BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF009I17

Length=735
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004235755.1|  PREDICTED: AP-3 complex subunit delta              179   1e-47   Solanum lycopersicum
ref|XP_006341581.1|  PREDICTED: AP-3 complex subunit delta-like         179   2e-47   Solanum tuberosum [potatoes]
ref|XP_009624654.1|  PREDICTED: AP-3 complex subunit delta              178   4e-47   Nicotiana tomentosiformis
ref|XP_009763005.1|  PREDICTED: AP-3 complex subunit delta              176   2e-46   Nicotiana sylvestris
ref|XP_007036565.1|  Delta-adaptin                                      153   2e-38   
ref|XP_010663613.1|  PREDICTED: AP-3 complex subunit delta isofor...    150   1e-37   Vitis vinifera
ref|XP_010663612.1|  PREDICTED: AP-3 complex subunit delta isofor...    150   2e-37   Vitis vinifera
ref|XP_006442618.1|  hypothetical protein CICLE_v10018705mg             148   1e-36   Citrus clementina [clementine]
gb|KDO45340.1|  hypothetical protein CISIN_1g040316mg                   146   4e-36   Citrus sinensis [apfelsine]
ref|XP_002524910.1|  conserved hypothetical protein                     144   4e-35   
ref|XP_006485818.1|  PREDICTED: AP-3 complex subunit delta-like         144   4e-35   Citrus sinensis [apfelsine]
ref|XP_002321481.2|  hypothetical protein POPTR_0015s03830g             141   3e-34   
emb|CBI15478.3|  unnamed protein product                                137   7e-33   Vitis vinifera
emb|CDO98419.1|  unnamed protein product                                136   2e-32   Coffea canephora [robusta coffee]
ref|XP_011008310.1|  PREDICTED: AP-3 complex subunit delta              135   3e-32   Populus euphratica
ref|XP_011096988.1|  PREDICTED: AP-3 complex subunit delta isofor...    135   3e-32   
ref|XP_011096987.1|  PREDICTED: AP-3 complex subunit delta isofor...    135   3e-32   Sesamum indicum [beniseed]
ref|XP_011096986.1|  PREDICTED: AP-3 complex subunit delta isofor...    135   4e-32   
gb|KJB52993.1|  hypothetical protein B456_008G287400                    134   5e-32   Gossypium raimondii
gb|KJB52992.1|  hypothetical protein B456_008G287400                    134   8e-32   Gossypium raimondii
ref|XP_002318543.2|  delta-adaptin family protein                       130   3e-30   
ref|XP_010036902.1|  PREDICTED: AP-3 complex subunit delta              129   5e-30   Eucalyptus grandis [rose gum]
gb|KDP20144.1|  hypothetical protein JCGZ_05913                         129   5e-30   Jatropha curcas
ref|XP_011045833.1|  PREDICTED: AP-3 complex subunit delta-like         128   9e-30   Populus euphratica
ref|XP_004512869.1|  PREDICTED: AP-3 complex subunit delta-like         127   2e-29   Cicer arietinum [garbanzo]
ref|XP_010094731.1|  AP-3 complex subunit delta                         125   1e-28   Morus notabilis
ref|XP_010246461.1|  PREDICTED: AP-3 complex subunit delta              123   5e-28   Nelumbo nucifera [Indian lotus]
ref|XP_003630870.1|  AP-3 complex subunit delta-1                       122   8e-28   Medicago truncatula
gb|KHN21597.1|  AP-3 complex subunit delta                              117   5e-26   Glycine soja [wild soybean]
ref|XP_006580434.1|  PREDICTED: AP-3 complex subunit delta-like         117   5e-26   Glycine max [soybeans]
ref|XP_004300510.1|  PREDICTED: AP-3 complex subunit delta              115   3e-25   Fragaria vesca subsp. vesca
ref|XP_007160391.1|  hypothetical protein PHAVU_002G317900g             115   3e-25   Phaseolus vulgaris [French bean]
ref|XP_009360139.1|  PREDICTED: AP-3 complex subunit delta-like         115   4e-25   Pyrus x bretschneideri [bai li]
ref|XP_010694398.1|  PREDICTED: AP-3 complex subunit delta              114   9e-25   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009396369.1|  PREDICTED: AP-3 complex subunit delta-like         112   4e-24   
ref|XP_010922047.1|  PREDICTED: LOW QUALITY PROTEIN: AP-3 complex...    112   5e-24   
ref|XP_008393324.1|  PREDICTED: AP-3 complex subunit delta-like         111   5e-24   
ref|XP_008797681.1|  PREDICTED: LOW QUALITY PROTEIN: AP-3 complex...    108   8e-23   
ref|XP_007210401.1|  hypothetical protein PRUPE_ppa000873mg             108   8e-23   Prunus persica
ref|XP_008240244.1|  PREDICTED: AP-3 complex subunit delta              107   2e-22   Prunus mume [ume]
ref|XP_008459026.1|  PREDICTED: AP-3 complex subunit delta              104   1e-21   Cucumis melo [Oriental melon]
gb|EYU19013.1|  hypothetical protein MIMGU_mgv1a018800mg                103   2e-21   Erythranthe guttata [common monkey flower]
ref|XP_004137481.1|  PREDICTED: AP-3 complex subunit delta-like         100   3e-20   Cucumis sativus [cucumbers]
ref|XP_009347324.1|  PREDICTED: AP-3 complex subunit delta-like       98.6    1e-19   Pyrus x bretschneideri [bai li]
ref|XP_010907010.1|  PREDICTED: AP-3 complex subunit delta-like       98.2    2e-19   Elaeis guineensis
ref|XP_008374775.1|  PREDICTED: AP-3 complex subunit delta-like       95.1    2e-18   Malus domestica [apple tree]
ref|XP_008792886.1|  PREDICTED: AP-3 complex subunit delta            92.0    2e-17   
ref|XP_006842352.1|  hypothetical protein AMTR_s00079p00176010        90.9    5e-17   Amborella trichopoda
ref|XP_009395567.1|  PREDICTED: AP-3 complex subunit delta-like       82.4    3e-14   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN33887.1|  Tubby-like F-box protein 8                            77.4    2e-13   Glycine soja [wild soybean]
gb|KHN16547.1|  AP-3 complex subunit delta                            74.3    8e-12   Glycine soja [wild soybean]
ref|XP_006584869.1|  PREDICTED: AP-3 complex subunit delta-like i...  74.3    1e-11   
ref|XP_002442304.1|  hypothetical protein SORBIDRAFT_08g017720        67.0    2e-09   
ref|XP_008662607.1|  PREDICTED: AP-3 complex subunit delta-like       66.6    3e-09   Zea mays [maize]
ref|XP_010549108.1|  PREDICTED: AP-3 complex subunit delta            62.0    1e-07   Tarenaya hassleriana [spider flower]
ref|XP_008672722.1|  PREDICTED: uncharacterized protein LOC100279...  62.0    1e-07   
ref|XP_004968829.1|  PREDICTED: AP-3 complex subunit delta-like       61.2    2e-07   Setaria italica
ref|NP_175308.1|  AP-3 complex subunit delta                          56.6    2e-06   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001146284.1|  uncharacterized protein LOC100279859             57.0    5e-06   
ref|NP_001043177.2|  Os01g0512200                                     55.8    7e-06   
gb|EEC70747.1|  hypothetical protein OsI_02156                        55.5    2e-05   Oryza sativa Indica Group [Indian rice]
dbj|BAD73073.1|  AP-3 complex delta subunit-like protein              55.5    2e-05   Oryza sativa Japonica Group [Japonica rice]
gb|EEE54678.1|  hypothetical protein OsJ_01979                        54.7    4e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002894132.1|  delta-adaptin                                    51.2    6e-05   
ref|XP_006296990.1|  hypothetical protein CARUB_v10012984mg           53.1    9e-05   Capsella rubella
ref|XP_010506684.1|  PREDICTED: AP-3 complex subunit delta-like       51.2    1e-04   
gb|KFK39167.1|  hypothetical protein AALP_AA3G208900                  50.4    8e-04   Arabis alpina [alpine rockcress]



>ref|XP_004235755.1| PREDICTED: AP-3 complex subunit delta [Solanum lycopersicum]
Length=970

 Score =   179 bits (455),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 124/205 (60%), Positives = 148/205 (72%), Gaps = 9/205 (4%)
 Frame = -1

Query  711  LYYLPSQKKETVSDDYPPANDPCMGDA--DNTEDLIKLTEQSFLPKNKPNQAKPRPVVVK  538
            LYYL SQKKE   DDYPPAND   G+   D  +DLIKLTEQS   K K NQAKPRPVVVK
Sbjct  766  LYYLQSQKKEMAYDDYPPANDLKTGENADDEADDLIKLTEQSLFSKKKANQAKPRPVVVK  825

Query  537  LDDVDGTHFPAKKLDSKDDLISGAIRDVLLGNDDVAstsrskkpekssskrreknkstRD  358
            LDD DG   PAKK++SKDDLISGA+RDVLLG++   S+SR+KK +KSSSKRR+K+K   D
Sbjct  826  LDDGDGPFIPAKKVESKDDLISGAVRDVLLGDEATTSSSRAKKSDKSSSKRRQKDKLDVD  885

Query  357  KPSELIDNLGNIKSS--EEVGSGRTKHRSRGKEGKNKS--KDRGEYNQGEKQ---HSHGR  199
            K S  I++   +++S  E V   R+K  SRGKE K++S  KDR E+ +G+KQ   H HG+
Sbjct  886  KSSGPIEDSKMMENSELENVNLRRSKRHSRGKEKKHRSTAKDRNEHEEGDKQKVSHHHGK  945

Query  198  HKSRHRADRATFLEAQSSVIPDFLL  124
            HKSR RAD A  L AQS VIPDFLL
Sbjct  946  HKSRQRADGALTLAAQSPVIPDFLL  970



>ref|XP_006341581.1| PREDICTED: AP-3 complex subunit delta-like [Solanum tuberosum]
Length=970

 Score =   179 bits (454),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 123/205 (60%), Positives = 149/205 (73%), Gaps = 9/205 (4%)
 Frame = -1

Query  711  LYYLPSQKKETVSDDYPPANDPCMGDA--DNTEDLIKLTEQSFLPKNKPNQAKPRPVVVK  538
            LYYL SQKKE V DDYPPAND   GD   D  +DLIKLTEQS   K K NQAKPRPVVVK
Sbjct  766  LYYLQSQKKEMVYDDYPPANDLKTGDNADDEADDLIKLTEQSLFSKKKVNQAKPRPVVVK  825

Query  537  LDDVDGTHFPAKKLDSKDDLISGAIRDVLLGNDDVAstsrskkpekssskrreknkstRD  358
            LDD DG   PAKK++SKDDLISGA+RDVLLG++   S+SR++K +KSSSKRR+K+K   D
Sbjct  826  LDDGDGPFIPAKKVESKDDLISGAVRDVLLGDEATTSSSRTRKSDKSSSKRRQKDKLDID  885

Query  357  KPSELIDNLGNIKSSEEVGSG--RTKHRSRGKEGKNKS--KDRGEYNQGEKQ---HSHGR  199
            K S   ++   +++SE+  +   R+K  SRGKE K++S  KDR E+ +G+KQ   H HG+
Sbjct  886  KSSGPKEDSKMMENSEQDNANLRRSKRHSRGKEKKHRSTAKDRDEHEEGDKQKVSHHHGK  945

Query  198  HKSRHRADRATFLEAQSSVIPDFLL  124
            HKSR RAD A  L AQS VIPDFLL
Sbjct  946  HKSRQRADGALTLAAQSPVIPDFLL  970



>ref|XP_009624654.1| PREDICTED: AP-3 complex subunit delta [Nicotiana tomentosiformis]
Length=971

 Score =   178 bits (451),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 122/205 (60%), Positives = 151/205 (74%), Gaps = 9/205 (4%)
 Frame = -1

Query  711  LYYLPSQKKETVSDDYPPANDPCMGDA--DNTEDLIKLTEQSFLPKNKPNQAKPRPVVVK  538
            LYYL SQKKET++D+YPPAND   G+   D  +DLIKLTEQS  PK K NQAKPRPVVVK
Sbjct  767  LYYLQSQKKETINDEYPPANDLKTGENADDKADDLIKLTEQSLFPKKKTNQAKPRPVVVK  826

Query  537  LDDVDGTHFPAKKLDSKDDLISGAIRDVLLGNDDVAstsrskkpekssskrreknkstRD  358
            LDD DG   PAKK+DSKDDLISGA+RDVL G++  AS+SR+KK +KSSSKRR+K+K   D
Sbjct  827  LDDGDGPFIPAKKVDSKDDLISGAVRDVLFGDEATASSSRTKKSDKSSSKRRQKDKLDID  886

Query  357  KPSELIDNLGNIKSSEEVGSG--RTKHRSRGKEGKNKS--KDRGEYNQGEKQ---HSHGR  199
            K S   ++   +++SE   +   R+K  SRGKE K++S  KD+ E+ +G+KQ   H HG+
Sbjct  887  KSSGPKEDSKFMENSELENANLRRSKRHSRGKEKKHRSNAKDKDEHEEGDKQKVSHHHGK  946

Query  198  HKSRHRADRATFLEAQSSVIPDFLL  124
            HKSR RA+ A  L AQS VIPDFLL
Sbjct  947  HKSRQRAEGALTLAAQSPVIPDFLL  971



>ref|XP_009763005.1| PREDICTED: AP-3 complex subunit delta [Nicotiana sylvestris]
Length=971

 Score =   176 bits (445),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 121/205 (59%), Positives = 150/205 (73%), Gaps = 9/205 (4%)
 Frame = -1

Query  711  LYYLPSQKKETVSDDYPPANDPCMGDA--DNTEDLIKLTEQSFLPKNKPNQAKPRPVVVK  538
            LYYL SQKKE+++D+YPPAND   G+   D  +DLIKLTEQS  PK K NQAKPRPVVVK
Sbjct  767  LYYLQSQKKESINDEYPPANDLKTGENADDKADDLIKLTEQSLFPKKKTNQAKPRPVVVK  826

Query  537  LDDVDGTHFPAKKLDSKDDLISGAIRDVLLGNDDVAstsrskkpekssskrreknkstRD  358
            LDD DG   P KK+DSKDDLISGA+RDVL G++  AS+SR+KK +KSSSKRR+K+K   D
Sbjct  827  LDDGDGPFIPIKKVDSKDDLISGAVRDVLFGDEATASSSRTKKSDKSSSKRRQKDKLDID  886

Query  357  KPSELIDNLGNIKSSEEVGSG--RTKHRSRGKEGKNKS--KDRGEYNQGEKQ---HSHGR  199
            K S   ++   +++SE   +   R+K  SRGKE K++S  KDR E+ +G+KQ   H HG+
Sbjct  887  KSSGPKEDSKFMENSELENANLRRSKRHSRGKEKKHRSNAKDRDEHEEGDKQKVSHHHGK  946

Query  198  HKSRHRADRATFLEAQSSVIPDFLL  124
            HKSR RA+ A  L AQS VIPDFLL
Sbjct  947  HKSRQRAEGALTLAAQSPVIPDFLL  971



>ref|XP_007036565.1| Delta-adaptin [Theobroma cacao]
 gb|EOY21066.1| Delta-adaptin [Theobroma cacao]
Length=941

 Score =   153 bits (386),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 97/207 (47%), Positives = 125/207 (60%), Gaps = 13/207 (6%)
 Frame = -1

Query  711  LYYLPSQKKETVSDDYPPANDPC-MGDA-DNTEDLIKLTEQSFLPKNKPNQAKPRPVVVK  538
            LYYLPS K E +S+DYPPANDP   G+  DN++DL KLTE+S  PK KPN AKPRPVVVK
Sbjct  737  LYYLPSGKSEIISNDYPPANDPTSQGNVNDNSDDLAKLTEESLFPKKKPNHAKPRPVVVK  796

Query  537  LDDVDGTHFPAKKLDSKDDLISGAIRDVLLGNDDVAstsrskkpekssskrreknkstRD  358
            LD+VD      KK ++KDD +SGA+RD+LLG++DV  TS         S +R   +    
Sbjct  797  LDEVDEKPIAMKKPEAKDDSLSGAVRDILLGSEDVIPTSSRSNLSGKPSSKRRGKEKQDT  856

Query  357  KPSELIDNLGNIKSSEEVGSGRTKHRSRGKEGKNKS---------KDRGEYNQGEKQHSH  205
             P   +++  N+       S R KH S GKE ++KS         +D G+  + +  H H
Sbjct  857  DPH--VESKENLVDDGNPSSRRRKHHSHGKERRHKSPRKKNAEEREDNGQKEKEKSSHRH  914

Query  204  GRHKSRHRADRATFLEAQSSVIPDFLL  124
            GRHKSR RAD    +  Q+ VIPDFLL
Sbjct  915  GRHKSRRRADELLNVSPQTPVIPDFLL  941



>ref|XP_010663613.1| PREDICTED: AP-3 complex subunit delta isoform X2 [Vitis vinifera]
Length=831

 Score =   150 bits (379),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 110/209 (53%), Positives = 140/209 (67%), Gaps = 16/209 (8%)
 Frame = -1

Query  711  LYYLPSQKKETVSDDYPPANDPCMGDA--DNTEDLIKLTEQSFLPKNKPNQAKPRPVVVK  538
            LYYLPS+K + VS+DYPPANDP + D   D+ +DL+KLTEQS L K KPN AKPRPVVVK
Sbjct  626  LYYLPSEKND-VSNDYPPANDPKLQDNLNDDAKDLVKLTEQSLLQKKKPNHAKPRPVVVK  684

Query  537  LDDVDGTHFPAKKLDSKDDLISGAIRDVLLGNDDVAstsrskkpekssskrreknkstRD  358
            LD+ D     AKKL+ K+DL+SGA+RDVLLGN+ V+ TS+S   +KSSSKRR K K   D
Sbjct  685  LDEGDEAPIAAKKLELKEDLLSGAVRDVLLGNEAVS-TSQSNLTDKSSSKRRGKEKLNTD  743

Query  357  KPS---ELIDNLGNIKSSEEVGSGRTKHRSRGKEGKNKS-----KDRGEYNQGEKQ---H  211
             PS   E++ ++GN        S R+KH   GKE +++S     K+R E  Q +KQ   H
Sbjct  744  HPSGPKEVLGDVGNPNMGNP-SSRRSKHHGHGKERRHRSPRKKEKEREENGQKDKQKSSH  802

Query  210  SHGRHKSRHRADRATFLEAQSSVIPDFLL  124
             H RHKSR RA+    +  Q+ +IPDFLL
Sbjct  803  RHNRHKSRQRAEGPNNVVTQTPLIPDFLL  831



>ref|XP_010663612.1| PREDICTED: AP-3 complex subunit delta isoform X1 [Vitis vinifera]
Length=964

 Score =   150 bits (379),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 110/209 (53%), Positives = 140/209 (67%), Gaps = 16/209 (8%)
 Frame = -1

Query  711  LYYLPSQKKETVSDDYPPANDPCMGDA--DNTEDLIKLTEQSFLPKNKPNQAKPRPVVVK  538
            LYYLPS+K + VS+DYPPANDP + D   D+ +DL+KLTEQS L K KPN AKPRPVVVK
Sbjct  759  LYYLPSEKND-VSNDYPPANDPKLQDNLNDDAKDLVKLTEQSLLQKKKPNHAKPRPVVVK  817

Query  537  LDDVDGTHFPAKKLDSKDDLISGAIRDVLLGNDDVAstsrskkpekssskrreknkstRD  358
            LD+ D     AKKL+ K+DL+SGA+RDVLLGN+ V+ TS+S   +KSSSKRR K K   D
Sbjct  818  LDEGDEAPIAAKKLELKEDLLSGAVRDVLLGNEAVS-TSQSNLTDKSSSKRRGKEKLNTD  876

Query  357  KPS---ELIDNLGNIKSSEEVGSGRTKHRSRGKEGKNKS-----KDRGEYNQGEKQ---H  211
             PS   E++ ++GN        S R+KH   GKE +++S     K+R E  Q +KQ   H
Sbjct  877  HPSGPKEVLGDVGNPNMGNP-SSRRSKHHGHGKERRHRSPRKKEKEREENGQKDKQKSSH  935

Query  210  SHGRHKSRHRADRATFLEAQSSVIPDFLL  124
             H RHKSR RA+    +  Q+ +IPDFLL
Sbjct  936  RHNRHKSRQRAEGPNNVVTQTPLIPDFLL  964



>ref|XP_006442618.1| hypothetical protein CICLE_v10018705mg [Citrus clementina]
 gb|ESR55858.1| hypothetical protein CICLE_v10018705mg [Citrus clementina]
Length=978

 Score =   148 bits (374),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 103/208 (50%), Positives = 129/208 (62%), Gaps = 13/208 (6%)
 Frame = -1

Query  711  LYYLPSQKKETVSDDYPPANDPCMGDA--DNTEDLIKLTEQSFLPKNKPNQAKPRPVVVK  538
            LYYL S+K E  S+DYPPANDP   D   D+ EDL+KLTEQS  PK KPNQAKPRPVV+K
Sbjct  772  LYYLASEKSEVASNDYPPANDPMSQDKLNDDAEDLLKLTEQSLAPKKKPNQAKPRPVVLK  831

Query  537  LDDVDGTHFPAKKLDSKDDLISGAIRDVLLGNDDVAstsrskkpekssskrreknkstRD  358
            LD  D     AKK + KDDL+SG ++DVLLGND V S+SRS + E  S K + K K   D
Sbjct  832  LDG-DEISVAAKKPELKDDLLSGVVQDVLLGNDGVPSSSRSNRSENLSGKSKGKEKLNTD  890

Query  357  KPSELIDNLGNIKSSEEV--GSGRTKHRSRGKEGKNKSK--------DRGEYNQGEKQHS  208
               E  +N+   K  + V   S R+KHRS GKE + K +        D G+  + +  H 
Sbjct  891  LSLETKENVPGEKMPDHVNTSSRRSKHRSHGKERRQKGQGKDGEEKEDNGQKEKRKSNHH  950

Query  207  HGRHKSRHRADRATFLEAQSSVIPDFLL  124
             G+HK+  RAD  + + AQ+ VIPDFLL
Sbjct  951  RGKHKAHQRADEPSNVVAQTPVIPDFLL  978



>gb|KDO45340.1| hypothetical protein CISIN_1g040316mg [Citrus sinensis]
Length=957

 Score =   146 bits (369),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 103/208 (50%), Positives = 129/208 (62%), Gaps = 13/208 (6%)
 Frame = -1

Query  711  LYYLPSQKKETVSDDYPPANDPCMGDA--DNTEDLIKLTEQSFLPKNKPNQAKPRPVVVK  538
            LYYL S+K E  S+DYPPANDP   D   D+ EDL+KLTEQS  PK KPNQAKPRPVV+K
Sbjct  751  LYYLASEKSEGASNDYPPANDPMSQDKLNDDAEDLLKLTEQSLAPKKKPNQAKPRPVVLK  810

Query  537  LDDVDGTHFPAKKLDSKDDLISGAIRDVLLGNDDVAstsrskkpekssskrreknkstRD  358
            LD  D     AKK + KDDL+SG ++DVLLGND V S+SRS + E  S K + K K + D
Sbjct  811  LDG-DEISVAAKKPELKDDLLSGVVQDVLLGNDGVPSSSRSNRSENLSGKSKGKEKLSTD  869

Query  357  KPSELIDNLGNIKSSEEV--GSGRTKHRSRGKEGKNKSK--------DRGEYNQGEKQHS  208
               E  +N+   K  + V   S R+KHRS GKE + K +        D G+  + +  H 
Sbjct  870  LSLETKENVPGEKMPDHVNTSSRRSKHRSHGKERRQKGQGKDGEEKEDNGQKEKRKSNHH  929

Query  207  HGRHKSRHRADRATFLEAQSSVIPDFLL  124
             G+HK+  RAD    + AQ+ VIPDFLL
Sbjct  930  RGKHKAHQRADEPLNVVAQTPVIPDFLL  957



>ref|XP_002524910.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF37534.1| conserved hypothetical protein [Ricinus communis]
Length=848

 Score =   144 bits (362),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 95/207 (46%), Positives = 128/207 (62%), Gaps = 11/207 (5%)
 Frame = -1

Query  711  LYYLPSQKKETVSDDYPPANDP--CMGDADNTEDLIKLTEQSFLPKNKPNQAKPRPVVVK  538
            LYYLPS+K E  ++DYPPANDP  C+   D+ +DL+KL +QS + K KPN AKPRPVVVK
Sbjct  642  LYYLPSEKNEITTNDYPPANDPKSCISTNDDAQDLVKLADQSLISKRKPNYAKPRPVVVK  701

Query  537  LDDVDGTHFPAKKLDSKDDLISGAIRDVLLGNDDVAstsrskkpekssskrreknkstRD  358
            LD+ D     AKK + KDDL+S A+R+VLLGN  + + S+    +K SSKR+ K K   D
Sbjct  702  LDEGDVAPINAKKPEIKDDLLSDAVREVLLGNTTIPALSQGNSSDKLSSKRKGKEKQNVD  761

Query  357  KPSELID------NLGNIKSSEEVGSGRTKHRSRGKEGKNKSKDRGEYNQGEKQ---HSH  205
             P    +      +LGN  S +     + K RS+    KN + +R ++ +  KQ   H H
Sbjct  762  LPESRENLGGEKPDLGNSSSRKSKHRSQGKERSKKSTEKNNTDEREDHEEKGKQKSKHRH  821

Query  204  GRHKSRHRADRATFLEAQSSVIPDFLL  124
            GRHK++ RA+    L AQ+ VIPDFLL
Sbjct  822  GRHKTQQRAETRLNLVAQTPVIPDFLL  848



>ref|XP_006485818.1| PREDICTED: AP-3 complex subunit delta-like [Citrus sinensis]
Length=978

 Score =   144 bits (362),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 102/208 (49%), Positives = 128/208 (62%), Gaps = 13/208 (6%)
 Frame = -1

Query  711  LYYLPSQKKETVSDDYPPANDPCMGDA--DNTEDLIKLTEQSFLPKNKPNQAKPRPVVVK  538
            LYYL S+K E  S+DYPPANDP   D   D+ EDL+KLTEQS  PK KPNQAKPRPVV+K
Sbjct  772  LYYLASEKSEGASNDYPPANDPMSQDKLNDDAEDLLKLTEQSLAPKKKPNQAKPRPVVLK  831

Query  537  LDDVDGTHFPAKKLDSKDDLISGAIRDVLLGNDDVAstsrskkpekssskrreknkstRD  358
            LD  D     AKK + K DL+SG ++DVLLGND V S+SRS + E  S K + K K + D
Sbjct  832  LDG-DEISIAAKKPELKGDLLSGVVQDVLLGNDGVPSSSRSNRSENLSGKSKGKEKLSTD  890

Query  357  KPSELIDNLGNIKSSEEV--GSGRTKHRSRGKEGKNKSK--------DRGEYNQGEKQHS  208
               E  +N+   K  + V   S R+KHRS GKE + K +        D G+  + +  H 
Sbjct  891  LSLETKENVPGEKMPDHVNTSSRRSKHRSHGKERRQKGQGKDGEEKEDNGQKEKRKSNHH  950

Query  207  HGRHKSRHRADRATFLEAQSSVIPDFLL  124
             G+HK+  RAD    + AQ+ VIPDFLL
Sbjct  951  RGKHKAHQRADEPLNVVAQTPVIPDFLL  978



>ref|XP_002321481.2| hypothetical protein POPTR_0015s03830g [Populus trichocarpa]
 gb|EEF05608.2| hypothetical protein POPTR_0015s03830g [Populus trichocarpa]
Length=914

 Score =   141 bits (355),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 101/207 (49%), Positives = 132/207 (64%), Gaps = 11/207 (5%)
 Frame = -1

Query  711  LYYLPSQKKETVSDDYPPANDPCMG--DADNTEDLIKLTEQSFLPKNKPNQAKPRPVVVK  538
            LYYLPS+K + +++DYPPANDP  G    D+TEDL+KL +QS + K KPN AKPRPVVVK
Sbjct  708  LYYLPSEKNKILANDYPPANDPSSGINTNDDTEDLVKLADQSLVSKRKPNHAKPRPVVVK  767

Query  537  LDDVDGTHFPAKKLDSKDDLISGAIRDVLLGNDDVAstsrskkpekssskrreknkstRD  358
            L+  D     +KK + KDDL+SGAIRDVLLGN+  A++S+S   +KSSSKR+ K K    
Sbjct  768  LEGGDAAPVVSKKPELKDDLLSGAIRDVLLGNEAKAASSQSNPSDKSSSKRKGKAKHVIL  827

Query  357  KPSELIDNLGNIKSSEEVGSGRTKHRSRGKEGKNKSKDR----GEYNQGEKQHS-----H  205
              S+    +G   + E   S R++HR  GKE   KS+ +    G  + GEK+       H
Sbjct  828  PDSKENLAVGEQPNHENPSSRRSQHRGHGKEKSKKSRGKKNGDGREDDGEKEREKIRDHH  887

Query  204  GRHKSRHRADRATFLEAQSSVIPDFLL  124
            GRHKSR RAD    + AQ+  IPD+LL
Sbjct  888  GRHKSRQRADAPINVVAQTPDIPDYLL  914



>emb|CBI15478.3| unnamed protein product [Vitis vinifera]
Length=868

 Score =   137 bits (345),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 89/200 (45%), Positives = 119/200 (60%), Gaps = 35/200 (18%)
 Frame = -1

Query  711  LYYLPSQKKETVSDDYPPANDPCMGDA--DNTEDLIKLTEQSFLPKNKPNQAKPRPVVVK  538
            LYYLPS+K + VS+DYPPANDP + D   D+ +DL+KLTEQS L K KPN AKPRPVVVK
Sbjct  700  LYYLPSEKND-VSNDYPPANDPKLQDNLNDDAKDLVKLTEQSLLQKKKPNHAKPRPVVVK  758

Query  537  LDDVDGTHFPAKKLDSKDDLISGAIRDVLLGNDDVAstsrskkpekssskrreknkstRD  358
            LD+ D     AKKL+ K+DL+SGA+RDVLLGN+ V+++                      
Sbjct  759  LDEGDEAPIAAKKLELKEDLLSGAVRDVLLGNEAVSTSQ---------------------  797

Query  357  KPSELIDNLGNIKSSEEVGSGR--TKHRSRGKEGKNKSKDRGEYNQGEKQHSHGRHKSRH  184
                   NL +  SS+  G  +  T H S  KE +   ++ G+ ++ +  H H RHKSR 
Sbjct  798  ------SNLTDKSSSKRRGKEKLNTDHPSGPKEER---EENGQKDKQKSSHRHNRHKSRQ  848

Query  183  RADRATFLEAQSSVIPDFLL  124
            RA+    +  Q+ +IPDFLL
Sbjct  849  RAEGPNNVVTQTPLIPDFLL  868



>emb|CDO98419.1| unnamed protein product [Coffea canephora]
Length=976

 Score =   136 bits (342),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 98/208 (47%), Positives = 125/208 (60%), Gaps = 19/208 (9%)
 Frame = -1

Query  711  LYYLPSQKKETVSDDYPPANDPCMGDADNTED--LIKLTEQSFLPKNKPNQAKPRPVVVK  538
            +YYLPS+KKE V +DYPPAND  M D  N E   L+KLTE+S +PK KP  AKPRPVVVK
Sbjct  776  IYYLPSEKKEKVPNDYPPANDLSMQDKVNDEVDYLVKLTEKSLVPKKKP-IAKPRPVVVK  834

Query  537  LDDVDGTHFPAKKLDSKDDLISGAIRDVLLGNDDVAstsrs-----kkpekssskrrekn  373
            LDD D  H      + K+DLIS A+++VLLGN  VAS+SR+         +S  +     
Sbjct  835  LDDGDRIHINETLPELKEDLISDAVQEVLLGNQAVASSSRTDKSDKSSNRRSRKETFRPL  894

Query  372  kstRDKPSELIDNLGNIKSSEEVGSGRTKHRSRGKEGKNKS--KDRGEYNQGEK---QHS  208
            +S  D  +  I  LGN        S R KHR+ GKE  ++S  K  GE ++ ++    H 
Sbjct  895  ESNADSTTVEIAELGN------KNSRRIKHRTHGKERSHRSSKKATGESDRSDRPNSSHP  948

Query  207  HGRHKSRHRADRATFLEAQSSVIPDFLL  124
            HG+HKSR RAD    + A+S VIPDFLL
Sbjct  949  HGKHKSRQRADGMENVAAESPVIPDFLL  976



>ref|XP_011008310.1| PREDICTED: AP-3 complex subunit delta [Populus euphratica]
Length=966

 Score =   135 bits (340),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 97/207 (47%), Positives = 130/207 (63%), Gaps = 11/207 (5%)
 Frame = -1

Query  711  LYYLPSQKKETVSDDYPPANDPCMG--DADNTEDLIKLTEQSFLPKNKPNQAKPRPVVVK  538
            LYYLPS+K + +++DYPPANDP  G    D+TEDL+KL +QS + K KPN AKPRPVVVK
Sbjct  760  LYYLPSEKNKILANDYPPANDPSSGINTNDDTEDLVKLADQSLVSKRKPNYAKPRPVVVK  819

Query  537  LDDVDGTHFPAKKLDSKDDLISGAIRDVLLGNDDVAstsrskkpekssskrreknkstRD  358
            L+  D     +KK + +DDL+SGAIRD+LLGN+  A++S+S   +KSSSKR+ K K    
Sbjct  820  LEGGDAAPVVSKKPELEDDLLSGAIRDILLGNEAKAASSQSNPSDKSSSKRKGKAKHVIL  879

Query  357  KPSELIDNLGNIKSSEEVGSGRTKHRSRGKEGKNKSKDR----GEYNQGEKQHS-----H  205
              S+    +G   + E   S +++HR  GK    KS+ +    G    GEK+       H
Sbjct  880  PGSKENQAVGEQPNHENPSSRQSQHRGHGKVKSKKSRGKKNGDGREGDGEKEREKISDHH  939

Query  204  GRHKSRHRADRATFLEAQSSVIPDFLL  124
            GRHKSR RAD    + AQ+  IPD+LL
Sbjct  940  GRHKSRQRADAPINVAAQTPDIPDYLL  966



>ref|XP_011096988.1| PREDICTED: AP-3 complex subunit delta isoform X3 [Sesamum indicum]
Length=841

 Score =   135 bits (339),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 88/198 (44%), Positives = 117/198 (59%), Gaps = 9/198 (5%)
 Frame = -1

Query  711  LYYLPSQKKETVSDDYPPANDPCMGDADNTEDLIKLTEQSFLPKNKPNQAKPRPVVVKLD  532
            LYYLPS+ K T  +D+PPA++P     D  EDL KLTE+S + K K NQ KPRPVVVKLD
Sbjct  651  LYYLPSENKGTTFNDFPPAHEPKDKTIDEAEDLAKLTEESLIIKKKQNQVKPRPVVVKLD  710

Query  531  DVDGTHFPAKKLDSKDDLISGAIRDVLLGNDDVAstsrskkpekssskrreknkstRDKP  352
            D +G +   +K   K DLISGA+R+VLLGN+       +    +S S  +   +   D+ 
Sbjct  711  DGEGLNVAVEKSKVKTDLISGAVREVLLGNE------ATTSSSRSKSSNKSSKRREVDRI  764

Query  351  SELIDNLGNIKSSEE--VGSGRTKHRSRGKEGKNKSKDRGEYNQGEKQHSHGRHKSRHRA  178
             E  +++ N   SE   VGSGR KH++    GK K +   +  Q ++   H +HKSR RA
Sbjct  765  PESGNDIVNTAISERSNVGSGRRKHQTHLSSGKEKEQHDHKGKQ-KRDSRHHKHKSRQRA  823

Query  177  DRATFLEAQSSVIPDFLL  124
            D A  +  QS VIPDFLL
Sbjct  824  DGAMNIPVQSPVIPDFLL  841



>ref|XP_011096987.1| PREDICTED: AP-3 complex subunit delta isoform X2 [Sesamum indicum]
Length=842

 Score =   135 bits (339),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 88/198 (44%), Positives = 117/198 (59%), Gaps = 9/198 (5%)
 Frame = -1

Query  711  LYYLPSQKKETVSDDYPPANDPCMGDADNTEDLIKLTEQSFLPKNKPNQAKPRPVVVKLD  532
            LYYLPS+ K T  +D+PPA++P     D  EDL KLTE+S + K K NQ KPRPVVVKLD
Sbjct  652  LYYLPSENKGTTFNDFPPAHEPKDKTIDEAEDLAKLTEESLIIKKKQNQVKPRPVVVKLD  711

Query  531  DVDGTHFPAKKLDSKDDLISGAIRDVLLGNDDVAstsrskkpekssskrreknkstRDKP  352
            D +G +   +K   K DLISGA+R+VLLGN+       +    +S S  +   +   D+ 
Sbjct  712  DGEGLNVAVEKSKVKTDLISGAVREVLLGNE------ATTSSSRSKSSNKSSKRREVDRI  765

Query  351  SELIDNLGNIKSSEE--VGSGRTKHRSRGKEGKNKSKDRGEYNQGEKQHSHGRHKSRHRA  178
             E  +++ N   SE   VGSGR KH++    GK K +   +  Q ++   H +HKSR RA
Sbjct  766  PESGNDIVNTAISERSNVGSGRRKHQTHLSSGKEKEQHDHKGKQ-KRDSRHHKHKSRQRA  824

Query  177  DRATFLEAQSSVIPDFLL  124
            D A  +  QS VIPDFLL
Sbjct  825  DGAMNIPVQSPVIPDFLL  842



>ref|XP_011096986.1| PREDICTED: AP-3 complex subunit delta isoform X1 [Sesamum indicum]
Length=937

 Score =   135 bits (339),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 88/198 (44%), Positives = 117/198 (59%), Gaps = 9/198 (5%)
 Frame = -1

Query  711  LYYLPSQKKETVSDDYPPANDPCMGDADNTEDLIKLTEQSFLPKNKPNQAKPRPVVVKLD  532
            LYYLPS+ K T  +D+PPA++P     D  EDL KLTE+S + K K NQ KPRPVVVKLD
Sbjct  747  LYYLPSENKGTTFNDFPPAHEPKDKTIDEAEDLAKLTEESLIIKKKQNQVKPRPVVVKLD  806

Query  531  DVDGTHFPAKKLDSKDDLISGAIRDVLLGNDDVAstsrskkpekssskrreknkstRDKP  352
            D +G +   +K   K DLISGA+R+VLLGN+       +    +S S  +   +   D+ 
Sbjct  807  DGEGLNVAVEKSKVKTDLISGAVREVLLGNE------ATTSSSRSKSSNKSSKRREVDRI  860

Query  351  SELIDNLGNIKSSEE--VGSGRTKHRSRGKEGKNKSKDRGEYNQGEKQHSHGRHKSRHRA  178
             E  +++ N   SE   VGSGR KH++    GK K +   +  Q ++   H +HKSR RA
Sbjct  861  PESGNDIVNTAISERSNVGSGRRKHQTHLSSGKEKEQHDHKGKQ-KRDSRHHKHKSRQRA  919

Query  177  DRATFLEAQSSVIPDFLL  124
            D A  +  QS VIPDFLL
Sbjct  920  DGAMNIPVQSPVIPDFLL  937



>gb|KJB52993.1| hypothetical protein B456_008G287400 [Gossypium raimondii]
Length=779

 Score =   134 bits (338),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 91/210 (43%), Positives = 123/210 (59%), Gaps = 25/210 (12%)
 Frame = -1

Query  711  LYYLPSQKKETVSDDYPPANDPCM-GDADNT-EDLIKLTEQSFLPKNKPNQAKPRPVVVK  538
            LYYLPS K E +S+DYPPANDP + GD ++T  DL+KLT +S +PK KPN +KPRPVVVK
Sbjct  581  LYYLPSGKNEVISNDYPPANDPALQGDNNDTASDLVKLTAESLVPKRKPNHSKPRPVVVK  640

Query  537  LDDVDGTHFPAKKLDSKDDLISGAIRDVLLGNDDVAstsrskkpekssskrreknkstRD  358
            LD+ D      K  +S+DD +SGA+RD+L G++D+  TS       S+            
Sbjct  641  LDEADEKPVAVKHPESRDDSLSGAVRDILFGSEDILPTSSRSNLPSSNR-----------  689

Query  357  KPSELIDNLGNIKSSEEV------GSGRTKHRSRGKEGKNKSK---DRGEYNQGEKQHSH  205
            K  E    +  ++S E V       S R K  S GKE +++ K   +R E ++ EK+ S 
Sbjct  690  KGKEKQHMITQVESKENVVGDGNSSSRRRKDHSHGKERRHRKKNAEERNETDRKEKESSS  749

Query  204  G---RHKSRHRADRATFLEAQSSVIPDFLL  124
                RHKSR RA+    +  Q+SVIPDFLL
Sbjct  750  NHPRRHKSRQRAEEPLKVPPQTSVIPDFLL  779



>gb|KJB52992.1| hypothetical protein B456_008G287400 [Gossypium raimondii]
Length=925

 Score =   134 bits (337),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 91/210 (43%), Positives = 123/210 (59%), Gaps = 25/210 (12%)
 Frame = -1

Query  711  LYYLPSQKKETVSDDYPPANDPCM-GDADNT-EDLIKLTEQSFLPKNKPNQAKPRPVVVK  538
            LYYLPS K E +S+DYPPANDP + GD ++T  DL+KLT +S +PK KPN +KPRPVVVK
Sbjct  727  LYYLPSGKNEVISNDYPPANDPALQGDNNDTASDLVKLTAESLVPKRKPNHSKPRPVVVK  786

Query  537  LDDVDGTHFPAKKLDSKDDLISGAIRDVLLGNDDVAstsrskkpekssskrreknkstRD  358
            LD+ D      K  +S+DD +SGA+RD+L G++D+  TS       S+            
Sbjct  787  LDEADEKPVAVKHPESRDDSLSGAVRDILFGSEDILPTSSRSNLPSSNR-----------  835

Query  357  KPSELIDNLGNIKSSEEV------GSGRTKHRSRGKEGKNKSK---DRGEYNQGEKQHSH  205
            K  E    +  ++S E V       S R K  S GKE +++ K   +R E ++ EK+ S 
Sbjct  836  KGKEKQHMITQVESKENVVGDGNSSSRRRKDHSHGKERRHRKKNAEERNETDRKEKESSS  895

Query  204  G---RHKSRHRADRATFLEAQSSVIPDFLL  124
                RHKSR RA+    +  Q+SVIPDFLL
Sbjct  896  NHPRRHKSRQRAEEPLKVPPQTSVIPDFLL  925



>ref|XP_002318543.2| delta-adaptin family protein [Populus trichocarpa]
 gb|EEE96763.2| delta-adaptin family protein [Populus trichocarpa]
Length=941

 Score =   130 bits (326),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 98/215 (46%), Positives = 132/215 (61%), Gaps = 23/215 (11%)
 Frame = -1

Query  711  LYYLPSQKKETVS--DDYPPANDPCMG--DADNTEDLIKLTEQSFLPKNKPNQAKPRPVV  544
            LYYLPS+K ET++  +DYPPAN P  G    D+T+DL+ LT QS + K KPN AKPRPVV
Sbjct  731  LYYLPSEKNETITIANDYPPANYPSSGINTNDDTQDLVTLTNQSLVSKRKPNHAKPRPVV  790

Query  543  VKLDDVDGTHFPAKKLDSKDDLISGAIRDV-LLGNDDVAstsrskkpekssskrreknks  367
            VKLD+ D     AKK + KDDL+SGAIRD+ LLGN+   ++S+S   +KSS K++ K K 
Sbjct  791  VKLDEGDAAPVTAKKPEVKDDLLSGAIRDILLLGNEAKPASSQSNPSDKSSIKKKGKEKL  850

Query  366  tRDKPSELIDNLGNIKSSEE-----VGSGRTKHRSRGKEGKNKSK---------DRGEYN  229
              D    L D+  ++   E+       S R+KHR  GKE   KS+         D GE  
Sbjct  851  NVD----LSDSKEDLAVREQPNPENPSSRRSKHRGHGKEKSKKSQGKKDGDGSEDGGEKE  906

Query  228  QGEKQHSHGRHKSRHRADRATFLEAQSSVIPDFLL  124
            + + ++ +G+HK+R RAD    + AQ+  IPDFLL
Sbjct  907  KQKSRNRNGKHKTRQRADAPLNVVAQTPPIPDFLL  941



>ref|XP_010036902.1| PREDICTED: AP-3 complex subunit delta [Eucalyptus grandis]
 gb|KCW48560.1| hypothetical protein EUGRSUZ_K02232 [Eucalyptus grandis]
Length=962

 Score =   129 bits (324),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 88/202 (44%), Positives = 122/202 (60%), Gaps = 11/202 (5%)
 Frame = -1

Query  711  LYYLPSQKKETVSDDYPPANDPCMGDA--DNTEDLIKLTEQSFLPKNKPNQAKPRPVVVK  538
            LYYLPS+   T+S+DYPPAND   GD   D+TED +KLT QS +PK KPN AKPRPVVVK
Sbjct  766  LYYLPSEGNGTISNDYPPANDLKSGDTNQDDTEDFVKLTAQSLVPKKKPNYAKPRPVVVK  825

Query  537  LDDVDGTHFPAKKLDSKDDLISGAIRDVLLGNDDVAstsrskkpekssskrreknkstRD  358
            LD+ +      KK DS+DD +SGA+RD+LLG+D V  +S  K  EK +    +  ++  D
Sbjct  826  LDEGESVPVVLKKRDSRDDSLSGAVRDILLGDDAVKLSSSIKGKEKVNVDPLDSKENMHD  885

Query  357  KPSELIDNLGNIKSSEEVGSGRTKHRSRGKEGKNK----SKDRGEYNQGEKQHSHGRHKS  190
                 ++N  + KSS      R   + RG+    K     ++ G   + +  H HGR KS
Sbjct  886  -----MENSSHRKSSSRRSKQRPHRKERGQTSPEKLGVEKEEHGGKVKSKSSHRHGRQKS  940

Query  189  RHRADRATFLEAQSSVIPDFLL  124
            R +A+ ++ + A++ VIPDFLL
Sbjct  941  RQKAEGSSDIIAETPVIPDFLL  962



>gb|KDP20144.1| hypothetical protein JCGZ_05913 [Jatropha curcas]
Length=954

 Score =   129 bits (324),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 92/209 (44%), Positives = 123/209 (59%), Gaps = 25/209 (12%)
 Frame = -1

Query  711  LYYLPSQKKETVSDDYPPAND--PCMGDADNTEDLIKLTEQSFLPKNKPNQAKPRPVVVK  538
            LYYLPS+K E +++DYPPAND    +   D+ +DL+KL +QS + K K + AKPRPVVVK
Sbjct  758  LYYLPSEKNEILANDYPPANDLKSSIDTHDDAQDLVKLADQSLVSKRKSSLAKPRPVVVK  817

Query  537  LDDVDGTHFPAKKLDSKDDLISGAIRDVLLGN-DDVAstsrskkpekssskrreknkstR  361
            LD+ D     AKK D +D L+SGA+RD+LL N  D  S++R  K +++      +     
Sbjct  818  LDEGD-VPLTAKKPDRQDGLLSGAVRDILLANPSDETSSNRKGKEKQNVDPLESREILGG  876

Query  360  DKPSELIDNLGNIKSSEEVGSGRTKHRSRGKEGKNKSK---------DRGEYNQGEKQHS  208
            +KP     +LGN        S R+KHRS GKE   KS          D GE  + + +H 
Sbjct  877  EKP-----DLGN------PSSRRSKHRSHGKEKGTKSVEKKNADENDDHGEKEKHKSRHR  925

Query  207  HGRHKSRHRADRATF-LEAQSSVIPDFLL  124
            HGRHK+R RAD  T  +  Q+ VIPDFLL
Sbjct  926  HGRHKTRQRADAPTLTVVTQTPVIPDFLL  954



>ref|XP_011045833.1| PREDICTED: AP-3 complex subunit delta-like [Populus euphratica]
Length=969

 Score =   128 bits (322),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 96/215 (45%), Positives = 129/215 (60%), Gaps = 23/215 (11%)
 Frame = -1

Query  711  LYYLPSQKKETVS--DDYPPANDPCMGDADN--TEDLIKLTEQSFLPKNKPNQAKPRPVV  544
            LYYLPS+K ET++  +DYPPAN P  G   N  T+DL+ LT QS +   KPN AKPRPVV
Sbjct  759  LYYLPSEKNETITIANDYPPANYPSSGINTNNDTQDLVTLTNQSLVSNRKPNHAKPRPVV  818

Query  543  VKLDDVDGTHFPAKKLDSKDDLISGAIRDV-LLGNDDVAstsrskkpekssskrreknks  367
            VKLD+ D  H  AKK + KDDL+SGAIRD+ LLGN+   ++S+S   +KS  K++ K K 
Sbjct  819  VKLDEGDAAHATAKKPEVKDDLLSGAIRDILLLGNEAKPASSQSNPSDKSYIKKKGKEKL  878

Query  366  tRDKPSELIDNLGNIKSSEE-----VGSGRTKHRSRGKEGKNKSK---------DRGEYN  229
              D    L D+  ++   E+       S R+KHR  GKE   KS+         D GE  
Sbjct  879  NVD----LSDSKEDLAVREQPNPENPSSRRSKHRGHGKEKSKKSRGKKDGDGSEDGGEKE  934

Query  228  QGEKQHSHGRHKSRHRADRATFLEAQSSVIPDFLL  124
            + + ++ +G+HK+R R D    + AQ+  IPDFLL
Sbjct  935  KQKSRNRNGKHKTRQRTDAPLNVVAQTPPIPDFLL  969



>ref|XP_004512869.1| PREDICTED: AP-3 complex subunit delta-like [Cicer arietinum]
Length=1014

 Score =   127 bits (320),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 97/202 (48%), Positives = 127/202 (63%), Gaps = 6/202 (3%)
 Frame = -1

Query  711   LYYLPSQKKETVSDDYPPANDPCMGDADNTE--DLIKLTEQSFLPKNKPNQAKPRPVVVK  538
             LYYLPS K ETV DDYPPANDP      N E  +L KLTE+S L K + NQ KPRP+VVK
Sbjct  813   LYYLPSDKSETVPDDYPPANDPMANSNINDEASELAKLTEKSLLLKKRTNQTKPRPIVVK  872

Query  537   LDDVDGTHFPAKKLDSKDDLISGAIRDVLLGNDDVAstsrskkpekssskrreknkstRD  358
             LDD D      K+ + +DD +SGAI+DVL G+    S S+S   +KSS+KR+EK K   D
Sbjct  873   LDDGDLAPISNKRPEPRDDSLSGAIKDVLQGSQTNPSLSQSNPLDKSSNKRQEKKKLGAD  932

Query  357   KPSELIDNLGNI-KSSEEVGSGRTKHRSRGKEGKNKSKDRGEYNQ-GEKQ--HSHGRHKS  190
              PSE+ +NLG+  K   E  +  +K + R + GK K  +  E +Q G+K+  H HGR K+
Sbjct  933   PPSEMKENLGDAEKPGPENPNSSSKSKERRRRGKEKIVEGEESDQRGKKKSSHRHGRRKT  992

Query  189   RHRADRATFLEAQSSVIPDFLL  124
               RA+    + +Q+ VIPDFLL
Sbjct  993   HERANSPLNVVSQTPVIPDFLL  1014



>ref|XP_010094731.1| AP-3 complex subunit delta [Morus notabilis]
 gb|EXB56896.1| AP-3 complex subunit delta [Morus notabilis]
Length=973

 Score =   125 bits (313),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 90/204 (44%), Positives = 125/204 (61%), Gaps = 12/204 (6%)
 Frame = -1

Query  711  LYYLPSQKKETVSDDYPPANDPCMGDADNTEDLIKLTEQSFLPKNKPNQAKPRPVVVKLD  532
            LYYLPS+K + VS+DYPPAND  +    N EDL+KLTEQ+ +PK KPN AKPRPVVVKLD
Sbjct  774  LYYLPSEKND-VSNDYPPAND--LKSQGNAEDLVKLTEQALVPKKKPNHAKPRPVVVKLD  830

Query  531  DVDGTHFPAKKLDSKDDLISGAIRDVLLGNDDVAstsrskkpekssskrreknkstRDKP  352
            + D     AK+   KDDL+S A+R+VLL +D  AS+S +K  + SS K + K K   D P
Sbjct  831  EGDVVPIAAKR-QPKDDLLSDAVREVLLPSDTKASSSHNKPLDSSSIKNKGKEKVNVDTP  889

Query  351  SELIDNLGNIKSSEEVGSGRTKHRSRGKEGKNKS--------KDRGEYNQGEKQHSHGRH  196
                D   + + +      ++KH+S GK+ K++S        ++RG+  + +  H H ++
Sbjct  890  ESKEDLSIDKQDNRNQSLRKSKHQSHGKDRKHRSSRNAGDEREERGQEGKKKSSHRHSKN  949

Query  195  KSRHRADRATFLEAQSSVIPDFLL  124
            K R R D    +  Q+ VIPDFLL
Sbjct  950  KGRQRTDVPQSVIPQTQVIPDFLL  973



>ref|XP_010246461.1| PREDICTED: AP-3 complex subunit delta [Nelumbo nucifera]
Length=977

 Score =   123 bits (309),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 96/214 (45%), Positives = 122/214 (57%), Gaps = 25/214 (12%)
 Frame = -1

Query  711  LYYLPSQKKETVSDDYPPANDPCMGD--ADNTEDLIKLTEQSFLPKNKPNQAKPRPVVVK  538
            LYYLPS K ETVS+DYPPAN+P +     D T+DL+KLTEQS   K K N AKPRPVVVK
Sbjct  771  LYYLPSDKNETVSNDYPPANEPPLLSNLVDGTQDLMKLTEQSLASKKKSNHAKPRPVVVK  830

Query  537  LDDVDGTHFPAKKL--DSKDDLISGAIRDVLLGNDDVAstsrskkpekssskrreknkst  364
            LD+ D     A KL  +SKDD +SGA+RD+LLG+     +S+ +  +KSS KR ++    
Sbjct  831  LDEGDELPVSATKLTKESKDDSLSGALRDILLGDKVNPMSSQRQPSDKSSGKREKEALVD  890

Query  363  RDKPSELIDNLGNIK---------SSEEVGSGRTKHRS-----RGKEGKNKSKDRGEYNQ  226
                S    NLG+ +          S+    G+ K RS      GKE   K K +G    
Sbjct  891  SGYASRSKQNLGDAQPSHGSSSSRRSKHRSHGKEKQRSPRRNNEGKEDTQKDKKKG----  946

Query  225  GEKQHSHGRHKSRHRADRATFLEAQSSVIPDFLL  124
                H H RHK+R RAD    + +Q+ VIPDFLL
Sbjct  947  ---SHHHRRHKTRQRADGPPNVISQTPVIPDFLL  977



>ref|XP_003630870.1| AP-3 complex subunit delta-1 [Medicago truncatula]
 gb|AET05346.1| adaptin amino-terminal region protein [Medicago truncatula]
Length=968

 Score =   122 bits (307),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 93/202 (46%), Positives = 128/202 (63%), Gaps = 7/202 (3%)
 Frame = -1

Query  711  LYYLPSQKKETVSDDYPPANDPCMGDADNTE--DLIKLTEQSFLPKNKPNQAKPRPVVVK  538
            LYYL S K E V +DYPPANDP      N E  +L KLTEQS L K + NQ KPRPVVV+
Sbjct  768  LYYLASDKSEIVPNDYPPANDPKSNSNINDEADELTKLTEQSVLLKKRTNQMKPRPVVVR  827

Query  537  LDDVDGTHFPAKKLDSKDDLISGAIRDVLLGNDDVAstsrskkpekssskrreknkstRD  358
            LDD D    P K+ + +D+ +SGAI+DV LG++   S S+S   +KSS+K++ K K   D
Sbjct  828  LDDGDVAPVPNKRPERRDNSLSGAIKDV-LGSETNPSLSQSNPLDKSSTKQKGKKKLGTD  886

Query  357  KPSELIDNLGNI-KSSEEVGSGRTKHRSRGKEGKNKSKDRGEYNQ-GEKQ--HSHGRHKS  190
             PSE+ +NLG+  K   E+ +  +K++ R + GK K  +  E +Q G+K+  H HGR K+
Sbjct  887  LPSEMKENLGDAEKPDPEIPNSSSKNKERRRRGKEKIVEGEESDQKGKKKSSHRHGRRKT  946

Query  189  RHRADRATFLEAQSSVIPDFLL  124
              RA+    + +Q+ VIPDFLL
Sbjct  947  HQRANSPLNVVSQTPVIPDFLL  968



>gb|KHN21597.1| AP-3 complex subunit delta [Glycine soja]
Length=977

 Score =   117 bits (294),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 86/208 (41%), Positives = 120/208 (58%), Gaps = 13/208 (6%)
 Frame = -1

Query  711  LYYLPSQKKETVSDDYPPANDPCMGDADNTE--DLIKLTEQSFLPKNKPNQAKPRPVVVK  538
            LYYLPS+K E VSD+YPPANDP      N E  +L+KLTEQS L K + NQ KPRPVVV+
Sbjct  771  LYYLPSEKSEIVSDEYPPANDPKSNSNINDEAAELVKLTEQSLLLKKRTNQTKPRPVVVR  830

Query  537  LDDVDGTHFPAKKLDSKDDLISGAIRDVLLGND---DVAstsrskkpekssskrreknks  367
            LDD D      K+ +  DD +SGAI+D LLG++    ++ +S S K  +   K++   + 
Sbjct  831  LDDGDVAPITVKRPEPLDDSLSGAIKDALLGSETRPSMSGSSPSDKSSRKKEKKKLSTRV  890

Query  366  tRDKPSELID----NLGNIKSSEEVGSGRTKHRSRGKEGKNKSKDRGEYNQGEKQ---HS  208
              +    ++D     L N  SS +   G +  + R  +GK K  +  E++Q EK+   H 
Sbjct  891  RSEMKKNVVDAENPELENPNSSSK-NHGHSHTKERRHQGKEKIVEGEEHDQREKKKSGHR  949

Query  207  HGRHKSRHRADRATFLEAQSSVIPDFLL  124
            HGR K+  RA     + +Q+ VIPDFLL
Sbjct  950  HGRRKTHQRAKSPLNVVSQTPVIPDFLL  977



>ref|XP_006580434.1| PREDICTED: AP-3 complex subunit delta-like [Glycine max]
Length=977

 Score =   117 bits (294),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 86/208 (41%), Positives = 120/208 (58%), Gaps = 13/208 (6%)
 Frame = -1

Query  711  LYYLPSQKKETVSDDYPPANDPCMGDADNTE--DLIKLTEQSFLPKNKPNQAKPRPVVVK  538
            LYYLPS+K E VSD+YPPANDP      N E  +L+KLTEQS L K + NQ KPRPVVV+
Sbjct  771  LYYLPSEKSEIVSDEYPPANDPKSNSNINDEAAELVKLTEQSLLLKKRTNQTKPRPVVVR  830

Query  537  LDDVDGTHFPAKKLDSKDDLISGAIRDVLLGND---DVAstsrskkpekssskrreknks  367
            LDD D      K+ +  DD +SGAI+D LLG++    ++ +S S K  +   K++   + 
Sbjct  831  LDDGDVAPITVKRPEPLDDSLSGAIKDALLGSETRPSMSGSSPSDKSSRKKEKKKLSTRV  890

Query  366  tRDKPSELID----NLGNIKSSEEVGSGRTKHRSRGKEGKNKSKDRGEYNQGEKQ---HS  208
              +    ++D     L N  SS +   G +  + R  +GK K  +  E++Q EK+   H 
Sbjct  891  RSEMKKNVVDAENPELENPNSSSK-NHGHSHTKERRHQGKEKIVEGEEHDQREKKKSGHR  949

Query  207  HGRHKSRHRADRATFLEAQSSVIPDFLL  124
            HGR K+  RA     + +Q+ VIPDFLL
Sbjct  950  HGRRKTHQRAKSPLNVVSQTPVIPDFLL  977



>ref|XP_004300510.1| PREDICTED: AP-3 complex subunit delta [Fragaria vesca subsp. 
vesca]
Length=963

 Score =   115 bits (288),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 85/204 (42%), Positives = 123/204 (60%), Gaps = 20/204 (10%)
 Frame = -1

Query  711  LYYLPSQKKETVSDDYPPANDP-CMGDADNTEDLIKLTEQSFLPKNKPNQAKPRPVVVKL  535
            LYYLPS+KK+    DYPPANDP     +++ EDL KLTEQ  +PK KPN AKPRPVVVKL
Sbjct  772  LYYLPSEKKD---GDYPPANDPQIQAKSNDDEDLAKLTEQLVVPKKKPNHAKPRPVVVKL  828

Query  534  DDVDGTHFPAKKLDSKDDLISGAIRDVLLGNDDVAstsrskkpekssskrreknkstRDK  355
            D  D     A     ++D +SG +RD+LLG++       ++   +SS++ + K K   + 
Sbjct  829  DG-DQVRI-AIGPRPQEDSLSGTVRDILLGSE-------TEPTTRSSTRIKGKEKLNVES  879

Query  354  PSELIDNLGNIKSSEE--VGSGRTKHRSRGKEGKNKSK-----DRGEYNQGEKQHSHGRH  196
             +E  +NLG+++  ++    S ++KHR+  K  +++S      +R E  Q  K  S GRH
Sbjct  880  ATESKENLGDVEKQDQGNSSSRKSKHRTHSKGRRHRSPGKKGDEREENGQKAKPKSSGRH  939

Query  195  KSRHRADRATFLEAQSSVIPDFLL  124
            K+R RAD    + +Q+ VIPDFLL
Sbjct  940  KARQRADAPLNVVSQTPVIPDFLL  963



>ref|XP_007160391.1| hypothetical protein PHAVU_002G317900g [Phaseolus vulgaris]
 gb|ESW32385.1| hypothetical protein PHAVU_002G317900g [Phaseolus vulgaris]
Length=975

 Score =   115 bits (288),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 91/206 (44%), Positives = 121/206 (59%), Gaps = 10/206 (5%)
 Frame = -1

Query  711  LYYLPSQKKETVSDDYPPANDPCMGDADNTE--DLIKLTEQSFLPKNKPNQAKPRPVVVK  538
            LYYLPS+K E   D+YP ANDP      N E  +L+KLTEQS L K +  Q KPRPVVVK
Sbjct  770  LYYLPSEKSEIFPDEYPRANDPKSNSNINDEAAELVKLTEQSLLLKKRTTQTKPRPVVVK  829

Query  537  LDDVDGTHFPAKKLDSKDDLISGAIRDVLLGNDDVAstsrskkpekssskrreknkstRD  358
            LDD D T    K+ + +DD +SGAI+DVLLG++   S SRS    KSS K++EK K + +
Sbjct  830  LDDGDLTPISVKRPEPRDDSLSGAIKDVLLGSETGPSVSRSYPSGKSSRKQKEKKKLSTN  889

Query  357  KPSELIDNLGNIK-------SSEEVGSGRTKHRS-RGKEGKNKSKDRGEYNQGEKQHSHG  202
              SE+ +N  + +       +S     G +K R  RGKE   +S+D     + +  H HG
Sbjct  890  DRSEMKENAVDSEKPDLESPNSSSKNHGHSKERKHRGKEKIVESEDHDHNEKKKSGHRHG  949

Query  201  RHKSRHRADRATFLEAQSSVIPDFLL  124
            R K+  RA     + +Q+ VIPDFLL
Sbjct  950  RRKTHQRAKSPLNVASQTPVIPDFLL  975



>ref|XP_009360139.1| PREDICTED: AP-3 complex subunit delta-like [Pyrus x bretschneideri]
 ref|XP_009345482.1| PREDICTED: AP-3 complex subunit delta-like [Pyrus x bretschneideri]
Length=971

 Score =   115 bits (287),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 93/209 (44%), Positives = 121/209 (58%), Gaps = 22/209 (11%)
 Frame = -1

Query  711  LYYLPSQKKETVSDDYPPANDPCM--GDADNTEDLIKLTEQSFLPKNKPNQAKPRPVVVK  538
            LYYLPS  KE   DDYPPAND  +  G  D+  DL+KLTEQ  L K KPN AKPRPVVVK
Sbjct  772  LYYLPSANKE---DDYPPANDTKLQAGTNDDDGDLVKLTEQLLLSKKKPNHAKPRPVVVK  828

Query  537  LDDVDGTHFPAKKLDSKDDLISGAIRDVLLGNDDVAstsrskkpekssskrreknkstRD  358
            LD    T   A     K+DL+SG +RDVLLG+D   ++S+ +   KSSSKR+ K K   D
Sbjct  829  LDGDQAT--IATNPRPKEDLLSGTVRDVLLGSDTNPTSSQGQASTKSSSKRKGKEKLNVD  886

Query  357  KPSELIDNLGNI-----------KSSEEVGSGRTKHRSRGKEGKNKSKDRGEYNQGEKQH  211
               E   NLG +           KS     S   +H S GK+G  ++++ G+  + +   
Sbjct  887  SAKE---NLGGVERRDQGNPSSRKSKHHSHSKGRRHGSPGKKGA-ETEENGQKLKQKSSR  942

Query  210  SHGRHKSRHRADRATFLEAQSSVIPDFLL  124
            +H +HK+R RA+    + AQ+ VIPDFLL
Sbjct  943  THSKHKARQRAEVPLNVVAQTPVIPDFLL  971



>ref|XP_010694398.1| PREDICTED: AP-3 complex subunit delta [Beta vulgaris subsp. vulgaris]
Length=976

 Score =   114 bits (284),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 83/211 (39%), Positives = 122/211 (58%), Gaps = 20/211 (9%)
 Frame = -1

Query  711  LYYLPSQKKETVSDDYPPANDP--CMGDADNTEDLIKLTEQSFLPKNKPNQAKPRPVVVK  538
            LYYLPS+K ET S+++PPAN+       ++   DL+KLTEQS   K KPN  KPRPVVVK
Sbjct  771  LYYLPSEKDETASNNFPPANESKYVENQSNKMNDLVKLTEQSLTLKKKPNHVKPRPVVVK  830

Query  537  LDDVDGTHFPAKKLDSKDDLISGAIRDVLLGNDDVAstsrskkpekssskrreknkstRD  358
            LD+ +    P  KL+ K+DL+SGA+RDVLLGN +V+++S+  +  K S+  + K     D
Sbjct  831  LDESEN-FIPPNKLEYKEDLLSGAVRDVLLGNTEVSTSSKYSETGKPSTTTKGKETLGID  889

Query  357  KPSELIDNLGNIKSSEEVGS---GRTKHRSRGKEGKNKSKDRGEYNQGEKQHSHGRHKSR  187
             PS+L+D+  ++    EV      R+KH++  KE +++S   GE ++G ++ S    K  
Sbjct  890  DPSDLLDH--SVALDSEVSDPSLRRSKHKNHSKERRHRS--HGESSKGLEERSKKEKKRS  945

Query  186  HRADRATFLE----------AQSSVIPDFLL  124
                 +   E           Q+  IPDFLL
Sbjct  946  SHHRHSRHKEQEKQGESKIALQTPQIPDFLL  976



>ref|XP_009396369.1| PREDICTED: AP-3 complex subunit delta-like [Musa acuminata subsp. 
malaccensis]
Length=938

 Score =   112 bits (279),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 75/207 (36%), Positives = 112/207 (54%), Gaps = 11/207 (5%)
 Frame = -1

Query  714  ALYYLPSQKKETVSDDYPPANDPCMG--DADNTEDLIKLTEQSFLPKNKPNQAKPRPVVV  541
             LYYLP++K E  S+DYP AN+P +     D+ +D++KLT QSF+P+ K    KPRPVV+
Sbjct  733  GLYYLPTEKDEVESNDYPLANEPLLAVSHVDDAKDIVKLTAQSFIPR-KEKPMKPRPVVI  791

Query  540  KLDDVDGTHFPAKKL--DSKDDLISGAIRDVLLGNDDVAstsrskkpekssskrreknks  367
            +LD+ DG       +  + KDDL+SGAIR+VLLGN+   S+S     +++S +      +
Sbjct  792  RLDEGDGDSSSGLTMVKEFKDDLLSGAIRNVLLGNESKPSSSCDMSSDRTSRRGETDASN  851

Query  366  tRD-----KPSELIDNLGNIKSSEEVGSGRTKHRSRGKEGKNKSKDRGEYNQGEKQHSH-  205
              +     K S  +D   + KSS       T+H+ +     N+  +   +    +   H 
Sbjct  852  NNELFSQPKESNALDGREHRKSSSRKSRHHTRHKEKNGSLGNEDIEETSHRHSTRSSRHQ  911

Query  204  GRHKSRHRADRATFLEAQSSVIPDFLL  124
            GRHK R R D    + +Q  VI DFLL
Sbjct  912  GRHKHRERGDAPPDVVSQEPVIQDFLL  938



>ref|XP_010922047.1| PREDICTED: LOW QUALITY PROTEIN: AP-3 complex subunit delta-like 
[Elaeis guineensis]
Length=968

 Score =   112 bits (279),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 92/209 (44%), Positives = 123/209 (59%), Gaps = 16/209 (8%)
 Frame = -1

Query  711  LYYLPSQKKETVSDDYPPANDPCM--GDADNTEDLIKLTEQSFLPKNKPNQAKPRPVVVK  538
            LYYLP++K  T S+DYP ANDP +     D +EDL+KLT+QS +P+ K    KPRPVV+K
Sbjct  763  LYYLPAEKDGTESNDYPRANDPLLPASQGDVSEDLVKLTDQSLIPR-KVKHTKPRPVVIK  821

Query  537  LDDVDGTHF-PAKKL-DSKDDLISGAIRDVLLGNDDVAstsrskkpekssskrreknkst  364
            LD+ DG    P+  + +SKDDL+SGAI DVLLG +   S+S+ K  +KSS +R +     
Sbjct  822  LDEGDGVSTSPSTTVKESKDDLLSGAIHDVLLGKERKPSSSQKKYSDKSSRRRVKDVSDN  881

Query  363  RDKPS---ELIDNLGNIKSSEEVGSGRTKHRSRGKE-----GKNKSK-DRGEYNQGEKQH  211
             +  S   E +D LG+ +     GS R+KHRS GKE      KN  K ++   N     H
Sbjct  882  GESVSLSKEKLD-LGD-REHRSSGSRRSKHRSHGKERHTSPQKNDEKEEKNHRNSTRSSH  939

Query  210  SHGRHKSRHRADRATFLEAQSSVIPDFLL  124
             H RHK R R +    +  Q+ VI DFLL
Sbjct  940  HHERHKHRQRGEALLDVAPQAPVIQDFLL  968



>ref|XP_008393324.1| PREDICTED: AP-3 complex subunit delta-like [Malus domestica]
Length=971

 Score =   111 bits (278),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 92/209 (44%), Positives = 121/209 (58%), Gaps = 22/209 (11%)
 Frame = -1

Query  711  LYYLPSQKKETVSDDYPPANDPCMGDADNTED--LIKLTEQSFLPKNKPNQAKPRPVVVK  538
            LYYL S  KE   DDYPPAND  +    N +D  L+KLTEQ  L K KPN AKPRPVVVK
Sbjct  772  LYYLXSANKE---DDYPPANDTKLQHDTNDDDGDLVKLTEQLLLSKKKPNHAKPRPVVVK  828

Query  537  LDDVDGTHFPAKKLDSKDDLISGAIRDVLLGNDDVAstsrskkpekssskrreknkstRD  358
            LD    T     +L  K+DL+SG +RDVLLG+D   ++S+ +   KSSSKR+ K K   D
Sbjct  829  LDGDQATIANNPRL--KEDLLSGTVRDVLLGSDTNPTSSQGQASTKSSSKRKGKEKLNVD  886

Query  357  KPSELIDNLGNI-----------KSSEEVGSGRTKHRSRGKEGKNKSKDRGEYNQGEKQH  211
               E   NLG +           KS     S   +H S GK+G +++++ G+  Q +   
Sbjct  887  SAKE---NLGGVEKHDQGNPSSRKSKHHSHSKGRRHGSPGKKG-DETEENGQKLQQKSNR  942

Query  210  SHGRHKSRHRADRATFLEAQSSVIPDFLL  124
            +H +HK+R RA+    + AQ+ VIPDFLL
Sbjct  943  THSKHKARQRAEVPLNVVAQTPVIPDFLL  971



>ref|XP_008797681.1| PREDICTED: LOW QUALITY PROTEIN: AP-3 complex subunit delta-like 
[Phoenix dactylifera]
Length=912

 Score =   108 bits (269),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 85/216 (39%), Positives = 121/216 (56%), Gaps = 32/216 (15%)
 Frame = -1

Query  711  LYYLPSQKKETVSDDYPPANDPCM--GDADNTEDLIKLTEQSFLPKNKPNQAKPRPVVVK  538
            LYYLP++K ET S+DYP ANDP +     D  EDL+KLT+QS +P+ K    KPRPVV+K
Sbjct  709  LYYLPTEKDETESNDYPRANDPLLPASQGDVPEDLVKLTKQSLIPR-KVKHTKPRPVVIK  767

Query  537  LDDVDG-THFPAKKL-DSKDDLISGAIRDVLLGNDDVAstsrskkpekssskrreknkst  364
            LD+ DG + FP+  + +SKDDL+SGAI D LLG             + SSS++R  +KS+
Sbjct  768  LDEGDGVSTFPSTTVKESKDDLLSGAIHDALLGEG-----------KPSSSQKRYSDKSS  816

Query  363  RDKPSELIDNLGNI-KSSEEVGSGRTKHRSRGKEGKNKSKDRGEY---------------  232
            R +  ++ D   ++ +S E + SG  +HRS G + K++   +  +               
Sbjct  817  RGRVKDIADTGESVSQSKENLESGNREHRSSGSKSKHRGHGKERHRSPQKNEEEEEKNHR  876

Query  231  NQGEKQHSHGRHKSRHRADRATFLEAQSSVIPDFLL  124
            N     H H RHK R R +    +  Q+ VI DFLL
Sbjct  877  NSARSSHHHERHKHRPRGEALLNVAPQAPVIQDFLL  912



>ref|XP_007210401.1| hypothetical protein PRUPE_ppa000873mg [Prunus persica]
 gb|EMJ11600.1| hypothetical protein PRUPE_ppa000873mg [Prunus persica]
Length=974

 Score =   108 bits (269),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 99/208 (48%), Positives = 129/208 (62%), Gaps = 17/208 (8%)
 Frame = -1

Query  711  LYYLPSQKKETVSDDYPPAND-PCMGDA-DNTEDLIKLTEQSFLPKNKPNQAKPRPVVVK  538
            LYYLPS K E   D+YPPAND     D  D  EDL+KLTEQ  + K KPN AKPRPVVVK
Sbjct  772  LYYLPSAKNE---DEYPPANDLKLQADTNDGDEDLVKLTEQFLVSKKKPNHAKPRPVVVK  828

Query  537  LDDVDGTHFPAKKLDSKDDLISGAIRDVLLGNDDVAstsrskkpekssskrreknkstRD  358
            LD  D  H  A   D K+DL+SG +RDVLLG+D   ++S+SK   KSS++R+ K+K   D
Sbjct  829  LDG-DQVHIAANP-DRKEDLLSGTVRDVLLGSDTNHTSSQSKVSTKSSTQRKGKDKLNVD  886

Query  357  KPSELIDNLGNIKSSEE--VGSGRTKHRSRGKEGKNKSK-----DRGEYNQGEKQ---HS  208
              +E  +NLG+I+  ++    S ++KH S GK  ++KS      +R E  Q  KQ   HS
Sbjct  887  SVTESKENLGDIEKHDQGNPSSRKSKHHSHGKGRRHKSPGKKGDEREENGQKVKQKSSHS  946

Query  207  HGRHKSRHRADRATFLEAQSSVIPDFLL  124
            H +HK+R RA+    + A +  IPDFLL
Sbjct  947  HSKHKARQRAEVPLNVVALTPGIPDFLL  974



>ref|XP_008240244.1| PREDICTED: AP-3 complex subunit delta [Prunus mume]
Length=975

 Score =   107 bits (267),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 99/209 (47%), Positives = 128/209 (61%), Gaps = 19/209 (9%)
 Frame = -1

Query  711  LYYLPSQKKETVSDDYPPAND-PCMGDA-DNTEDLIKLTEQSFLPKNKPNQAKPRPVVVK  538
            LYYLPS K E   D+YPPAND     D  D  EDL+KLTEQ    K KPN AKPRPVVVK
Sbjct  773  LYYLPSAKNE---DEYPPANDLKLQADTNDGDEDLVKLTEQLLFSKKKPNHAKPRPVVVK  829

Query  537  LDDVDGTHFP-AKKLDSKDDLISGAIRDVLLGNDDVAstsrskkpekssskrreknkstR  361
            L   DG   P A   D K+DL+SG +RDVLLG+D   ++S+SK   KSS++R+ K+K   
Sbjct  830  L---DGDQVPIAANPDRKEDLLSGTVRDVLLGSDTNHTSSQSKVSTKSSTQRKGKDKLNV  886

Query  360  DKPSELIDNLGNIKSSEEVGSG--RTKHRSRGKEGKNKSK-----DRGEYNQGEKQ---H  211
            D  +E  +NLG+I+  ++      ++KH + GK  ++KS      +R E  Q  KQ   H
Sbjct  887  DSVTESKENLGDIEKHDQGNPSLRKSKHHTHGKGRRHKSPGKKGDEREENGQKVKQKSSH  946

Query  210  SHGRHKSRHRADRATFLEAQSSVIPDFLL  124
            SH +HK+R RA+    + AQS  IPDFLL
Sbjct  947  SHSKHKARQRAEVPLNVAAQSPGIPDFLL  975



>ref|XP_008459026.1| PREDICTED: AP-3 complex subunit delta [Cucumis melo]
Length=977

 Score =   104 bits (260),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 86/209 (41%), Positives = 122/209 (58%), Gaps = 14/209 (7%)
 Frame = -1

Query  711  LYYLPSQKKETVSDDYPPANDPCMGDA--DNTEDLIKLTEQSFLPKNKPNQAKPRPVVVK  538
            LYYLPS K +  S+DYPPAN+    D   D+   L+KL E+S   K K   AKPRPVVV+
Sbjct  770  LYYLPSDKTDDASNDYPPANELKEQDILDDDAAHLVKLAERSLAMKKKSTSAKPRPVVVR  829

Query  537  LDDVDGTHFPAKKLDSKDDLISGAIRDVLLGNDDVAstsrskkpekssskrreknkstRD  358
            LD+ D      KK    D+ +S A+RDVL+G+D   ++S++ +  K S++R+ K K    
Sbjct  830  LDEGDELPVTRKKPQLNDEQLSDAVRDVLVGSDARPTSSQTDQSSKPSNRRKGKEKQNAG  889

Query  357  KPSELIDNLGNI--KSSEEV-GSGRTKHRSRGKEGKNKS--KDRGEYNQGEKQ------H  211
             PS+  +NLGN+  +SS  V  S R  HR  GK+GK  S  K+  + +Q  K+       
Sbjct  890  NPSDSKENLGNVEEQSSNMVDTSLRRTHRHHGKDGKQASLEKNSEKKDQTHKKSKRTSSQ  949

Query  210  SHGRHKSRHRADRATFLEAQSSVIPDFLL  124
             HGRHK++   D +  + +Q +VIPDFLL
Sbjct  950  RHGRHKAKQSGDTSLPVASQ-TVIPDFLL  977



>gb|EYU19013.1| hypothetical protein MIMGU_mgv1a018800mg, partial [Erythranthe 
guttata]
Length=863

 Score =   103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 70/95 (74%), Gaps = 1/95 (1%)
 Frame = -1

Query  711  LYYLPSQKKETVSDDYPPANDPCMGDADNTEDLIKLTEQSFLPKNKPNQAKPRPVVVKLD  532
            LYYL S+   TVS+DYPPA DP   DAD  EDL +LTE+S + K KPNQA+ RPVVVKLD
Sbjct  703  LYYLSSENAGTVSNDYPPAIDPKDKDADEAEDLARLTEESLVIKKKPNQARIRPVVVKLD  762

Query  531  DVDGTHFPAKKLDSK-DDLISGAIRDVLLGNDDVA  430
            D +G +  AKK + +  DLISGA+++VLLGN+  A
Sbjct  763  DGEGFNVSAKKREVEGGDLISGAVQEVLLGNEATA  797



>ref|XP_004137481.1| PREDICTED: AP-3 complex subunit delta-like [Cucumis sativus]
 ref|XP_004161844.1| PREDICTED: AP-3 complex subunit delta-like [Cucumis sativus]
 gb|KGN64130.1| hypothetical protein Csa_1G042420 [Cucumis sativus]
Length=977

 Score =   100 bits (249),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 82/209 (39%), Positives = 121/209 (58%), Gaps = 14/209 (7%)
 Frame = -1

Query  711  LYYLPSQKKETVSDDYPPANDPCMGDA--DNTEDLIKLTEQSFLPKNKPNQAKPRPVVVK  538
            +YYLPS K +  S+DYPPAN+  + D   D+   L+KL E+S   K K   AKPRPVVV+
Sbjct  770  MYYLPSDKTDDASNDYPPANELKVQDILDDDAAHLVKLAERSLALKKKSTSAKPRPVVVR  829

Query  537  LDDVDGTHFPAKKLDSKDDLISGAIRDVLLGNDDVAstsrskkpekssskrreknkstRD  358
            LD+ D      KK    D+ +S A+RDVL+G+D   ++S++ +  K S +R+ K K   D
Sbjct  830  LDEGDELPVTRKKPQLNDEQLSDAVRDVLVGSDARPTSSQTNQSSKPSGRRKGKEKQNAD  889

Query  357  KPSELIDNLGNI--KSSEEV-GSGRTKHRSRGKEGKNKSKDRGE------YNQGEKQHS-  208
               E  +NLGN+  +SS  V  S R  HR   K+ K +S ++        + +G++  S 
Sbjct  890  NLLESKENLGNVEEQSSNMVDTSLRRTHRHHEKDAKQESPEKNSEKKDQTHKKGKRTSSQ  949

Query  207  -HGRHKSRHRADRATFLEAQSSVIPDFLL  124
             HGRHK++   D +  + +Q +VIPDFLL
Sbjct  950  RHGRHKAKQSGDTSLPVASQ-TVIPDFLL  977



>ref|XP_009347324.1| PREDICTED: AP-3 complex subunit delta-like [Pyrus x bretschneideri]
Length=960

 Score = 98.6 bits (244),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 91/207 (44%), Positives = 117/207 (57%), Gaps = 22/207 (11%)
 Frame = -1

Query  711  LYYLPSQKKETVSDDYPPANDPCMG--DADNTEDLIKLTEQSFLPKNKPNQAKPRPVVVK  538
            LYYLPS K+E   D+YPPANDP +     D+ EDL+KL     + K KP  AKPRPVVVK
Sbjct  765  LYYLPSVKEE---DNYPPANDPKLQVDTNDDDEDLVKL----LVSKKKPCHAKPRPVVVK  817

Query  537  LDDVDGTHFP-AKKLDSKDDLISGAIRDVLLGNDDVAstsrskkpekssskrreknkstR  361
            LD   G   P A     K+D++SG +RDVL G+D   ++S+S+   KSSSKR+ K K   
Sbjct  818  LD---GDQAPIAANPRPKEDVLSGTVRDVLSGSDTNPTSSQSRVSTKSSSKRKGKEKLNV  874

Query  360  DKPSELI-----DNLGNIKSSEEVGSGRTKHRSRGKEGKNKSKDRGEYNQGEKQ---HSH  205
            D   E +      +LGN  S        +K R  G  GK K  +R E  Q  KQ   H H
Sbjct  875  DSAKENLGDVEKHDLGNPCSRNSKHHSHSKGRRHGSPGK-KGDEREENGQKVKQKSSHRH  933

Query  204  GRHKSRHRADRATFLEAQSSVIPDFLL  124
             +HK+R RA+    + AQ+ V+PDFLL
Sbjct  934  SKHKARQRAEVPLNVVAQTPVVPDFLL  960



>ref|XP_010907010.1| PREDICTED: AP-3 complex subunit delta-like [Elaeis guineensis]
Length=1022

 Score = 98.2 bits (243),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 78/205 (38%), Positives = 111/205 (54%), Gaps = 10/205 (5%)
 Frame = -1

Query  711   LYYLPSQKKETVSDDYPPANDPCM--GDADNTEDLIKLTEQSFLPKNKPNQAKPRPVVVK  538
             LYYL ++K +T S+D+P A DP +    +D TEDL+KLTEQS +P+ K    KPRP+V+K
Sbjct  819   LYYLSAEKDDTESNDFPHALDPLLPGSHSDATEDLVKLTEQSLIPR-KVKPTKPRPIVLK  877

Query  537   LDDVDG--THFPAKKLDSKDDLISGAIRDVLLGNDDVAstsrskkpekssskrreknkst  364
             LD+ DG  T       +SKDDL+SGAI DVLLGN+   S+S+ +   KSS +R ++    
Sbjct  878   LDEGDGVSTSTSTTVKESKDDLLSGAIHDVLLGNEGKPSSSQKRSSNKSSGRRVKEVSDN  937

Query  363   RDKPSELIDNLG-----NIKSSEEVGSGRTKHRSRGKEGKNKSKDRGEYNQGEKQHSHGR  199
              +  S+  +NL      N  S         K R R  +   + +++   N     H H R
Sbjct  938   SESVSQSKENLDLGDRENRSSRRSKHRSHDKERHRSSQNNEEKEEKSHRNSTRSSHHHER  997

Query  198   HKSRHRADRATFLEAQSSVIPDFLL  124
              K R R +    +  Q+ VI D LL
Sbjct  998   QKHRQRGEAPLNVVPQAPVIQDLLL  1022



>ref|XP_008374775.1| PREDICTED: AP-3 complex subunit delta-like [Malus domestica]
Length=960

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 91/210 (43%), Positives = 123/210 (59%), Gaps = 28/210 (13%)
 Frame = -1

Query  711  LYYLPSQKKETVSDDYPPANDPCMG--DADNTEDLIKLTEQSFLPKNKPNQAKPRPVVVK  538
            LYYL S KKE   D+YPPANDP +     D+ EDL+KL     + K KP  AKPRPVVVK
Sbjct  765  LYYLSSAKKE---DNYPPANDPKLQVDTNDDDEDLVKL----LVSKKKPCHAKPRPVVVK  817

Query  537  LDDVDGTHFP-AKKLDSKDDLISGAIRDVLLGNDDVAstsrskkpekssskrreknkstR  361
            LD   G   P A     K+D++SG +++VLLG+D   ++S+SK   KSSSKR+ K K   
Sbjct  818  LD---GDQAPIAANPRPKEDVLSGTVQNVLLGSDTNPTSSQSKVSTKSSSKRKGKEKLNV  874

Query  360  DKPSELIDNLGNIKSSEEVG---SGRTKHRSRGKEGKN-----KSKDRGEYNQGEKQ---  214
            D   E   NLG+++   ++G   S  +KH S GK  ++     K  +R E  Q  KQ   
Sbjct  875  DSAKE---NLGDVEK-HDLGNPSSRNSKHHSHGKGRRHGSPGKKGDEREENGQKVKQKSS  930

Query  213  HSHGRHKSRHRADRATFLEAQSSVIPDFLL  124
            H H +H++R RA+    + AQ+ V+PDFLL
Sbjct  931  HRHSKHQARQRAEVPLNVVAQTPVVPDFLL  960



>ref|XP_008792886.1| PREDICTED: AP-3 complex subunit delta, partial [Phoenix dactylifera]
Length=836

 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 68/95 (72%), Gaps = 5/95 (5%)
 Frame = -1

Query  711  LYYLPSQKKETVSDDYPPANDPCM--GDADNTEDLIKLTEQSFLPKNKPNQAKPRPVVVK  538
            LYYLP++K ET S+D+P A DP +    +D TEDL+KLTEQS +P+ K    KPRP+V+K
Sbjct  631  LYYLPAEKDETESNDFPRAYDPLLPVSHSDATEDLVKLTEQSLIPR-KVKHTKPRPIVLK  689

Query  537  LDDVDGTHFPAKKL--DSKDDLISGAIRDVLLGND  439
            +D+ DG    A     +SKDD++SGAI +VLLGN+
Sbjct  690  MDEGDGVLPSASTTVKESKDDMLSGAIHEVLLGNE  724



>ref|XP_006842352.1| hypothetical protein AMTR_s00079p00176010 [Amborella trichopoda]
 gb|ERN04027.1| hypothetical protein AMTR_s00079p00176010 [Amborella trichopoda]
Length=948

 Score = 90.9 bits (224),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 82/212 (39%), Positives = 115/212 (54%), Gaps = 36/212 (17%)
 Frame = -1

Query  711  LYYLPSQKKETVSD-DYPPAND-PCMGDADNT-EDLIKLTEQSFLPKNKPNQAKPRPVVV  541
            L+YL   K ET S+ DYP AN      D  N   DL++LTE++F+ K KP +AKPRPVVV
Sbjct  757  LFYLSPSKGETESNLDYPSANVVEAPNDTPNAPSDLVRLTEKTFVSK-KPTRAKPRPVVV  815

Query  540  KLDDVD--GTHFPAKKLDSKDDLISGAIRDVLL-GNDDVAstsrskkpekssskrreknk  370
            K+DD D   T    +   SK+DL++G IRDVLL G  D +S+S  +              
Sbjct  816  KIDDGDEVVTQTEKQMKGSKEDLLAGVIRDVLLSGKGDPSSSSSHR--------------  861

Query  369  stRDKPSELIDNLGNIKSSEEV--------GSGRTKHRSRGKEGKNKSKDRGEYNQGEK-  217
                K   ++D     ++SE +         S RTKH+S GK G++KS  + E N+  K 
Sbjct  862  ----KEKNIMDMHTPEENSEAIEKNRHGSPSSKRTKHKSHGK-GRHKSSGKNEDNEKHKN  916

Query  216  -QHSHGRHKSRHRADRATFLEAQSSVIPDFLL  124
              H + +H+S  RA+    ++ Q+ VIPDFLL
Sbjct  917  GHHQNTKHRSWRRAESPRKVDPQAQVIPDFLL  948



>ref|XP_009395567.1| PREDICTED: AP-3 complex subunit delta-like [Musa acuminata subsp. 
malaccensis]
Length=961

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 84/222 (38%), Positives = 115/222 (52%), Gaps = 44/222 (20%)
 Frame = -1

Query  711  LYYLPSQKKETVSDDYPPANDPCM--GDADNTEDLIKLTEQSFLP-KNKPNQAKPRPVVV  541
            LYYLP  K ++ S+DYP AN+P +     ++TED++KL  QS +P K KP   KPRPVV+
Sbjct  758  LYYLPMDKDKSESNDYPCANEPLLPVSHGEDTEDIVKLPAQSLIPEKAKPT--KPRPVVI  815

Query  540  KLDDVDG---THFPAKKLDSKDDLISGAIRDVLLGNDDVAstsrskkpekssskrreknk  370
            +LD+ DG   ++    K +SKDD++SGAIRDVLL N+                K    +K
Sbjct  816  RLDEGDGVSSSNLSTAK-ESKDDMLSGAIRDVLLRNE---------------KKPSSTHK  859

Query  369  stRDKPSELIDNLGNIKS---SEEVGSGRTKHRSRGKEGKNKS----KDRGEYN-----Q  226
            ++ D+ S+  +N G+  S   S++  S     R  GK    KS    K+R E +      
Sbjct  860  TSSDRTSQRRENDGSENSELISQQKESNSFGDREHGKSSSRKSRHHHKERIESSGQNRDN  919

Query  225  GEKQHSHG--------RHKSRHRADRATFLEAQSSVIPDFLL  124
             EK H H         RHK R R D    +  QS VI DFLL
Sbjct  920  EEKSHRHSAKSSHHHRRHKHRQRGDAPLDIVPQSPVIQDFLL  961



>gb|KHN33887.1| Tubby-like F-box protein 8 [Glycine soja]
Length=284

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 53/81 (65%), Gaps = 2/81 (2%)
 Frame = -1

Query  711  LYYLPSQKKETVSDDYPPANDPCMGDADNTE--DLIKLTEQSFLPKNKPNQAKPRPVVVK  538
            LY LPS+K E VSD+Y P NDP   +  N E  +L+KLTEQS L K + NQ KPRP+VV+
Sbjct  204  LYCLPSEKSEIVSDEYLPTNDPKSNNNINDEAAELVKLTEQSLLLKKRTNQTKPRPIVVR  263

Query  537  LDDVDGTHFPAKKLDSKDDLI  475
            LDD D      K+ +  DD++
Sbjct  264  LDDGDVAPISVKRPEPMDDIV  284



>gb|KHN16547.1| AP-3 complex subunit delta [Glycine soja]
Length=652

 Score = 74.3 bits (181),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 64/205 (31%), Positives = 88/205 (43%), Gaps = 69/205 (34%)
 Frame = -1

Query  711  LYYLPSQKKETVSDDYPPANDPCMGDADNTEDLIKLTEQSFLPKNKPNQAKPRPVVVKLD  532
            LYYLPS+K E VSD+YPPA                        K + NQ KPR  +V+LD
Sbjct  508  LYYLPSEKSEIVSDEYPPAKKD---------------------KKRANQTKPRLALVRLD  546

Query  531  DVDGTHFPAKKLDSKDDLISGAIRDVLLGNDDVAstsrskkpekssskrreknkstRDKP  352
            D D      K+ + +DD +SGAI+DVLL ++                             
Sbjct  547  DGDVAPISVKRPEPRDDSLSGAIKDVLLRSET----------------------------  578

Query  351  SELIDNLGNIKSSEEVGSGRTKH------RSRGKEGKNKSKDRGEYNQGEKQ---HSHGR  199
                   G   S    GS R+K+      + R   GK K  +  E++Q EK+   +  GR
Sbjct  579  -------GPCMS----GSSRSKNHGHSHTKERRHRGKEKIVEGEEHDQREKKKSGYCRGR  627

Query  198  HKSRHRADRATFLEAQSSVIPDFLL  124
             K+  RA     + +Q+ VIPDFLL
Sbjct  628  RKTHQRAKSPVNVVSQTPVIPDFLL  652



>ref|XP_006584869.1| PREDICTED: AP-3 complex subunit delta-like isoform X1 [Glycine 
max]
 ref|XP_006584870.1| PREDICTED: AP-3 complex subunit delta-like isoform X2 [Glycine 
max]
 ref|XP_006584871.1| PREDICTED: AP-3 complex subunit delta-like isoform X3 [Glycine 
max]
 ref|XP_006584872.1| PREDICTED: AP-3 complex subunit delta-like isoform X4 [Glycine 
max]
 ref|XP_006584873.1| PREDICTED: AP-3 complex subunit delta-like isoform X5 [Glycine 
max]
Length=916

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 64/205 (31%), Positives = 87/205 (42%), Gaps = 69/205 (34%)
 Frame = -1

Query  711  LYYLPSQKKETVSDDYPPANDPCMGDADNTEDLIKLTEQSFLPKNKPNQAKPRPVVVKLD  532
            LYYLPS+K E VSD+YPPA                        K + NQ KPR  +V+LD
Sbjct  772  LYYLPSEKSEIVSDEYPPAKKD---------------------KKRANQTKPRLALVRLD  810

Query  531  DVDGTHFPAKKLDSKDDLISGAIRDVLLGNDDVAstsrskkpekssskrreknkstRDKP  352
            D D      K+ + +DD +SGAI+DVLL ++                             
Sbjct  811  DGDVAPISVKRPEPRDDSLSGAIKDVLLRSET----------------------------  842

Query  351  SELIDNLGNIKSSEEVGSGRTKH------RSRGKEGKNKSKDRGEYNQGEKQ---HSHGR  199
                   G   S    GS R+K+      + R   GK K  +  E++Q EK+   H  GR
Sbjct  843  -------GPCMS----GSSRSKNHGHSHTKERRHRGKEKIVEGEEHDQREKKKSGHCRGR  891

Query  198  HKSRHRADRATFLEAQSSVIPDFLL  124
             K+  RA     + + + VIPDFLL
Sbjct  892  RKTHQRAKSPVNVVSHTPVIPDFLL  916



>ref|XP_002442304.1| hypothetical protein SORBIDRAFT_08g017720 [Sorghum bicolor]
 gb|EES16142.1| hypothetical protein SORBIDRAFT_08g017720 [Sorghum bicolor]
Length=948

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 65/207 (31%), Positives = 101/207 (49%), Gaps = 18/207 (9%)
 Frame = -1

Query  711  LYYLPSQKKETVSDDYPPANDPCMGDADNT--EDLIKLTEQSFLPKNKPNQAKPRPVVVK  538
            L+YL + K E   +DYP AND     ++N+  +D +K  E  F  + K    K RP VVK
Sbjct  749  LFYLQTGKTEDEPNDYPQANDSLPSSSNNSVNDDKLKTAELVF-GRKKSTATKSRPKVVK  807

Query  537  LD--DVDGTHFPAKKLDSKDDLISGAIRDVLLGNDDVAstsrskkpekssskrreknkst  364
            LD  D   +  P+  +  K+D +SGA+RDVLLG+D  A +S+            + + + 
Sbjct  808  LDTEDFLSSMMPSANV-PKEDPLSGALRDVLLGSDAKALSSQRTSDINLEGMLNKTSSNE  866

Query  363  RDKPSELIDNLGNIKSSEEVGSGRTKHRSRGK-------EGKNKSKDRGEYNQGEKQHSH  205
               P   I+NLG+  +S    + + ++  + K       +GK + K R   + G   H  
Sbjct  867  SSTPR--IENLGSHPASHSSRTSKQQNHDKEKGANPAESDGKEQRKHR---SSGRSGHRQ  921

Query  204  GRHKSRHRADRATFLEAQSSVIPDFLL  124
            G+HK R ++        Q+ VI DFLL
Sbjct  922  GKHKHREKSSTQPDTVPQAPVIQDFLL  948



>ref|XP_008662607.1| PREDICTED: AP-3 complex subunit delta-like [Zea mays]
Length=941

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 72/210 (34%), Positives = 106/210 (50%), Gaps = 25/210 (12%)
 Frame = -1

Query  711  LYYLPSQKKETVSDDYPPANDPCMGDADNT--EDLIKLTEQSFLPKNKPNQAKPRPVVVK  538
            L+YL + K E   +DYP AND     ++N+  +D  K  E+ F  K K    K RP VVK
Sbjct  743  LFYLQTGKAEDEPNDYPQANDSLPSSSNNSANDDKWKTAERVFAGK-KSTATKTRPKVVK  801

Query  537  LD--DVDGTHFPAKKLDSKDDLISGAIRDVLLGNDDVAstsrskkpekssskrreknkst  364
            LD  D   +  P+  +  K+D +SGA+RDVLLG+D  A    S+K    + +      ++
Sbjct  802  LDTEDFLSSMMPSA-IVPKEDPLSGALRDVLLGSD--AKALSSQKASDMNLEVMLNKANS  858

Query  363  RDKPSELIDNLGNIKSSEEVGSGRTKH---------RSRGKEG-KNKSKDRGEYNQGEKQ  214
             +  S+ I+NLG+  +S    S +  H          S GKE  K++S  R  + QG+ +
Sbjct  859  NESSSQQIENLGSHPASHSRTSKQQNHDKEKVTDRPESDGKEPRKHRSSGRSGHRQGKNK  918

Query  213  HSHGRHKSRHRADRATFLEAQSSVIPDFLL  124
            H   R KS  + D    +  Q+ VI DFLL
Sbjct  919  H---REKSSAQPD----IVPQTPVIQDFLL  941



>ref|XP_010549108.1| PREDICTED: AP-3 complex subunit delta [Tarenaya hassleriana]
Length=855

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 58/96 (60%), Gaps = 14/96 (15%)
 Frame = -1

Query  711  LYYLPSQKKETVSD--DYPPANDPCMGDADNTEDLIKLTEQSFLPKNKPNQAKPRPVVVK  538
            LYYLPSQK +  SD  DYPPAN+  + D        +++ +SF P+ K  Q KPRPVVVK
Sbjct  700  LYYLPSQKNDRDSDGNDYPPANE--LAD--------EISVESFNPRRKQGQYKPRPVVVK  749

Query  537  LDDVD-GTHFPAKKLDSKDD-LISGAIRDVLLGNDD  436
            LD+ D        K D KDD  +S AI++ L+G D+
Sbjct  750  LDEGDESASVKTTKEDVKDDESLSRAIQNALMGKDE  785



>ref|XP_008672722.1| PREDICTED: uncharacterized protein LOC100279859 isoform X1 [Zea 
mays]
 gb|ACR36472.1| unknown [Zea mays]
 tpg|DAA55276.1| TPA: hypothetical protein ZEAMMB73_773793 [Zea mays]
Length=941

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 65/206 (32%), Positives = 104/206 (50%), Gaps = 17/206 (8%)
 Frame = -1

Query  711  LYYLPSQKKETVSDDYPPANDPCMGDADNT--EDLIKLTEQSFLPKNKPNQAKPRPVVVK  538
            L+YL ++K E   +DYP AND     ++N+  +D +K  +  F P  K    K RP VVK
Sbjct  743  LFYLQTRKTEDEPNDYPQANDSLPSSSNNSVNDDKLKAADLVF-PGKKLTAMKSRPKVVK  801

Query  537  LD--DVDGTHFPAKKLDSKDDLISGAIRDVLLGNDDVAstsrskkpekssskrreknkst  364
            LD  D   +  P+  +  K+D +SG +RDVL G+D  A    S++    + +      S+
Sbjct  802  LDAEDFLSSMMPSANV-PKEDPLSGVLRDVLFGSD--AKALSSQRTSDINLEGMLNKTSS  858

Query  363  RDKPSELIDNLGN-----IKSSEEVGSGRTKHRSRGK-EGKNKSKDRGEYNQGEKQHSHG  202
             +  S+ I+NLG+      ++S+E  + + K  +  + +GK   K R   + G   H  G
Sbjct  859  NESSSQQIENLGSHPASCSRTSKEQNNDKVKGTNPPESDGKEPRKHR---SSGRSGHRQG  915

Query  201  RHKSRHRADRATFLEAQSSVIPDFLL  124
            +HK R ++        Q+ VI DFLL
Sbjct  916  KHKHREKSSTQPDAIPQAPVIQDFLL  941



>ref|XP_004968829.1| PREDICTED: AP-3 complex subunit delta-like [Setaria italica]
Length=948

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 68/205 (33%), Positives = 95/205 (46%), Gaps = 15/205 (7%)
 Frame = -1

Query  711  LYYLPSQKKETVSDDYPPAND--PCMGDADNTEDLIKLTEQSFLPKNKPNQAKPRPVVVK  538
            ++YLP+   E    DYP  ND  P   +A    D  K  E  F  K K    K RP VVK
Sbjct  750  IFYLPTGNTEDEQSDYPHVNDTLPSCSNATVYGDNSKTIEPVFAGK-KSKSTKSRPKVVK  808

Query  537  LDDVDGTHFPAKKLDS----KDDLISGAIRDVLLGNDDVAstsrskkpekssskrreknk  370
            LD   G  F +  + +    K+D +SGA+R VLLG D  A  S S+K    +S+      
Sbjct  809  LD---GEDFLSSMMATANALKEDPLSGALRGVLLGRD--AKASSSQKALDVNSEAIPNLM  863

Query  369  stRDKPSELIDNLGNIKSSEEVGSGRTKH-RSRGKE--GKNKSKDRGEYNQGEKQHSHGR  199
             T +  S+ I+ LG+  +S    S R  H + +G      +  + R   + G   H  G+
Sbjct  864  GTNESSSQQIEYLGSHPTSSSRTSMRQNHDKEKGTNPPESDAKQSRKHRSSGRSGHRQGK  923

Query  198  HKSRHRADRATFLEAQSSVIPDFLL  124
            HK R R+     +  Q+ VI DFLL
Sbjct  924  HKHRERSSTQPDIVPQAPVIQDFLL  948



>ref|NP_175308.1| AP-3 complex subunit delta [Arabidopsis thaliana]
 ref|NP_849785.1| AP-3 complex subunit delta [Arabidopsis thaliana]
 ref|NP_001031156.1| AP-3 complex subunit delta [Arabidopsis thaliana]
 sp|Q9C744.1|AP3D_ARATH RecName: Full=AP-3 complex subunit delta; AltName: Full=Adaptor-related 
protein complex 3 subunit delta; AltName: Full=Delta-adaptin; 
Short=At-d-Ad; Short=At-delta-Ad; AltName: Full=Protein-affected 
trafficking 4 [Arabidopsis thaliana]
 gb|AAG60121.1|AC073555_5 delta-adaptin, putative [Arabidopsis thaliana]
 gb|AAL07009.1| At1g48760/F11I4_7 [Arabidopsis thaliana]
 gb|AEE32345.1| AP-3 complex subunit delta [Arabidopsis thaliana]
 gb|AEE32346.1| AP-3 complex subunit delta [Arabidopsis thaliana]
 gb|AEE32347.1| AP-3 complex subunit delta [Arabidopsis thaliana]
Length=869

 Score = 56.6 bits (135),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 57/97 (59%), Gaps = 19/97 (20%)
 Frame = -1

Query  711  LYYLPSQKKET----VSDDYPPANDPCMGDADNTEDLIKLTEQSFLPKNKPNQAKPRPVV  544
            +YYL SQK++      S DYP AN+  + +        ++++ SF PK KPNQ+KPRPVV
Sbjct  709  MYYLTSQKEDQDSNGTSSDYPLANE--LAN--------EISQDSFNPKRKPNQSKPRPVV  758

Query  543  VKLDDVDGTHF-PAKKLDSK----DDLISGAIRDVLL  448
            VKLDD D +   P  K + +    D+ +S AI+  LL
Sbjct  759  VKLDDGDESRITPQAKTNIQTANDDESLSRAIQSALL  795


 Score = 23.1 bits (48),  Expect(2) = 2e-06, Method: Composition-based stats.
 Identities = 9/12 (75%), Positives = 9/12 (75%), Gaps = 0/12 (0%)
 Frame = -3

Query  733  EHRKRHGPVLLT  698
            EHRKRHG   LT
Sbjct  702  EHRKRHGMYYLT  713



>ref|NP_001146284.1| uncharacterized protein LOC100279859 [Zea mays]
 gb|ACL53627.1| unknown [Zea mays]
Length=876

 Score = 57.0 bits (136),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 37/95 (39%), Positives = 54/95 (57%), Gaps = 6/95 (6%)
 Frame = -1

Query  711  LYYLPSQKKETVSDDYPPANDPCMGDADNT--EDLIKLTEQSFLPKNKPNQAKPRPVVVK  538
            L+YL ++K E   +DYP AND     ++N+  +D +K  +  F P  K    K RP VVK
Sbjct  743  LFYLQTRKTEDEPNDYPQANDSLPSSSNNSVNDDKLKAADLVF-PGKKLTAMKSRPKVVK  801

Query  537  LDDVD--GTHFPAKKLDSKDDLISGAIRDVLLGND  439
            LD  D   +  P+  +  K+D +SG +RDVL G+D
Sbjct  802  LDAEDFLSSMMPSANV-PKEDPLSGVLRDVLFGSD  835



>ref|NP_001043177.2| Os01g0512200 [Oryza sativa Japonica Group]
 dbj|BAF05091.2| Os01g0512200, partial [Oryza sativa Japonica Group]
Length=317

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 53/97 (55%), Gaps = 10/97 (10%)
 Frame = -1

Query  711  LYYLPSQKKETVSDDYPPANDPCMGDADNT--EDLIKLTEQSFLPKNKPNQAKPRPVVVK  538
            LYYLP+ K E    DYP ANDP +  +  +  +D +K T Q      KP   K RP VVK
Sbjct  118  LYYLPTGKAEDGPVDYPHANDPLLPASSESALDDKLK-TIQPVTGGKKPKAVKSRPKVVK  176

Query  537  LDDVDGTHFPAKKLDS----KDDLISGAIRDVLLGND  439
            L   DG  F +  + S    K+D +SGA+R VLLG D
Sbjct  177  L---DGEDFLSSMVASASVPKEDSLSGAVRGVLLGRD  210



>gb|EEC70747.1| hypothetical protein OsI_02156 [Oryza sativa Indica Group]
Length=580

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 53/97 (55%), Gaps = 10/97 (10%)
 Frame = -1

Query  711  LYYLPSQKKETVSDDYPPANDPCMGDADNT--EDLIKLTEQSFLPKNKPNQAKPRPVVVK  538
            LYYLP+ K E    DYP ANDP +  +  +  +D +K T Q      KP   K RP VVK
Sbjct  381  LYYLPTGKAEDGPVDYPHANDPLLPASSESALDDKLK-TIQPVTGGKKPKAVKSRPKVVK  439

Query  537  LDDVDGTHFPAKKLDS----KDDLISGAIRDVLLGND  439
            L   DG  F +  + S    K+D +SGA+R VLLG D
Sbjct  440  L---DGEDFLSSMVASASVPKEDSLSGAVRGVLLGRD  473



>dbj|BAD73073.1| AP-3 complex delta subunit-like protein [Oryza sativa Japonica 
Group]
 dbj|BAD73265.1| AP-3 complex delta subunit-like protein [Oryza sativa Japonica 
Group]
Length=631

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 53/97 (55%), Gaps = 10/97 (10%)
 Frame = -1

Query  711  LYYLPSQKKETVSDDYPPANDPCMGDADNT--EDLIKLTEQSFLPKNKPNQAKPRPVVVK  538
            LYYLP+ K E    DYP ANDP +  +  +  +D +K T Q      KP   K RP VVK
Sbjct  432  LYYLPTGKAEDGPVDYPHANDPLLPASSESALDDKLK-TIQPVTGGKKPKAVKSRPKVVK  490

Query  537  LDDVDGTHFPAKKLDS----KDDLISGAIRDVLLGND  439
            L   DG  F +  + S    K+D +SGA+R VLLG D
Sbjct  491  L---DGEDFLSSMVASASVPKEDSLSGAVRGVLLGRD  524



>gb|EEE54678.1| hypothetical protein OsJ_01979 [Oryza sativa Japonica Group]
Length=905

 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 53/97 (55%), Gaps = 10/97 (10%)
 Frame = -1

Query  711  LYYLPSQKKETVSDDYPPANDPCMGDADNT--EDLIKLTEQSFLPKNKPNQAKPRPVVVK  538
            LYYLP+ K E    DYP ANDP +  +  +  +D +K T Q      KP   K RP VVK
Sbjct  706  LYYLPTGKAEDGPVDYPHANDPLLPASSESALDDKLK-TIQPVTGGKKPKAVKSRPKVVK  764

Query  537  LDDVDGTHFPAKKLDS----KDDLISGAIRDVLLGND  439
            L   DG  F +  + S    K+D +SGA+R VLLG D
Sbjct  765  L---DGEDFLSSMVASASVPKEDSLSGAVRGVLLGRD  798



>ref|XP_002894132.1| delta-adaptin [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70391.1| delta-adaptin [Arabidopsis lyrata subsp. lyrata]
Length=863

 Score = 51.2 bits (121),  Expect(2) = 6e-05, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 57/97 (59%), Gaps = 19/97 (20%)
 Frame = -1

Query  711  LYYLPSQKKE----TVSDDYPPANDPCMGDADNTEDLIKLTEQSFLPKNKPNQAKPRPVV  544
            ++YL SQK++    +   DYP AN+  + +        ++++  F PK KPNQ+KPRPVV
Sbjct  709  MFYLTSQKEDPDSNSTHSDYPLANE--LAN--------EISQDPFNPKRKPNQSKPRPVV  758

Query  543  VKLDDVDGTHFP--AKK--LDSKDD-LISGAIRDVLL  448
            VKLDD D +     AKK    +KDD  +S AI+  LL
Sbjct  759  VKLDDGDESRITPQAKKNIQTAKDDESLSLAIQSALL  795


 Score = 23.1 bits (48),  Expect(2) = 6e-05, Method: Composition-based stats.
 Identities = 9/12 (75%), Positives = 9/12 (75%), Gaps = 0/12 (0%)
 Frame = -3

Query  733  EHRKRHGPVLLT  698
            EHRKRHG   LT
Sbjct  702  EHRKRHGMFYLT  713



>ref|XP_006296990.1| hypothetical protein CARUB_v10012984mg [Capsella rubella]
 gb|EOA29888.1| hypothetical protein CARUB_v10012984mg [Capsella rubella]
Length=825

 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 51/98 (52%), Gaps = 23/98 (23%)
 Frame = -1

Query  711  LYYLPSQKKETVSD---------DYPPANDPCMGDADNTEDLIKLTEQSFLPKNKPNQAK  559
            LYYL SQKK+  +D         +YPPAN+   GD             SF PK K NQ+K
Sbjct  677  LYYLSSQKKDEHNDSNGNNNTLNEYPPANE-ISGD-------------SFNPKKKMNQSK  722

Query  558  PRPVVVKLDDVDGTHFPAKKLDSKDDLISGAIRDVLLG  445
            PRPVVVKLD+ D          S D+ +S AI+  L+G
Sbjct  723  PRPVVVKLDEGDDDLKTKPNASSNDEPLSRAIQTALMG  760



>ref|XP_010506684.1| PREDICTED: AP-3 complex subunit delta-like [Camelina sativa]
Length=859

 Score = 51.2 bits (121),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 52/99 (53%), Gaps = 26/99 (26%)
 Frame = -1

Query  711  LYYLPSQKKETVSD---------DYPPANDPCMGDADNTEDLIKLTEQSFLPKNKPNQAK  559
            +YYL SQK +  +D         +YPPAN+              ++  SF PK K NQ+K
Sbjct  712  MYYLSSQKSDDHNDSNGNNNTLNEYPPANE--------------ISADSFNPKKKMNQSK  757

Query  558  PRPVVVKLDDVDGTHFPAK-KLDSKDDLISGAIRDVLLG  445
            PRPVVVKLD  +G  F  K    S D+ +S AI+  L+G
Sbjct  758  PRPVVVKLD--EGDDFKMKPDASSNDEPLSRAIQTALMG  794


 Score = 21.9 bits (45),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 8/12 (67%), Positives = 9/12 (75%), Gaps = 0/12 (0%)
 Frame = -3

Query  733  EHRKRHGPVLLT  698
            EHRKRHG   L+
Sbjct  705  EHRKRHGMYYLS  716



>gb|KFK39167.1| hypothetical protein AALP_AA3G208900 [Arabis alpina]
Length=860

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 55/101 (54%), Gaps = 29/101 (29%)
 Frame = -1

Query  711  LYYLPSQKKETVSD----------DYPPANDPCMGDADNTEDLIKLTEQSFLPKNKPNQA  562
            LYYL SQK +  +D          +YPPAN+              ++  SF PK KPN++
Sbjct  713  LYYLSSQKSDDQNDSNGNNNNALNEYPPANE--------------ISVDSFNPKKKPNRS  758

Query  561  KPRPVVVKLDDVDGTHFPAKKLDSK--DDLISGAIRDVLLG  445
            KPRPVVVKLD+ D +     K D++  D+ +S AI+  L+G
Sbjct  759  KPRPVVVKLDEGDESK---TKSDARNNDEPLSRAIQTALMG  796



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1340626501500