BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF009J17

Length=720
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009625446.1|  PREDICTED: sucrose synthase                        222   2e-63   Nicotiana tomentosiformis
ref|XP_009792656.1|  PREDICTED: sucrose synthase                        221   3e-63   Nicotiana sylvestris
gb|ADA68250.1|  sucrose synthase                                        204   8e-63   Schiedea globosa
gb|ADK98097.1|  sucrose synthase                                        203   1e-62   Schiedea globosa
dbj|BAN18500.1|  sucrose synthase                                       203   1e-62   Schiedea pentandra
dbj|BAN18504.1|  sucrose synthase                                       202   2e-62   Schiedea trinervis
gb|ADW09936.1|  putative sucrose synthase                               202   3e-62   Schiedea globosa
gb|ADW09901.1|  putative sucrose synthase                               202   3e-62   Schiedea globosa
gb|ADK98109.1|  sucrose synthase                                        202   3e-62   Schiedea globosa
gb|ADW09933.1|  putative sucrose synthase                               201   6e-62   Schiedea globosa
gb|ADW09904.1|  putative sucrose synthase                               201   7e-62   Schiedea globosa
gb|ADK98116.1|  sucrose synthase                                        201   7e-62   Schiedea globosa
ref|NP_001275286.1|  sucrose synthase                                   218   7e-62   Solanum tuberosum [potatoes]
gb|ADK98101.1|  sucrose synthase                                        201   7e-62   Schiedea globosa
ref|XP_006345244.1|  PREDICTED: uncharacterized LOC102577594            218   7e-62   Solanum tuberosum [potatoes]
gb|ADA68252.1|  sucrose synthase                                        201   8e-62   Honckenya peploides
emb|CAA09681.1|  sucrose synthase                                       218   9e-62   Solanum lycopersicum
ref|NP_001234655.1|  sucrose synthase                                   218   9e-62   
gb|ADK98120.1|  sucrose synthase                                        201   1e-61   Schiedea adamantis
ref|XP_011093886.1|  PREDICTED: sucrose synthase                        217   1e-61   Sesamum indicum [beniseed]
gb|ADK98103.1|  sucrose synthase                                        200   1e-61   Schiedea globosa
gb|AAA97571.1|  sucrose synthase                                        217   1e-61   Solanum tuberosum [potatoes]
gb|ADW09903.1|  putative sucrose synthase                               200   2e-61   Schiedea globosa
gb|ADW09926.1|  putative sucrose synthase                               200   2e-61   Schiedea globosa
gb|ADA68251.1|  sucrose synthase                                        200   2e-61   Schiedea membranacea
gb|ADK98112.1|  sucrose synthase                                        200   2e-61   Schiedea globosa
ref|XP_006353766.1|  PREDICTED: sucrose synthase 2 isoform X2           216   3e-61   
ref|NP_001274911.1|  sucrose synthase 2                                 216   3e-61   Solanum tuberosum [potatoes]
sp|P49039.1|SUS2_SOLTU  RecName: Full=Sucrose synthase; AltName: ...    216   3e-61   Solanum tuberosum [potatoes]
ref|NP_001234804.1|  sucrose synthase                                   216   5e-61   
sp|P10691.1|SUS1_SOLTU  RecName: Full=Sucrose synthase; AltName: ...    216   5e-61   Solanum tuberosum [potatoes]
ref|XP_010323602.1|  PREDICTED: sucrose synthase isoform X1             215   5e-61   
gb|ADW09905.1|  putative sucrose synthase                               198   8e-61   Schiedea globosa
ref|XP_011078145.1|  PREDICTED: sucrose synthase                        214   1e-60   
gb|ABV02029.1|  sucrose sythase                                         214   2e-60   Nicotiana langsdorffii x Nicotiana sanderae
gb|ADW09914.1|  putative sucrose synthase                               197   2e-60   Schiedea globosa
gb|ADW09891.1|  putative sucrose synthase                               197   3e-60   Schiedea membranacea
ref|XP_009589756.1|  PREDICTED: sucrose synthase                        213   3e-60   Nicotiana tomentosiformis
gb|AHL84158.1|  sucrose synthase                                        213   4e-60   Nicotiana tabacum [American tobacco]
gb|ADW09895.1|  putative sucrose synthase                               196   4e-60   Schiedea globosa
sp|P49035.1|SUS1_DAUCA  RecName: Full=Sucrose synthase isoform 1;...    213   6e-60   Daucus carota [carrots]
gb|ADW09921.1|  putative sucrose synthase                               196   7e-60   Schiedea globosa
ref|XP_009760458.1|  PREDICTED: sucrose synthase                        211   1e-59   Nicotiana sylvestris
gb|AEN79500.1|  sucrose synthase 1                                      210   5e-59   Phelipanche ramosa
gb|ADW09887.1|  putative sucrose synthase                               192   1e-58   Schiedea stellarioides
gb|ADW09917.1|  putative sucrose synthase                               192   3e-58   Schiedea globosa
sp|O49845.1|SUS2_DAUCA  RecName: Full=Sucrose synthase isoform 2;...    207   3e-58   Daucus carota [carrots]
emb|CAI56307.1|  sucrose synthase                                       207   3e-58   Coffea canephora [robusta coffee]
emb|CAJ32596.1|  sucrose synthase                                       207   4e-58   Coffea arabica [arabica coffee]
gb|ADW09918.1|  putative sucrose synthase                               191   5e-58   Schiedea globosa
emb|CAA67195.1|  sucrose synthase                                       192   7e-58   Pisum sativum [garden pea]
gb|ADW09907.1|  putative sucrose synthase                               191   8e-58   Schiedea globosa
gb|AHL29281.1|  sucrose synthase 1                                      206   1e-57   Camellia sinensis [black tea]
gb|ABI17891.1|  sucrose synthase                                        206   1e-57   Coffea canephora [robusta coffee]
gb|AFK45264.1|  unknown                                                 192   2e-57   Medicago truncatula
ref|XP_004508035.1|  PREDICTED: sucrose synthase-like isoform X3        205   2e-57   Cicer arietinum [garbanzo]
ref|XP_004287669.1|  PREDICTED: sucrose synthase                        205   2e-57   Fragaria vesca subsp. vesca
gb|AEE60913.1|  nodule-enhanced sucrose synthase                        205   2e-57   Cicer arietinum [garbanzo]
gb|ADW09927.1|  putative sucrose synthase                               189   3e-57   Schiedea globosa
dbj|BAD94975.1|  sucrose-UDP glucosyltransferase                        194   4e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011010969.1|  PREDICTED: sucrose synthase-like isoform X2        204   4e-57   Populus euphratica
ref|XP_011010968.1|  PREDICTED: sucrose synthase-like isoform X1        204   4e-57   Populus euphratica
gb|KDP33978.1|  hypothetical protein JCGZ_07549                         204   4e-57   Jatropha curcas
gb|ADR00484.1|  sucrose synthase                                        200   4e-57   Arachis hypogaea var. vulgaris [Spanish peanut]
gb|AGH29112.1|  sucrose synthase                                        204   4e-57   Jatropha curcas
gb|ADW80556.1|  sucrose synthase 1                                      204   5e-57   Populus tomentosa [Chinese white poplar]
gb|ADW80565.1|  sucrose synthase 1                                      204   6e-57   Populus tomentosa [Chinese white poplar]
gb|ADW80555.1|  sucrose synthase 1                                      204   6e-57   Populus tomentosa [Chinese white poplar]
gb|ADW80549.1|  sucrose synthase 1                                      204   6e-57   Populus tomentosa [Chinese white poplar]
gb|ADW80546.1|  sucrose synthase 1                                      204   6e-57   Populus tomentosa [Chinese white poplar]
gb|ADW80552.1|  sucrose synthase 1                                      204   6e-57   Populus tomentosa [Chinese white poplar]
gb|ADW80550.1|  sucrose synthase 1                                      204   6e-57   Populus tomentosa [Chinese white poplar]
gb|ADW80559.1|  sucrose synthase 1                                      204   6e-57   Populus tomentosa [Chinese white poplar]
gb|ADW80563.1|  sucrose synthase 1                                      204   6e-57   Populus tomentosa [Chinese white poplar]
gb|ADW80543.1|  sucrose synthase 1                                      204   6e-57   Populus tomentosa [Chinese white poplar]
gb|ADW80534.1|  sucrose synthase 1                                      204   6e-57   Populus tomentosa [Chinese white poplar]
gb|ADW80540.1|  sucrose synthase 1                                      204   6e-57   Populus tomentosa [Chinese white poplar]
gb|ADW80541.1|  sucrose synthase 1                                      204   6e-57   Populus tomentosa [Chinese white poplar]
gb|ADV71181.1|  sucrose synthase 1                                      204   6e-57   Populus tomentosa [Chinese white poplar]
gb|ADW80558.1|  sucrose synthase 1                                      204   6e-57   Populus tomentosa [Chinese white poplar]
gb|ADW80535.1|  sucrose synthase 1                                      204   6e-57   Populus tomentosa [Chinese white poplar]
gb|ADW80570.1|  sucrose synthase 1                                      204   7e-57   Populus tomentosa [Chinese white poplar]
gb|ADW80536.1|  sucrose synthase 1                                      204   7e-57   Populus tomentosa [Chinese white poplar]
gb|ADW80548.1|  sucrose synthase 1                                      204   7e-57   Populus tomentosa [Chinese white poplar]
gb|ADW80539.1|  sucrose synthase 1                                      204   7e-57   Populus tomentosa [Chinese white poplar]
gb|ADW80571.1|  sucrose synthase 1                                      204   7e-57   Populus tomentosa [Chinese white poplar]
gb|ADW80566.1|  sucrose synthase 1                                      204   7e-57   Populus tomentosa [Chinese white poplar]
gb|ADW80562.1|  sucrose synthase 1                                      204   7e-57   Populus tomentosa [Chinese white poplar]
gb|ADW80551.1|  sucrose synthase 1                                      204   7e-57   Populus tomentosa [Chinese white poplar]
gb|ADW80560.1|  sucrose synthase 1                                      204   7e-57   Populus tomentosa [Chinese white poplar]
gb|AFS17277.1|  sucrose synthase 1                                      203   9e-57   Amaranthus cruentus/Amaranthus hypocondriacus mixed library
gb|KJB65372.1|  hypothetical protein B456_010G092300                    203   9e-57   Gossypium raimondii
ref|XP_007012546.1|  Sucrose synthase 4 isoform 1                       203   1e-56   Theobroma cacao [chocolate]
ref|XP_007012547.1|  Sucrose synthase 4 isoform 2                       203   1e-56   
ref|XP_003551045.1|  PREDICTED: sucrose synthase-like isoform X1        202   2e-56   
gb|AIJ28960.1|  sucrose synthase                                        202   2e-56   Manihot esculenta subsp. flabellifolia
gb|KHN17754.1|  Sucrose synthase                                        202   2e-56   Glycine soja [wild soybean]
dbj|BAA88905.1|  sucrose synthase                                       202   3e-56   Citrus unshiu [satsuma mandarin]
ref|XP_006452883.1|  hypothetical protein CICLE_v10007483mg             202   3e-56   Citrus clementina [clementine]
ref|XP_006474580.1|  PREDICTED: sucrose synthase-like isoform X1        202   3e-56   Citrus sinensis [apfelsine]
gb|KJB82966.1|  hypothetical protein B456_013G222400                    202   3e-56   Gossypium raimondii
dbj|BAA89049.1|  sucrose synthase                                       202   3e-56   Citrus unshiu [satsuma mandarin]
gb|AEV40460.1|  sucrose synthase 1                                      202   3e-56   Gossypium arboreum [tree cotton]
gb|KHG00606.1|  Sucrose synthase                                        202   3e-56   Gossypium arboreum [tree cotton]
gb|AHA41509.1|  sucrose synthase                                        202   3e-56   Populus deltoides
gb|AEV40463.1|  sucrose synthase 4                                      202   3e-56   Gossypium arboreum [tree cotton]
dbj|BAM68521.1|  sucrose synthase                                       202   4e-56   Mangifera indica
gb|ADW09923.1|  putative sucrose synthase                               186   4e-56   Schiedea globosa
ref|XP_007154543.1|  hypothetical protein PHAVU_003G127500g             202   4e-56   Phaseolus vulgaris [French bean]
gb|ADW80545.1|  sucrose synthase 1                                      202   4e-56   Populus tomentosa [Chinese white poplar]
dbj|BAM37539.1|  sucrose synthase                                       202   4e-56   Mangifera indica
gb|KDO73788.1|  hypothetical protein CISIN_1g003661mg                   202   4e-56   Citrus sinensis [apfelsine]
gb|ABD61653.1|  sucrose synthase                                        202   4e-56   Cichorium intybus [radicchio]
gb|AEV40464.1|  sucrose synthase 5                                      201   5e-56   Gossypium arboreum [tree cotton]
gb|AAN76498.1|AF315375_1  sucrose synthase                              201   5e-56   Phaseolus vulgaris [French bean]
gb|AEF56625.1|  sucrose synthase                                        200   1e-55   Arachis hypogaea var. vulgaris [Spanish peanut]
gb|AFO84090.1|  sucrose synthase                                        200   1e-55   Actinidia chinensis
gb|ADR81996.1|  sucrose synthase 1                                      200   2e-55   Populus trichocarpa [western balsam poplar]
ref|XP_002324136.2|  sucrose synthase family protein                    200   2e-55   
gb|AAC28107.1|  nodule-enhanced sucrose synthase                        200   2e-55   Pisum sativum [garden pea]
emb|CAA09910.1|  sucrose synthase                                       200   2e-55   Pisum sativum [garden pea]
ref|XP_003609947.1|  Sucrose synthase                                   196   2e-55   
dbj|BAM68520.1|  sucrose synthase                                       199   2e-55   Mangifera indica
sp|P31926.1|SUSY_VICFA  RecName: Full=Sucrose synthase; AltName: ...    199   3e-55   Vicia faba [broad bean]
dbj|BAM68527.1|  sucrose synthase                                       199   3e-55   Mangifera indica
ref|XP_010047438.1|  PREDICTED: sucrose synthase                        199   3e-55   Eucalyptus grandis [rose gum]
gb|AEN71079.1|  sucrose synthase Sus1                                   199   3e-55   Gossypium aridum
gb|AEN71067.1|  sucrose synthase Sus1                                   199   3e-55   Gossypium tomentosum
gb|AEK81520.1|  sucrose synthase isoform B                              199   3e-55   Gossypium hirsutum [American cotton]
gb|AEN71068.1|  sucrose synthase Sus1                                   199   3e-55   Gossypium tomentosum
gb|AEN71080.1|  sucrose synthase Sus1                                   199   3e-55   Gossypium gossypioides
gb|AEN71078.1|  sucrose synthase Sus1                                   199   4e-55   Gossypium klotzschianum
gb|ADY68846.1|  sucrose synthase                                        199   4e-55   Gossypium herbaceum subsp. africanum
gb|ACV72640.1|  sucrose synthase 1                                      199   4e-55   Gossypium hirsutum [American cotton]
gb|AEN71063.1|  sucrose synthase Sus1                                   199   4e-55   Gossypium mustelinum
gb|AEV40462.1|  sucrose synthase 3                                      199   4e-55   Gossypium arboreum [tree cotton]
gb|ADY68845.1|  sucrose synthase                                        199   4e-55   Gossypium barbadense [Egyptian cotton]
gb|AEN71059.1|  sucrose synthase Sus1                                   199   4e-55   Gossypium thurberi
dbj|BAM68526.1|  sucrose synthase                                       199   4e-55   Mangifera indica
gb|AEN71075.1|  sucrose synthase Sus1                                   199   4e-55   Gossypium armourianum
gb|ADY68848.1|  sucrose synthase                                        199   4e-55   Gossypium hirsutum [American cotton]
gb|AEN71061.1|  sucrose synthase Sus1                                   199   4e-55   Gossypium schwendimanii
gb|ADY68844.1|  sucrose synthase                                        199   4e-55   Gossypium barbadense [Egyptian cotton]
gb|AAD28641.1|  sucrose synthase                                        199   4e-55   Gossypium hirsutum [American cotton]
gb|AEK81522.1|  sucrose synthase isoform D                              199   4e-55   Gossypium hirsutum [American cotton]
gb|AEN71066.1|  sucrose synthase Sus1                                   199   4e-55   Gossypium darwinii
emb|CAB39757.2|  sucrose synthase                                       188   4e-55   Lotus japonicus
ref|XP_002877269.1|  hypothetical protein ARALYDRAFT_484788             199   4e-55   
gb|AAR03498.1|  sucrose synthase                                        198   5e-55   Populus tremuloides
gb|ABP88869.1|  sucrose synthase                                        198   6e-55   Medicago falcata [sickle alfalfa]
gb|AIJ28962.1|  sucrose synthase                                        198   6e-55   Manihot esculenta [manioc]
gb|AGM14949.1|  sucrose synthase 4                                      198   7e-55   Hevea brasiliensis [jebe]
ref|NP_001289655.1|  sucrose synthase                                   198   8e-55   Eucalyptus grandis [rose gum]
gb|AGO61958.1|  sucrose synthase                                        192   1e-54   Prunus serrulata
ref|XP_002275155.1|  PREDICTED: sucrose synthase                        197   1e-54   Vitis vinifera
gb|AAK59464.1|  putative sucrose synthase                               195   1e-54   Arabidopsis thaliana [mouse-ear cress]
emb|CAN82840.1|  hypothetical protein VITISV_024563                     197   1e-54   Vitis vinifera
gb|AIJ28961.1|  sucrose synthase                                        197   1e-54   Manihot esculenta [manioc]
gb|AGM14948.1|  sucrose synthase 3                                      197   1e-54   Hevea brasiliensis [jebe]
gb|ABD96570.1|  sucrose synthase                                        197   1e-54   Manihot esculenta [manioc]
sp|O65026.1|SUSY_MEDSA  RecName: Full=Sucrose synthase; AltName: ...    197   1e-54   Medicago sativa [alfalfa]
ref|NP_001237525.1|  sucrose synthase                                   197   1e-54   Glycine max [soybeans]
gb|AEQ94149.1|  sucrose synthase1                                       186   2e-54   Elaeis guineensis
gb|ADR81997.1|  sucrose synthase 2                                      197   2e-54   Populus trichocarpa [western balsam poplar]
ref|XP_010535796.1|  PREDICTED: sucrose synthase 4                      197   2e-54   Tarenaya hassleriana [spider flower]
ref|XP_006381564.1|  sucrose synthase family protein                    197   2e-54   Populus trichocarpa [western balsam poplar]
emb|CAB40795.1|  sucrose synthase                                       197   2e-54   Medicago truncatula
ref|XP_003609949.1|  Sucrose synthase                                   197   2e-54   Medicago truncatula
ref|XP_010420928.1|  PREDICTED: sucrose synthase 1-like                 197   2e-54   Camelina sativa [gold-of-pleasure]
ref|XP_010454391.1|  PREDICTED: sucrose synthase 1-like isoform X2      196   3e-54   Camelina sativa [gold-of-pleasure]
gb|AEN71060.1|  sucrose synthase Sus1                                   196   3e-54   Gossypium laxum
ref|XP_010454392.1|  PREDICTED: sucrose synthase 1-like isoform X3      197   3e-54   Camelina sativa [gold-of-pleasure]
ref|XP_010493195.1|  PREDICTED: sucrose synthase 1                      196   3e-54   Camelina sativa [gold-of-pleasure]
ref|XP_007138617.1|  hypothetical protein PHAVU_009G223800g             196   3e-54   Phaseolus vulgaris [French bean]
ref|XP_006290612.1|  hypothetical protein CARUB_v10016702mg             196   3e-54   Capsella rubella
ref|XP_010454390.1|  PREDICTED: sucrose synthase 1-like isoform X1      197   3e-54   Camelina sativa [gold-of-pleasure]
emb|CDX70945.1|  BnaC03g10290D                                          196   3e-54   
gb|AAR19769.1|  sucrose synthase                                        196   3e-54   Beta vulgaris [beet]
ref|XP_010687574.1|  PREDICTED: sucrose synthase                        196   3e-54   
ref|XP_009120766.1|  PREDICTED: LOW QUALITY PROTEIN: sucrose synt...    196   3e-54   Brassica rapa
emb|CDX92432.1|  BnaA10g14710D                                          196   3e-54   
gb|ADW80575.1|  sucrose synthase 2                                      196   4e-54   Populus tomentosa [Chinese white poplar]
gb|ADW80600.1|  sucrose synthase 2                                      196   4e-54   Populus tomentosa [Chinese white poplar]
gb|ADW80607.1|  sucrose synthase 2                                      196   4e-54   Populus tomentosa [Chinese white poplar]
gb|ADW80589.1|  sucrose synthase 2                                      196   4e-54   Populus tomentosa [Chinese white poplar]
gb|ADW80610.1|  sucrose synthase 2                                      196   4e-54   Populus tomentosa [Chinese white poplar]
gb|ADW80595.1|  sucrose synthase 2                                      196   4e-54   Populus tomentosa [Chinese white poplar]
gb|ADW80591.1|  sucrose synthase 2                                      196   4e-54   Populus tomentosa [Chinese white poplar]
gb|ADW80578.1|  sucrose synthase 2                                      196   4e-54   Populus tomentosa [Chinese white poplar]
gb|ADW80592.1|  sucrose synthase 2                                      196   4e-54   Populus tomentosa [Chinese white poplar]
gb|ADW80588.1|  sucrose synthase 2                                      196   4e-54   Populus tomentosa [Chinese white poplar]
gb|ADW80580.1|  sucrose synthase 2                                      196   4e-54   Populus tomentosa [Chinese white poplar]
gb|ADW80586.1|  sucrose synthase 2                                      196   4e-54   Populus tomentosa [Chinese white poplar]
gb|ADW80581.1|  sucrose synthase 2                                      196   4e-54   Populus tomentosa [Chinese white poplar]
gb|ADV71182.1|  sucrose synthase 2                                      196   4e-54   Populus tomentosa [Chinese white poplar]
gb|ADW80611.1|  sucrose synthase 2                                      196   4e-54   Populus tomentosa [Chinese white poplar]
gb|ADW80590.1|  sucrose synthase 2                                      196   4e-54   Populus tomentosa [Chinese white poplar]
gb|ADW80587.1|  sucrose synthase 2                                      196   4e-54   Populus tomentosa [Chinese white poplar]
emb|CDY16569.1|  BnaC09g37040D                                          196   4e-54   Brassica napus [oilseed rape]
gb|ADW80608.1|  sucrose synthase 2                                      196   4e-54   Populus tomentosa [Chinese white poplar]
gb|ADW80593.1|  sucrose synthase 2                                      196   4e-54   Populus tomentosa [Chinese white poplar]
gb|ADW80606.1|  sucrose synthase 2                                      196   4e-54   Populus tomentosa [Chinese white poplar]
gb|ADW80598.1|  sucrose synthase 2                                      196   4e-54   Populus tomentosa [Chinese white poplar]
gb|ADW80582.1|  sucrose synthase 2                                      196   4e-54   Populus tomentosa [Chinese white poplar]
gb|ADW80609.1|  sucrose synthase 2                                      196   4e-54   Populus tomentosa [Chinese white poplar]
gb|ADW80604.1|  sucrose synthase 2                                      196   4e-54   Populus tomentosa [Chinese white poplar]
gb|ADW80584.1|  sucrose synthase 2                                      196   4e-54   Populus tomentosa [Chinese white poplar]
gb|ADW80574.1|  sucrose synthase 2                                      196   4e-54   Populus tomentosa [Chinese white poplar]
ref|XP_009348896.1|  PREDICTED: sucrose synthase-like                   196   4e-54   Pyrus x bretschneideri [bai li]
ref|XP_008337809.1|  PREDICTED: sucrose synthase                        196   4e-54   Malus domestica [apple tree]
gb|ADW80597.1|  sucrose synthase 2                                      196   4e-54   Populus tomentosa [Chinese white poplar]
gb|ADW80585.1|  sucrose synthase 2                                      196   4e-54   Populus tomentosa [Chinese white poplar]
gb|ADW80605.1|  sucrose synthase 2                                      196   4e-54   Populus tomentosa [Chinese white poplar]
gb|ABW76422.1|  sucrose synthase                                        196   4e-54   Populus tremuloides
gb|ADW80576.1|  sucrose synthase 2                                      196   4e-54   Populus tomentosa [Chinese white poplar]
gb|ADW80596.1|  sucrose synthase 2                                      196   5e-54   Populus tomentosa [Chinese white poplar]
gb|AIJ28959.1|  sucrose synthase                                        196   5e-54   Manihot esculenta subsp. flabellifolia
sp|P49034.1|SUSY_ALNGL  RecName: Full=Sucrose synthase; AltName: ...    196   5e-54   Alnus glutinosa
ref|XP_003609946.1|  Sucrose synthase                                   196   5e-54   
gb|ADW80602.1|  sucrose synthase 2                                      196   5e-54   Populus tomentosa [Chinese white poplar]
gb|KHN49081.1|  Sucrose synthase                                        196   6e-54   Glycine soja [wild soybean]
ref|XP_011039917.1|  PREDICTED: sucrose synthase                        196   6e-54   Populus euphratica
ref|XP_003546526.1|  PREDICTED: sucrose synthase-like isoform X1        195   6e-54   
pdb|3S28|A  Chain A, The Crystal Structure Of Sucrose Synthase-1 ...    196   6e-54   Arabidopsis thaliana [mouse-ear cress]
ref|NP_197583.1|  sucrose synthase 1                                    195   6e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010247458.1|  PREDICTED: sucrose synthase                        195   7e-54   Nelumbo nucifera [Indian lotus]
ref|XP_010271909.1|  PREDICTED: sucrose synthase                        195   7e-54   Nelumbo nucifera [Indian lotus]
ref|XP_010520519.1|  PREDICTED: sucrose synthase 4-like                 195   8e-54   Tarenaya hassleriana [spider flower]
ref|XP_003533802.1|  PREDICTED: sucrose synthase-like isoform X1        195   8e-54   Glycine max [soybeans]
ref|NP_566865.2|  sucrose synthase 4                                    195   8e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009131818.1|  PREDICTED: sucrose synthase 1                      195   9e-54   Brassica rapa
gb|KHN47619.1|  Sucrose synthase                                        195   9e-54   Glycine soja [wild soybean]
ref|XP_002516210.1|  sucrose synthase, putative                         194   1e-53   
sp|Q01390.1|SUSY_VIGRR  RecName: Full=Sucrose synthase; AltName: ...    195   1e-53   Vigna radiata var. radiata [golden gram]
gb|ADW80603.1|  sucrose synthase 2                                      194   1e-53   Populus tomentosa [Chinese white poplar]
gb|AII19313.1|  sucrose synthase 1                                      194   1e-53   Ricinus communis
ref|XP_006287059.1|  hypothetical protein CARUB_v10000208mg             195   1e-53   
emb|CDX88838.1|  BnaA03g08110D                                          194   1e-53   
gb|EYU25805.1|  hypothetical protein MIMGU_mgv1a001207mg                195   1e-53   Erythranthe guttata [common monkey flower]
gb|AGQ57012.1|  sucrose synthase 1                                      194   1e-53   Hevea brasiliensis [jebe]
gb|ADW80599.1|  sucrose synthase 2                                      194   1e-53   Populus tomentosa [Chinese white poplar]
gb|AFI57908.1|  sucrose synthase 1                                      194   1e-53   Prunus persica
dbj|BAH56282.1|  sucrose synthase                                       194   1e-53   Vigna angularis [azuki bean]
ref|XP_008382924.1|  PREDICTED: sucrose synthase-like                   194   1e-53   
ref|XP_007204649.1|  hypothetical protein PRUPE_ppa001535mg             194   1e-53   Prunus persica
gb|ADW80579.1|  sucrose synthase 2                                      194   1e-53   Populus tomentosa [Chinese white poplar]
ref|XP_008242292.1|  PREDICTED: sucrose synthase                        194   1e-53   Prunus mume [ume]
ref|XP_008349074.1|  PREDICTED: sucrose synthase-like                   194   1e-53   
gb|ACP17902.1|  sucrose synthase                                        194   2e-53   Phaseolus vulgaris [French bean]
gb|ADW80577.1|  sucrose synthase 2                                      194   2e-53   Populus tomentosa [Chinese white poplar]
gb|ADW80601.1|  sucrose synthase 2                                      194   2e-53   Populus tomentosa [Chinese white poplar]
ref|XP_009348897.1|  PREDICTED: sucrose synthase-like                   194   2e-53   Pyrus x bretschneideri [bai li]
ref|XP_008338289.1|  PREDICTED: sucrose synthase-like                   194   2e-53   
ref|XP_006400648.1|  hypothetical protein EUTSA_v10012719mg             193   4e-53   Eutrema salsugineum [saltwater cress]
gb|AIL23782.1|  sucrose synthase                                        193   4e-53   Prunus serrulata
ref|XP_009343357.1|  PREDICTED: sucrose synthase                        193   5e-53   Pyrus x bretschneideri [bai li]
pdb|3S27|A  Chain A, The Crystal Structure Of Sucrose Synthase-1 ...    192   6e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008391788.1|  PREDICTED: sucrose synthase-like isoform X2        192   6e-53   
ref|XP_009343356.1|  PREDICTED: sucrose synthase-like                   192   6e-53   Pyrus x bretschneideri [bai li]
ref|XP_008391777.1|  PREDICTED: sucrose synthase-like isoform X1        192   7e-53   
gb|ADW80583.1|  sucrose synthase 2                                      192   7e-53   Populus tomentosa [Chinese white poplar]
ref|XP_002874016.1|  hypothetical protein ARALYDRAFT_910122             192   7e-53   Arabidopsis lyrata subsp. lyrata
gb|KJB65376.1|  hypothetical protein B456_010G092300                    192   8e-53   Gossypium raimondii
gb|KEH37657.1|  sucrose synthase                                        192   8e-53   Medicago truncatula
tpg|DAA45272.1|  TPA: putative sucrose synthase family protein          183   1e-52   
gb|AGV22112.1|  sucrose synthase 2                                      192   1e-52   Betula luminifera [liang ye hua]
gb|ACF85812.1|  unknown                                                 178   1e-52   Zea mays [maize]
emb|CDO97805.1|  unnamed protein product                                191   1e-52   Coffea canephora [robusta coffee]
ref|XP_004508033.1|  PREDICTED: sucrose synthase-like isoform X1        191   3e-52   
ref|XP_010107074.1|  Sucrose synthase                                   191   3e-52   Morus notabilis
ref|XP_008797380.1|  PREDICTED: sucrose synthase 1-like isoform X2      191   3e-52   Phoenix dactylifera
ref|XP_008797379.1|  PREDICTED: sucrose synthase 1-like isoform X1      190   5e-52   
dbj|BAM05649.1|  sucrose synthase 3                                     190   6e-52   Eucalyptus globulus subsp. globulus
tpg|DAA45273.1|  TPA: putative sucrose synthase family protein          184   8e-52   
ref|XP_004488146.1|  PREDICTED: sucrose synthase-like isoform X6        189   1e-51   
ref|XP_009410254.1|  PREDICTED: sucrose synthase 1-like                 189   1e-51   
ref|XP_010917399.1|  PREDICTED: sucrose synthase 1-like                 189   1e-51   Elaeis guineensis
sp|Q41608.1|SUS1_TULGE  RecName: Full=Sucrose synthase 1; AltName...    189   1e-51   Tulipa gesneriana
ref|XP_008450968.1|  PREDICTED: sucrose synthase                        189   2e-51   Cucumis melo [Oriental melon]
gb|KGN66333.1|  hypothetical protein Csa_1G597800                       188   2e-51   
ref|XP_004144053.1|  PREDICTED: sucrose synthase-like                   188   2e-51   
gb|AEN83999.1|  sucrose synthase                                        188   2e-51   
emb|CAA57881.1|  sucrose synthase                                       188   2e-51   
gb|AFM52233.1|  putative sucrose synthase 2                             188   2e-51   
gb|ABK23178.1|  unknown                                                 175   2e-51   
gb|ABR25521.1|  sucrose synthase metabolism                             177   2e-51   
ref|XP_008783137.1|  PREDICTED: sucrose synthase 1-like isoform X2      188   2e-51   
ref|XP_008783129.1|  PREDICTED: sucrose synthase 1-like isoform X1      188   2e-51   
emb|CAC32462.1|  sucrose synthase isoform 3                             188   2e-51   
gb|KJB82967.1|  hypothetical protein B456_013G222400                    188   3e-51   
dbj|BAA89232.1|  wsus                                                   188   3e-51   
emb|CAA50317.1|  sucrose synthase                                       188   3e-51   
gb|ACF80843.1|  unknown                                                 176   3e-51   
ref|XP_010932355.1|  PREDICTED: sucrose synthase 2-like isoform X2      187   4e-51   
ref|XP_010932353.1|  PREDICTED: sucrose synthase 1-like isoform X1      187   4e-51   
sp|Q41607.1|SUS2_TULGE  RecName: Full=Sucrose synthase 2; AltName...    187   4e-51   
gb|KJB54541.1|  hypothetical protein B456_009G038000                    187   6e-51   
gb|KJB54539.1|  hypothetical protein B456_009G038000                    187   6e-51   
ref|NP_001289661.1|  sucrose synthase-like                              187   7e-51   
ref|XP_010049327.1|  PREDICTED: sucrose synthase-like                   187   7e-51   
gb|ADM77484.1|  sucrose synthase-like protein                           174   8e-51   
gb|AEV40461.1|  sucrose synthase 2                                      186   8e-51   
gb|ADM77474.1|  sucrose synthase-like protein                           174   8e-51   
ref|XP_010937277.1|  PREDICTED: sucrose synthase 2-like                 186   9e-51   
gb|AAM22755.1|  sucrose synthase                                        174   1e-50   
ref|XP_008783098.1|  PREDICTED: sucrose synthase 1                      186   1e-50   
dbj|BAE06059.1|  sucrose synthase                                       186   1e-50   
gb|AAA34305.1|  sucrose synthase type 2                                 176   1e-50   
ref|XP_006838088.1|  hypothetical protein AMTR_s00106p00019920          186   2e-50   
gb|ACF78506.1|  unknown                                                 184   2e-50   
gb|AFA36485.1|  putative sucrose synthase 2                             176   2e-50   
gb|AGM14947.1|  sucrose synthase 2                                      185   4e-50   
tpg|DAA45279.1|  TPA: putative sucrose synthase family protein          180   4e-50   
gb|KDO71750.1|  hypothetical protein CISIN_1g003726mg                   184   4e-50   
dbj|BAM05651.1|  sucrose synthase 3                                     184   4e-50   
ref|XP_002516963.1|  sucrose synthase, putative                         184   4e-50   
gb|AAM95944.1|  sucrose synthase                                        185   4e-50   
dbj|BAM05650.1|  sucrose synthase 3                                     184   5e-50   
emb|CAA09680.1|  sucrose synthase                                       179   5e-50   
ref|XP_006419508.1|  hypothetical protein CICLE_v10004341mg             184   5e-50   
gb|AAL50570.1|AF412037_1  sucrose synthase                              184   5e-50   
gb|AFW88069.1|  sucrose synthase1                                       178   8e-50   
gb|AGQ57013.1|  sucrose synthase 2                                      184   9e-50   
gb|KJB07349.1|  hypothetical protein B456_001G017700                    184   9e-50   
ref|XP_006474683.1|  PREDICTED: sucrose synthase-like                   184   9e-50   
ref|XP_008655408.1|  PREDICTED: sucrose synthase 4-like                 184   9e-50   
dbj|BAM75184.1|  sucrose synthase                                       177   9e-50   
ref|XP_008795811.1|  PREDICTED: sucrose synthase 4-like                 174   1e-49   
gb|AAA34304.1|  sucrose synthase type 1                                 173   1e-49   
ref|XP_009404100.1|  PREDICTED: sucrose synthase 2                      184   1e-49   
gb|ADY02961.1|  sucrose synthase                                        183   1e-49   
ref|XP_009610442.1|  PREDICTED: sucrose synthase 4-like                 176   1e-49   
ref|NP_001105194.1|  sucrose synthase2                                  183   1e-49   
gb|ABR15470.1|  sucrose synthase                                        183   2e-49   
ref|XP_010051346.1|  PREDICTED: sucrose synthase-like                   183   2e-49   
gb|ADE77562.1|  unknown                                                 174   2e-49   
ref|NP_001268888.1|  sucrose synthase 2-like                            183   2e-49   
ref|XP_002465303.1|  hypothetical protein SORBIDRAFT_01g035890          182   2e-49   
ref|XP_009352312.1|  PREDICTED: sucrose synthase 2-like                 182   3e-49   
gb|ABY82048.1|  sucrose synthase                                        177   3e-49   
gb|KGN52828.1|  hypothetical protein Csa_4G001950                       182   3e-49   
gb|ABE73120.1|  SUS1                                                    179   3e-49   
ref|XP_006287087.1|  hypothetical protein CARUB_v10000249mg             181   3e-49   
ref|XP_009359754.1|  PREDICTED: sucrose synthase                        182   3e-49   
gb|AIS75087.1|  sus1                                                    182   3e-49   
gb|EMT20174.1|  Sucrose synthase 2                                      181   4e-49   
ref|XP_009380139.1|  PREDICTED: sucrose synthase 2-like                 182   4e-49   
ref|XP_010685729.1|  PREDICTED: sucrose synthase-like                   182   4e-49   
gb|AFY03626.1|  sucrose synthase                                        182   4e-49   
gb|AAL27096.1|  sucrose synthase                                        182   5e-49   
ref|XP_008800466.1|  PREDICTED: sucrose synthase 2                      182   5e-49   
gb|KDO73800.1|  hypothetical protein CISIN_1g003947mg                   181   6e-49   
ref|XP_010939862.1|  PREDICTED: sucrose synthase 1                      181   6e-49   
ref|XP_010092252.1|  Sucrose synthase 2                                 181   6e-49   
gb|KDP28192.1|  hypothetical protein JCGZ_13963                         181   7e-49   
ref|XP_006452875.1|  hypothetical protein CICLE_v10010343mg             181   7e-49   
ref|XP_008454320.1|  PREDICTED: sucrose synthase 2                      181   7e-49   
gb|ACN36258.1|  unknown                                                 178   8e-49   
gb|AGW23638.1|  sucrose synthase                                        181   9e-49   
gb|KDO87153.1|  hypothetical protein CISIN_1g003492mg                   180   1e-48   
ref|NP_001050319.1|  Os03g0401300                                       181   1e-48   
gb|EAY90371.1|  hypothetical protein OsI_11950                          181   1e-48   
ref|XP_010482198.1|  PREDICTED: sucrose synthase 2-like                 167   1e-48   
gb|KDO87158.1|  hypothetical protein CISIN_1g003492mg                   180   1e-48   
ref|XP_006444401.1|  hypothetical protein CICLE_v10018889mg             180   1e-48   
gb|EMS65561.1|  Sucrose synthase 2                                      181   1e-48   
gb|AGM14950.1|  sucrose synthase 5                                      180   2e-48   
gb|AHM02468.1|  sucrose synthase                                        179   2e-48   
ref|XP_006480003.1|  PREDICTED: sucrose synthase 3-like                 180   2e-48   
gb|KDO87151.1|  hypothetical protein CISIN_1g003492mg                   180   2e-48   
ref|XP_006444402.1|  hypothetical protein CICLE_v10018889mg             180   2e-48   
ref|XP_006489034.1|  PREDICTED: sucrose synthase 2-like isoform X2      180   2e-48   
dbj|BAA88904.1|  sucrose synthase                                       180   2e-48   
gb|AJA37527.1|  sucrose synthase                                        179   2e-48   
tpg|DAA45281.1|  TPA: putative sucrose synthase family protein          180   2e-48   
ref|XP_006651359.1|  PREDICTED: sucrose synthase 4-like                 178   2e-48   
ref|XP_002271896.1|  PREDICTED: sucrose synthase 2                      178   3e-48   
dbj|BAJ10424.1|  sucrose synthase                                       179   3e-48   
emb|CAL25362.2|  sucrose synthase                                       178   3e-48   
sp|O24301.1|SUS2_PEA  RecName: Full=Sucrose synthase 2; AltName: ...    178   3e-48   
ref|XP_006378062.1|  hypothetical protein POPTR_0010s01360g             174   3e-48   
gb|AEO09338.2|  sucrose synthase                                        179   3e-48   
ref|XP_008223239.1|  PREDICTED: sucrose synthase 2                      170   3e-48   
ref|XP_007163138.1|  hypothetical protein PHAVU_001G209600g             179   4e-48   
gb|AIL88517.1|  sucrose synthase type 2-2                               179   4e-48   
gb|AIL88516.1|  sucrose synthase type 2-1                               179   4e-48   
ref|NP_001050064.1|  Os03g0340500                                       177   4e-48   
ref|XP_006650177.1|  PREDICTED: sucrose synthase 1-like isoform X2      179   4e-48   
ref|XP_010269598.1|  PREDICTED: sucrose synthase 2-like                 177   4e-48   
dbj|BAA88981.1|  sucrose synthase                                       177   4e-48   
emb|CDX86250.1|  BnaA06g29670D                                          179   4e-48   
gb|AFM52237.1|  putative sucrose synthase 6                             177   5e-48   
ref|NP_001280838.1|  sucrose synthase 3                                 177   5e-48   
ref|XP_008386674.1|  PREDICTED: sucrose synthase 3                      177   5e-48   
gb|AAA68209.1|  sus1                                                    179   6e-48   
ref|XP_003562658.1|  PREDICTED: sucrose synthase 2                      179   6e-48   
ref|XP_009390318.1|  PREDICTED: sucrose synthase 2-like                 179   6e-48   
ref|XP_010556726.1|  PREDICTED: sucrose synthase 3                      177   7e-48   
ref|XP_008235123.1|  PREDICTED: sucrose synthase 3                      177   7e-48   
gb|AEN71096.1|  sucrose synthase SusA1                                  178   7e-48   
gb|AEN71094.1|  sucrose synthase SusA1                                  178   7e-48   
gb|AEN71090.1|  sucrose synthase SusA1                                  178   7e-48   
gb|AEN71086.1|  sucrose synthase SusA1                                  178   7e-48   
gb|AEN71088.1|  sucrose synthase SusA1                                  178   8e-48   
gb|AEN71083.1|  sucrose synthase SusA1                                  178   8e-48   
gb|AEN71092.1|  sucrose synthase SusA1                                  178   8e-48   
gb|AEN71087.1|  sucrose synthase SusA1                                  177   8e-48   
gb|AEZ00746.1|  SusA1                                                   178   8e-48   
gb|ABF95854.1|  Sucrose synthase 2, putative, expressed                 177   8e-48   
gb|AEN71101.1|  sucrose synthase SusA1                                  178   8e-48   
gb|AEN71099.1|  sucrose synthase SusA1                                  178   8e-48   
gb|AEV40893.1|  sucrose synthase                                        178   8e-48   
gb|AEN71091.1|  sucrose synthase SusA1                                  178   8e-48   
ref|XP_004290813.1|  PREDICTED: sucrose synthase 2                      177   8e-48   
gb|AEN71106.1|  sucrose synthase SusA1                                  178   8e-48   
gb|AEN71104.1|  sucrose synthase SusA1                                  178   8e-48   
gb|AEZ00745.1|  SusA1                                                   178   8e-48   
ref|XP_008659017.1|  PREDICTED: sucrose synthase 2 isoform X1           178   8e-48   
gb|AEN71085.1|  sucrose synthase SusA1                                  178   8e-48   
gb|AEN71089.1|  sucrose synthase SusA1                                  178   8e-48   
gb|AEN71093.1|  sucrose synthase SusA1                                  178   9e-48   
ref|XP_004495938.1|  PREDICTED: sucrose synthase 2-like                 176   9e-48   
gb|AEV40896.1|  sucrose synthase                                        178   9e-48   
gb|AEV40894.1|  sucrose synthase                                        178   9e-48   
gb|AEN71103.1|  sucrose synthase SusA1                                  178   9e-48   
gb|AEN71105.1|  sucrose synthase SusA1                                  178   1e-47   
gb|AEN71084.1|  sucrose synthase SusA1                                  178   1e-47   
ref|XP_009151715.1|  PREDICTED: sucrose synthase 2                      178   1e-47   
ref|XP_002465161.1|  hypothetical protein SORBIDRAFT_01g033060          178   1e-47   
gb|AAV64256.2|  sucrose synthase                                        178   1e-47   
gb|AGI56230.1|  sucrose synthase 1                                      178   1e-47   
ref|XP_004984086.1|  PREDICTED: sucrose synthase 2-like                 178   1e-47   
ref|XP_007050984.1|  Sucrose synthase 3 isoform 1                       176   1e-47   
dbj|BAK02964.1|  predicted protein                                      178   1e-47   
ref|XP_010456053.1|  PREDICTED: sucrose synthase 3-like                 176   2e-47   
ref|XP_003557752.1|  PREDICTED: sucrose synthase 1                      177   2e-47   
ref|NP_001060278.1|  Os07g0616800                                       177   2e-47   
ref|XP_004287544.1|  PREDICTED: sucrose synthase-like                   177   2e-47   
gb|KJB24379.1|  hypothetical protein B456_004G142700                    176   2e-47   
gb|AAC41682.1|  sucrose synthase 3                                      177   2e-47   
gb|AEV40895.1|  sucrose synthase                                        176   2e-47   
ref|XP_011462741.1|  PREDICTED: sucrose synthase 2                      176   2e-47   
ref|XP_006657957.1|  PREDICTED: sucrose synthase 3-like                 177   2e-47   
gb|EAZ04713.1|  hypothetical protein OsI_26874                          177   2e-47   
ref|XP_010429475.1|  PREDICTED: sucrose synthase 3                      176   2e-47   
ref|XP_007200961.1|  hypothetical protein PRUPE_ppa002723mg             176   2e-47   
ref|XP_002523115.1|  sucrose synthase, putative                         177   2e-47   
dbj|BAB20799.1|  sucrose synthase 1                                     177   2e-47   
gb|KEH24408.1|  sucrose synthase                                        175   3e-47   
ref|XP_008246168.1|  PREDICTED: sucrose synthase 2-like                 168   3e-47   
emb|CDX85398.1|  BnaC07g27090D                                          176   3e-47   
dbj|BAM05652.1|  sucrose synthase 3                                     176   3e-47   
ref|XP_010921619.1|  PREDICTED: sucrose synthase 4                      176   3e-47   
ref|XP_003564156.1|  PREDICTED: sucrose synthase 1                      176   4e-47   
ref|NP_001105323.1|  sucrose synthase 2                                 176   4e-47   
gb|AGV22111.1|  sucrose synthase 1                                      176   4e-47   
ref|XP_002302727.1|  sucrose synthase family protein                    174   4e-47   
gb|AFR41908.1|  sucrose synthase                                        164   4e-47   
emb|CAA03935.1|  sucrose synthase type 2                                176   5e-47   
ref|XP_004488141.1|  PREDICTED: sucrose synthase-like isoform X1        176   5e-47   
gb|KJB24380.1|  hypothetical protein B456_004G142700                    175   5e-47   
ref|XP_004494391.1|  PREDICTED: sucrose synthase 2-like isoform X2      174   5e-47   
ref|XP_003521575.1|  PREDICTED: sucrose synthase 2-like                 174   5e-47   
gb|KDO87150.1|  hypothetical protein CISIN_1g003492mg                   174   6e-47   
gb|AAL50572.2|AF412039_1  sucrose synthase                              176   6e-47   
gb|KCW81848.1|  hypothetical protein EUGRSUZ_C03199                     176   6e-47   
ref|XP_003557951.1|  PREDICTED: sucrose synthase 4                      174   6e-47   
gb|AIL88515.1|  sucrose synthase type 3                                 174   7e-47   
gb|AAL50571.1|AF412038_1  sucrose synthase                              176   7e-47   
dbj|BAE06058.1|  sucrose synthase                                       176   7e-47   
ref|NP_001275237.1|  sucrose synthase                                   173   9e-47   
dbj|BAM05645.1|  sucrose synthase 1                                     175   1e-46   
gb|AIO11846.1|  sucrose synthase                                        173   1e-46   
ref|XP_010422613.1|  PREDICTED: sucrose synthase 3-like                 173   1e-46   
ref|XP_010088307.1|  Sucrose synthase 2                                 174   1e-46   
gb|AFR41929.1|  sucrose synthase                                        163   1e-46   
gb|KCW67227.1|  hypothetical protein EUGRSUZ_F01010                     173   1e-46   
ref|XP_009800149.1|  PREDICTED: sucrose synthase 2-like                 173   1e-46   
ref|XP_004247973.1|  PREDICTED: sucrose synthase 2-like                 173   1e-46   
gb|AAM95943.1|  sucrose synthase                                        175   1e-46   
gb|AEA76429.1|  sucrose synthase 1                                      175   1e-46   
gb|EMS66266.1|  Sucrose synthase 1                                      175   1e-46   
ref|XP_009390882.1|  PREDICTED: sucrose synthase 2-like                 175   1e-46   
gb|EMT06653.1|  Sucrose synthase 1                                      175   2e-46   
ref|XP_004984440.1|  PREDICTED: sucrose synthase 4-like                 172   2e-46   
ref|XP_010259474.1|  PREDICTED: sucrose synthase 4-like                 172   2e-46   
ref|XP_010069893.1|  PREDICTED: sucrose synthase 2                      172   2e-46   
gb|KHN43494.1|  Sucrose synthase 2                                      174   2e-46   
gb|EMT33394.1|  Sucrose synthase 1                                      174   2e-46   
sp|P31923.1|SUS2_HORVU  RecName: Full=Sucrose synthase 2; AltName...    174   2e-46   
ref|XP_007225257.1|  hypothetical protein PRUPE_ppa001573mg             172   2e-46   
ref|XP_002271530.1|  PREDICTED: sucrose synthase 2                      172   2e-46   
emb|CAA04543.1|  sucrose synthase type I                                174   2e-46   
ref|XP_006396436.1|  hypothetical protein EUTSA_v10028435mg             172   2e-46   
ref|XP_008351185.1|  PREDICTED: sucrose synthase 2-like                 172   2e-46   
ref|XP_010938368.1|  PREDICTED: LOW QUALITY PROTEIN: sucrose synt...    172   2e-46   
gb|AFR41912.1|  sucrose synthase                                        162   3e-46   
gb|AFR41915.1|  sucrose synthase                                        162   3e-46   
ref|XP_007035651.1|  Sucrose synthase 2 isoform 1                       172   3e-46   
ref|XP_003554531.1|  PREDICTED: sucrose synthase 2-like                 174   3e-46   



>ref|XP_009625446.1| PREDICTED: sucrose synthase [Nicotiana tomentosiformis]
Length=805

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/111 (93%), Positives = 107/111 (96%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHGEQAAELL DFFE+CKK+PSHWE IS GGLKRIQEKYTWQ
Sbjct  695  GGPAEIIVHGKSGFHIDPYHGEQAAELLADFFERCKKEPSHWEAISEGGLKRIQEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYSDRLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAE VPLA+E
Sbjct  755  IYSDRLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEAVPLAVE  805



>ref|XP_009792656.1| PREDICTED: sucrose synthase [Nicotiana sylvestris]
Length=805

 Score =   221 bits (564),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 103/111 (93%), Positives = 107/111 (96%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG+QAAELL DFFEKCKK+PSHWE IS GGLKRIQEKYTWQ
Sbjct  695  GGPAEIIVHGKSGFHIDPYHGDQAAELLADFFEKCKKEPSHWEAISEGGLKRIQEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYSDRLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAE VPLA+E
Sbjct  755  IYSDRLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEAVPLAVE  805



>gb|ADA68250.1| sucrose synthase, partial [Schiedea globosa]
 dbj|BAN18490.1| sucrose synthase, partial [Schiedea spergulina]
 dbj|BAN18491.1| sucrose synthase, partial [Schiedea kealiae]
 dbj|BAN18492.1| sucrose synthase, partial [Schiedea mannii]
 dbj|BAN18493.1| sucrose synthase, partial [Schiedea menziesii]
 dbj|BAN18494.1| sucrose synthase, partial [Schiedea hookeri]
 dbj|BAN18495.1| sucrose synthase, partial [Schiedea sarmentosa]
 dbj|BAN18496.1| sucrose synthase, partial [Schiedea lydgatei]
 dbj|BAN18497.1| sucrose synthase, partial [Schiedea haleakalensis]
 dbj|BAN18498.1| sucrose synthase, partial [Schiedea salicaria]
 dbj|BAN18499.1| sucrose synthase, partial [Schiedea globosa]
Length=118

 Score =   204 bits (518),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 96/111 (86%), Positives = 104/111 (94%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIV+GKSGFHIDPYHG++AA+LLVDFF+KCK DPSHWE IS GGLKRI+EKYTWQ
Sbjct  7    GGPAEIIVNGKSGFHIDPYHGDKAADLLVDFFQKCKGDPSHWEAISLGGLKRIEEKYTWQ  66

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  67   IYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  117



>gb|ADK98097.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98098.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98099.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98100.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98104.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98105.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98106.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98107.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98108.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98110.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98111.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98114.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98115.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98117.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98119.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADW09893.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09894.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09899.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09900.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09902.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09909.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09910.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09919.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09920.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09931.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09932.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09935.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09937.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09938.1| putative sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   203 bits (517),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 96/111 (86%), Positives = 104/111 (94%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIV+GKSGFHIDPYHG++AA+LLVDFF+KCK DPSHWE IS GGLKRI+EKYTWQ
Sbjct  3    GGPAEIIVNGKSGFHIDPYHGDKAADLLVDFFQKCKGDPSHWEAISLGGLKRIEEKYTWQ  62

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  63   IYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>dbj|BAN18500.1| sucrose synthase, partial [Schiedea pentandra]
 dbj|BAN18501.1| sucrose synthase, partial [Schiedea kauaiensis]
 dbj|BAN18502.1| sucrose synthase, partial [Schiedea perlmanii]
 dbj|BAN18509.1| sucrose synthase, partial [Schiedea stellarioides]
Length=118

 Score =   203 bits (517),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 95/111 (86%), Positives = 104/111 (94%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIV+GKSGFHIDPYHG++AA+LLVDFF+KCK DPSHWE +S GGLKRI+EKYTWQ
Sbjct  7    GGPAEIIVNGKSGFHIDPYHGDKAADLLVDFFQKCKGDPSHWEAVSLGGLKRIEEKYTWQ  66

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  67   IYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  117



>dbj|BAN18504.1| sucrose synthase, partial [Schiedea trinervis]
 dbj|BAN18505.1| sucrose synthase, partial [Schiedea obovata]
 dbj|BAN18506.1| sucrose synthase, partial [Schiedea viscosa]
 dbj|BAN18507.1| sucrose synthase, partial [Schiedea verticillata]
Length=118

 Score =   202 bits (515),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 95/111 (86%), Positives = 104/111 (94%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIV+G+SGFHIDPYHG++AA+LLVDFF+KCK DPSHWE IS GGLKRI+EKYTWQ
Sbjct  7    GGPAEIIVNGQSGFHIDPYHGDKAADLLVDFFQKCKGDPSHWEAISLGGLKRIEEKYTWQ  66

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  67   IYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  117



>gb|ADW09936.1| putative sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   202 bits (514),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 96/111 (86%), Positives = 103/111 (93%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIV+GKSGFHIDPYHG++AA LLVDFF+KCK DPSHWE IS GGLKRI+EKYTWQ
Sbjct  3    GGPAEIIVNGKSGFHIDPYHGDKAAHLLVDFFQKCKGDPSHWEAISLGGLKRIEEKYTWQ  62

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  63   IYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>gb|ADW09901.1| putative sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   202 bits (514),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 95/111 (86%), Positives = 104/111 (94%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIV+G+SGFHIDPYHG++AA+LLVDFF+KCK DPSHWE IS GGLKRI+EKYTWQ
Sbjct  3    GGPAEIIVNGRSGFHIDPYHGDKAADLLVDFFQKCKGDPSHWEAISLGGLKRIEEKYTWQ  62

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  63   IYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>gb|ADK98109.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98118.1| sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   202 bits (514),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 96/111 (86%), Positives = 103/111 (93%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIV+GKSGFHIDPYHG++AA LLVDFF+KCK DPSHWE IS GGLKRI+EKYTWQ
Sbjct  3    GGPAEIIVNGKSGFHIDPYHGDKAAXLLVDFFQKCKGDPSHWEAISLGGLKRIEEKYTWQ  62

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  63   IYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>gb|ADW09933.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09934.1| putative sucrose synthase, partial [Schiedea globosa]
Length=113

 Score =   201 bits (512),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 95/111 (86%), Positives = 103/111 (93%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGP EIIV+GKSGFHIDPYHG++AA+LLVDFF+KCK DPSHWE IS GGLKRI+EKYTWQ
Sbjct  2    GGPXEIIVNGKSGFHIDPYHGDKAADLLVDFFQKCKGDPSHWEAISLGGLKRIEEKYTWQ  61

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  62   IYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  112



>gb|ADW09904.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09911.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09912.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09913.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09925.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09929.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09930.1| putative sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   201 bits (511),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 95/111 (86%), Positives = 103/111 (93%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGP EIIV+GKSGFHIDPYHG++AA+LLVDFF+KCK DPSHWE IS GGLKRI+EKYTWQ
Sbjct  3    GGPXEIIVNGKSGFHIDPYHGDKAADLLVDFFQKCKGDPSHWEAISLGGLKRIEEKYTWQ  62

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  63   IYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>gb|ADK98116.1| sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   201 bits (511),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 95/111 (86%), Positives = 103/111 (93%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIV+GKSGFHIDPYHG++AA+LL DFF+KCK DPSHWE IS GGLKRI+EKYTWQ
Sbjct  3    GGPAEIIVNGKSGFHIDPYHGDKAADLLXDFFQKCKGDPSHWEAISLGGLKRIEEKYTWQ  62

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  63   IYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>ref|NP_001275286.1| sucrose synthase [Solanum tuberosum]
 emb|CAD61188.1| sucrose synthase 4 [Solanum tuberosum]
Length=805

 Score =   218 bits (555),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 101/111 (91%), Positives = 107/111 (96%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHGEQAA+LL DFFEKCKK+PSHWETIS GGLKRIQEKYTWQ
Sbjct  695  GGPAEIIVHGKSGFHIDPYHGEQAADLLADFFEKCKKEPSHWETISTGGLKRIQEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS+RLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALK+RK+AE VPLA E
Sbjct  755  IYSERLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKYRKMAEAVPLAAE  805



>gb|ADK98101.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98102.1| sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   201 bits (511),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 95/111 (86%), Positives = 103/111 (93%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIV+G SGFHIDPYHG++AA+LLVDFF+KCK DPSHWE IS GGLKRI+EKYTWQ
Sbjct  3    GGPAEIIVNGXSGFHIDPYHGDKAADLLVDFFQKCKGDPSHWEAISLGGLKRIEEKYTWQ  62

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  63   IYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>ref|XP_006345244.1| PREDICTED: uncharacterized LOC102577594 [Solanum tuberosum]
Length=805

 Score =   218 bits (554),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 101/111 (91%), Positives = 107/111 (96%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHGEQAA+LL DFFEKCKKDPSHWETIS GGLKRI+EKYTWQ
Sbjct  695  GGPAEIIVHGKSGFHIDPYHGEQAADLLADFFEKCKKDPSHWETISMGGLKRIEEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS+RLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALK+RK+AE VPLA E
Sbjct  755  IYSERLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKYRKMAEAVPLAAE  805



>gb|ADA68252.1| sucrose synthase, partial [Honckenya peploides]
Length=118

 Score =   201 bits (511),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 95/111 (86%), Positives = 103/111 (93%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIV+GKSGFHIDPYHG++AA+LLVDFF+KCK DPSHWE IS GGLKRI+EKYTWQ
Sbjct  7    GGPAEIIVNGKSGFHIDPYHGDKAADLLVDFFQKCKGDPSHWEAISLGGLKRIKEKYTWQ  66

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYSDRLLTLA VYGFWK+VS LD LE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  67   IYSDRLLTLAGVYGFWKYVSNLDHLEARRYLEMFYALKYRKLAESVPLAIE  117



>emb|CAA09681.1| sucrose synthase [Solanum lycopersicum]
Length=805

 Score =   218 bits (554),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 101/111 (91%), Positives = 107/111 (96%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHGEQAA+LL DFFEKCKK+PSHWETIS GGLKRIQEKYTWQ
Sbjct  695  GGPAEIIVHGKSGFHIDPYHGEQAADLLADFFEKCKKEPSHWETISTGGLKRIQEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS+RLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALK+RK+AE VPLA E
Sbjct  755  IYSERLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKYRKMAEAVPLAAE  805



>ref|NP_001234655.1| sucrose synthase [Solanum lycopersicum]
 sp|P49037.1|SUSY_SOLLC RecName: Full=Sucrose synthase; AltName: Full=Sucrose-UDP glucosyltransferase 
[Solanum lycopersicum]
 gb|AAA34196.1| sucrose synthase [Solanum lycopersicum]
Length=805

 Score =   218 bits (554),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 101/111 (91%), Positives = 107/111 (96%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHGEQAA+LL DFFEKCKK+PSHWETIS GGLKRIQEKYTWQ
Sbjct  695  GGPAEIIVHGKSGFHIDPYHGEQAADLLADFFEKCKKEPSHWETISTGGLKRIQEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS+RLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALK+RK+AE VPLA E
Sbjct  755  IYSERLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKYRKMAEAVPLAAE  805



>gb|ADK98120.1| sucrose synthase, partial [Schiedea adamantis]
 gb|ADW09897.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09898.1| putative sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   201 bits (510),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 95/111 (86%), Positives = 103/111 (93%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIV+GKSG HIDPYHG++AA+LLVDFF+KCK DPSHWE IS GGLKRI+EKYTWQ
Sbjct  3    GGPAEIIVNGKSGXHIDPYHGDKAADLLVDFFQKCKGDPSHWEAISLGGLKRIEEKYTWQ  62

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  63   IYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>ref|XP_011093886.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011093887.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011093888.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011093889.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011093890.1| PREDICTED: sucrose synthase [Sesamum indicum]
Length=805

 Score =   217 bits (553),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 102/111 (92%), Positives = 106/111 (95%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPY+GEQ AE+LVDFFEKCK DPSHWETISAGGLKRIQEKYTWQ
Sbjct  695  GGPAEIIVHGKSGFHIDPYNGEQVAEVLVDFFEKCKHDPSHWETISAGGLKRIQEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYSDRLLTLA VYGFWK+VSKLDR EIRRYLEMFYALKFRKLAE VPLA+E
Sbjct  755  IYSDRLLTLAGVYGFWKYVSKLDRREIRRYLEMFYALKFRKLAEAVPLAVE  805



>gb|ADK98103.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADK98113.1| sucrose synthase, partial [Schiedea globosa]
 gb|ADW09889.1| putative sucrose synthase, partial [Schiedea adamantis]
 gb|ADW09890.1| putative sucrose synthase, partial [Schiedea adamantis]
 gb|ADW09915.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09916.1| putative sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   200 bits (509),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 95/111 (86%), Positives = 103/111 (93%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIV+GKSG HIDPYHG++AA+LLVDFF+KCK DPSHWE IS GGLKRI+EKYTWQ
Sbjct  3    GGPAEIIVNGKSGSHIDPYHGDKAADLLVDFFQKCKGDPSHWEAISLGGLKRIEEKYTWQ  62

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  63   IYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>gb|AAA97571.1| sucrose synthase [Solanum tuberosum]
Length=805

 Score =   217 bits (552),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/111 (90%), Positives = 107/111 (96%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHGEQAA+LL DFFEKCK++PSHWETIS GGLKRIQEKYTWQ
Sbjct  695  GGPAEIIVHGKSGFHIDPYHGEQAADLLADFFEKCKREPSHWETISTGGLKRIQEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS+RLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALK+RK+AE VPLA E
Sbjct  755  IYSERLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKYRKMAEAVPLAAE  805



>gb|ADW09903.1| putative sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   200 bits (509),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 94/111 (85%), Positives = 103/111 (93%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGP EIIV+G+SGFHIDPYHG++AA+LLVDFF+KCK DPSHWE IS GGLKRI+EKYTWQ
Sbjct  3    GGPXEIIVNGRSGFHIDPYHGDKAADLLVDFFQKCKGDPSHWEAISLGGLKRIEEKYTWQ  62

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  63   IYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>gb|ADW09926.1| putative sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   200 bits (509),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/111 (86%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGP EIIV+GKSGFHIDPYHG++AA LLVDFF+KCK DPSHWE IS GGLKRI+EKYTWQ
Sbjct  3    GGPXEIIVNGKSGFHIDPYHGDKAAHLLVDFFQKCKGDPSHWEAISLGGLKRIEEKYTWQ  62

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  63   IYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>gb|ADA68251.1| sucrose synthase, partial [Schiedea membranacea]
 dbj|BAN18503.1| sucrose synthase, partial [Schiedea helleri]
 dbj|BAN18508.1| sucrose synthase, partial [Schiedea membranacea]
Length=118

 Score =   200 bits (508),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/111 (86%), Positives = 103/111 (93%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIV+GKSGFHIDPYHG++AA+LLVDFF+KCK D SHWE IS GGLKRI+EKYTWQ
Sbjct  7    GGPAEIIVNGKSGFHIDPYHGDKAADLLVDFFQKCKGDLSHWEAISLGGLKRIEEKYTWQ  66

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  67   IYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  117



>gb|ADK98112.1| sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   200 bits (508),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/111 (86%), Positives = 103/111 (93%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIV+GKSGFHIDPYHG++AA+LLVDFF+KCK DPSHWE IS GGLKRI+EKYT Q
Sbjct  3    GGPAEIIVNGKSGFHIDPYHGDKAADLLVDFFQKCKGDPSHWEAISLGGLKRIEEKYTXQ  62

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  63   IYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>ref|XP_006353766.1| PREDICTED: sucrose synthase 2 isoform X2 [Solanum tuberosum]
Length=805

 Score =   216 bits (550),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 101/111 (91%), Positives = 105/111 (95%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGF IDPYHGEQAA+LL DFFEKCK DPSHWE IS GGLKRIQEKYTWQ
Sbjct  695  GGPAEIIVHGKSGFQIDPYHGEQAADLLADFFEKCKVDPSHWEAISEGGLKRIQEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYSDRLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALKFRKLA+ VPLA+E
Sbjct  755  IYSDRLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAQLVPLAVE  805



>ref|NP_001274911.1| sucrose synthase 2 [Solanum tuberosum]
 gb|AAO34668.1| sucrose synthase 2 [Solanum tuberosum]
Length=805

 Score =   216 bits (550),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 101/111 (91%), Positives = 105/111 (95%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGF IDPYHGEQAA+LL DFFEKCK DPSHWE IS GGLKRIQEKYTWQ
Sbjct  695  GGPAEIIVHGKSGFQIDPYHGEQAADLLADFFEKCKVDPSHWEAISEGGLKRIQEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYSDRLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALKFRKLA+ VPLA+E
Sbjct  755  IYSDRLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAQLVPLAVE  805



>sp|P49039.1|SUS2_SOLTU RecName: Full=Sucrose synthase; AltName: Full=SS65; AltName: 
Full=Sucrose-UDP glucosyltransferase [Solanum tuberosum]
 gb|AAA97572.1| sucrose synthase [Solanum tuberosum]
Length=805

 Score =   216 bits (550),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 101/111 (91%), Positives = 105/111 (95%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGF IDPYHGEQAA+LL DFFEKCK DPSHWE IS GGLKRIQEKYTWQ
Sbjct  695  GGPAEIIVHGKSGFQIDPYHGEQAADLLADFFEKCKVDPSHWEAISEGGLKRIQEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYSDRLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALKFRKLA+ VPLA+E
Sbjct  755  IYSDRLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAQLVPLAVE  805



>ref|NP_001234804.1| sucrose synthase [Solanum lycopersicum]
 emb|CAA09593.1| sucrose synthase [Solanum lycopersicum]
Length=805

 Score =   216 bits (549),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 101/111 (91%), Positives = 105/111 (95%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGF IDPYHGEQAA+LL +FFEKCK DPSHWE IS GGLKRIQEKYTWQ
Sbjct  695  GGPAEIIVHGKSGFQIDPYHGEQAADLLAEFFEKCKVDPSHWEAISKGGLKRIQEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYSDRLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAE VPLA+E
Sbjct  755  IYSDRLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAELVPLAVE  805



>sp|P10691.1|SUS1_SOLTU RecName: Full=Sucrose synthase; AltName: Full=SS16; AltName: 
Full=Sucrose-UDP glucosyltransferase [Solanum tuberosum]
 gb|AAA33841.1| sucrase synthase (EC 2.4.1.13) [Solanum tuberosum]
Length=805

 Score =   216 bits (549),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 100/111 (90%), Positives = 106/111 (95%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHGEQAA+LL DFFEKCKKDPSHWETIS GGLKRI+EKYTWQ
Sbjct  695  GGPAEIIVHGKSGFHIDPYHGEQAADLLADFFEKCKKDPSHWETISMGGLKRIEEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS+ LLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALK+RK+AE VPLA E
Sbjct  755  IYSESLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKYRKMAEAVPLAAE  805



>ref|XP_010323602.1| PREDICTED: sucrose synthase isoform X1 [Solanum lycopersicum]
 ref|XP_010323603.1| PREDICTED: sucrose synthase isoform X1 [Solanum lycopersicum]
 ref|XP_010323604.1| PREDICTED: sucrose synthase isoform X1 [Solanum lycopersicum]
 ref|XP_010323605.1| PREDICTED: sucrose synthase isoform X1 [Solanum lycopersicum]
 gb|ADM47608.1| sucrose synthase isoform 3 [Solanum lycopersicum]
Length=805

 Score =   215 bits (548),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 101/111 (91%), Positives = 105/111 (95%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGF IDPYHGEQAA+LL +FFEKCK DPSHWE IS GGLKRIQEKYTWQ
Sbjct  695  GGPAEIIVHGKSGFQIDPYHGEQAADLLAEFFEKCKVDPSHWEAISKGGLKRIQEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYSDRLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAE VPLA+E
Sbjct  755  IYSDRLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAELVPLAVE  805



>gb|ADW09905.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09906.1| putative sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   198 bits (504),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 94/111 (85%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGP EIIV+GKSG HIDPYHG++AA+LLVDFF+KCK DPSHWE IS GGLKRI+EKYTWQ
Sbjct  3    GGPXEIIVNGKSGSHIDPYHGDKAADLLVDFFQKCKGDPSHWEAISLGGLKRIEEKYTWQ  62

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  63   IYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>ref|XP_011078145.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011078146.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011078147.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011078148.1| PREDICTED: sucrose synthase [Sesamum indicum]
Length=805

 Score =   214 bits (545),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 101/111 (91%), Positives = 105/111 (95%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPY+GEQ AE LV+FFEKCKKDPSHWETISAGGLKRI EKYTWQ
Sbjct  695  GGPAEIIVHGKSGFHIDPYNGEQVAETLVNFFEKCKKDPSHWETISAGGLKRIMEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYSDRLLTLA VYGFWK+VSKLDRLEIRRYLEMFYALK+RKLAE VPLA E
Sbjct  755  IYSDRLLTLAGVYGFWKYVSKLDRLEIRRYLEMFYALKYRKLAEAVPLAAE  805



>gb|ABV02029.1| sucrose sythase [Nicotiana langsdorffii x Nicotiana sanderae]
Length=805

 Score =   214 bits (545),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/111 (89%), Positives = 106/111 (95%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIV+GKSGFHIDPYHGEQAA+LL DFFEKCK +PSHWETIS GGLKRIQEKYTWQ
Sbjct  695  GGPAEIIVNGKSGFHIDPYHGEQAADLLADFFEKCKTEPSHWETISTGGLKRIQEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS+RLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALK+RK+AE VPLA E
Sbjct  755  IYSERLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKYRKMAEAVPLAAE  805



>gb|ADW09914.1| putative sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   197 bits (502),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/111 (85%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGP EIIV+GKSGFHIDPYHG++AA+LLVDFF+KCK DPSHWE IS GGLKRI+EKYT Q
Sbjct  3    GGPXEIIVNGKSGFHIDPYHGDKAADLLVDFFQKCKGDPSHWEAISLGGLKRIEEKYTRQ  62

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  63   IYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>gb|ADW09891.1| putative sucrose synthase, partial [Schiedea membranacea]
 gb|ADW09892.1| putative sucrose synthase, partial [Schiedea membranacea]
Length=114

 Score =   197 bits (501),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 94/111 (85%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIV+GKSGFHIDPYHG++AA+LLVDFF+KCK D S WE IS GGLKRI+EKYTWQ
Sbjct  3    GGPAEIIVNGKSGFHIDPYHGDKAADLLVDFFQKCKGDLSRWEAISLGGLKRIEEKYTWQ  62

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  63   IYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>ref|XP_009589756.1| PREDICTED: sucrose synthase [Nicotiana tomentosiformis]
 ref|XP_009589757.1| PREDICTED: sucrose synthase [Nicotiana tomentosiformis]
Length=805

 Score =   213 bits (543),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 99/111 (89%), Positives = 105/111 (95%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIV+GKSGFHIDPYHGEQAA+LL DFFEKCK  PSHWETIS GGLKRIQEKYTWQ
Sbjct  695  GGPAEIIVNGKSGFHIDPYHGEQAADLLADFFEKCKTQPSHWETISTGGLKRIQEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS+RLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALK+RK+AE VPLA E
Sbjct  755  IYSERLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKYRKMAEAVPLAAE  805



>gb|AHL84158.1| sucrose synthase [Nicotiana tabacum]
Length=805

 Score =   213 bits (542),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 98/111 (88%), Positives = 106/111 (95%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIV+GKSGFHIDPYHGEQAA+LL DFFEKCK +PSHWETIS GGLKRIQEKYTWQ
Sbjct  695  GGPAEIIVNGKSGFHIDPYHGEQAADLLADFFEKCKTEPSHWETISTGGLKRIQEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS+RLLTLA+VYGFWKHVSKLDRLEIRRYL+MFYALK+RK+AE VPLA E
Sbjct  755  IYSERLLTLAAVYGFWKHVSKLDRLEIRRYLDMFYALKYRKMAEAVPLAAE  805



>gb|ADW09895.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09896.1| putative sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   196 bits (499),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 93/111 (84%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGP EIIV+G SG HIDPYHG++AA+LLVDFF+KCK DPSHWE IS GGLKRI+EKYTWQ
Sbjct  3    GGPXEIIVNGXSGXHIDPYHGDKAADLLVDFFQKCKGDPSHWEAISLGGLKRIEEKYTWQ  62

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  63   IYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>sp|P49035.1|SUS1_DAUCA RecName: Full=Sucrose synthase isoform 1; AltName: Full=Sucrose 
synthase isoform I; AltName: Full=Sucrose-UDP glucosyltransferase 
1; AltName: Full=Susy*Dc1 [Daucus carota]
 emb|CAA53081.1| sucrose synthase [Daucus carota]
 emb|CAA76056.1| sucrose synthase isoform I [Daucus carota]
Length=808

 Score =   213 bits (541),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 99/109 (91%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHGEQ AELLV+FFEKCK DPS W+ ISAGGLKRIQEKYTWQ
Sbjct  697  GGPAEIIVHGKSGFHIDPYHGEQVAELLVNFFEKCKTDPSQWDAISAGGLKRIQEKYTWQ  756

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLA  342
            IYS+RLLTLA VYGFWKHVSKLDRLEIRRYLEMFYALK+RKLAE VPLA
Sbjct  757  IYSERLLTLAGVYGFWKHVSKLDRLEIRRYLEMFYALKYRKLAESVPLA  805



>gb|ADW09921.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09922.1| putative sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   196 bits (498),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 93/111 (84%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GG  EI V+GKSGFHIDPYHG++AA+LLVDFF+KCK DPSHWE IS GGLKRI+EKYTWQ
Sbjct  3    GGXXEIXVNGKSGFHIDPYHGDKAADLLVDFFQKCKGDPSHWEAISLGGLKRIEEKYTWQ  62

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  63   IYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>ref|XP_009760458.1| PREDICTED: sucrose synthase [Nicotiana sylvestris]
 ref|XP_009760459.1| PREDICTED: sucrose synthase [Nicotiana sylvestris]
Length=805

 Score =   211 bits (538),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/111 (88%), Positives = 105/111 (95%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIV+GKSGFHIDPYHGEQAA+LL DFFEKCK +P HWETIS GGLKRIQEKYTWQ
Sbjct  695  GGPAEIIVNGKSGFHIDPYHGEQAADLLADFFEKCKTEPYHWETISTGGLKRIQEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS+RLLTLA+VYGFWKHVSKLDRLEIRRYLEMFYALK+RK+AE VPLA E
Sbjct  755  IYSERLLTLAAVYGFWKHVSKLDRLEIRRYLEMFYALKYRKMAEAVPLAAE  805



>gb|AEN79500.1| sucrose synthase 1 [Orobanche ramosa]
Length=805

 Score =   210 bits (534),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 98/111 (88%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIV GKSGFHIDPY+GEQ AE LV FFEKC KDPSHWE IS GGLKRIQEKYTWQ
Sbjct  695  GGPAEIIVDGKSGFHIDPYNGEQVAETLVSFFEKCNKDPSHWEAISTGGLKRIQEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYSDRLLTLA VYGFWK+VSKLDRLEIRRYLEMFYALK+RKLAE VPLA+E
Sbjct  755  IYSDRLLTLAGVYGFWKYVSKLDRLEIRRYLEMFYALKYRKLAEAVPLAVE  805



>gb|ADW09887.1| putative sucrose synthase, partial [Schiedea stellarioides]
 gb|ADW09888.1| putative sucrose synthase, partial [Schiedea stellarioides]
Length=114

 Score =   192 bits (489),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GG  EI V+GKSG HIDPYHG++AA+LLVDFF+KCK DPSHWE +S GGLKRI+EKYTWQ
Sbjct  3    GGXXEIXVNGKSGXHIDPYHGDKAADLLVDFFQKCKGDPSHWEAVSLGGLKRIEEKYTWQ  62

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  63   IYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>gb|ADW09917.1| putative sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   192 bits (487),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 99/111 (89%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GG  EIIV GKSG HIDPYHG++AA+LLVDFF+KCK DPSHWE I  GGLKRI+EKYTWQ
Sbjct  3    GGXXEIIVXGKSGXHIDPYHGDKAADLLVDFFQKCKGDPSHWEAIXLGGLKRIEEKYTWQ  62

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  63   IYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>sp|O49845.1|SUS2_DAUCA RecName: Full=Sucrose synthase isoform 2; AltName: Full=Sucrose 
synthase isoform II; AltName: Full=Sucrose-UDP glucosyltransferase 
2; AltName: Full=Susy*Dc2 [Daucus carota]
 emb|CAA76057.1| sucrose synthase isoform II [Daucus carota]
Length=801

 Score =   207 bits (528),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 94/111 (85%), Positives = 104/111 (94%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHG SGFHIDPYHGE+AAEL+V+FFE+CK +PSHWETISAGGLKRIQEKYTWQ
Sbjct  691  GGPAEIIVHGTSGFHIDPYHGEKAAELIVNFFERCKTEPSHWETISAGGLKRIQEKYTWQ  750

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS+RLLTL  VYGFWKHVSKLDR+EIRRYLEMF ALK+R LAE VPLA++
Sbjct  751  IYSERLLTLGGVYGFWKHVSKLDRIEIRRYLEMFCALKYRNLAESVPLAVD  801



>emb|CAI56307.1| sucrose synthase [Coffea canephora]
 emb|CDP03035.1| unnamed protein product [Coffea canephora]
Length=806

 Score =   207 bits (528),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 95/111 (86%), Positives = 105/111 (95%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEII+HGKSGFHIDPYHGEQ +ELL +FFE+CKK+PS+W+TISAGGLKRIQEKYTWQ
Sbjct  695  GGPAEIIIHGKSGFHIDPYHGEQVSELLANFFERCKKEPSYWDTISAGGLKRIQEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYSDRLLTLA VYGFWK VSKLDR EIRRYLEMFYALK+RKLAE VPLA++
Sbjct  755  IYSDRLLTLAGVYGFWKCVSKLDRQEIRRYLEMFYALKYRKLAEAVPLAVD  805



>emb|CAJ32596.1| sucrose synthase [Coffea arabica]
Length=806

 Score =   207 bits (528),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 95/111 (86%), Positives = 105/111 (95%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEII+HGKSGFHIDPYHGEQ +ELL +FFE+CKK+PS+W+TISAGGLKRIQEKYTWQ
Sbjct  695  GGPAEIIIHGKSGFHIDPYHGEQVSELLANFFERCKKEPSYWDTISAGGLKRIQEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYSDRLLTLA VYGFWK VSKLDR EIRRYLEMFYALK+RKLAE VPLA++
Sbjct  755  IYSDRLLTLAGVYGFWKCVSKLDRQEIRRYLEMFYALKYRKLAEAVPLAVD  805



>gb|ADW09918.1| putative sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   191 bits (486),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 99/111 (89%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GG  EIIV GKSG HIDPYHG++AA+LL+DFF+KCK DPSHWE I  GGLKRI+EKYTWQ
Sbjct  3    GGXXEIIVXGKSGXHIDPYHGDKAADLLIDFFQKCKGDPSHWEAIXLGGLKRIEEKYTWQ  62

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  63   IYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>emb|CAA67195.1| sucrose synthase [Pisum sativum]
Length=164

 Score =   192 bits (489),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 99/112 (88%), Gaps = 1/112 (1%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS-AGGLKRIQEKYTW  492
            GGPAEIIVHGKSGFHIDPYHGE AA+LLV+FFEK K DPSHW+ IS  GGL+RI+EKYTW
Sbjct  52   GGPAEIIVHGKSGFHIDPYHGEGAADLLVEFFEKVKSDPSHWDKISLKGGLQRIEEKYTW  111

Query  491  QIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            QIYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RK AE VPLA+E
Sbjct  112  QIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKSAESVPLAVE  163



>gb|ADW09907.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09908.1| putative sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   191 bits (484),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GG  EIIV+GKSG HIDPYHG++AA+LLVDFF+K K DPSHWE IS GGLKRI+EKYTWQ
Sbjct  3    GGXXEIIVNGKSGXHIDPYHGDKAADLLVDFFQKXKGDPSHWEAISLGGLKRIEEKYTWQ  62

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  63   IYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  113



>gb|AHL29281.1| sucrose synthase 1 [Camellia sinensis]
Length=805

 Score =   206 bits (524),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/111 (84%), Positives = 104/111 (94%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEII+HGKSGFHIDPYHG+Q AELLV+F+E+C KDPSHW+ ISAGGL+RI EKYTWQ
Sbjct  695  GGPAEIIIHGKSGFHIDPYHGDQVAELLVNFYERCSKDPSHWDEISAGGLQRIMEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS+RL+TLA VYGFWK+VSKLDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  755  IYSERLMTLAGVYGFWKYVSKLDRLETRRYLEMFYALKYRKLAESVPLAIE  805



>gb|ABI17891.1| sucrose synthase [Coffea canephora]
Length=806

 Score =   206 bits (523),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/111 (85%), Positives = 104/111 (94%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEII+HGKSGFHIDPYHGEQ +ELL +FFE+CKK+PS+W+TI AGGLKRIQEKYTWQ
Sbjct  695  GGPAEIIIHGKSGFHIDPYHGEQVSELLANFFERCKKEPSYWDTIPAGGLKRIQEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYSDRLLTLA VYGFWK VSKLDR EIRRYLEMFYALK+RKLAE VPLA++
Sbjct  755  IYSDRLLTLAGVYGFWKCVSKLDRQEIRRYLEMFYALKYRKLAEAVPLAVD  805



>gb|AFK45264.1| unknown [Medicago truncatula]
Length=175

 Score =   192 bits (488),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 89/111 (80%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG++AA+LLV+FFEK K DPSHW+ IS GG +RI+EKYTW 
Sbjct  65   GGPAEIIVHGKSGFHIDPYHGDRAADLLVEFFEKVKVDPSHWDKISQGGFQRIEEKYTWT  124

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IY  RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  125  IYFQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  175



>ref|XP_004508035.1| PREDICTED: sucrose synthase-like isoform X3 [Cicer arietinum]
Length=806

 Score =   205 bits (522),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/111 (86%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHGE+AA+LLV+FFEKCK DPSHW+ IS GGLKRI+EKYTWQ
Sbjct  695  GGPAEIIVHGKSGFHIDPYHGERAADLLVEFFEKCKVDPSHWDKISQGGLKRIEEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  755  IYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>ref|XP_004287669.1| PREDICTED: sucrose synthase [Fragaria vesca subsp. vesca]
 ref|XP_011461050.1| PREDICTED: sucrose synthase [Fragaria vesca subsp. vesca]
Length=806

 Score =   205 bits (522),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/111 (85%), Positives = 103/111 (93%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSG+HIDPYHGEQAAE+LVDFFEKCKKDPSHW+ IS GGLKRI+EKYTWQ
Sbjct  696  GGPAEIIVHGKSGYHIDPYHGEQAAEILVDFFEKCKKDPSHWDKISQGGLKRIEEKYTWQ  755

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS+RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK++KLA+ VPLA E
Sbjct  756  IYSERLLTLTGVYGFWKHVSNLDRLESRRYIEMFYALKYKKLADSVPLAEE  806



>gb|AEE60913.1| nodule-enhanced sucrose synthase [Cicer arietinum]
Length=806

 Score =   205 bits (522),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/111 (86%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHGE+AA+LLV+FFEKCK DPSHW+ IS GGLKRI+EKYTWQ
Sbjct  695  GGPAEIIVHGKSGFHIDPYHGERAADLLVEFFEKCKVDPSHWDKISQGGLKRIEEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  755  IYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>gb|ADW09927.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09928.1| putative sucrose synthase, partial [Schiedea globosa]
Length=113

 Score =   189 bits (481),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GG  E   +GKSG HIDPYHG++AA+LLVDFF+KCK DPSHWE IS GGLKRI+EKYTWQ
Sbjct  2    GGXXEXXXNGKSGXHIDPYHGDKAADLLVDFFQKCKGDPSHWEAISLGGLKRIEEKYTWQ  61

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYSDRLLTLA VYGFWK+VS LDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  62   IYSDRLLTLAGVYGFWKYVSNLDRLEARRYLEMFYALKYRKLAESVPLAIE  112



>dbj|BAD94975.1| sucrose-UDP glucosyltransferase [Arabidopsis thaliana]
Length=279

 Score =   194 bits (494),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG+QAA+ L DFF KCK+DPSHW+ IS GGL+RI+EKYTWQ
Sbjct  168  GGPAEIIVHGKSGFHIDPYHGDQAADTLADFFTKCKEDPSHWDEISKGGLQRIEEKYTWQ  227

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLA  342
            IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA
Sbjct  228  IYSQRLLTLTGVYGFWKHVSNLDRLEARRYLEMFYALKYRPLAQAVPLA  276



>ref|XP_011010969.1| PREDICTED: sucrose synthase-like isoform X2 [Populus euphratica]
Length=805

 Score =   204 bits (520),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 96/111 (86%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFF+KCK DP+HWE IS GGL+RIQEKYTWQ
Sbjct  695  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFDKCKVDPAHWEKISHGGLQRIQEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPL  E
Sbjct  755  IYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLTKE  805



>ref|XP_011010968.1| PREDICTED: sucrose synthase-like isoform X1 [Populus euphratica]
Length=812

 Score =   204 bits (520),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 96/111 (86%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFF+KCK DP+HWE IS GGL+RIQEKYTWQ
Sbjct  702  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFDKCKVDPAHWEKISHGGLQRIQEKYTWQ  761

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPL  E
Sbjct  762  IYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLTKE  812



>gb|KDP33978.1| hypothetical protein JCGZ_07549 [Jatropha curcas]
Length=805

 Score =   204 bits (520),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 95/111 (86%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGF+IDPYHGEQAA+LLVDFFEKCK DPSHW+ IS GGL+RIQEKYTWQ
Sbjct  695  GGPAEIIVHGKSGFNIDPYHGEQAAQLLVDFFEKCKVDPSHWDKISQGGLQRIQEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVSKLDR E RRYLEMFYALK+RKLAE VPL +E
Sbjct  755  IYSQRLLTLTGVYGFWKHVSKLDRRESRRYLEMFYALKYRKLAESVPLTVE  805



>gb|ADR00484.1| sucrose synthase [Arachis hypogaea var. vulgaris]
Length=490

 Score =   200 bits (509),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG++AA+LLVDFF+KCK DP+HW+ IS GGL+RI+EKYTWQ
Sbjct  379  GGPAEIIVHGKSGFHIDPYHGDRAADLLVDFFDKCKVDPTHWDNISQGGLQRIEEKYTWQ  438

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKLAE VPLA+E
Sbjct  439  IYSQRLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLAESVPLAVE  489



>gb|AGH29112.1| sucrose synthase [Jatropha curcas]
Length=805

 Score =   204 bits (520),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 95/111 (86%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGF+IDPYHGEQAA+LLVDFFEKCK DPSHW+ IS GGL+RIQEKYTWQ
Sbjct  695  GGPAEIIVHGKSGFNIDPYHGEQAAQLLVDFFEKCKVDPSHWDKISQGGLQRIQEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVSKLDR E RRYLEMFYALK+RKLAE VPL +E
Sbjct  755  IYSQRLLTLTGVYGFWKHVSKLDRRESRRYLEMFYALKYRKLAESVPLTVE  805



>gb|ADW80556.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   204 bits (519),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 95/111 (86%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQ
Sbjct  695  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  755  IYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80565.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   204 bits (519),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 95/111 (86%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQ
Sbjct  695  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  755  IYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80555.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   204 bits (519),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 95/111 (86%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQ
Sbjct  695  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  755  IYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80549.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   204 bits (519),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 95/111 (86%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQ
Sbjct  695  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  755  IYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80546.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   204 bits (519),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 95/111 (86%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQ
Sbjct  695  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  755  IYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80552.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   204 bits (519),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 95/111 (86%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQ
Sbjct  695  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  755  IYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80550.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   204 bits (519),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 95/111 (86%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQ
Sbjct  695  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  755  IYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80559.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   204 bits (519),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 95/111 (86%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQ
Sbjct  695  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  755  IYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80563.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   204 bits (519),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 95/111 (86%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQ
Sbjct  695  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  755  IYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80543.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   204 bits (519),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 95/111 (86%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQ
Sbjct  695  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  755  IYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80534.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   204 bits (519),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 95/111 (86%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQ
Sbjct  695  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  755  IYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80540.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   204 bits (518),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 95/111 (86%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQ
Sbjct  695  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  755  IYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80541.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80542.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80547.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80553.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80554.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80564.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   204 bits (518),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 95/111 (86%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQ
Sbjct  695  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  755  IYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADV71181.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80538.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80557.1| sucrose synthase 1 [Populus tomentosa]
 gb|AFZ78658.1| sucrose synthase [Populus tomentosa]
Length=805

 Score =   204 bits (518),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 95/111 (86%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQ
Sbjct  695  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  755  IYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80558.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   204 bits (518),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 95/111 (86%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQ
Sbjct  695  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  755  IYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80535.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80537.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   204 bits (518),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 95/111 (86%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQ
Sbjct  695  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  755  IYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80570.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   204 bits (518),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 95/111 (86%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQ
Sbjct  695  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  755  IYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80536.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80544.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80561.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80567.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80568.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   204 bits (518),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 95/111 (86%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQ
Sbjct  695  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  755  IYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80548.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   204 bits (518),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 95/111 (86%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQ
Sbjct  695  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  755  IYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80539.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80569.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   204 bits (518),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 95/111 (86%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQ
Sbjct  695  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  755  IYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80571.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   204 bits (518),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 95/111 (86%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQ
Sbjct  695  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  755  IYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80566.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   204 bits (518),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 95/111 (86%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQ
Sbjct  695  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  755  IYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80562.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   204 bits (518),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 95/111 (86%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQ
Sbjct  695  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  755  IYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80551.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   204 bits (518),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 95/111 (86%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQ
Sbjct  695  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  755  IYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80560.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   204 bits (518),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 95/111 (86%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQ
Sbjct  695  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  755  IYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|AFS17277.1| sucrose synthase 1 [Amaranthus cruentus/Amaranthus hypocondriacus 
mixed library]
Length=803

 Score =   203 bits (517),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 95/111 (86%), Positives = 103/111 (93%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG++AAELLVDFF+K K DP+HWETIS GGLKRI+EKYTWQ
Sbjct  692  GGPAEIIVHGKSGFHIDPYHGDKAAELLVDFFKKSKADPTHWETISKGGLKRIEEKYTWQ  751

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYSDRLLTLA VYGFWK+VS LDR E RRYLEMFYALK++KLAE VPLAIE
Sbjct  752  IYSDRLLTLAGVYGFWKYVSNLDRREARRYLEMFYALKYKKLAESVPLAIE  802



>gb|KJB65372.1| hypothetical protein B456_010G092300 [Gossypium raimondii]
 gb|KJB65373.1| hypothetical protein B456_010G092300 [Gossypium raimondii]
 gb|KJB65374.1| hypothetical protein B456_010G092300 [Gossypium raimondii]
Length=806

 Score =   203 bits (517),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 95/111 (86%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGF+IDPYHG+QAAE+LVDFF+KCKKDPSHW  IS GGLKRIQEKYTWQ
Sbjct  695  GGPAEIIVHGKSGFNIDPYHGDQAAEILVDFFDKCKKDPSHWNDISEGGLKRIQEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS+RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKLAE VPLA E
Sbjct  755  IYSERLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLAESVPLAEE  805



>ref|XP_007012546.1| Sucrose synthase 4 isoform 1 [Theobroma cacao]
 gb|EOY30165.1| Sucrose synthase 4 isoform 1 [Theobroma cacao]
Length=852

 Score =   203 bits (517),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/111 (85%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGF+IDPYHG+QAAE+LVDFFEKCK DPS+W  IS GGLKRIQEKYTWQ
Sbjct  741  GGPAEIIVHGKSGFNIDPYHGDQAAEILVDFFEKCKADPSYWNKISEGGLKRIQEKYTWQ  800

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS+RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKLAE VPLA+E
Sbjct  801  IYSERLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLAESVPLAVE  851



>ref|XP_007012547.1| Sucrose synthase 4 isoform 2 [Theobroma cacao]
 gb|EOY30166.1| Sucrose synthase 4 isoform 2 [Theobroma cacao]
Length=806

 Score =   203 bits (516),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/111 (85%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGF+IDPYHG+QAAE+LVDFFEKCK DPS+W  IS GGLKRIQEKYTWQ
Sbjct  695  GGPAEIIVHGKSGFNIDPYHGDQAAEILVDFFEKCKADPSYWNKISEGGLKRIQEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS+RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKLAE VPLA+E
Sbjct  755  IYSERLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLAESVPLAVE  805



>ref|XP_003551045.1| PREDICTED: sucrose synthase-like isoform X1 [Glycine max]
 ref|XP_006600427.1| PREDICTED: sucrose synthase-like isoform X2 [Glycine max]
Length=805

 Score =   202 bits (515),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/111 (84%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG++AA+LLVDFFEKCK DP+HWETIS  GL+RI+EKYTWQ
Sbjct  695  GGPAEIIVHGKSGFHIDPYHGDRAADLLVDFFEKCKLDPTHWETISKAGLQRIEEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKLAE VPLA+E
Sbjct  755  IYSQRLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLAESVPLAVE  805



>gb|AIJ28960.1| sucrose synthase [Manihot esculenta subsp. flabellifolia]
Length=806

 Score =   202 bits (515),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/111 (84%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGF+IDPYHG+QAAELLV+FFEKCK DPSHW+ IS G ++RIQEKYTWQ
Sbjct  695  GGPAEIIVHGKSGFNIDPYHGDQAAELLVEFFEKCKADPSHWDKISQGAMQRIQEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVSKLDRLE RRYLEMFYALK+RKLAE VPL +E
Sbjct  755  IYSQRLLTLTGVYGFWKHVSKLDRLESRRYLEMFYALKYRKLAESVPLTVE  805



>gb|KHN17754.1| Sucrose synthase [Glycine soja]
Length=805

 Score =   202 bits (515),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/111 (84%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG++AA+LLVDFFEKCK DP+HWETIS  GL+RI+EKYTWQ
Sbjct  695  GGPAEIIVHGKSGFHIDPYHGDRAADLLVDFFEKCKLDPTHWETISKAGLQRIEEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKLAE VPLA+E
Sbjct  755  IYSQRLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLAESVPLAVE  805



>dbj|BAA88905.1| sucrose synthase [Citrus unshiu]
Length=805

 Score =   202 bits (514),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/111 (84%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIV+GKSG+HIDPYHGEQAAE+LVDFFEKCK DPS+W+ IS GGLKRI+EKYTW+
Sbjct  695  GGPAEIIVNGKSGYHIDPYHGEQAAEILVDFFEKCKADPSYWDKISLGGLKRIEEKYTWK  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  755  IYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>ref|XP_006452883.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452884.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452885.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452886.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452887.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452888.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452889.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452890.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452891.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66123.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66124.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66125.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66126.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66127.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66128.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66129.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66130.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66131.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
Length=806

 Score =   202 bits (514),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/111 (84%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIV+GKSG+HIDPYHGEQAAE+LVDFFEKCK DPS+W+ IS GGLKRI+EKYTW+
Sbjct  695  GGPAEIIVNGKSGYHIDPYHGEQAAEILVDFFEKCKADPSYWDKISLGGLKRIEEKYTWK  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  755  IYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>ref|XP_006474580.1| PREDICTED: sucrose synthase-like isoform X1 [Citrus sinensis]
 ref|XP_006474581.1| PREDICTED: sucrose synthase-like isoform X2 [Citrus sinensis]
 ref|XP_006474582.1| PREDICTED: sucrose synthase-like isoform X3 [Citrus sinensis]
 ref|XP_006474583.1| PREDICTED: sucrose synthase-like isoform X4 [Citrus sinensis]
 ref|XP_006474584.1| PREDICTED: sucrose synthase-like isoform X5 [Citrus sinensis]
 ref|XP_006474585.1| PREDICTED: sucrose synthase-like isoform X6 [Citrus sinensis]
 ref|XP_006474586.1| PREDICTED: sucrose synthase-like isoform X7 [Citrus sinensis]
 ref|XP_006474587.1| PREDICTED: sucrose synthase-like isoform X8 [Citrus sinensis]
 gb|KDO73779.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|KDO73780.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|KDO73781.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|KDO73782.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|KDO73783.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|KDO73784.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|KDO73785.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|AIN45138.1| sucrose synthase [Citrus suavissima]
Length=805

 Score =   202 bits (514),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/111 (84%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIV+GKSG+HIDPYHGEQAAE+LVDFFEKCK DPS+W+ IS GGLKRI+EKYTW+
Sbjct  695  GGPAEIIVNGKSGYHIDPYHGEQAAEILVDFFEKCKADPSYWDKISLGGLKRIEEKYTWK  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  755  IYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>gb|KJB82966.1| hypothetical protein B456_013G222400 [Gossypium raimondii]
Length=806

 Score =   202 bits (514),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/111 (84%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGF+IDPYHG+QAAE+LVDFFEKCK DPS+W  IS GGLKRI+EKYTW+
Sbjct  695  GGPAEIIVHGKSGFNIDPYHGDQAAEILVDFFEKCKTDPSYWTKISEGGLKRIEEKYTWK  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS+RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  755  IYSERLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>dbj|BAA89049.1| sucrose synthase [Citrus unshiu]
Length=805

 Score =   202 bits (513),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/111 (84%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIV+GKSG+HIDPYHGEQAAE+LVDFFEKCK DPS+W+ IS GGLKRI+EKYTW+
Sbjct  695  GGPAEIIVNGKSGYHIDPYHGEQAAEILVDFFEKCKADPSYWDKISLGGLKRIEEKYTWK  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  755  IYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>gb|AEV40460.1| sucrose synthase 1 [Gossypium arboreum]
 gb|AFM52232.1| putative sucrose synthase 1 [Gossypium arboreum]
Length=806

 Score =   202 bits (513),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/111 (84%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGF+IDPYHG+QAAE+LVDFFEKCK DPS+W  IS GGLKRI+EKYTW+
Sbjct  695  GGPAEIIVHGKSGFNIDPYHGDQAAEILVDFFEKCKTDPSYWTKISEGGLKRIEEKYTWK  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS+RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  755  IYSERLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>gb|KHG00606.1| Sucrose synthase [Gossypium arboreum]
Length=814

 Score =   202 bits (513),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/111 (84%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGF+IDPYHG+QAAE+LVDFFEKCK DPS+W  IS GGLKRI+EKYTW+
Sbjct  703  GGPAEIIVHGKSGFNIDPYHGDQAAEILVDFFEKCKTDPSYWTKISEGGLKRIEEKYTWK  762

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS+RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  763  IYSERLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  813



>gb|AHA41509.1| sucrose synthase [Populus deltoides]
Length=805

 Score =   202 bits (513),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 94/111 (85%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIV+GKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQ
Sbjct  695  GGPAEIIVNGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  755  IYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|AEV40463.1| sucrose synthase 4 [Gossypium arboreum]
 gb|AFM52235.1| putative sucrose synthase 4 [Gossypium arboreum]
 gb|KHG06249.1| Sucrose synthase [Gossypium arboreum]
Length=806

 Score =   202 bits (513),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 94/111 (85%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGF+IDPYHG+QAAE+LVDFF+KCKK+PSHW  IS GGLKRIQEKYTWQ
Sbjct  695  GGPAEIIVHGKSGFNIDPYHGDQAAEILVDFFDKCKKEPSHWNDISEGGLKRIQEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS+RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKLAE VPLA E
Sbjct  755  IYSERLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLAESVPLAEE  805



>dbj|BAM68521.1| sucrose synthase [Mangifera indica]
 dbj|BAM68528.1| sucrose synthase [Mangifera indica]
Length=800

 Score =   202 bits (513),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIV+GKSGFHIDPYHG+QAAE+LVDFF KCK DPSHW+ IS GGLKRI+EKYTW+
Sbjct  690  GGPAEIIVNGKSGFHIDPYHGQQAAEILVDFFGKCKADPSHWDKISQGGLKRIEEKYTWK  749

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPLA+E
Sbjct  750  IYSQRLLTLTGVYGFWKHVSNLDRLESRRYIEMFYALKYRKLAESVPLAVE  800



>gb|ADW09923.1| putative sucrose synthase, partial [Schiedea globosa]
 gb|ADW09924.1| putative sucrose synthase, partial [Schiedea globosa]
Length=114

 Score =   186 bits (473),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 89/111 (80%), Positives = 97/111 (87%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GG  E  V+GKSG HIDPYHG++AA+LLVDFF+KCK DPSHWE IS GGLKRI+EKYTWQ
Sbjct  3    GGXXEXXVNGKSGXHIDPYHGDKAADLLVDFFQKCKGDPSHWEAISLGGLKRIEEKYTWQ  62

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYSD LLTLA VYGFWK+VS LDRLE RRYLEMFY LK+RKLAE VPLAIE
Sbjct  63   IYSDXLLTLAGVYGFWKYVSNLDRLEARRYLEMFYXLKYRKLAESVPLAIE  113



>ref|XP_007154543.1| hypothetical protein PHAVU_003G127500g [Phaseolus vulgaris]
 gb|ESW26537.1| hypothetical protein PHAVU_003G127500g [Phaseolus vulgaris]
Length=805

 Score =   202 bits (513),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG++AA+LLV+FFEKCK +PSHW+TIS  GL+RI+EKYTWQ
Sbjct  695  GGPAEIIVHGKSGFHIDPYHGDRAADLLVEFFEKCKVEPSHWDTISQAGLQRIEEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  755  IYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>gb|ADW80545.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   202 bits (513),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 94/111 (85%), Positives = 99/111 (89%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RI EKYTWQ
Sbjct  695  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIHEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  755  IYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>dbj|BAM37539.1| sucrose synthase [Mangifera indica]
Length=800

 Score =   202 bits (513),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIV+GKSGFHIDPYHG+QAAE+LVDFF KCK DPSHW+ IS GGLKRI+EKYTW+
Sbjct  690  GGPAEIIVNGKSGFHIDPYHGQQAAEILVDFFGKCKADPSHWDKISQGGLKRIEEKYTWK  749

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPLA+E
Sbjct  750  IYSQRLLTLTGVYGFWKHVSNLDRLESRRYIEMFYALKYRKLAESVPLAVE  800



>gb|KDO73788.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
Length=783

 Score =   202 bits (513),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 93/111 (84%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIV+GKSG+HIDPYHGEQAAE+LVDFFEKCK DPS+W+ IS GGLKRI+EKYTW+
Sbjct  673  GGPAEIIVNGKSGYHIDPYHGEQAAEILVDFFEKCKADPSYWDKISLGGLKRIEEKYTWK  732

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  733  IYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  783



>gb|ABD61653.1| sucrose synthase [Cichorium intybus]
Length=806

 Score =   202 bits (513),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 93/111 (84%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG+Q  +LLV FFEK K DPSHWE IS G  +RIQEKYTWQ
Sbjct  695  GGPAEIIVHGKSGFHIDPYHGDQVTDLLVKFFEKTKVDPSHWEAISKGAEQRIQEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYSDRLLTLA VYGFWKHVSKLDRLEIRRYLEMFYALK+RK+AE VPLA++
Sbjct  755  IYSDRLLTLAGVYGFWKHVSKLDRLEIRRYLEMFYALKYRKMAESVPLAVD  805



>gb|AEV40464.1| sucrose synthase 5 [Gossypium arboreum]
Length=833

 Score =   201 bits (512),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 94/111 (85%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGF+IDPYHG+QAAE+LVDFF+KCKK+PSHW  IS GGLKRIQEKYTWQ
Sbjct  722  GGPAEIIVHGKSGFNIDPYHGDQAAEILVDFFDKCKKEPSHWNDISEGGLKRIQEKYTWQ  781

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS+RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKLAE VPLA E
Sbjct  782  IYSERLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLAESVPLAEE  832



>gb|AAN76498.1|AF315375_1 sucrose synthase [Phaseolus vulgaris]
Length=805

 Score =   201 bits (512),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG++AA+LLV+FFEKCK +PSHW+TIS  GL+RI+EKYTWQ
Sbjct  695  GGPAEIIVHGKSGFHIDPYHGDRAADLLVEFFEKCKVEPSHWDTISQAGLQRIEEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  755  IYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>gb|AEF56625.1| sucrose synthase [Arachis hypogaea var. vulgaris]
Length=806

 Score =   200 bits (509),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG++AA+LLVDFF+KCK DP+HW+ IS GGL+RI+EKYTWQ
Sbjct  695  GGPAEIIVHGKSGFHIDPYHGDRAADLLVDFFDKCKVDPTHWDKISQGGLQRIEEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKLAE VPLA+E
Sbjct  755  IYSQRLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLAESVPLAVE  805



>gb|AFO84090.1| sucrose synthase [Actinidia chinensis]
Length=806

 Score =   200 bits (508),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEII+HGKSGFHIDPYHG+Q AELLV+F+EKCK DPSHW+ IS GGLKRI EKYTWQ
Sbjct  695  GGPAEIIIHGKSGFHIDPYHGDQVAELLVNFYEKCKVDPSHWDAISEGGLKRILEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS+RL+TLA VYGFWK+VSKLDR E RRYLEMFYALK+RKLAE VPLA++
Sbjct  755  IYSERLMTLAGVYGFWKYVSKLDRRETRRYLEMFYALKYRKLAEAVPLAVD  805



>gb|ADR81996.1| sucrose synthase 1 [Populus trichocarpa]
 gb|ADV71183.1| sucrose synthase 1 [Populus trichocarpa]
Length=805

 Score =   200 bits (508),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/111 (84%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIV+GKSGFHIDPYHGE+AAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQ
Sbjct  695  GGPAEIIVNGKSGFHIDPYHGEKAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  755  IYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>ref|XP_002324136.2| sucrose synthase family protein [Populus trichocarpa]
 gb|EEF02701.2| sucrose synthase family protein [Populus trichocarpa]
Length=805

 Score =   200 bits (508),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/111 (84%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIV+GKSGFHIDPYHGE+AAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQ
Sbjct  695  GGPAEIIVNGKSGFHIDPYHGEKAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  755  IYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|AAC28107.1| nodule-enhanced sucrose synthase [Pisum sativum]
Length=806

 Score =   200 bits (508),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG++AA+LLV+FFEK K DPSHW+ IS GGL+RI+EKYTWQ
Sbjct  695  GGPAEIIVHGKSGFHIDPYHGDRAADLLVEFFEKVKTDPSHWDKISQGGLQRIEEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  755  IYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>emb|CAA09910.1| sucrose synthase [Pisum sativum]
Length=806

 Score =   200 bits (508),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG++AA+LLV+FFEK K DPSHW+ IS GGL+RI+EKYTWQ
Sbjct  695  GGPAEIIVHGKSGFHIDPYHGDRAADLLVEFFEKVKTDPSHWDKISQGGLQRIEEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  755  IYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>ref|XP_003609947.1| Sucrose synthase [Medicago truncatula]
Length=531

 Score =   196 bits (499),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG++AA+LLV+FFEK K DPSHW+ IS GGL+RI+EKYTW 
Sbjct  421  GGPAEIIVHGKSGFHIDPYHGDRAADLLVEFFEKVKVDPSHWDKISQGGLQRIEEKYTWT  480

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  481  IYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  531



>dbj|BAM68520.1| sucrose synthase [Mangifera indica]
 dbj|BAM68522.1| sucrose synthase [Mangifera indica]
 dbj|BAM68523.1| sucrose synthase [Mangifera indica]
 dbj|BAM68524.1| sucrose synthase [Mangifera indica]
 dbj|BAM68525.1| sucrose synthase [Mangifera indica]
Length=800

 Score =   199 bits (507),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIV+GKSGFHIDPYHG+QAAE+LVDFF KCK DPS+W+ IS GGLKRI+EKYTW+
Sbjct  690  GGPAEIIVNGKSGFHIDPYHGQQAAEILVDFFGKCKADPSYWDKISQGGLKRIEEKYTWK  749

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPLA+E
Sbjct  750  IYSQRLLTLTGVYGFWKHVSNLDRLESRRYIEMFYALKYRKLAESVPLAVE  800



>sp|P31926.1|SUSY_VICFA RecName: Full=Sucrose synthase; AltName: Full=Sucrose-UDP glucosyltransferase 
[Vicia faba]
 emb|CAA49428.1| sucrose synthase [Vicia faba]
 gb|AAC37346.1| UDP-glucose:D-fructose-2-glucosyltransferase [Vicia faba]
Length=806

 Score =   199 bits (507),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG++AA+LLV+FFEK K DPSHW+ IS GGL+RI+EKYTWQ
Sbjct  695  GGPAEIIVHGKSGFHIDPYHGDRAADLLVEFFEKVKADPSHWDKISLGGLQRIEEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  755  IYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>dbj|BAM68527.1| sucrose synthase [Mangifera indica]
Length=800

 Score =   199 bits (507),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIV+GKSGFHIDPYHG+QAAE+LVDFF KCK DPS+W+ IS GGLKRI+EKYTW+
Sbjct  690  GGPAEIIVNGKSGFHIDPYHGQQAAEILVDFFGKCKADPSYWDKISQGGLKRIEEKYTWK  749

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPLA+E
Sbjct  750  IYSQRLLTLTGVYGFWKHVSNLDRLESRRYIEMFYALKYRKLAESVPLAVE  800



>ref|XP_010047438.1| PREDICTED: sucrose synthase [Eucalyptus grandis]
 gb|KCW79350.1| hypothetical protein EUGRSUZ_C00769 [Eucalyptus grandis]
Length=805

 Score =   199 bits (506),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG+QAAE L +FFEKCK DPSHW+ IS G ++RI+EKYTWQ
Sbjct  695  GGPAEIIVHGKSGFHIDPYHGDQAAETLANFFEKCKVDPSHWDKISQGAMQRIKEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS+RLL L +VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  755  IYSERLLNLTAVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>gb|AEN71079.1| sucrose synthase Sus1 [Gossypium aridum]
Length=805

 Score =   199 bits (506),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS GGLKRI+EKYTW+
Sbjct  695  GGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKISQGGLKRIEEKYTWK  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  755  IYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|AEN71067.1| sucrose synthase Sus1 [Gossypium tomentosum]
Length=805

 Score =   199 bits (506),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS GGLKRI+EKYTW+
Sbjct  695  GGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKISQGGLKRIEEKYTWK  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  755  IYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|AEK81520.1| sucrose synthase isoform B [Gossypium hirsutum]
Length=805

 Score =   199 bits (506),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 93/111 (84%), Positives = 99/111 (89%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGF+IDPYHG+QAAE+L DFF+KCKKDPSHW  IS GGLKRIQEKYTWQ
Sbjct  695  GGPAEIIVHGKSGFNIDPYHGDQAAEILADFFDKCKKDPSHWNDISEGGLKRIQEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS+RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+ KLAE VPLA E
Sbjct  755  IYSERLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYPKLAESVPLAEE  805



>gb|AEN71068.1| sucrose synthase Sus1 [Gossypium tomentosum]
Length=805

 Score =   199 bits (506),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS GGLKRI+EKYTW+
Sbjct  695  GGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKISQGGLKRIEEKYTWK  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  755  IYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|AEN71080.1| sucrose synthase Sus1 [Gossypium gossypioides]
Length=805

 Score =   199 bits (506),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS GGLKRI+EKYTW+
Sbjct  695  GGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKISQGGLKRIEEKYTWK  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  755  IYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|AEN71078.1| sucrose synthase Sus1 [Gossypium klotzschianum]
Length=805

 Score =   199 bits (506),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS GGLKRI+EKYTW+
Sbjct  695  GGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKISQGGLKRIEEKYTWK  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  755  IYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|ADY68846.1| sucrose synthase [Gossypium herbaceum subsp. africanum]
Length=805

 Score =   199 bits (506),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS GGLKRI+EKYTW+
Sbjct  695  GGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKISQGGLKRIEEKYTWK  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  755  IYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|ACV72640.1| sucrose synthase 1 [Gossypium hirsutum]
 gb|ADY68849.1| sucrose synthase [Gossypium hirsutum]
 gb|AEN71074.1| sucrose synthase Sus1 [Gossypium hirsutum subsp. latifolium]
Length=805

 Score =   199 bits (506),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS GGLKRI+EKYTW+
Sbjct  695  GGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKISQGGLKRIEEKYTWK  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  755  IYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|AEN71063.1| sucrose synthase Sus1 [Gossypium mustelinum]
 gb|AEN71065.1| sucrose synthase Sus1 [Gossypium darwinii]
 gb|AEN71069.1| sucrose synthase Sus1 [Gossypium barbadense var. brasiliense]
 gb|AEN71071.1| sucrose synthase Sus1 [Gossypium barbadense var. peruvianum]
 gb|AEN71073.1| sucrose synthase Sus1 [Gossypium hirsutum subsp. latifolium]
Length=805

 Score =   199 bits (506),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS GGLKRI+EKYTW+
Sbjct  695  GGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKISQGGLKRIEEKYTWK  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  755  IYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|AEV40462.1| sucrose synthase 3 [Gossypium arboreum]
 gb|AFM52234.1| putative sucrose synthase 3 [Gossypium arboreum]
 gb|KHG30366.1| Sucrose synthase [Gossypium arboreum]
Length=805

 Score =   199 bits (506),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS GGLKRI+EKYTW+
Sbjct  695  GGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKISQGGLKRIEEKYTWK  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  755  IYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|ADY68845.1| sucrose synthase [Gossypium barbadense]
 gb|ADY68847.1| sucrose synthase [Gossypium raimondii]
 gb|AEN71062.1| sucrose synthase Sus1 [Gossypium turneri]
 gb|AEN71064.1| sucrose synthase Sus1 [Gossypium mustelinum]
 gb|AEN71070.1| sucrose synthase Sus1 [Gossypium barbadense var. brasiliense]
 gb|AEN71072.1| sucrose synthase Sus1 [Gossypium barbadense var. peruvianum]
 gb|AEN71077.1| sucrose synthase Sus1 [Gossypium davidsonii]
 gb|KJB54536.1| hypothetical protein B456_009G038000 [Gossypium raimondii]
 gb|KJB54537.1| hypothetical protein B456_009G038000 [Gossypium raimondii]
 gb|KJB54538.1| hypothetical protein B456_009G038000 [Gossypium raimondii]
Length=805

 Score =   199 bits (506),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS GGLKRI+EKYTW+
Sbjct  695  GGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKISQGGLKRIEEKYTWK  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  755  IYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|AEN71059.1| sucrose synthase Sus1 [Gossypium thurberi]
 gb|AEN71082.1| sucrose synthase Sus1 [Gossypium trilobum]
Length=805

 Score =   199 bits (505),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS GGLKRI+EKYTW+
Sbjct  695  GGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKISQGGLKRIEEKYTWK  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  755  IYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>dbj|BAM68526.1| sucrose synthase [Mangifera indica]
 dbj|BAM68529.1| sucrose synthase [Mangifera indica]
Length=800

 Score =   199 bits (505),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIV+GKSGFHIDPYHG+QAAE+LVDFF KCK DPS+W+ IS GGLKRI+EKYTW+
Sbjct  690  GGPAEIIVNGKSGFHIDPYHGQQAAEILVDFFGKCKVDPSYWDKISQGGLKRIEEKYTWK  749

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPLA+E
Sbjct  750  IYSQRLLTLTGVYGFWKHVSNLDRLESRRYIEMFYALKYRKLAESVPLAVE  800



>gb|AEN71075.1| sucrose synthase Sus1 [Gossypium armourianum]
 gb|AEN71076.1| sucrose synthase Sus1 [Gossypium harknessii]
Length=805

 Score =   199 bits (505),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS GGLKRI+EKYTW+
Sbjct  695  GGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKISQGGLKRIEEKYTWK  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  755  IYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|ADY68848.1| sucrose synthase [Gossypium hirsutum]
Length=805

 Score =   199 bits (505),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS GGLKRI+EKYTW+
Sbjct  695  GGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKISQGGLKRIEEKYTWK  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  755  IYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|AEN71061.1| sucrose synthase Sus1 [Gossypium schwendimanii]
Length=805

 Score =   199 bits (505),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS GGLKRI+EKYTW+
Sbjct  695  GGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKISQGGLKRIEEKYTWK  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  755  IYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|ADY68844.1| sucrose synthase [Gossypium barbadense]
Length=805

 Score =   199 bits (505),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS GGLKRI+EKYTW+
Sbjct  695  GGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKISQGGLKRIEEKYTWK  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  755  IYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|AAD28641.1| sucrose synthase [Gossypium hirsutum]
Length=806

 Score =   199 bits (505),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS GGLKRI+EKYTW+
Sbjct  696  GGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKISQGGLKRIEEKYTWK  755

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  756  IYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  806



>gb|AEK81522.1| sucrose synthase isoform D [Gossypium hirsutum]
Length=806

 Score =   199 bits (505),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGF+IDPYHG+QAAE+LVDFFEKCK D S+W  IS GGLKRI+EKYTW+
Sbjct  695  GGPAEIIVHGKSGFNIDPYHGDQAAEILVDFFEKCKTDSSYWTKISEGGLKRIEEKYTWK  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS+RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  755  IYSERLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>gb|AEN71066.1| sucrose synthase Sus1 [Gossypium darwinii]
Length=805

 Score =   199 bits (505),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS GGLKRI+EKYTW+
Sbjct  695  GGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEKCKKDPSHWDKISQGGLKRIEEKYTWK  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  755  IYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>emb|CAB39757.2| sucrose synthase [Lotus japonicus]
Length=233

 Score =   188 bits (477),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 86/111 (77%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSG+HIDPYHG++AAE LV+FFEK K DPS+W+ IS GGL+RI EKYTW+
Sbjct  122  GGPAEIIVHGKSGYHIDPYHGDRAAETLVEFFEKSKADPSYWDKISQGGLQRIHEKYTWK  181

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYSDRLLTL  VYGFWKHV+ LDR E +RYLEMFYALK+ KLAE VPLA+E
Sbjct  182  IYSDRLLTLTGVYGFWKHVTNLDRRENKRYLEMFYALKYSKLAESVPLAVE  232



>ref|XP_002877269.1| hypothetical protein ARALYDRAFT_484788 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53528.1| hypothetical protein ARALYDRAFT_484788 [Arabidopsis lyrata subsp. 
lyrata]
Length=808

 Score =   199 bits (505),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG+QAAE L DFF KCK DPSHW+ IS GGL+RIQEKYTWQ
Sbjct  697  GGPAEIIVHGKSGFHIDPYHGDQAAETLADFFTKCKHDPSHWDQISLGGLERIQEKYTWQ  756

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS+RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  757  IYSERLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRPLAQAVPLAQE  807



>gb|AAR03498.1| sucrose synthase [Populus tremuloides]
Length=805

 Score =   198 bits (504),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 99/111 (89%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  695  GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  755  IYSQRLLTLTGVYGFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ABP88869.1| sucrose synthase [Medicago falcata]
Length=804

 Score =   198 bits (504),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHGE+AA+LLV+FFEK K DPSHW+ IS GGL+RI+EKYTW 
Sbjct  694  GGPAEIIVHGKSGFHIDPYHGERAADLLVEFFEKVKADPSHWDKISQGGLQRIEEKYTWT  753

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  754  IYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  804



>gb|AIJ28962.1| sucrose synthase [Manihot esculenta]
Length=806

 Score =   198 bits (504),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 99/111 (89%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGF+IDPYHG+QAAELLV+FFEKCK DP HW+ IS G ++RIQEKYTWQ
Sbjct  695  GGPAEIIVHGKSGFNIDPYHGDQAAELLVEFFEKCKADPPHWDKISQGAMQRIQEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVSKLDR E RRYLEMFYALK+RKLAE VPL +E
Sbjct  755  IYSQRLLTLTGVYGFWKHVSKLDRRESRRYLEMFYALKYRKLAESVPLTVE  805



>gb|AGM14949.1| sucrose synthase 4 [Hevea brasiliensis]
Length=806

 Score =   198 bits (503),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGF+IDPYHG+QAAELLVDFFEK K DPSHW  IS G ++RIQEKYTWQ
Sbjct  695  GGPAEIIVHGKSGFNIDPYHGDQAAELLVDFFEKSKADPSHWNNISQGAMQRIQEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVSKLDR E RRYLEMFYALK+RKLAE VPL +E
Sbjct  755  IYSQRLLTLTGVYGFWKHVSKLDRRESRRYLEMFYALKYRKLAESVPLTVE  805



>ref|NP_001289655.1| sucrose synthase [Eucalyptus grandis]
 gb|ABB53602.1| sucrose synthase [Eucalyptus grandis]
Length=805

 Score =   198 bits (503),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 89/111 (80%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG+QAAE L +FFEKCK DPSHW+ IS G ++RI++KYTWQ
Sbjct  695  GGPAEIIVHGKSGFHIDPYHGDQAAETLANFFEKCKVDPSHWDKISQGAMQRIKDKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS+RLL L +VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  755  IYSERLLNLTAVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>gb|AGO61958.1| sucrose synthase, partial [Prunus serrulata]
Length=437

 Score =   192 bits (489),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 99/111 (89%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSG+HIDPYHG+QAAE+LVDFFEK + DPSHW+ IS GGL+RI EKYT Q
Sbjct  326  GGPAEIIVHGKSGYHIDPYHGDQAAEILVDFFEKSRADPSHWDKISQGGLQRIFEKYTRQ  385

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS+RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA E
Sbjct  386  IYSERLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAEE  436



>ref|XP_002275155.1| PREDICTED: sucrose synthase [Vitis vinifera]
 ref|XP_010656083.1| PREDICTED: sucrose synthase [Vitis vinifera]
 ref|XP_010656084.1| PREDICTED: sucrose synthase [Vitis vinifera]
 emb|CBI27755.3| unnamed protein product [Vitis vinifera]
Length=806

 Score =   197 bits (502),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG++AAELL +FFEKCK DP+HWE IS  GLKRI+EKYTW+
Sbjct  695  GGPAEIIVHGKSGFHIDPYHGDKAAELLANFFEKCKADPTHWEKISKAGLKRIEEKYTWK  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS+RLLTLA VYGFWK+VS LDR E RRYLEMFYALK+RKLA+ VPLA+E
Sbjct  755  IYSERLLTLAGVYGFWKYVSNLDRRETRRYLEMFYALKYRKLAQSVPLAVE  805



>gb|AAK59464.1| putative sucrose synthase [Arabidopsis thaliana]
Length=532

 Score =   195 bits (495),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 97/111 (87%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG++AAE L DFF KCK DPSHW+ IS GGL+RIQEKYTWQ
Sbjct  421  GGPAEIIVHGKSGFHIDPYHGDKAAESLADFFTKCKHDPSHWDQISLGGLERIQEKYTWQ  480

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  481  IYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRPLAQAVPLAHE  531



>emb|CAN82840.1| hypothetical protein VITISV_024563 [Vitis vinifera]
Length=806

 Score =   197 bits (502),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG++AAELL +FFEKCK DP+HWE IS  GLKRI+EKYTW+
Sbjct  695  GGPAEIIVHGKSGFHIDPYHGDKAAELLANFFEKCKADPTHWEKISKAGLKRIEEKYTWK  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS+RLLTLA VYGFWK+VS LDR E RRYLEMFYALK+RKLA+ VPLA+E
Sbjct  755  IYSERLLTLAGVYGFWKYVSNLDRRETRRYLEMFYALKYRKLAQSVPLAVE  805



>gb|AIJ28961.1| sucrose synthase [Manihot esculenta]
Length=806

 Score =   197 bits (502),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGF+IDPYHG+QAAELLV FFEKCK DPSHW  IS G ++RIQEKYTWQ
Sbjct  695  GGPAEIIVHGKSGFNIDPYHGDQAAELLVQFFEKCKADPSHWIKISEGAMQRIQEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVSKLDR E RRYLEMFYALK+RKLAE VPL +E
Sbjct  755  IYSQRLLTLTGVYGFWKHVSKLDRRESRRYLEMFYALKYRKLAESVPLTVE  805



>gb|AGM14948.1| sucrose synthase 3 [Hevea brasiliensis]
Length=810

 Score =   197 bits (502),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 99/111 (89%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGF+IDPYHG+QAAELLVDFFEKCK DPS+W  IS G ++RIQEKYTWQ
Sbjct  699  GGPAEIIVHGKSGFNIDPYHGDQAAELLVDFFEKCKVDPSYWNNISHGAMQRIQEKYTWQ  758

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVSKLDRLE +RYLEMFYALK+ KLAE VPL +E
Sbjct  759  IYSQRLLTLTGVYGFWKHVSKLDRLESKRYLEMFYALKYHKLAESVPLTVE  809



>gb|ABD96570.1| sucrose synthase [Manihot esculenta]
Length=806

 Score =   197 bits (502),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGF+IDPYHG+QAAELLV FFEKCK DPSHW  IS G ++RIQEKYTWQ
Sbjct  695  GGPAEIIVHGKSGFNIDPYHGDQAAELLVQFFEKCKADPSHWIKISEGAMQRIQEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVSKLDR E RRYLEMFYALK+RKLAE VPL +E
Sbjct  755  IYSQRLLTLTGVYGFWKHVSKLDRRESRRYLEMFYALKYRKLAESVPLTVE  805



>sp|O65026.1|SUSY_MEDSA RecName: Full=Sucrose synthase; AltName: Full=Sucrose-UDP glucosyltransferase 
[Medicago sativa]
 gb|AAC17867.1| sucrose synthase [Medicago sativa]
Length=805

 Score =   197 bits (501),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG++AA+LLV+FFEK K DPSHW+ IS GGL+RI+EKYTW 
Sbjct  695  GGPAEIIVHGKSGFHIDPYHGDRAADLLVEFFEKVKADPSHWDKISQGGLQRIEEKYTWT  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  755  IYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>ref|NP_001237525.1| sucrose synthase [Glycine max]
 sp|P13708.2|SUSY_SOYBN RecName: Full=Sucrose synthase; AltName: Full=Nodulin-100; Short=N-100; 
AltName: Full=Sucrose-UDP glucosyltransferase [Glycine 
max]
 gb|AAC39323.1| sucrose synthase [Glycine max]
 gb|KHN45052.1| Sucrose synthase [Glycine soja]
Length=805

 Score =   197 bits (501),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 99/111 (89%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG++AA+LLVDFFEKCK DP+HW+ IS  GL+RI+EKYTWQ
Sbjct  695  GGPAEIIVHGKSGFHIDPYHGDRAADLLVDFFEKCKLDPTHWDKISKAGLQRIEEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKLAE VPLA E
Sbjct  755  IYSQRLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLAESVPLAAE  805



>gb|AEQ94149.1| sucrose synthase1 [Elaeis guineensis]
Length=235

 Score =   186 bits (473),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 84/108 (78%), Positives = 97/108 (90%), Gaps = 0/108 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHG SGFHIDPY G++AAELLVDFFEKCK+DPSHW  IS GGL+RI+EKYTW+
Sbjct  116  GGPAEIIVHGVSGFHIDPYQGDKAAELLVDFFEKCKEDPSHWAKISQGGLQRIEEKYTWK  175

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPL  345
            +YS+RL+TL+ VYGFWK+VS LDR E RRYLEMFYALK+R LA+ VPL
Sbjct  176  LYSERLMTLSGVYGFWKYVSNLDRRETRRYLEMFYALKYRNLAKSVPL  223



>gb|ADR81997.1| sucrose synthase 2 [Populus trichocarpa]
 gb|ADV71184.1| sucrose synthase 2 [Populus trichocarpa]
Length=803

 Score =   197 bits (500),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DPS+W+ IS GGL+RIQEKYTW+
Sbjct  693  GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPSYWDKISQGGLQRIQEKYTWK  752

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753  IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>ref|XP_010535796.1| PREDICTED: sucrose synthase 4 [Tarenaya hassleriana]
Length=806

 Score =   197 bits (500),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 99/111 (89%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG+QAAE+L DFF KCK+DPSHW+ IS GGL+RI+EKYTWQ
Sbjct  695  GGPAEIIVHGKSGFHIDPYHGDQAAEILADFFAKCKEDPSHWDEISHGGLQRIEEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  755  IYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRPLAKAVPLAQE  805



>ref|XP_006381564.1| sucrose synthase family protein [Populus trichocarpa]
 gb|ERP59361.1| sucrose synthase family protein [Populus trichocarpa]
Length=803

 Score =   197 bits (500),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DPS+W+ IS GGL+RIQEKYTW+
Sbjct  693  GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPSYWDKISQGGLQRIQEKYTWK  752

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753  IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>emb|CAB40795.1| sucrose synthase [Medicago truncatula]
Length=805

 Score =   197 bits (500),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG++AA+LLV+FFEK K DPSHW+ IS GGL+RI+EKYTW 
Sbjct  695  GGPAEIIVHGKSGFHIDPYHGDRAADLLVEFFEKVKVDPSHWDKISQGGLQRIEEKYTWT  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  755  IYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>ref|XP_003609949.1| Sucrose synthase [Medicago truncatula]
 emb|CAB40794.1| sucrose synthase [Medicago truncatula]
 gb|AES92146.1| sucrose synthase [Medicago truncatula]
Length=805

 Score =   197 bits (500),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG++AA+LLV+FFEK K DPSHW+ IS GGL+RI+EKYTW 
Sbjct  695  GGPAEIIVHGKSGFHIDPYHGDRAADLLVEFFEKVKVDPSHWDKISQGGLQRIEEKYTWT  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  755  IYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>ref|XP_010420928.1| PREDICTED: sucrose synthase 1-like [Camelina sativa]
Length=808

 Score =   197 bits (500),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG+QAA+ L DFF KCK+DPSHW+ IS GGL+RI+EKYTWQ
Sbjct  697  GGPAEIIVHGKSGFHIDPYHGDQAADTLADFFTKCKEDPSHWDEISQGGLQRIEEKYTWQ  756

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  757  IYSQRLLTLTGVYGFWKHVSNLDRLEARRYLEMFYALKYRPLAQAVPLAQE  807



>ref|XP_010454391.1| PREDICTED: sucrose synthase 1-like isoform X2 [Camelina sativa]
Length=808

 Score =   196 bits (499),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG+QAA+ L DFF KCK+DPSHW+ IS GGL+RI+EKYTWQ
Sbjct  697  GGPAEIIVHGKSGFHIDPYHGDQAADTLADFFTKCKEDPSHWDEISQGGLQRIEEKYTWQ  756

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  757  IYSQRLLTLTGVYGFWKHVSNLDRLEARRYLEMFYALKYRPLAQAVPLAQE  807



>gb|AEN71060.1| sucrose synthase Sus1 [Gossypium laxum]
 gb|AEN71081.1| sucrose synthase Sus1 [Gossypium lobatum]
Length=805

 Score =   196 bits (499),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGF+IDPYHG+QAA++LVDFFE CKKDPSHW+ IS GGLKRI+EKYTW+
Sbjct  695  GGPAEIIVHGKSGFNIDPYHGDQAADILVDFFEVCKKDPSHWDKISQGGLKRIEEKYTWK  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS+RLLTL  VYGFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  755  IYSERLLTLTGVYGFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>ref|XP_010454392.1| PREDICTED: sucrose synthase 1-like isoform X3 [Camelina sativa]
Length=838

 Score =   197 bits (500),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG+QAA+ L DFF KCK+DPSHW+ IS GGL+RI+EKYTWQ
Sbjct  727  GGPAEIIVHGKSGFHIDPYHGDQAADTLADFFTKCKEDPSHWDEISQGGLQRIEEKYTWQ  786

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  787  IYSQRLLTLTGVYGFWKHVSNLDRLEARRYLEMFYALKYRPLAQAVPLAQE  837



>ref|XP_010493195.1| PREDICTED: sucrose synthase 1 [Camelina sativa]
Length=808

 Score =   196 bits (499),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG+QAA+ L DFF KCK+DPSHW+ IS GGL+RI+EKYTWQ
Sbjct  697  GGPAEIIVHGKSGFHIDPYHGDQAADTLADFFTKCKEDPSHWDEISQGGLQRIEEKYTWQ  756

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  757  IYSQRLLTLTGVYGFWKHVSNLDRLEARRYLEMFYALKYRPLAQAVPLAQE  807



>ref|XP_007138617.1| hypothetical protein PHAVU_009G223800g [Phaseolus vulgaris]
 ref|XP_007138618.1| hypothetical protein PHAVU_009G223800g [Phaseolus vulgaris]
 gb|ESW10611.1| hypothetical protein PHAVU_009G223800g [Phaseolus vulgaris]
 gb|ESW10612.1| hypothetical protein PHAVU_009G223800g [Phaseolus vulgaris]
Length=806

 Score =   196 bits (499),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIV GKSG+HIDPYHG++AAE+LVDFFEK K DPSHW+ IS GGLKRIQEKYTWQ
Sbjct  695  GGPAEIIVDGKSGYHIDPYHGDRAAEILVDFFEKSKADPSHWDKISQGGLKRIQEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYSDRLLTL  VYGFWKHV+ L+R E +RYLEMFYALK+RKLAE VPLAIE
Sbjct  755  IYSDRLLTLTGVYGFWKHVTNLERRESKRYLEMFYALKYRKLAESVPLAIE  805



>ref|XP_006290612.1| hypothetical protein CARUB_v10016702mg [Capsella rubella]
 gb|EOA23510.1| hypothetical protein CARUB_v10016702mg [Capsella rubella]
Length=807

 Score =   196 bits (499),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 97/111 (87%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEII HGKSGFHIDPYHG+QAAE L DFF KCK+DPSHW+ IS GGL+RIQEKYTWQ
Sbjct  697  GGPAEIIEHGKSGFHIDPYHGDQAAETLADFFTKCKQDPSHWDQISLGGLQRIQEKYTWQ  756

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  757  IYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRPLAQAVPLAQE  807



>ref|XP_010454390.1| PREDICTED: sucrose synthase 1-like isoform X1 [Camelina sativa]
Length=862

 Score =   197 bits (500),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG+QAA+ L DFF KCK+DPSHW+ IS GGL+RI+EKYTWQ
Sbjct  751  GGPAEIIVHGKSGFHIDPYHGDQAADTLADFFTKCKEDPSHWDEISQGGLQRIEEKYTWQ  810

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  811  IYSQRLLTLTGVYGFWKHVSNLDRLEARRYLEMFYALKYRPLAQAVPLAQE  861



>emb|CDX70945.1| BnaC03g10290D [Brassica napus]
Length=806

 Score =   196 bits (499),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHGEQAA+ L DFF KCK+DPSHW+ IS GGL+RI+EKYTWQ
Sbjct  695  GGPAEIIVHGKSGFHIDPYHGEQAADTLADFFTKCKEDPSHWDEISKGGLQRIEEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  755  IYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRPLAKAVPLAEE  805



>gb|AAR19769.1| sucrose synthase [Beta vulgaris]
Length=805

 Score =   196 bits (499),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG++AA+LLVDFFEK   DPS+WE IS GGL+RI+EKYTW+
Sbjct  692  GGPAEIIVHGKSGFHIDPYHGDKAADLLVDFFEKSTADPSYWENISKGGLQRIEEKYTWK  751

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYSDRLLTLA VYGFWK+VS LDR E RRYLEMFYALK++KLAE VPLAIE
Sbjct  752  IYSDRLLTLAGVYGFWKYVSNLDRREARRYLEMFYALKYKKLAESVPLAIE  802



>ref|XP_010687574.1| PREDICTED: sucrose synthase [Beta vulgaris subsp. vulgaris]
Length=805

 Score =   196 bits (499),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG++AA+LLVDFFEK   DPS+WE IS GGL+RI+EKYTW+
Sbjct  692  GGPAEIIVHGKSGFHIDPYHGDKAADLLVDFFEKSTADPSYWENISKGGLQRIEEKYTWK  751

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYSDRLLTLA VYGFWK+VS LDR E RRYLEMFYALK++KLAE VPLAIE
Sbjct  752  IYSDRLLTLAGVYGFWKYVSNLDRREARRYLEMFYALKYKKLAESVPLAIE  802



>ref|XP_009120766.1| PREDICTED: LOW QUALITY PROTEIN: sucrose synthase 1 [Brassica 
rapa]
Length=805

 Score =   196 bits (498),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG+QAA+ L DFF KCK+DPSHW+ IS GGL+RI+EKYTWQ
Sbjct  695  GGPAEIIVHGKSGFHIDPYHGDQAADTLADFFTKCKEDPSHWDQISKGGLQRIEEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  755  IYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRPLAQAVPLAQE  805



>emb|CDX92432.1| BnaA10g14710D [Brassica napus]
Length=805

 Score =   196 bits (498),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG+QAA+ L DFF KCK+DPSHW+ IS GGL+RI+EKYTWQ
Sbjct  695  GGPAEIIVHGKSGFHIDPYHGDQAADTLADFFTKCKEDPSHWDQISKGGLQRIEEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  755  IYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRPLAQAVPLAQE  805



>gb|ADW80575.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   196 bits (498),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693  GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  752

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753  IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80600.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   196 bits (498),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693  GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  752

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753  IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80607.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   196 bits (498),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693  GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  752

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753  IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80589.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   196 bits (498),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693  GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  752

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753  IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80610.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   196 bits (498),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693  GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  752

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753  IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80595.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   196 bits (498),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693  GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  752

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753  IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80591.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   196 bits (498),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693  GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  752

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753  IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80578.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   196 bits (498),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693  GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  752

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753  IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80592.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   196 bits (498),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693  GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  752

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753  IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80588.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   196 bits (498),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693  GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  752

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753  IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80580.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   196 bits (498),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693  GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  752

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753  IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80586.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   196 bits (498),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693  GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  752

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753  IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80581.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   196 bits (498),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693  GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  752

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753  IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADV71182.1| sucrose synthase 2 [Populus tomentosa]
 gb|ADW80572.1| sucrose synthase 2 [Populus tomentosa]
 gb|ADW80573.1| sucrose synthase 2 [Populus tomentosa]
 gb|ADW80594.1| sucrose synthase 2 [Populus tomentosa]
 gb|AFZ78659.1| sucrose synthase [Populus tomentosa]
Length=803

 Score =   196 bits (498),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693  GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  752

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753  IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80611.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   196 bits (498),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693  GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  752

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753  IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80590.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   196 bits (498),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693  GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  752

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753  IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80587.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   196 bits (498),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693  GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  752

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753  IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>emb|CDY16569.1| BnaC09g37040D [Brassica napus]
Length=805

 Score =   196 bits (498),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG+QAA+ L DFF KCK+DPSHW+ IS GGL+RI+EKYTWQ
Sbjct  695  GGPAEIIVHGKSGFHIDPYHGDQAADTLADFFAKCKEDPSHWDQISKGGLQRIEEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  755  IYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRPLAQAVPLAQE  805



>gb|ADW80608.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   196 bits (498),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693  GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  752

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753  IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80593.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   196 bits (498),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693  GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  752

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753  IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80606.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   196 bits (498),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693  GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  752

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753  IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80598.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   196 bits (498),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693  GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  752

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753  IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80582.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   196 bits (498),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693  GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  752

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753  IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80609.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   196 bits (498),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693  GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  752

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753  IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80604.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   196 bits (498),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693  GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  752

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753  IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80584.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   196 bits (498),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693  GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  752

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753  IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80574.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   196 bits (498),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693  GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  752

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753  IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>ref|XP_009348896.1| PREDICTED: sucrose synthase-like [Pyrus x bretschneideri]
Length=807

 Score =   196 bits (498),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = -2

Query  671  MGGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTW  492
            MGGPAEIIV+GKSG+HIDPYHG+QAAE+LVDFFEK K DPSHW+ IS GGL+RI EKYTW
Sbjct  695  MGGPAEIIVNGKSGYHIDPYHGDQAAEILVDFFEKSKADPSHWDKISQGGLQRIYEKYTW  754

Query  491  QIYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            QIYS+RLLTL  VYGFWK VS LDRLE RRYLEMFYALK+RKLA  VPLA+E
Sbjct  755  QIYSERLLTLTGVYGFWKDVSNLDRLESRRYLEMFYALKYRKLAASVPLAVE  806



>ref|XP_008337809.1| PREDICTED: sucrose synthase [Malus domestica]
 ref|XP_008337810.1| PREDICTED: sucrose synthase [Malus domestica]
 ref|XP_008337811.1| PREDICTED: sucrose synthase [Malus domestica]
Length=807

 Score =   196 bits (498),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSG+HIDPYHG+QAAE+LVDFFEK K DPSHW+ IS GGL+RI EKYTWQ
Sbjct  696  GGPAEIIVHGKSGYHIDPYHGDQAAEILVDFFEKSKADPSHWDKISQGGLQRIYEKYTWQ  755

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+ KLA  VPLA+E
Sbjct  756  IYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYSKLAASVPLAVE  806



>gb|ADW80597.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   196 bits (498),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693  GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  752

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753  IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80585.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   196 bits (498),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693  GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  752

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753  IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80605.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   196 bits (498),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693  GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  752

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753  IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ABW76422.1| sucrose synthase [Populus tremuloides]
Length=803

 Score =   196 bits (498),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693  GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  752

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753  IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80576.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   196 bits (498),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693  GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  752

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753  IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80596.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   196 bits (497),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693  GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  752

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753  IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|AIJ28959.1| sucrose synthase [Manihot esculenta subsp. flabellifolia]
Length=806

 Score =   196 bits (497),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 97/111 (87%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGF+IDPYHG+QAAELLV FF KCK DPSHW  IS G ++RIQEKYTWQ
Sbjct  695  GGPAEIIVHGKSGFNIDPYHGDQAAELLVQFFVKCKADPSHWTKISEGAMQRIQEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVSKLDR E RRYLEMFYALK+RKLAE VPL +E
Sbjct  755  IYSQRLLTLTGVYGFWKHVSKLDRRESRRYLEMFYALKYRKLAESVPLTVE  805



>sp|P49034.1|SUSY_ALNGL RecName: Full=Sucrose synthase; AltName: Full=Sucrose-UDP glucosyltransferase 
[Alnus glutinosa]
 emb|CAA63122.1| sucrose synthase [Alnus glutinosa]
Length=803

 Score =   196 bits (497),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHGEQAA+LLVDFFEK K DPSHW  IS GGL+RI EKYTW+
Sbjct  693  GGPAEIIVHGKSGFHIDPYHGEQAAQLLVDFFEKTKADPSHWAKISLGGLQRIHEKYTWK  752

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS+RLLTL  V  FWKHVS LDRLE RRY+EMFYALK+RKLAE VPLA+E
Sbjct  753  IYSERLLTLTGVTAFWKHVSNLDRLESRRYIEMFYALKYRKLAESVPLAVE  803



>ref|XP_003609946.1| Sucrose synthase [Medicago truncatula]
Length=893

 Score =   196 bits (498),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG++AA+LLV+FFEK K DPSHW+ IS GGL+RI+EKYTW 
Sbjct  783  GGPAEIIVHGKSGFHIDPYHGDRAADLLVEFFEKVKVDPSHWDKISQGGLQRIEEKYTWT  842

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  843  IYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  893



>gb|ADW80602.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   196 bits (497),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFH+DPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693  GGPAEIIVHGKSGFHVDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  752

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753  IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|KHN49081.1| Sucrose synthase [Glycine soja]
Length=806

 Score =   196 bits (497),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSG+HIDPYHG++AAE+LV+FFEK K DPSHW+ IS GGLKRI EKYTWQ
Sbjct  695  GGPAEIIVHGKSGYHIDPYHGDRAAEILVEFFEKSKADPSHWDKISQGGLKRIHEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYSDRLLTL  VYGFWKHV+ L+R E +RYLEMFYALK+RKLAE VPLAIE
Sbjct  755  IYSDRLLTLTGVYGFWKHVTNLERRESKRYLEMFYALKYRKLAESVPLAIE  805



>ref|XP_011039917.1| PREDICTED: sucrose synthase [Populus euphratica]
Length=803

 Score =   196 bits (497),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEK+TW+
Sbjct  693  GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKHTWK  752

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLAE VPL IE
Sbjct  753  IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLAESVPLTIE  803



>ref|XP_003546526.1| PREDICTED: sucrose synthase-like isoform X1 [Glycine max]
 ref|XP_006597891.1| PREDICTED: sucrose synthase-like isoform X2 [Glycine max]
Length=806

 Score =   195 bits (496),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSG+HIDPYHG++AAE+LV+FFEK K DPSHW+ IS GGLKRI EKYTWQ
Sbjct  695  GGPAEIIVHGKSGYHIDPYHGDRAAEILVEFFEKSKADPSHWDKISQGGLKRIHEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYSDRLLTL  VYGFWKHV+ L+R E +RYLEMFYALK+RKLAE VPLAIE
Sbjct  755  IYSDRLLTLTGVYGFWKHVTNLERRESKRYLEMFYALKYRKLAESVPLAIE  805



>pdb|3S28|A Chain A, The Crystal Structure Of Sucrose Synthase-1 In Complex 
With A Breakdown Product Of The Udp-Glucose
 pdb|3S28|B Chain B, The Crystal Structure Of Sucrose Synthase-1 In Complex 
With A Breakdown Product Of The Udp-Glucose
 pdb|3S28|C Chain C, The Crystal Structure Of Sucrose Synthase-1 In Complex 
With A Breakdown Product Of The Udp-Glucose
 pdb|3S28|D Chain D, The Crystal Structure Of Sucrose Synthase-1 In Complex 
With A Breakdown Product Of The Udp-Glucose
 pdb|3S28|E Chain E, The Crystal Structure Of Sucrose Synthase-1 In Complex 
With A Breakdown Product Of The Udp-Glucose
 pdb|3S28|F Chain F, The Crystal Structure Of Sucrose Synthase-1 In Complex 
With A Breakdown Product Of The Udp-Glucose
 pdb|3S28|G Chain G, The Crystal Structure Of Sucrose Synthase-1 In Complex 
With A Breakdown Product Of The Udp-Glucose
 pdb|3S28|H Chain H, The Crystal Structure Of Sucrose Synthase-1 In Complex 
With A Breakdown Product Of The Udp-Glucose
 pdb|3S29|A Chain A, The Crystal Structure Of Sucrose Synthase-1 From Arabidopsis 
Thaliana And Its Functional Implications.
 pdb|3S29|B Chain B, The Crystal Structure Of Sucrose Synthase-1 From Arabidopsis 
Thaliana And Its Functional Implications.
 pdb|3S29|C Chain C, The Crystal Structure Of Sucrose Synthase-1 From Arabidopsis 
Thaliana And Its Functional Implications.
 pdb|3S29|D Chain D, The Crystal Structure Of Sucrose Synthase-1 From Arabidopsis 
Thaliana And Its Functional Implications.
 pdb|3S29|E Chain E, The Crystal Structure Of Sucrose Synthase-1 From Arabidopsis 
Thaliana And Its Functional Implications.
 pdb|3S29|F Chain F, The Crystal Structure Of Sucrose Synthase-1 From Arabidopsis 
Thaliana And Its Functional Implications.
 pdb|3S29|G Chain G, The Crystal Structure Of Sucrose Synthase-1 From Arabidopsis 
Thaliana And Its Functional Implications.
 pdb|3S29|H Chain H, The Crystal Structure Of Sucrose Synthase-1 From Arabidopsis 
Thaliana And Its Functional Implications.
Length=816

 Score =   196 bits (497),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG+QAA+ L DFF KCK+DPSHW+ IS GGL+RI+EKYTWQ
Sbjct  697  GGPAEIIVHGKSGFHIDPYHGDQAADTLADFFTKCKEDPSHWDEISKGGLQRIEEKYTWQ  756

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLA  342
            IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA
Sbjct  757  IYSQRLLTLTGVYGFWKHVSNLDRLEARRYLEMFYALKYRPLAQAVPLA  805



>ref|NP_197583.1| sucrose synthase 1 [Arabidopsis thaliana]
 ref|NP_001031915.1| sucrose synthase 1 [Arabidopsis thaliana]
 sp|P49040.3|SUSY1_ARATH RecName: Full=Sucrose synthase 1; Short=AtSUS1; AltName: Full=Sucrose-UDP 
glucosyltransferase 1 [Arabidopsis thaliana]
 dbj|BAH19538.1| AT5G20830 [Arabidopsis thaliana]
 gb|AED92894.1| sucrose synthase 1 [Arabidopsis thaliana]
 gb|AED92895.1| sucrose synthase 1 [Arabidopsis thaliana]
Length=808

 Score =   195 bits (496),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG+QAA+ L DFF KCK+DPSHW+ IS GGL+RI+EKYTWQ
Sbjct  697  GGPAEIIVHGKSGFHIDPYHGDQAADTLADFFTKCKEDPSHWDEISKGGLQRIEEKYTWQ  756

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLA  342
            IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA
Sbjct  757  IYSQRLLTLTGVYGFWKHVSNLDRLEARRYLEMFYALKYRPLAQAVPLA  805



>ref|XP_010247458.1| PREDICTED: sucrose synthase [Nelumbo nucifera]
 ref|XP_010247459.1| PREDICTED: sucrose synthase [Nelumbo nucifera]
 ref|XP_010247460.1| PREDICTED: sucrose synthase [Nelumbo nucifera]
Length=806

 Score =   195 bits (496),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG++AAELLV+FFEK K+DP++WE IS GGL+RI EKYTWQ
Sbjct  695  GGPAEIIVHGKSGFHIDPYHGDRAAELLVNFFEKSKEDPTYWEKISQGGLQRIHEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RL+TLA VYGFWK+VSKLDR E RRYLEMFYALK+RKLAE VPLA+E
Sbjct  755  IYSGRLMTLAGVYGFWKYVSKLDRRETRRYLEMFYALKYRKLAEMVPLAVE  805



>ref|XP_010271909.1| PREDICTED: sucrose synthase [Nelumbo nucifera]
Length=806

 Score =   195 bits (496),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPY G++AAELLV FFEKCK+DPSHWE IS GGLKRI EKYTWQ
Sbjct  695  GGPAEIIVHGKSGFHIDPYQGDRAAELLVHFFEKCKEDPSHWEKISQGGLKRIHEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS+RL+TL+ VYGFWK+VSKL+R E RRYLEMFYALK+RKLA+ VPLA++
Sbjct  755  IYSERLMTLSGVYGFWKYVSKLERRETRRYLEMFYALKYRKLAQMVPLAVD  805



>ref|XP_010520519.1| PREDICTED: sucrose synthase 4-like [Tarenaya hassleriana]
Length=807

 Score =   195 bits (496),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 99/111 (89%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIV+GKSGFHIDPYHG+QAAE+L DFF KCK+DPSHW+ IS GGL+RI+EKYTWQ
Sbjct  696  GGPAEIIVNGKSGFHIDPYHGDQAAEILADFFAKCKEDPSHWDEISHGGLQRIEEKYTWQ  755

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  756  IYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRPLAQAVPLAQE  806



>ref|XP_003533802.1| PREDICTED: sucrose synthase-like isoform X1 [Glycine max]
 ref|XP_006587064.1| PREDICTED: sucrose synthase-like isoform X2 [Glycine max]
Length=806

 Score =   195 bits (496),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 99/111 (89%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSG+HIDPYHG+ AAE+LV+FFEK K DPSHW+ IS GGLKRI EKYTWQ
Sbjct  695  GGPAEIIVHGKSGYHIDPYHGDHAAEILVEFFEKSKADPSHWDKISQGGLKRIHEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYSDRLLTL  VYGFWKHV+ L+R E +RYLEMFYALK+RKLAE VPLAIE
Sbjct  755  IYSDRLLTLTGVYGFWKHVTNLERRESKRYLEMFYALKYRKLAESVPLAIE  805



>ref|NP_566865.2| sucrose synthase 4 [Arabidopsis thaliana]
 sp|Q9LXL5.1|SUS4_ARATH RecName: Full=Sucrose synthase 4; Short=AtSUS4; AltName: Full=Sucrose-UDP 
glucosyltransferase 4 [Arabidopsis thaliana]
 emb|CAB89040.1| sucrose synthase-like protein [Arabidopsis thaliana]
 gb|AEE77773.1| sucrose synthase 4 [Arabidopsis thaliana]
Length=808

 Score =   195 bits (496),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 97/111 (87%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG++AAE L DFF KCK DPSHW+ IS GGL+RIQEKYTWQ
Sbjct  697  GGPAEIIVHGKSGFHIDPYHGDKAAESLADFFTKCKHDPSHWDQISLGGLERIQEKYTWQ  756

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  757  IYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRPLAQAVPLAHE  807



>ref|XP_009131818.1| PREDICTED: sucrose synthase 1 [Brassica rapa]
Length=806

 Score =   195 bits (495),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG+QAA+ L DFF KCK+DPSHW+ IS GGL+RI+EKYTWQ
Sbjct  695  GGPAEIIVHGKSGFHIDPYHGDQAADTLADFFTKCKEDPSHWDEISKGGLQRIEEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  755  IYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRPLAKAVPLAEE  805



>gb|KHN47619.1| Sucrose synthase [Glycine soja]
Length=806

 Score =   195 bits (495),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 99/111 (89%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSG+HIDPYHG+ AAE+LV+FFEK K DPSHW+ IS GGLKRI EKYTWQ
Sbjct  695  GGPAEIIVHGKSGYHIDPYHGDHAAEILVEFFEKSKADPSHWDKISQGGLKRIHEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYSDRLLTL  VYGFWKHV+ L+R E +RYLEMFYALK+RKLAE VPLAIE
Sbjct  755  IYSDRLLTLTGVYGFWKHVTNLERRESKRYLEMFYALKYRKLAESVPLAIE  805



>ref|XP_002516210.1| sucrose synthase, putative [Ricinus communis]
 gb|EEF46212.1| sucrose synthase, putative [Ricinus communis]
Length=773

 Score =   194 bits (494),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 99/111 (89%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGF+IDPYHG+QAAELLV+FFEKCK DP  W+ IS GGL+RIQEKYTWQ
Sbjct  663  GGPAEIIVHGKSGFNIDPYHGDQAAELLVEFFEKCKADPCVWDEISKGGLQRIQEKYTWQ  722

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVSKLDR E RRYLEMFYALK++KLA+ VPL +E
Sbjct  723  IYSQRLLTLTGVYGFWKHVSKLDRRESRRYLEMFYALKYKKLADSVPLTVE  773



>sp|Q01390.1|SUSY_VIGRR RecName: Full=Sucrose synthase; AltName: Full=Sucrose-UDP glucosyltransferase 
[Vigna radiata var. radiata]
 dbj|BAA01108.1| sucrose synthase [Vigna radiata var. radiata]
Length=805

 Score =   195 bits (495),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 99/111 (89%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG++AA+LLV+FFEK K DPSHW+ IS  GL+RI+EKYTWQ
Sbjct  695  GGPAEIIVHGKSGFHIDPYHGDRAADLLVEFFEKVKVDPSHWDKISQAGLQRIEEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKLAE VPLA+E
Sbjct  755  IYSQRLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLAESVPLAVE  805



>gb|ADW80603.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   194 bits (494),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693  GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  752

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFW+HVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753  IYSQRLLTLTGVYGFWEHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|AII19313.1| sucrose synthase 1, partial [Ricinus communis]
Length=805

 Score =   194 bits (494),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 99/111 (89%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGF+IDPYHG+QAAELLV+FFEKCK DP  W+ IS GGL+RIQEKYTWQ
Sbjct  695  GGPAEIIVHGKSGFNIDPYHGDQAAELLVEFFEKCKADPCVWDEISKGGLQRIQEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVSKLDR E RRYLEMFYALK++KLA+ VPL +E
Sbjct  755  IYSQRLLTLTGVYGFWKHVSKLDRRESRRYLEMFYALKYKKLADSVPLTVE  805



>ref|XP_006287059.1| hypothetical protein CARUB_v10000208mg, partial [Capsella rubella]
 gb|EOA19957.1| hypothetical protein CARUB_v10000208mg, partial [Capsella rubella]
Length=850

 Score =   195 bits (495),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG+QAA+ L DFF KCK+DPSHW+ IS GGL+RI+EKYTWQ
Sbjct  739  GGPAEIIVHGKSGFHIDPYHGDQAADTLADFFTKCKEDPSHWDEISLGGLQRIEEKYTWQ  798

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLA  342
            IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA
Sbjct  799  IYSQRLLTLTGVYGFWKHVSNLDRLEARRYLEMFYALKYRPLAQAVPLA  847



>emb|CDX88838.1| BnaA03g08110D [Brassica napus]
Length=743

 Score =   194 bits (493),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG+QAA+ L DFF KCK+DPSHW+ IS GGL+RI+EKYTWQ
Sbjct  632  GGPAEIIVHGKSGFHIDPYHGDQAADTLADFFTKCKEDPSHWDEISKGGLQRIEEKYTWQ  691

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  692  IYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRPLAKAVPLAEE  742



>gb|EYU25805.1| hypothetical protein MIMGU_mgv1a001207mg [Erythranthe guttata]
Length=866

 Score =   195 bits (495),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIV G SGFHIDPY+GE  AE+L+ FFEKC KDPSHWE IS GGLKRI+EKYTWQ
Sbjct  756  GGPAEIIVDGISGFHIDPYNGESVAEILIGFFEKCTKDPSHWEAISTGGLKRIREKYTWQ  815

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS+RLL LA VYGFWK+VSKLDRLEI+RYLEM YALK RKLAE VPLA+E
Sbjct  816  IYSERLLNLAGVYGFWKYVSKLDRLEIKRYLEMLYALKLRKLAEAVPLAVE  866



>gb|AGQ57012.1| sucrose synthase 1 [Hevea brasiliensis]
Length=806

 Score =   194 bits (494),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 96/111 (86%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGK GF+IDPYHG QAAELLVDFFEK K DPSHW  IS G ++RIQEKYTWQ
Sbjct  695  GGPAEIIVHGKPGFNIDPYHGGQAAELLVDFFEKSKADPSHWNNISRGAMQRIQEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVSKLDR E RRYLEMFYALK+RKLAE VPL +E
Sbjct  755  IYSQRLLTLTGVYGFWKHVSKLDRRESRRYLEMFYALKYRKLAESVPLTVE  805



>gb|ADW80599.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   194 bits (494),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 97/111 (87%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693  GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  752

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LD  E RRYLEMFYALK+RKLA+  PL IE
Sbjct  753  IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEMFYALKYRKLADSAPLTIE  803



>gb|AFI57908.1| sucrose synthase 1 [Prunus persica]
Length=806

 Score =   194 bits (494),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 99/111 (89%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSG+HIDPYHG+QAA++LVDFFEK + DPSHW+ IS GGL+RI EKYTWQ
Sbjct  695  GGPAEIIVHGKSGYHIDPYHGDQAADILVDFFEKSRADPSHWDKISQGGLQRIYEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS+RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VP A E
Sbjct  755  IYSERLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPRAEE  805



>dbj|BAH56282.1| sucrose synthase [Vigna angularis]
Length=805

 Score =   194 bits (494),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 99/111 (89%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG++AA+LLV+FFEK K DPSHW+ IS  GL+RI+EKYTWQ
Sbjct  695  GGPAEIIVHGKSGFHIDPYHGDRAADLLVEFFEKVKVDPSHWDKISEAGLQRIEEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LDR E RRYLEMFYALK+RKLAE VPLA+E
Sbjct  755  IYSQRLLTLTGVYGFWKHVSNLDRRESRRYLEMFYALKYRKLAESVPLAVE  805



>ref|XP_008382924.1| PREDICTED: sucrose synthase-like [Malus domestica]
Length=807

 Score =   194 bits (494),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIV+GKSG+HIDPYHG+QAAE+ VDFFEK K DPSHW+ IS GGL+RI EKYTWQ
Sbjct  696  GGPAEIIVNGKSGYHIDPYHGDQAAEIJVDFFEKNKADPSHWDKISQGGLQRIYEKYTWQ  755

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS+RLLTL  VYGFWK VS LDRLE RRYLEMFYALKFRKLA  VPLA+E
Sbjct  756  IYSERLLTLTGVYGFWKDVSNLDRLESRRYLEMFYALKFRKLAASVPLAVE  806



>ref|XP_007204649.1| hypothetical protein PRUPE_ppa001535mg [Prunus persica]
 ref|XP_007204650.1| hypothetical protein PRUPE_ppa001535mg [Prunus persica]
 gb|EMJ05848.1| hypothetical protein PRUPE_ppa001535mg [Prunus persica]
 gb|EMJ05849.1| hypothetical protein PRUPE_ppa001535mg [Prunus persica]
Length=806

 Score =   194 bits (494),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 99/111 (89%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSG+HIDPYHG+QAA++LVDFFEK + DPSHW+ IS GGL+RI EKYTWQ
Sbjct  695  GGPAEIIVHGKSGYHIDPYHGDQAADILVDFFEKSRADPSHWDKISQGGLQRIYEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS+RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VP A E
Sbjct  755  IYSERLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPRAEE  805



>gb|ADW80579.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   194 bits (494),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 97/111 (87%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693  GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWR  752

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKH S LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  753  IYSQRLLTLTGVYGFWKHASNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>ref|XP_008242292.1| PREDICTED: sucrose synthase [Prunus mume]
 ref|XP_008242293.1| PREDICTED: sucrose synthase [Prunus mume]
Length=806

 Score =   194 bits (494),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 99/111 (89%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSG+HIDPYHG+QAA++LVDFFEK + DPSHW+ IS GGL+RI EKYTWQ
Sbjct  695  GGPAEIIVHGKSGYHIDPYHGDQAADILVDFFEKSRADPSHWDKISQGGLQRIYEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS+RLLTL  VYGFWKHVS LDRLE RRYLEMFYALK+RKLAE VP A E
Sbjct  755  IYSERLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPRAEE  805



>ref|XP_008349074.1| PREDICTED: sucrose synthase-like [Malus domestica]
Length=807

 Score =   194 bits (494),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIV+GKSG+HIDPYHG+QAAE+ VDFFEK K DPSHW+ IS GGL+RI EKYTWQ
Sbjct  696  GGPAEIIVNGKSGYHIDPYHGDQAAEIJVDFFEKNKADPSHWDKISQGGLQRIYEKYTWQ  755

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS+RLLTL  VYGFWK VS LDRLE RRYLEMFYALKFRKLA  VPLA+E
Sbjct  756  IYSERLLTLTGVYGFWKDVSNLDRLESRRYLEMFYALKFRKLAASVPLAVE  806



>gb|ACP17902.1| sucrose synthase [Phaseolus vulgaris]
Length=806

 Score =   194 bits (493),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 99/111 (89%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIV GKSG+HIDPYHG++AAE+LVDFFEK K DPSHWE IS GGLKRIQEKYTWQ
Sbjct  695  GGPAEIIVDGKSGYHIDPYHGDRAAEILVDFFEKSKADPSHWEKISQGGLKRIQEKYTWQ  754

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            +YSDRLLTL  VYGFWKHV+ L+R E +R LEMFYALK+RKLAE VPLAIE
Sbjct  755  VYSDRLLTLTGVYGFWKHVTNLERRESKRSLEMFYALKYRKLAESVPLAIE  805



>gb|ADW80577.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   194 bits (493),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -2

Query  668  GGPAEIIVHGKSGFHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQ  489
            GGPAEIIVHGKSGFHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+
Sbjct  693  GGPAEIIVHGKSGFHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWK  752

Query  488  IYSDRLLTLASVYGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  336
            IYS RLLTL  VYGFWKHVS LD  E RRYLE+FYALK+RKLA+ VPL IE
Sbjct  753  IYSQRLLTLTGVYGFWKHVSNLDHRESRRYLEVFYALKYRKLADSVPLTIE  803



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1273595176425