKA+HEQLSVAEITNSAFEPSSMM 
Sbjct  11   FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVAEITNSAFEPSSMMA  70

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  71   KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  130

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  131  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  190

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  191  DLAALEKD  198



>gb|AHJ80819.1| Tua1, partial [Eragrostis tef]
Length=243

 Score =   390 bits (1002),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  36   FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  95

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VV
Sbjct  96   KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVV  155

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  156  PGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  215

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  216  DLAALEKD  223



>gb|KJB32211.1| hypothetical protein B456_005G229600 [Gossypium raimondii]
Length=361

 Score =   394 bits (1012),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  155  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  214

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  215  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  274

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  275  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  334

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  335  DLAALEKD  342



>gb|AAW57305.1| alpha-tubulin, partial [Ceratopteris richardii]
Length=306

 Score =   392 bits (1007),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  100  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  159

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  160  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  219

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRA+CMISNSTSVAEVFSRID KFDLMYCKRAFVHWYVGEGMEEGEFSEARE
Sbjct  220  PGGDLAKVQRAICMISNSTSVAEVFSRIDFKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  279

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  280  DLAALEKD  287



>ref|XP_009614122.1| PREDICTED: tubulin alpha-3 chain [Nicotiana tomentosiformis]
 ref|XP_009787472.1| PREDICTED: tubulin alpha-3 chain [Nicotiana sylvestris]
 emb|CAD13177.1| alpha-tubulin [Nicotiana tabacum]
Length=451

 Score =   397 bits (1020),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 187/188 (99%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV
Sbjct  244  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_004238046.1| PREDICTED: tubulin alpha chain [Solanum lycopersicum]
Length=450

 Score =   397 bits (1020),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 187/188 (99%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV
Sbjct  244  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>gb|AAW57309.1| alpha-tubulin, partial [Ceratopteris richardii]
Length=266

 Score =   390 bits (1002),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  59   FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  118

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  119  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  178

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRID+KFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  179  PGGDLAKVQRAVCMISNSTSVAEVFSRIDYKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  238

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  239  DLAALEKD  246



>ref|XP_009790136.1| PREDICTED: tubulin alpha chain [Nicotiana sylvestris]
Length=450

 Score =   397 bits (1019),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 187/188 (99%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV
Sbjct  244  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>gb|AAW57310.1| alpha-tubulin, partial [Ceratopteris richardii]
 gb|AAW57311.1| alpha-tubulin, partial [Ceratopteris richardii]
 gb|AAW57313.1| alpha-tubulin, partial [Ceratopteris richardii]
Length=267

 Score =   390 bits (1002),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  60   FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  119

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  120  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  179

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRID+KFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  180  PGGDLAKVQRAVCMISNSTSVAEVFSRIDYKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  239

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  240  DLAALEKD  247



>ref|XP_009620798.1| PREDICTED: tubulin alpha chain [Nicotiana tomentosiformis]
Length=450

 Score =   397 bits (1019),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 187/188 (99%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV
Sbjct  244  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>emb|CAD13176.1| alpha-tubulin [Nicotiana tabacum]
Length=450

 Score =   397 bits (1019),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 187/188 (99%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV
Sbjct  244  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_006356798.1| PREDICTED: tubulin alpha chain-like [Solanum tuberosum]
Length=450

 Score =   397 bits (1019),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 187/188 (99%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV
Sbjct  244  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|NP_001275271.1| alpha-tubulin-like protein [Solanum tuberosum]
 gb|ABB72803.1| alpha-tubulin-like protein [Solanum tuberosum]
Length=452

 Score =   397 bits (1019),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 187/188 (99%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV
Sbjct  245  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  304

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  305  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  364

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  365  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  424

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  425  DLAALEKD  432



>gb|ABB02631.1| unknown [Solanum tuberosum]
Length=450

 Score =   397 bits (1019),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 187/188 (99%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV
Sbjct  244  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>gb|ABP65320.1| alpha tubulin [Capsicum annuum]
Length=450

 Score =   397 bits (1019),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 187/188 (99%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV
Sbjct  244  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>gb|ACH68563.1| alpha-tubulin [Solanum tuberosum]
Length=449

 Score =   396 bits (1018),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 187/188 (99%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV
Sbjct  243  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  302

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  303  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  362

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  363  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  422

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  423  DLAALEKD  430



>ref|XP_006362511.1| PREDICTED: tubulin alpha-1 chain-like [Solanum tuberosum]
Length=450

 Score =   396 bits (1018),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 187/188 (99%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV
Sbjct  244  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_004244533.1| PREDICTED: tubulin alpha-3 chain-like [Solanum lycopersicum]
Length=451

 Score =   396 bits (1018),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 187/188 (99%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV
Sbjct  244  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>gb|ABC59068.2| alpha tubulin 1 [Camellia sinensis]
Length=450

 Score =   396 bits (1018),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 186/188 (99%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV
Sbjct  244  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_009605705.1| PREDICTED: tubulin alpha-2 chain-like [Nicotiana tomentosiformis]
 ref|XP_009761158.1| PREDICTED: tubulin alpha-2 chain-like [Nicotiana sylvestris]
 emb|CAD13178.1| alpha-tubulin [Nicotiana tabacum]
Length=451

 Score =   396 bits (1018),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 187/188 (99%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV
Sbjct  244  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>emb|CAB76917.1| alpha-tubulin 4 [Hordeum vulgare subsp. vulgare]
Length=289

 Score =   390 bits (1002),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSV+EITNSAFEPSSMM 
Sbjct  82   FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVSEITNSAFEPSSMMA  141

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  142  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  201

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  202  PGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  261

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  262  DLAALEKD  269



>emb|CAA52158.1| alpha tubulin [Zea mays]
Length=256

 Score =   389 bits (998),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  49   FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  108

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VV
Sbjct  109  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVV  168

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  169  PGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  228

Query  224  DLAALEKD  201
            DL ALEKD
Sbjct  229  DLRALEKD  236



>ref|WP_039310890.1| hypothetical protein, partial [Paenibacillus sp. IHB B 3415]
 gb|KHL91192.1| hypothetical protein QW71_36085, partial [Paenibacillus sp. IHB 
B 3415]
Length=453

 Score =   396 bits (1017),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 186/188 (99%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV
Sbjct  248  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  307

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  308  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  367

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  368  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  427

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  428  DLAALEKD  435



>gb|EYU34660.1| hypothetical protein MIMGU_mgv1a006269mg [Erythranthe guttata]
Length=450

 Score =   395 bits (1015),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 185/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITN+AFEPSSMMV
Sbjct  244  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNTAFEPSSMMV  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>gb|AFR42054.1| alpha-tubulin, partial [Populus fremontii]
Length=196

 Score =   386 bits (991),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 183/188 (97%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTN  PYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  4    FDGALNVDVTEFQTNXXPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  63

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  64   KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  123

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  124  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  183

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  184  DLAALEKD  191



>gb|AFR42049.1| alpha-tubulin, partial [Populus fremontii]
Length=197

 Score =   386 bits (991),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 183/188 (97%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTN  PYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  5    FDGALNVDVTEFQTNXXPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  64

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  65   KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  124

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  125  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  184

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  185  DLAALEKD  192



>gb|KJB58756.1| hypothetical protein B456_009G224800 [Gossypium raimondii]
Length=415

 Score =   394 bits (1012),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  209  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  268

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  269  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  328

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  329  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  388

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  389  DLAALEKD  396



>dbj|BAB19779.1| alpha tubulin [Nicotiana tabacum]
Length=450

 Score =   395 bits (1015),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 186/188 (99%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV
Sbjct  244  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRA VHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRALVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>dbj|BAH19954.1| AT1G50010 [Arabidopsis thaliana]
Length=248

 Score =   387 bits (995),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 181/188 (96%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKA+HEQLSVAEITNSAFEP+SMM 
Sbjct  42   FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVAEITNSAFEPASMMA  101

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  102  KCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVV  161

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  162  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  221

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  222  DLAALEKD  229



>gb|KGN48654.1| hypothetical protein Csa_6G497050 [Cucumis sativus]
Length=415

 Score =   394 bits (1011),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  209  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  268

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  269  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  328

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  329  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  388

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  389  DLAALEKD  396



>gb|AAW57306.1| alpha-tubulin, partial [Ceratopteris richardii]
 gb|AAW57308.1| alpha-tubulin, partial [Ceratopteris richardii]
Length=257

 Score =   387 bits (995),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 178/188 (95%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVD+ EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEP+SMM 
Sbjct  50   FDGALNVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMA  109

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACC+M+RGDVVPKDVNA+VATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  110  KCDPRHGKYMACCMMYRGDVVPKDVNASVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  169

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTS+AEVFSR+DHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  170  PGGDLAKVQRAVCMISNSTSIAEVFSRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  229

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  230  DLAALEKD  237



>ref|NP_001291325.1| tubulin alpha chain-like [Sesamum indicum]
 gb|AFJ42573.1| alpha-tubulin [Sesamum indicum]
Length=450

 Score =   395 bits (1014),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 185/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITN+AFEPSSMMV
Sbjct  244  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNTAFEPSSMMV  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>gb|KIY91712.1| Tubulin alpha chain [Monoraphidium neglectum]
Length=249

 Score =   387 bits (994),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 179/188 (95%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVD+ EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEP+SMM 
Sbjct  42   FDGALNVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMA  101

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNA+VATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  102  KCDPRHGKYMACCLMYRGDVVPKDVNASVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  161

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNST+VAEVFSR+DHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  162  PGGDLAKVQRAVCMISNSTAVAEVFSRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  221

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  222  DLAALEKD  229



>gb|AFR42047.1| alpha-tubulin, partial [Populus fremontii]
Length=194

 Score =   385 bits (988),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 183/188 (97%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTN  PYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  2    FDGALNVDVTEFQTNXXPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  61

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  62   KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  121

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  122  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  181

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  182  DLAALEKD  189



>emb|CDP02221.1| unnamed protein product [Coffea canephora]
Length=449

 Score =   394 bits (1013),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 185/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITN+AFEPSSMMV
Sbjct  244  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNTAFEPSSMMV  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>gb|KDO81349.1| hypothetical protein CISIN_1g013037mg [Citrus sinensis]
Length=355

 Score =   391 bits (1004),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKA+HEQLSVAEITNSAFEPSSMM 
Sbjct  148  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVAEITNSAFEPSSMMA  207

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  208  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  267

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  268  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  327

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  328  DLAALEKD  335



>ref|XP_011098608.1| PREDICTED: tubulin alpha chain [Sesamum indicum]
Length=450

 Score =   394 bits (1013),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 185/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITN+AFEPSSMMV
Sbjct  244  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNTAFEPSSMMV  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_004232226.1| PREDICTED: tubulin alpha chain-like [Solanum lycopersicum]
 ref|XP_006338460.1| PREDICTED: tubulin alpha-3 chain-like isoform X1 [Solanum tuberosum]
Length=450

 Score =   394 bits (1012),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 185/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITN+AFEPSSMMV
Sbjct  244  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNTAFEPSSMMV  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_009626810.1| PREDICTED: tubulin alpha chain-like [Nicotiana tomentosiformis]
 ref|XP_009785294.1| PREDICTED: tubulin alpha chain-like [Nicotiana sylvestris]
Length=450

 Score =   394 bits (1012),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 185/188 (98%), Positives = 187/188 (99%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITN+AFEPSSMMV
Sbjct  244  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNTAFEPSSMMV  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>gb|AFW67749.1| alpha tubulin4 [Zea mays]
Length=321

 Score =   389 bits (998),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  114  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  173

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VV
Sbjct  174  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVV  233

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  234  PGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  293

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  294  DLAALEKD  301



>gb|ADW83724.1| alpha-tubulin [Musa acuminata AAA Group]
Length=423

 Score =   392 bits (1008),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  216  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  275

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VV
Sbjct  276  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVV  335

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  336  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  395

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  396  DLAALEKD  403



>gb|AAX96763.1| Tubulin/FtsZ family, GTPase domain, putative [Oryza sativa Japonica 
Group]
 gb|ABA92354.1| Tubulin alpha-3 chain, putative, expressed [Oryza sativa Japonica 
Group]
Length=346

 Score =   390 bits (1001),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  139  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  198

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VV
Sbjct  199  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVV  258

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSV EVFSRID KFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  259  PGGDLAKVQRAVCMISNSTSVVEVFSRIDIKFDLMYSKRAFVHWYVGEGMEEGEFSEARE  318

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  319  DLAALEKD  326



>gb|KDO49533.1| hypothetical protein CISIN_1g013062mg [Citrus sinensis]
Length=431

 Score =   392 bits (1007),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  225  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  284

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  285  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  344

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  345  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  404

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  405  DLAALEKD  412



>gb|EYU37544.1| hypothetical protein MIMGU_mgv1a007145mg [Erythranthe guttata]
Length=417

 Score =   391 bits (1005),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  210  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  269

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  270  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  329

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  330  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  389

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  390  DLAALEKD  397



>ref|XP_003608582.1| Tubulin alpha-5 chain [Medicago truncatula]
 gb|AES90779.1| tubulin beta-1 chain [Medicago truncatula]
Length=451

 Score =   392 bits (1008),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_002959708.1| alpha tubulin [Volvox carteri f. nagariensis]
 gb|EFJ39226.1| alpha tubulin [Volvox carteri f. nagariensis]
Length=255

 Score =   385 bits (989),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 177/188 (94%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAP+ISAEKAYHEQLSVAEITN+AFEP+SMMV
Sbjct  48   FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPIISAEKAYHEQLSVAEITNAAFEPASMMV  107

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  108  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  167

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNST++ E+FSR+DHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  168  PGGDLAKVQRAVCMISNSTAIGEIFSRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  227

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  228  DLAALEKD  235



>ref|XP_010245599.1| PREDICTED: tubulin alpha chain-like [Nelumbo nucifera]
Length=451

 Score =   392 bits (1008),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_002510010.1| tubulin alpha chain, putative [Ricinus communis]
 ref|XP_006852746.1| hypothetical protein AMTR_s00033p00112490 [Amborella trichopoda]
 gb|EEF52197.1| tubulin alpha chain, putative [Ricinus communis]
 gb|ERN14213.1| hypothetical protein AMTR_s00033p00112490 [Amborella trichopoda]
Length=451

 Score =   392 bits (1008),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>gb|KDP44552.1| hypothetical protein JCGZ_16385 [Jatropha curcas]
Length=450

 Score =   392 bits (1008),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>gb|ACJ60905.1| alpha tubulin [Betula pendula]
Length=450

 Score =   392 bits (1008),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>gb|ABX57816.1| alpha tubulin [Picea wilsonii]
Length=451

 Score =   392 bits (1008),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>gb|AIX10966.1| tubulin [Ornithogalum saundersiae]
Length=451

 Score =   392 bits (1008),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>gb|AAV92352.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92353.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92354.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92355.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92356.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92357.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92358.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92359.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92360.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92361.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92362.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92363.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92364.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92365.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92366.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92367.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92368.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92369.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92370.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92371.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92372.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92373.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92374.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92375.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92376.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92377.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92378.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92379.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|ACN40661.1| unknown [Picea sitchensis]
 gb|ACN40854.1| unknown [Picea sitchensis]
 gb|ACN40972.1| unknown [Picea sitchensis]
 gb|ACN41102.1| unknown [Picea sitchensis]
 gb|AIZ74331.1| alpha-tubulin [Pinus massoniana]
Length=451

 Score =   392 bits (1008),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_006422747.1| hypothetical protein CICLE_v10028426mg [Citrus clementina]
 ref|XP_006486878.1| PREDICTED: tubulin alpha chain-like isoform X1 [Citrus sinensis]
 gb|ESR35987.1| hypothetical protein CICLE_v10028426mg [Citrus clementina]
 gb|KDO49534.1| hypothetical protein CISIN_1g013062mg [Citrus sinensis]
Length=450

 Score =   392 bits (1008),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_010936237.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
Length=451

 Score =   392 bits (1008),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_010943272.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
Length=451

 Score =   392 bits (1008),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_003635553.2| PREDICTED: tubulin alpha chain-like [Vitis vinifera]
Length=451

 Score =   392 bits (1008),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_011457777.1| PREDICTED: tubulin alpha chain [Fragaria vesca subsp. vesca]
Length=450

 Score =   392 bits (1008),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_009335354.1| PREDICTED: tubulin alpha chain [Pyrus x bretschneideri]
Length=450

 Score =   392 bits (1008),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_010266793.1| PREDICTED: tubulin alpha chain [Nelumbo nucifera]
Length=451

 Score =   392 bits (1008),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_001764722.1| predicted protein [Physcomitrella patens]
 gb|EDQ70421.1| predicted protein [Physcomitrella patens]
Length=451

 Score =   392 bits (1008),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_007199840.1| hypothetical protein PRUPE_ppa005633mg [Prunus persica]
 ref|XP_008236252.1| PREDICTED: tubulin alpha chain isoform X1 [Prunus mume]
 gb|EMJ01039.1| hypothetical protein PRUPE_ppa005633mg [Prunus persica]
Length=450

 Score =   392 bits (1008),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_010939312.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
Length=451

 Score =   392 bits (1008),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_006426173.1| hypothetical protein CICLE_v10025588mg [Citrus clementina]
 gb|ESR39413.1| hypothetical protein CICLE_v10025588mg [Citrus clementina]
Length=451

 Score =   392 bits (1008),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_007018369.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOY15594.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=451

 Score =   392 bits (1008),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>gb|ABO47740.1| alpha-tubulin [Gossypium hirsutum]
 gb|ACM89777.1| alpha-tubulin 10 [Gossypium hirsutum]
 gb|KHG24734.1| Tubulin alpha chain [Gossypium arboreum]
 gb|KJB58758.1| hypothetical protein B456_009G224800 [Gossypium raimondii]
Length=450

 Score =   392 bits (1008),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|NP_001289660.1| tubulin alpha chain-like [Eucalyptus grandis]
 gb|ABS50670.1| alpha-tubulin [Eucalyptus grandis]
Length=451

 Score =   392 bits (1008),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_004288297.1| PREDICTED: tubulin alpha-3 chain [Fragaria vesca subsp. vesca]
Length=451

 Score =   392 bits (1008),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>gb|ABO47739.1| alpha-tubulin [Gossypium hirsutum]
 gb|KHG18532.1| Tubulin alpha-2 chain [Gossypium arboreum]
Length=450

 Score =   392 bits (1007),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_008787237.1| PREDICTED: tubulin alpha chain [Phoenix dactylifera]
 ref|XP_010941981.1| PREDICTED: tubulin alpha chain [Elaeis guineensis]
Length=451

 Score =   392 bits (1008),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_008372961.1| PREDICTED: tubulin alpha chain isoform X1 [Malus domestica]
Length=450

 Score =   392 bits (1007),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>gb|ACN40181.1| unknown [Picea sitchensis]
 gb|ACN40840.1| unknown [Picea sitchensis]
Length=450

 Score =   392 bits (1007),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_002283198.1| PREDICTED: tubulin alpha chain [Vitis vinifera]
 ref|XP_006827169.1| hypothetical protein AMTR_s00010p00254750 [Amborella trichopoda]
 ref|XP_010939541.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
 gb|ERM94406.1| hypothetical protein AMTR_s00010p00254750 [Amborella trichopoda]
Length=450

 Score =   392 bits (1007),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_009335355.1| PREDICTED: tubulin alpha chain-like [Pyrus x bretschneideri]
Length=450

 Score =   392 bits (1007),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_002522104.1| tubulin alpha chain, putative [Ricinus communis]
 gb|EEF40304.1| tubulin alpha chain, putative [Ricinus communis]
Length=450

 Score =   392 bits (1007),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>sp|P33629.1|TBA_PRUDU RecName: Full=Tubulin alpha chain [Prunus dulcis]
 emb|CAA47635.1| alpha-tubulin [Prunus dulcis]
Length=450

 Score =   392 bits (1007),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>gb|KDP32140.1| hypothetical protein JCGZ_12601 [Jatropha curcas]
Length=450

 Score =   392 bits (1007),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_004150268.1| PREDICTED: tubulin alpha chain-like [Cucumis sativus]
 ref|XP_004156870.1| PREDICTED: tubulin alpha chain-like [Cucumis sativus]
 ref|XP_008454421.1| PREDICTED: tubulin alpha chain [Cucumis melo]
 gb|ADN33817.1| tubulin alpha chain [Cucumis melo subsp. melo]
 gb|KGN52737.1| Tubulin alpha chain [Cucumis sativus]
Length=450

 Score =   392 bits (1007),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV
Sbjct  244  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLA+VQRAVC ISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLARVQRAVCKISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_010242419.1| PREDICTED: tubulin alpha-1 chain [Nelumbo nucifera]
Length=451

 Score =   392 bits (1007),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>sp|Q6VAF9.1|TBA4_GOSHI RecName: Full=Tubulin alpha-4 chain; AltName: Full=Alpha-4-tubulin 
[Gossypium hirsutum]
 gb|AAQ92663.1| alpha-tubulin 4 [Gossypium hirsutum]
Length=450

 Score =   392 bits (1007),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYTKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_004136930.1| PREDICTED: tubulin alpha-4 chain-like [Cucumis sativus]
 ref|XP_004155416.1| PREDICTED: tubulin alpha-4 chain-like [Cucumis sativus]
 gb|KGN43837.1| Tubulin alpha chain [Cucumis sativus]
Length=450

 Score =   392 bits (1007),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_010093625.1| Tubulin alpha chain [Morus notabilis]
 gb|EXB54386.1| Tubulin alpha chain [Morus notabilis]
Length=451

 Score =   392 bits (1007),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_006466394.1| PREDICTED: tubulin alpha-3 chain-like isoform X1 [Citrus sinensis]
Length=451

 Score =   392 bits (1007),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_008804464.1| PREDICTED: tubulin alpha chain-like [Phoenix dactylifera]
Length=450

 Score =   392 bits (1007),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>gb|AFW67748.1| alpha tubulin4 [Zea mays]
Length=364

 Score =   389 bits (999),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  157  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  216

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VV
Sbjct  217  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVV  276

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  277  PGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  336

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  337  DLAALEKD  344



>ref|XP_007032501.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOY03427.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=450

 Score =   392 bits (1007),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_004143417.1| PREDICTED: tubulin alpha chain-like [Cucumis sativus]
 ref|XP_004160931.1| PREDICTED: tubulin alpha chain-like [Cucumis sativus]
Length=450

 Score =   392 bits (1007),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>gb|KHG18997.1| Tubulin alpha chain [Gossypium arboreum]
 gb|KJB32210.1| hypothetical protein B456_005G229600 [Gossypium raimondii]
Length=450

 Score =   392 bits (1007),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_002275973.1| PREDICTED: tubulin alpha chain [Vitis vinifera]
Length=450

 Score =   392 bits (1007),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>emb|CAN62392.1| hypothetical protein VITISV_016172 [Vitis vinifera]
Length=435

 Score =   392 bits (1006),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  229  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  288

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  289  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  348

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  349  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  408

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  409  DLAALEKD  416



>ref|XP_008455054.1| PREDICTED: tubulin alpha-4 chain isoform X1 [Cucumis melo]
Length=451

 Score =   392 bits (1007),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>sp|P46259.1|TBA1_PEA RecName: Full=Tubulin alpha-1 chain [Pisum sativum]
 gb|AAA79910.1| alpha-tubulin [Pisum sativum]
Length=452

 Score =   392 bits (1007),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>gb|ABO47736.1| alpha-tubulin [Gossypium hirsutum]
 gb|ACM89778.1| alpha-tubulin 6 [Gossypium hirsutum]
Length=450

 Score =   392 bits (1007),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>gb|AID52921.1| tubulin alpha chain [Carthamus tinctorius]
Length=450

 Score =   392 bits (1007),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_008621874.1| tubulin alpha, partial [Saprolegnia diclina VS20]
 gb|EQC24696.1| tubulin alpha, partial [Saprolegnia diclina VS20]
Length=273

 Score =   385 bits (990),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 177/188 (94%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEP+SMM 
Sbjct  64   FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMA  123

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMA CLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  124  KCDPRHGKYMAACLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  183

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLA+VQRAVCMISN++++AEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  184  PGGDLARVQRAVCMISNTSAIAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  243

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  244  DLAALEKD  251



>gb|KDP41548.1| hypothetical protein JCGZ_15955 [Jatropha curcas]
Length=451

 Score =   392 bits (1007),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_002981542.1| hypothetical protein SELMODRAFT_178975 [Selaginella moellendorffii]
 gb|EFJ17357.1| hypothetical protein SELMODRAFT_178975 [Selaginella moellendorffii]
Length=449

 Score =   392 bits (1007),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_010531321.1| PREDICTED: tubulin alpha chain isoform X1 [Tarenaya hassleriana]
Length=450

 Score =   392 bits (1007),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_010256937.1| PREDICTED: tubulin alpha chain-like [Nelumbo nucifera]
Length=450

 Score =   392 bits (1007),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_010099392.1| Tubulin alpha chain [Morus notabilis]
 ref|XP_010105098.1| Tubulin alpha chain [Morus notabilis]
 gb|EXB78237.1| Tubulin alpha chain [Morus notabilis]
 gb|EXC03883.1| Tubulin alpha chain [Morus notabilis]
Length=467

 Score =   392 bits (1008),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  260  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  319

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  320  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  379

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  380  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  439

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  440  DLAALEKD  447



>ref|XP_010065856.1| PREDICTED: tubulin alpha chain [Eucalyptus grandis]
 gb|KCW63554.1| hypothetical protein EUGRSUZ_G01186 [Eucalyptus grandis]
Length=450

 Score =   392 bits (1007),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_008440459.1| PREDICTED: tubulin alpha chain-like isoform X1 [Cucumis melo]
Length=450

 Score =   392 bits (1006),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>gb|AGG37283.1| alpha-tubulin 1 [Salix arbutifolia]
Length=451

 Score =   392 bits (1006),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_010555432.1| PREDICTED: tubulin alpha chain-like [Tarenaya hassleriana]
Length=450

 Score =   392 bits (1006),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_010526692.1| PREDICTED: tubulin alpha chain-like [Tarenaya hassleriana]
Length=450

 Score =   392 bits (1006),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_003522731.1| PREDICTED: tubulin alpha-4 chain isoform X1 [Glycine max]
Length=452

 Score =   392 bits (1006),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_007137281.1| hypothetical protein PHAVU_009G114100g [Phaseolus vulgaris]
 gb|ESW09275.1| hypothetical protein PHAVU_009G114100g [Phaseolus vulgaris]
Length=451

 Score =   392 bits (1006),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_007205183.1| hypothetical protein PRUPE_ppa005613mg [Prunus persica]
 ref|XP_008236958.1| PREDICTED: tubulin alpha chain-like isoform X1 [Prunus mume]
 gb|EMJ06382.1| hypothetical protein PRUPE_ppa005613mg [Prunus persica]
Length=451

 Score =   392 bits (1006),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_002301128.1| hypothetical protein POPTR_0002s11250g [Populus trichocarpa]
 ref|XP_011017025.1| PREDICTED: tubulin alpha chain-like isoform X1 [Populus euphratica]
 ref|XP_011017026.1| PREDICTED: tubulin alpha chain-like isoform X1 [Populus euphratica]
 ref|XP_011017027.1| PREDICTED: tubulin alpha chain-like isoform X2 [Populus euphratica]
 gb|AAO63781.1| alpha-tubulin 1 [Populus tremuloides]
 gb|ABK96001.1| unknown [Populus trichocarpa]
 gb|EEE80401.1| hypothetical protein POPTR_0002s11250g [Populus trichocarpa]
Length=451

 Score =   392 bits (1006),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_004501073.1| PREDICTED: tubulin alpha chain-like [Cicer arietinum]
Length=451

 Score =   392 bits (1006),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_003603670.1| Tubulin alpha-7 chain [Medicago truncatula]
 gb|AES73921.1| tubulin beta-1 chain [Medicago truncatula]
Length=451

 Score =   392 bits (1006),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>gb|AHJ80823.1| Tua1 [Eragrostis tef]
Length=451

 Score =   392 bits (1006),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_007042689.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOX98520.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=450

 Score =   392 bits (1006),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>gb|AEQ75493.1| alpha-tubulin [Rosa multiflora]
Length=440

 Score =   391 bits (1005),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEP+SMM 
Sbjct  233  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMA  292

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  293  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  352

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  353  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  412

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  413  DLAALEKD  420



>gb|AGG37289.1| alpha-tubulin 7 [Salix arbutifolia]
Length=450

 Score =   391 bits (1005),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE+TNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEVTNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_011008936.1| PREDICTED: tubulin alpha chain [Populus euphratica]
Length=451

 Score =   392 bits (1006),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE+TNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEVTNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>gb|AIX10773.1| alpha tubulin [Panax notoginseng]
Length=451

 Score =   391 bits (1005),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_008665337.1| PREDICTED: tubulin alpha-1 chain-like [Zea mays]
 sp|P14640.1|TBA1_MAIZE RecName: Full=Tubulin alpha-1 chain; AltName: Full=Alpha-1-tubulin 
[Zea mays]
 emb|CAA33734.1| alpha1-tubulin [Zea mays]
 tpg|DAA51112.1| TPA: tubulin alpha-1 chain [Zea mays]
 tpg|DAA51113.1| TPA: tubulin alpha-1 chain [Zea mays]
 tpg|DAA51114.1| TPA: tubulin alpha-1 chain [Zea mays]
 tpg|DAA51117.1| TPA: tubulin alpha-1 chain [Zea mays]
Length=451

 Score =   391 bits (1005),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_008665339.1| PREDICTED: tubulin alpha-2 chain [Zea mays]
 sp|P14641.1|TBA2_MAIZE RecName: Full=Tubulin alpha-2 chain; AltName: Full=Alpha-2-tubulin 
[Zea mays]
 emb|CAA33733.1| alpha2-tubulin [Zea mays]
 tpg|DAA51111.1| TPA: tubulin alpha-2 chain [Zea mays]
Length=451

 Score =   391 bits (1005),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>sp|O22347.1|TBA1_ELEIN RecName: Full=Tubulin alpha-1 chain; AltName: Full=Alpha-1-tubulin 
[Eleusine indica]
 gb|AAC05717.1| alpha tubulin 1 [Eleusine indica]
 emb|CAA06618.1| alpha-tubulin 1 [Eleusine indica]
 gb|AFC88823.1| putative tubulin alpha-1 chain [Miscanthus sinensis]
 gb|AFC88833.1| tubulin alpha-1 chain [Miscanthus sinensis]
Length=451

 Score =   391 bits (1005),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>gb|AFC88832.1| putative tubulin alpha-3 chain [Miscanthus sinensis]
Length=451

 Score =   391 bits (1005),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_002324047.2| hypothetical protein POPTR_0017s11740g [Populus trichocarpa]
 gb|EEF04180.2| hypothetical protein POPTR_0017s11740g [Populus trichocarpa]
Length=454

 Score =   391 bits (1005),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE+TNSAFEPSSMM 
Sbjct  247  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEVTNSAFEPSSMMA  306

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  307  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  366

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  367  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  426

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  427  DLAALEKD  434



>gb|KHN08201.1| Tubulin alpha chain [Glycine soja]
Length=457

 Score =   392 bits (1006),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 184/188 (98%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  249  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  308

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  309  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  368

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  369  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  428

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  429  DLAALEKD  436



>ref|XP_010680774.1| PREDICTED: tubulin alpha-2 chain [Beta vulgaris subsp. vulgaris]
Length=451

 Score =   391 bits (1005),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEIT SAFEPSSMM 
Sbjct  244  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITTSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>sp|P33623.1|TBA1_ANEPH RecName: Full=Tubulin alpha-1 chain [Anemia phyllitidis]
 emb|CAA48927.1| alpha tubulin [Anemia phyllitidis]
Length=451

 Score =   391 bits (1005),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEP+SMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>dbj|BAJ06362.1| alpha-tubulin [Alopecurus aequalis]
Length=451

 Score =   391 bits (1005),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|NP_001167663.1| tubulin alpha-3 chain [Zea mays]
 gb|ACG26907.1| tubulin alpha-3 chain [Zea mays]
 gb|AFW67746.1| alpha tubulin4 isoform 1 [Zea mays]
 gb|AFW67747.1| alpha tubulin4 isoform 2 [Zea mays]
Length=451

 Score =   391 bits (1005),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_003560377.1| PREDICTED: tubulin alpha-1 chain [Brachypodium distachyon]
Length=451

 Score =   391 bits (1005),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>gb|AGG37285.1| alpha-tubulin 3 [Salix arbutifolia]
Length=451

 Score =   391 bits (1005),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEP+SMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_004981922.1| PREDICTED: tubulin alpha-1 chain-like [Setaria italica]
 emb|CAE52515.1| alpha tubulin [Setaria viridis]
Length=451

 Score =   391 bits (1005),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_009402887.1| PREDICTED: tubulin alpha chain [Musa acuminata subsp. malaccensis]
Length=451

 Score =   391 bits (1005),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_008787760.1| PREDICTED: tubulin alpha chain-like [Phoenix dactylifera]
Length=451

 Score =   391 bits (1005),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSV+EITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVSEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_002298794.2| TUBULIN ALPHA CHAIN family protein [Populus trichocarpa]
 gb|EEE83599.2| TUBULIN ALPHA CHAIN family protein [Populus trichocarpa]
Length=451

 Score =   391 bits (1005),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEP+SMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>emb|CAA06619.1| alpha-tubulin 1 [Eleusine indica]
Length=451

 Score =   391 bits (1005),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_002466535.1| hypothetical protein SORBIDRAFT_01g009570 [Sorghum bicolor]
 gb|EER93533.1| hypothetical protein SORBIDRAFT_01g009570 [Sorghum bicolor]
 gb|ACX70682.1| tubulin alpha-2-like protein [Sorghum bicolor]
Length=452

 Score =   391 bits (1005),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  245  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  304

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VV
Sbjct  305  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVV  364

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  365  PGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  424

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  425  DLAALEKD  432



>ref|XP_011030289.1| PREDICTED: tubulin alpha-4 chain [Populus euphratica]
Length=451

 Score =   391 bits (1004),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEP+SMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_006404742.1| hypothetical protein EUTSA_v10000161mg [Eutrema salsugineum]
 gb|ESQ46195.1| hypothetical protein EUTSA_v10000161mg [Eutrema salsugineum]
Length=451

 Score =   391 bits (1004),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITN+AFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNTAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>gb|AHJ80815.1| Tua1 [Eragrostis tef]
Length=451

 Score =   391 bits (1004),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_006650518.1| PREDICTED: tubulin alpha-1 chain-like [Oryza brachyantha]
Length=451

 Score =   391 bits (1004),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP++V
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSIV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_004299843.1| PREDICTED: tubulin alpha chain-like [Fragaria vesca subsp. vesca]
 gb|AAK81858.1|AF394915_1 alpha tubulin subunit [Rosa hybrid cultivar]
Length=451

 Score =   391 bits (1004),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEP+SMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>gb|ABK92520.1| unknown [Populus trichocarpa]
Length=451

 Score =   391 bits (1004),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEP+SMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_007223365.1| hypothetical protein PRUPE_ppa005617mg [Prunus persica]
 ref|XP_008219156.1| PREDICTED: tubulin alpha chain-like isoform X1 [Prunus mume]
 ref|XP_008347836.1| PREDICTED: tubulin alpha chain isoform X1 [Malus domestica]
 ref|XP_008352750.1| PREDICTED: tubulin alpha chain isoform X1 [Malus domestica]
 ref|XP_009357230.1| PREDICTED: tubulin alpha chain-like isoform X1 [Pyrus x bretschneideri]
 ref|XP_009335481.1| PREDICTED: tubulin alpha chain-like [Pyrus x bretschneideri]
 gb|EMJ24564.1| hypothetical protein PRUPE_ppa005617mg [Prunus persica]
Length=451

 Score =   391 bits (1004),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEP+SMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_006581474.1| PREDICTED: tubulin alpha-4 chain-like isoform X1 [Glycine max]
Length=452

 Score =   391 bits (1004),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLA+VQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLARVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>gb|ABQ59633.1| alpha-tubulin 3 [Populus tremuloides]
Length=451

 Score =   391 bits (1004),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEP+SMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>tpg|DAA51109.1| TPA: alpha tubulin [Zea mays]
Length=452

 Score =   391 bits (1004),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  245  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  304

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VV
Sbjct  305  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVV  364

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  365  PGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  424

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  425  DLAALEKD  432



>ref|XP_007215369.1| hypothetical protein PRUPE_ppa005626mg [Prunus persica]
 ref|XP_008230754.1| PREDICTED: tubulin alpha chain-like [Prunus mume]
 gb|EMJ16568.1| hypothetical protein PRUPE_ppa005626mg [Prunus persica]
Length=450

 Score =   391 bits (1004),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEP+SMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>gb|AAB36609.1| alpha-tubulin, partial [Eucalyptus globulus subsp. bicostata]
Length=380

 Score =   388 bits (997),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 180/188 (96%), Positives = 183/188 (97%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE TNSAFEPSS+M 
Sbjct  174  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAETTNSAFEPSSLMA  233

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  234  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  293

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNST +AEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  294  PGGDLAKVQRAVCMISNSTRLAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  353

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  354  DLAALEKD  361



>gb|ABR25378.1| tubulin alpha 3 chain [Oryza sativa Indica Group]
Length=207

 Score =   382 bits (980),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 181/187 (97%), Positives = 183/187 (98%), Gaps = 0/187 (0%)
 Frame = -1

Query  761  DGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVK  582
            DGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM K
Sbjct  1    DGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAK  60

Query  581  CDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVP  402
            CDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVP
Sbjct  61   CDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVP  120

Query  401  GGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARED  222
            GGDLAKVQRAVCMISNSTSV EVFSRID KFDLMY KRAFVHWYVGEGMEEGEFSEARED
Sbjct  121  GGDLAKVQRAVCMISNSTSVVEVFSRIDIKFDLMYSKRAFVHWYVGEGMEEGEFSEARED  180

Query  221  LAALEKD  201
            LAALEKD
Sbjct  181  LAALEKD  187



>gb|ABO47742.1| alpha-tubulin [Gossypium hirsutum]
 gb|KHG08879.1| Tubulin alpha-1 chain [Gossypium arboreum]
 gb|KJB11380.1| hypothetical protein B456_001G255600 [Gossypium raimondii]
Length=450

 Score =   391 bits (1004),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEIT+SAFEP+SMM 
Sbjct  244  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITSSAFEPASMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_004304311.1| PREDICTED: tubulin alpha-2 chain-like [Fragaria vesca subsp. 
vesca]
Length=450

 Score =   391 bits (1004),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEP+SMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>gb|KDO81348.1| hypothetical protein CISIN_1g013037mg [Citrus sinensis]
Length=447

 Score =   390 bits (1003),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKA+HEQLSVAEITNSAFEPSSMM 
Sbjct  240  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVAEITNSAFEPSSMMA  299

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  300  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  359

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  360  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  419

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  420  DLAALEKD  427



>ref|XP_009388502.1| PREDICTED: tubulin alpha-2 chain isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=451

 Score =   391 bits (1004),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_003556001.1| PREDICTED: tubulin alpha-4 chain-like isoform X1 [Glycine max]
 gb|KHN01573.1| Tubulin alpha-4 chain [Glycine soja]
Length=449

 Score =   390 bits (1003),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVF RIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFGRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_009409992.1| PREDICTED: tubulin alpha chain-like [Musa acuminata subsp. malaccensis]
Length=451

 Score =   391 bits (1004),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVA+VFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVADVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_006662856.1| PREDICTED: tubulin alpha-3 chain-like [Oryza brachyantha]
Length=451

 Score =   391 bits (1004),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>sp|Q9ZRR5.1|TBA3_HORVU RecName: Full=Tubulin alpha-3 chain [Hordeum vulgare]
 emb|CAA10663.1| alpha-tubulin 3 [Hordeum vulgare subsp. vulgare]
 gb|ABD92933.1| alpha tubulin-3B [Triticum aestivum]
 gb|ABD92934.1| alpha tubulin-3A [Triticum aestivum]
 gb|ABD92935.1| alpha tubulin-3D [Triticum aestivum]
 dbj|BAJ87680.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMS48260.1| Tubulin alpha-3 chain [Triticum urartu]
 gb|EMT18537.1| Tubulin alpha-3 chain [Aegilops tauschii]
Length=451

 Score =   390 bits (1003),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_002517492.1| tubulin alpha chain, putative [Ricinus communis]
 gb|EEF45034.1| tubulin alpha chain, putative [Ricinus communis]
Length=450

 Score =   390 bits (1003),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSV+EITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVSEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_008379344.1| PREDICTED: tubulin alpha-2 chain [Malus domestica]
Length=450

 Score =   390 bits (1003),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEP+SMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>gb|ABF98641.1| Tubulin alpha-1 chain, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAG95437.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99628.1| unnamed protein product [Oryza sativa Japonica Group]
Length=416

 Score =   389 bits (1000),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  209  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  268

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VV
Sbjct  269  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVV  328

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            P GDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  329  PSGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEARE  388

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  389  DLAALEKD  396



>ref|XP_006472372.1| PREDICTED: tubulin alpha chain isoform X1 [Citrus sinensis]
Length=451

 Score =   390 bits (1003),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKA+HEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>dbj|BAG99724.1| unnamed protein product [Oryza sativa Japonica Group]
Length=417

 Score =   389 bits (1000),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  209  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  268

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VV
Sbjct  269  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVV  328

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            P GDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  329  PSGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEARE  388

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  389  DLAALEKD  396



>ref|XP_007156677.1| hypothetical protein PHAVU_002G007900g [Phaseolus vulgaris]
 gb|ESW28671.1| hypothetical protein PHAVU_002G007900g [Phaseolus vulgaris]
Length=451

 Score =   390 bits (1003),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFV+WCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVEWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_011014531.1| PREDICTED: tubulin alpha-4 chain-like [Populus euphratica]
Length=451

 Score =   390 bits (1003),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEP+SMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>gb|KDO81347.1| hypothetical protein CISIN_1g013037mg [Citrus sinensis]
Length=451

 Score =   390 bits (1003),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKA+HEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>sp|Q6VAG0.1|TBA2_GOSHI RecName: Full=Tubulin alpha-2 chain; AltName: Full=Alpha-2-tubulin 
[Gossypium hirsutum]
 gb|AAQ92662.1| alpha-tubulin 2 [Gossypium hirsutum]
 gb|ACM89776.1| alpha-tubulin 2 [Gossypium hirsutum]
 gb|KJB77616.1| hypothetical protein B456_012G147000 [Gossypium raimondii]
 gb|KJB77617.1| hypothetical protein B456_012G147000 [Gossypium raimondii]
Length=450

 Score =   390 bits (1003),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVA+IKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVASIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAF+HWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFIHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>gb|KHN42598.1| Tubulin alpha-2 chain [Glycine soja]
Length=451

 Score =   390 bits (1003),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVA IKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVAIIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_006650524.1| PREDICTED: tubulin alpha-1 chain-like [Oryza brachyantha]
Length=451

 Score =   390 bits (1002),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP++V
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSIV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_003517369.1| PREDICTED: tubulin alpha-2 chain-like isoform X1 [Glycine max]
Length=451

 Score =   390 bits (1002),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVA IKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVAIIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_010104543.1| Tubulin alpha chain [Morus notabilis]
 gb|EXC01144.1| Tubulin alpha chain [Morus notabilis]
Length=448

 Score =   390 bits (1002),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSS+APVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  241  FDGALNVDVTEFQTNLVPYPRIHFMLSSFAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  300

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  301  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  360

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  361  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  420

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  421  DLAALEKD  428



>ref|XP_003536570.1| PREDICTED: tubulin alpha chain-like isoform X1 [Glycine max]
 gb|KHN23177.1| Tubulin alpha chain [Glycine soja]
Length=449

 Score =   390 bits (1002),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVF RIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFGRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_007515802.1| alpha-tubulin [Bathycoccus prasinos]
 emb|CCO14681.1| alpha-tubulin [Bathycoccus prasinos]
Length=415

 Score =   389 bits (999),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 180/188 (96%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  209  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  268

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVA+IKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  269  KCDPRHGKYMACCLMYRGDVVPKDVNAAVASIKTKRTIQFVDWCPTGFKCGINYQPPTVV  328

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNST++AEVFSR+DHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  329  PGGDLAKVQRAVCMISNSTAIAEVFSRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  388

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  389  DLAALEKD  396



>ref|XP_003539228.1| PREDICTED: tubulin alpha-2 chain-like [Glycine max]
 gb|KHN13032.1| Tubulin alpha-2 chain [Glycine soja]
Length=451

 Score =   390 bits (1002),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVA IKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVAIIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>gb|AAO73546.1| alpha-tubulin [Ceratopteris richardii]
 gb|AAW57307.1| alpha-tubulin [Ceratopteris richardii]
Length=450

 Score =   390 bits (1002),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRA+CMISNSTSVAEVFSRID KFDLMYCKRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAICMISNSTSVAEVFSRIDFKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>gb|AAB08791.1| alpha tubulin [Hordeum vulgare subsp. vulgare]
Length=451

 Score =   390 bits (1002),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP VV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPGVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_007143142.1| hypothetical protein PHAVU_007G047300g [Phaseolus vulgaris]
 gb|ESW15136.1| hypothetical protein PHAVU_007G047300g [Phaseolus vulgaris]
Length=449

 Score =   390 bits (1002),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVF RIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFGRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_002964078.1| hypothetical protein SELMODRAFT_405729 [Selaginella moellendorffii]
 ref|XP_002975442.1| hypothetical protein SELMODRAFT_232506 [Selaginella moellendorffii]
 gb|EFJ23643.1| hypothetical protein SELMODRAFT_232506 [Selaginella moellendorffii]
 gb|EFJ34411.1| hypothetical protein SELMODRAFT_405729 [Selaginella moellendorffii]
Length=451

 Score =   390 bits (1002),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITN+AFEP+SMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNTAFEPASMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>gb|KEH43997.1| tubulin beta-1 chain [Medicago truncatula]
Length=450

 Score =   390 bits (1002),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVF RIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFGRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_004496862.1| PREDICTED: tubulin alpha chain-like [Cicer arietinum]
Length=450

 Score =   390 bits (1002),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVF RIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFGRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_002962630.1| hypothetical protein SELMODRAFT_230143 [Selaginella moellendorffii]
 ref|XP_002980460.1| hypothetical protein SELMODRAFT_233518 [Selaginella moellendorffii]
 gb|EFJ18720.1| hypothetical protein SELMODRAFT_233518 [Selaginella moellendorffii]
 gb|EFJ36093.1| hypothetical protein SELMODRAFT_230143 [Selaginella moellendorffii]
Length=452

 Score =   390 bits (1002),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITN+AFEP+SMM 
Sbjct  246  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNTAFEPASMMA  305

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  306  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  365

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  366  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  425

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  426  DLAALEKD  433



>sp|Q96460.1|TBA2_HORVU RecName: Full=Tubulin alpha-2 chain [Hordeum vulgare]
 emb|CAA69724.1| alpha-tubulin 2 [Hordeum vulgare subsp. vulgare]
Length=451

 Score =   390 bits (1001),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP VV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPGVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>emb|CDO97305.1| unnamed protein product [Coffea canephora]
Length=450

 Score =   390 bits (1001),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDG+LNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGSLNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDL+ VQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLSGVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_011088040.1| PREDICTED: tubulin alpha chain [Sesamum indicum]
Length=450

 Score =   390 bits (1001),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAP ISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPAISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLA+VQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLARVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>gb|ABD92930.1| alpha tubulin-2A [Triticum aestivum]
 gb|ABD92931.1| alpha tubulin-2D [Triticum aestivum]
 gb|ABD92932.1| alpha tubulin-2B [Triticum aestivum]
 gb|EMS59370.1| Tubulin alpha chain [Triticum urartu]
 gb|EMT25007.1| Tubulin alpha chain [Aegilops tauschii]
Length=451

 Score =   390 bits (1001),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP VV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPGVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_010557535.1| PREDICTED: tubulin alpha-2 chain-like isoform X1 [Tarenaya hassleriana]
Length=450

 Score =   390 bits (1001),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEP+SMM 
Sbjct  244  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAV+TIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVSTIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRID+KFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDYKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>emb|CAB66336.1| alpha-tubulin [Betula pendula]
 gb|AJA29683.1| tubulin alpha chain [Betula luminifera]
Length=451

 Score =   390 bits (1001),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRID+KFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDNKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>dbj|BAJ06364.1| alpha-tubulin [Alopecurus aequalis]
Length=451

 Score =   390 bits (1001),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSV+EITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVSEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>sp|Q9ZRB7.1|TBA_WHEAT RecName: Full=Tubulin alpha chain [Triticum aestivum]
 gb|AAD10486.1| alpha-tubulin [Triticum aestivum]
Length=451

 Score =   390 bits (1001),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP VV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPGVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>dbj|BAC24800.1| alpha tubulin [Physcomitrella patens]
Length=451

 Score =   390 bits (1001),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKF LMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFGLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>gb|AHJ80817.1| Tua1 [Eragrostis tef]
Length=451

 Score =   390 bits (1001),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDVNEFQ NLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVNEFQANLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_003558668.1| PREDICTED: tubulin alpha-2 chain-like [Brachypodium distachyon]
 emb|CAM58977.1| alpha-tubulin 4 [Hordeum vulgare subsp. vulgare]
Length=451

 Score =   389 bits (1000),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSV+EITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVSEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_010664458.1| PREDICTED: tubulin alpha-4 chain [Vitis vinifera]
 emb|CAN77412.1| hypothetical protein VITISV_000470 [Vitis vinifera]
Length=451

 Score =   389 bits (1000),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRID+KFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDNKFDLMYSKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_010060142.1| PREDICTED: tubulin alpha chain-like [Eucalyptus grandis]
 gb|KCW66706.1| hypothetical protein EUGRSUZ_F00470 [Eucalyptus grandis]
Length=451

 Score =   389 bits (1000),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKA+HEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAHHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>gb|ABD92937.1| alpha tubulin-4A [Triticum aestivum]
 gb|ABD92938.1| alpha tubulin-4B [Triticum aestivum]
 gb|EMS53764.1| Tubulin alpha chain [Triticum urartu]
Length=451

 Score =   389 bits (1000),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSV+EITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVSEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>gb|ABD92936.1| alpha tubulin-4D [Triticum aestivum]
Length=451

 Score =   389 bits (1000),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSV+EITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVSEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>gb|KIZ01406.1| Tubulin alpha-1 chain [Monoraphidium neglectum]
Length=451

 Score =   389 bits (1000),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 180/188 (96%), Positives = 186/188 (99%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVD+ EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV
Sbjct  244  FDGALNVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNA+VATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNASVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNST++AEVFSR+DHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTAIAEVFSRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>gb|ABQ59634.1| alpha-tubulin 5 [Populus tremuloides]
Length=451

 Score =   389 bits (999),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRID KFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDSKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_006307493.1| hypothetical protein CARUB_v10009117mg [Capsella rubella]
 ref|XP_010418156.1| PREDICTED: tubulin alpha-2 chain [Camelina sativa]
 ref|XP_010430201.1| PREDICTED: tubulin alpha-2 chain isoform X1 [Camelina sativa]
 ref|XP_010430202.1| PREDICTED: tubulin alpha-2 chain isoform X2 [Camelina sativa]
 ref|XP_010473400.1| PREDICTED: tubulin alpha-2 chain [Camelina sativa]
 gb|EOA40391.1| hypothetical protein CARUB_v10009117mg [Capsella rubella]
Length=450

 Score =   389 bits (999),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKA+HEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_007047652.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOX91809.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=501

 Score =   391 bits (1004),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNS FEPSSMM 
Sbjct  294  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSTFEPSSMMA  353

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  354  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  413

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  414  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  473

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  474  DLAALEKD  481



>dbj|BAP59012.1| alpha tubulin [Taxus cuspidata]
Length=451

 Score =   389 bits (999),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRID KFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDRKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_002313194.1| hypothetical protein POPTR_0009s08850g [Populus trichocarpa]
 gb|EEE87149.1| hypothetical protein POPTR_0009s08850g [Populus trichocarpa]
Length=451

 Score =   389 bits (999),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRID KFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDSKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>gb|ABL61201.1| alpha-tubulin [Oxymonadida environmental sample]
Length=299

 Score =   384 bits (985),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 176/188 (94%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVD+ EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNS+FEP++MM 
Sbjct  92   FDGALNVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSSFEPANMMA  151

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACC+M+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  152  KCDPRHGKYMACCMMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  211

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNST++AEVFSRID KFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  212  PGGDLAKVQRAVCMISNSTAIAEVFSRIDRKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  271

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  272  DLAALEKD  279



>gb|KHG20487.1| Tubulin alpha chain [Gossypium arboreum]
Length=451

 Score =   389 bits (999),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISA KAYHEQLSVAEITN+AFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEQLSVAEITNTAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>sp|Q6VAG1.1|TBA1_GOSHI RecName: Full=Tubulin alpha-1 chain; AltName: Full=Alpha-1-tubulin 
[Gossypium hirsutum]
 gb|AAQ92661.1| alpha-tubulin 1 [Gossypium hirsutum]
Length=451

 Score =   389 bits (999),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EF+TNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFRTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQF DWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFADWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_009407690.1| PREDICTED: tubulin alpha chain-like [Musa acuminata subsp. malaccensis]
Length=452

 Score =   389 bits (999),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFE SSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFETSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_010096739.1| Tubulin alpha chain [Morus notabilis]
 gb|EXB65591.1| Tubulin alpha chain [Morus notabilis]
Length=449

 Score =   389 bits (999),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSS+APVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  241  FDGALNVDVTEFQTNLVPYPRIHFMLSSFAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  300

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  301  KCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVV  360

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  361  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  420

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  421  DLAALEKD  428



>emb|CAD20821.1| alpha tubulin [Zea mays]
Length=274

 Score =   382 bits (982),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 176/188 (94%), Positives = 183/188 (97%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGA+NVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSV EITN+ FEPSSMM 
Sbjct  68   FDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMA  127

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPP+VV
Sbjct  128  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVV  187

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  188  PGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  247

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  248  DLAALEKD  255



>gb|AEW46684.1| beta-tubulin [Ulva linza]
Length=452

 Score =   389 bits (999),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 180/188 (96%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEP+SMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNST++AEVFSR+DHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTAIAEVFSRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>emb|CAA62916.1| alpha-tubulin [Oryza sativa Japonica Group]
Length=451

 Score =   389 bits (999),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            P GDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PSGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>gb|ACU20294.1| unknown [Glycine max]
Length=339

 Score =   385 bits (988),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 179/188 (95%), Positives = 182/188 (97%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKA+HEQLSV EITNSAFEPSSMM 
Sbjct  133  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAHHEQLSVGEITNSAFEPSSMMA  192

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAV  IKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  193  KCDPRHGKYMACCLMYRGDVVPKDVNAAVGIIKTKRTIQFVDWCPTGFKCGINYQPPTVV  252

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEG+FSEARE
Sbjct  253  PGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGKFSEARE  312

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  313  DLAALEKD  320



>emb|CDY29334.1| BnaA05g16010D [Brassica napus]
Length=431

 Score =   388 bits (996),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 181/188 (96%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKA+HEQLSVAEITNSAFEP+SMM 
Sbjct  225  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVAEITNSAFEPASMMA  284

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  285  KCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVV  344

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  345  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  404

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  405  DLAALEKD  412



>gb|AAO46127.1| alpha-tubulin [Streblomastix strix]
 gb|AAO46129.1| alpha-tubulin [Streblomastix strix]
Length=249

 Score =   381 bits (979),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 176/188 (94%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVD+ EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNS+FEP++MM 
Sbjct  43   FDGALNVDMTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSSFEPANMMA  102

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACC+M+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFK GINYQPPTVV
Sbjct  103  KCDPRHGKYMACCMMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKVGINYQPPTVV  162

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNST++AEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  163  PGGDLAKVQRAVCMISNSTAIAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  222

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  223  DLAALEKD  230



>gb|AGG37287.1| alpha-tubulin 5 [Salix arbutifolia]
Length=451

 Score =   389 bits (998),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRID KFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDTKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>gb|ABV55999.1| alpha-tubulin 7 [Populus tremuloides]
Length=451

 Score =   389 bits (998),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAE+TNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEVTNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPR GKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRRGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_011398411.1| Tubulin alpha chain [Auxenochlorella protothecoides]
 gb|KFM25515.1| Tubulin alpha chain [Auxenochlorella protothecoides]
Length=394

 Score =   387 bits (993),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 178/188 (95%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVD+ EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEP+SMM 
Sbjct  188  FDGALNVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMA  247

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVAT+KTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  248  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATVKTKRTIQFVDWCPTGFKCGINYQPPTVV  307

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNST++AEVFSR+DHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  308  PGGDLAKVQRAVCMISNSTAIAEVFSRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  367

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  368  DLAALEKD  375



>gb|ABL61216.1| alpha-tubulin [Oxymonadida environmental sample]
Length=314

 Score =   384 bits (985),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 176/188 (94%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVD+ EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNS+FEP++MM 
Sbjct  107  FDGALNVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSSFEPANMMA  166

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACC+M+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  167  KCDPRHGKYMACCMMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  226

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNST++AEVFSRID KFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  227  PGGDLAKVQRAVCMISNSTAIAEVFSRIDRKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  286

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  287  DLAALEKD  294



>ref|XP_011002356.1| PREDICTED: tubulin alpha chain-like [Populus euphratica]
Length=451

 Score =   389 bits (998),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRID KFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDTKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>gb|KFK32793.1| hypothetical protein AALP_AA6G289100 [Arabis alpina]
Length=450

 Score =   388 bits (997),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 181/188 (96%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKA+HEQLSVAEITN+AFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVAEITNTAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|NP_001051132.1| Os03g0726100 [Oryza sativa Japonica Group]
 gb|AAG16905.1|AF182523_1 alpha-tubulin [Oryza sativa]
 gb|AAS07163.1| alpha tubulin [Oryza sativa Japonica Group]
 gb|AAT77077.1| alpha tubulin [Oryza sativa Japonica Group]
 gb|ABF98642.1| Tubulin alpha-1 chain, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABG78592.1| alpha-tubulin [Oryza sativa Japonica Group]
 dbj|BAF13046.1| Os03g0726100 [Oryza sativa Japonica Group]
 gb|EAY91719.1| hypothetical protein OsI_13361 [Oryza sativa Indica Group]
 gb|EAZ28437.1| hypothetical protein OsJ_12419 [Oryza sativa Japonica Group]
 gb|AFI71265.1| alpha tubulin [Oryza sativa Japonica Group]
Length=451

 Score =   388 bits (997),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            P GDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PSGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>gb|ACK76232.1| alpha-tubulin [Dimocarpus longan]
Length=450

 Score =   388 bits (997),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 183/188 (97%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGA NVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGAPNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|NP_171974.1| tubulin alpha-4 chain [Arabidopsis thaliana]
 ref|NP_175423.1| tubulin alpha-2 chain [Arabidopsis thaliana]
 ref|XP_002863595.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002891551.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 ref|XP_006279139.1| hypothetical protein CARUB_v10008014mg [Capsella rubella]
 ref|XP_006393188.1| hypothetical protein EUTSA_v10011471mg [Eutrema salsugineum]
 ref|XP_006406473.1| hypothetical protein EUTSA_v10020718mg [Eutrema salsugineum]
 ref|XP_009107244.1| PREDICTED: tubulin alpha-2 chain isoform X1 [Brassica rapa]
 sp|B9DGT7.2|TBA2_ARATH RecName: Full=Tubulin alpha-2 chain [Arabidopsis thaliana]
 sp|Q0WV25.2|TBA4_ARATH RecName: Full=Tubulin alpha-4 chain [Arabidopsis thaliana]
 gb|AAF40454.1|AC004809_12 Identical to the alpha-4 tubulin (TUA4) gene from A. thaliana 
gb|M84697. ESTs gb|T46564. gb|T04381, gb|T76028, gb|T21602, 
gb|H37154 gb|H37663 and gb|T21719 come from this gene [Arabidopsis 
thaliana]
 gb|AAF76449.1|AC015445_16 Identical to Tubulin Alpha-6 Chain from Arabidopsis thaliana 
gi|267070 and contains a Tubulin PF|00091 domain. ESTs gb|N37387, 
gb|N37805, gb|R90497, gb|T44684, gb|H36144, gb|N38686, 
gb|AI994844, gb|R90689, gb|T04725, gb|H36928, gb|N96479, gb|H36922, 
gb|R90670, gb|Z17980, gb|T4428, gb|H36248, gb|N65408, 
gb|T46222 come from this gene [Arabidopsis thaliana]
 gb|AAK95316.1|AF410330_1 At1g50010/F2J10_12 [Arabidopsis thaliana]
 gb|AAA32889.1| apha-2 tubulin [Arabidopsis thaliana]
 gb|AAA32890.1| alpha-4 tubulin [Arabidopsis thaliana]
 gb|AAL25612.1| At1g04820/F13M7_26 [Arabidopsis thaliana]
 gb|AAL38293.1| Tubulin Alpha-6 Chain [Arabidopsis thaliana]
 gb|AAM98269.1| At1g04820/F13M7_26 [Arabidopsis thaliana]
 gb|AAN31076.1| At1g50010/F2J10_12 [Arabidopsis thaliana]
 gb|ABQ01730.1| TUA2 [Eutrema halophilum]
 gb|ABQ01731.1| TUA2-2 [Eutrema halophilum]
 gb|EFH39854.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67810.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 gb|AEE27747.1| tubulin alpha-4 chain [Arabidopsis thaliana]
 gb|AEE32507.1| tubulin alpha-2 chain [Arabidopsis thaliana]
 gb|EOA12037.1| hypothetical protein CARUB_v10008014mg [Capsella rubella]
 gb|ESQ30474.1| hypothetical protein EUTSA_v10011471mg [Eutrema salsugineum]
 gb|ESQ47926.1| hypothetical protein EUTSA_v10020718mg [Eutrema salsugineum]
 gb|KFK35954.1| hypothetical protein AALP_AA4G059800 [Arabis alpina]
 gb|KFK39296.1| alpha tubulin 1 [Arabis alpina]
 emb|CDY45043.1| BnaA08g02320D [Brassica napus]
 emb|CDY03583.1| BnaC03g68420D [Brassica napus]
Length=450

 Score =   388 bits (997),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 181/188 (96%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKA+HEQLSVAEITNSAFEP+SMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVAEITNSAFEPASMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>gb|ABR25510.1| tubulin alpha-1 chain [Oryza sativa Indica Group]
Length=255

 Score =   381 bits (978),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 176/188 (94%), Positives = 183/188 (97%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGA+NVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSV EITN+ FEPSSMM 
Sbjct  49   FDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMA  108

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPP+VV
Sbjct  109  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVV  168

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  169  PGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  228

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  229  DLAALEKD  236



>emb|CDY66630.1| BnaCnng51680D [Brassica napus]
Length=435

 Score =   387 bits (995),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 181/188 (96%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKA+HEQLSVAEITNSAFEP+SMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVAEITNSAFEPASMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>dbj|BAE99023.1| tubulin alpha-2/alpha-4 chain [Arabidopsis thaliana]
Length=450

 Score =   388 bits (996),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 181/188 (96%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKA+HEQLSVAEITNSAFEP+SMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVAEITNSAFEPASMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_010500555.1| PREDICTED: tubulin alpha-6 chain isoform X1 [Camelina sativa]
 ref|XP_010479400.1| PREDICTED: tubulin alpha-6 chain [Camelina sativa]
Length=450

 Score =   388 bits (996),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 181/188 (96%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKA+HEQLSVAEITNSAFEP+SMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVAEITNSAFEPASMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|NP_193232.1| tubulin alpha-6 chain [Arabidopsis thaliana]
 sp|P29511.1|TBA6_ARATH RecName: Full=Tubulin alpha-6 chain [Arabidopsis thaliana]
 gb|AAA32892.1| TUA6 [Arabidopsis thaliana]
 emb|CAB10275.1| tubulin alpha-6 chain (TUA6) [Arabidopsis thaliana]
 emb|CAB78538.1| tubulin alpha-6 chain (TUA6) [Arabidopsis thaliana]
 gb|AAL24246.1| AT4g14960/dl3520c [Arabidopsis thaliana]
 gb|AAL38788.1| putative tubulin alpha-6 chain TUA6 [Arabidopsis thaliana]
 gb|AAL79586.1| AT4g14960/dl3520c [Arabidopsis thaliana]
 gb|AAM51249.1| putative tubulin alpha-6 chain TUA6 [Arabidopsis thaliana]
 gb|ABD75335.1| tubulin alpha-1 chain [Brassica rapa subsp. oleifera]
 gb|AEE83530.1| tubulin alpha-6 chain [Arabidopsis thaliana]
 emb|CDY50974.1| BnaA06g37700D [Brassica napus]
 emb|CDY28123.1| BnaC06g03040D [Brassica napus]
Length=450

 Score =   388 bits (996),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 181/188 (96%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKA+HEQLSVAEITNSAFEP+SMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVAEITNSAFEPASMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>gb|AAL16174.1|AF428406_1 AT4g14960/dl3520c [Arabidopsis thaliana]
Length=450

 Score =   388 bits (996),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 181/188 (96%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKA+HEQLSVAEITNSAFEP+SMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVAEITNSAFEPASMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_001777110.1| predicted protein [Physcomitrella patens]
 gb|EDQ58103.1| predicted protein [Physcomitrella patens]
Length=344

 Score =   384 bits (986),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 177/188 (94%), Positives = 183/188 (97%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVD+ EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSV EITN+ FEPSSMM 
Sbjct  139  FDGALNVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMA  198

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVV
Sbjct  199  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVV  258

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  259  PGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  318

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  319  DLAALEKD  326



>gb|ABL61224.1| alpha-tubulin [Oxymonadida environmental sample]
Length=314

 Score =   383 bits (983),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 176/188 (94%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVD+ EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNS+FEP++MM 
Sbjct  107  FDGALNVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSSFEPANMMA  166

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACC+M+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  167  KCDPRHGKYMACCMMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  226

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNST++AEVFSRID KFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  227  PGGDLAKVQRAVCMISNSTAIAEVFSRIDRKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  286

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  287  DLAALEKD  294



>gb|ABL61215.1| alpha-tubulin [Oxymonadida environmental sample]
Length=314

 Score =   383 bits (983),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 176/188 (94%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVD+ EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNS+FEP++MM 
Sbjct  107  FDGALNVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSSFEPANMMA  166

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACC+M+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  167  KCDPRHGKYMACCMMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  226

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNST++AEVFSRID KFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  227  PGGDLAKVQRAVCMISNSTAIAEVFSRIDRKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  286

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  287  DLAALEKD  294



>gb|ABL61212.1| alpha-tubulin [Oxymonadida environmental sample]
 gb|ABL61220.1| alpha-tubulin [Oxymonadida environmental sample]
 gb|ABL61221.1| alpha-tubulin [Oxymonadida environmental sample]
 gb|ABL61222.1| alpha-tubulin [Oxymonadida environmental sample]
 gb|ABL61223.1| alpha-tubulin [Oxymonadida environmental sample]
 gb|ABL61225.1| alpha-tubulin [Oxymonadida environmental sample]
 gb|ABL61229.1| alpha-tubulin [Oxymonadida environmental sample]
Length=314

 Score =   383 bits (983),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 176/188 (94%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVD+ EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNS+FEP++MM 
Sbjct  107  FDGALNVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSSFEPANMMA  166

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACC+M+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  167  KCDPRHGKYMACCMMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  226

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNST++AEVFSRID KFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  227  PGGDLAKVQRAVCMISNSTAIAEVFSRIDRKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  286

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  287  DLAALEKD  294



>gb|AFK33477.1| unknown [Lotus japonicus]
Length=352

 Score =   384 bits (986),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 181/188 (96%), Positives = 183/188 (97%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  146  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  205

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAV +IKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  206  KCDPRHGKYMACCLMYRGDVVPKDVNAAVGSIKTKRTIQFVDWCPTGFKCGINYQPPTVV  265

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRID KFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  266  PGGDLAKVQRAVCMISNSTSVAEVFSRIDVKFDLMYSKRAFVHWYVGEGMEEGEFSEARE  325

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  326  DLAALEKD  333



>gb|ETM52928.1| tubulin alpha chain, partial [Phytophthora parasitica]
 gb|ETM52931.1| tubulin alpha chain, partial [Phytophthora parasitica]
Length=398

 Score =   385 bits (990),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 177/188 (94%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEP+SMM 
Sbjct  189  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMA  248

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMA CLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  249  KCDPRHGKYMAACLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  308

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLA+VQRAVCMISN++++AEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  309  PGGDLARVQRAVCMISNTSAIAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  368

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  369  DLAALEKD  376



>gb|KJB29387.1| hypothetical protein B456_005G097800 [Gossypium raimondii]
Length=451

 Score =   387 bits (995),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 181/188 (96%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISA KAYHEQLSVAEITN+AFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEQLSVAEITNTAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLA+VQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAEVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_005851144.1| alpha-tubulin [Chlorella variabilis]
 gb|EFN59042.1| alpha-tubulin [Chlorella variabilis]
Length=450

 Score =   387 bits (995),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 179/188 (95%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVD+ EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNA+VATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNASVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNST++AEVFSR+DHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTAIAEVFSRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_009124556.1| PREDICTED: tubulin alpha-2 chain-like isoform X1 [Brassica rapa]
Length=450

 Score =   387 bits (994),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 181/188 (96%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKA+HEQLSVAEITNSAFEP+SMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAFHEQLSVAEITNSAFEPASMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>gb|ACU19580.1| unknown [Glycine max]
Length=449

 Score =   387 bits (994),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 183/188 (97%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVF RIDHKFDLMY KRAFVHWYVGEGMEEGEF EARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFGRIDHKFDLMYAKRAFVHWYVGEGMEEGEFFEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>ref|XP_008341563.1| PREDICTED: tubulin alpha-2 chain-like [Malus domestica]
Length=450

 Score =   387 bits (994),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 184/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVDV EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEP+SMM 
Sbjct  244  FDGALNVDVTEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPR GKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRXGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



>emb|CAL35827.1| alpha-2 tubulin [Plantago major]
Length=249

 Score =   380 bits (975),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 174/188 (93%), Positives = 182/188 (97%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGA+NVD+ EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLS+ EITN+ FEPSSMM 
Sbjct  43   FDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSIPEITNAVFEPSSMMA  102

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRT+QFVDWCPTGFKCGINYQPPTVV
Sbjct  103  KCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTVQFVDWCPTGFKCGINYQPPTVV  162

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  163  PGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  222

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  223  DLAALEKD  230



>gb|KIZ03400.1| Tubulin alpha chain [Monoraphidium neglectum]
Length=451

 Score =   387 bits (994),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 179/188 (95%), Positives = 185/188 (98%), Gaps = 0/188 (0%)
 Frame = -1

Query  764  FDGALNVDVNEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMV  585
            FDGALNVD+ EFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEP+SMM 
Sbjct  244  FDGALNVDITEFQTNLVPYPRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMA  303

Query  584  KCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  405
            KCDPRHGKYMACCLM+RGDVVPKDVNA+VATIKTKRTIQFVDWCPTGFKCGINYQPPTVV
Sbjct  304  KCDPRHGKYMACCLMYRGDVVPKDVNASVATIKTKRTIQFVDWCPTGFKCGINYQPPTVV  363

Query  404  PGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEARE  225
            PGGDLAKVQRAVCMISNST+VAEVFSR+DHKFDLMY KRAFVHWYVGEGMEEGEFSEARE
Sbjct  364  PGGDLAKVQRAVCMISNSTAVAEVFSRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARE  423

Query  224  DLAALEKD  201
            DLAALEKD
Sbjct  424  DLAALEKD  431



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1441039810680