BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF009I08

Length=687
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009803018.1|  PREDICTED: RING-H2 finger protein ATL65          67.4    9e-10   Nicotiana sylvestris
ref|XP_009618632.1|  PREDICTED: RING-H2 finger protein ATL65          67.0    1e-09   Nicotiana tomentosiformis
ref|XP_011088757.1|  PREDICTED: RING-H2 finger protein ATL65          65.9    4e-09   
gb|EPS68373.1|  hypothetical protein M569_06391                       63.5    1e-08   Genlisea aurea
ref|XP_004309937.1|  PREDICTED: RING-H2 finger protein ATL65          62.4    4e-08   Fragaria vesca subsp. vesca
ref|XP_002519118.1|  ring finger protein, putative                    59.3    4e-07   
emb|CDO97105.1|  unnamed protein product                              58.2    1e-06   Coffea canephora [robusta coffee]
ref|XP_004502661.1|  PREDICTED: RING-H2 finger protein ATL65-like     57.8    2e-06   Cicer arietinum [garbanzo]
ref|XP_003602261.1|  RING finger protein                              57.8    2e-06   Medicago truncatula
ref|XP_010999537.1|  PREDICTED: RING-H2 finger protein ATL65          56.6    4e-06   Populus euphratica
ref|XP_002313823.2|  hypothetical protein POPTR_0009s11310g           56.6    5e-06   Populus trichocarpa [western balsam poplar]
ref|XP_007131883.1|  hypothetical protein PHAVU_011G049300g           56.2    5e-06   Phaseolus vulgaris [French bean]
gb|KGN61760.1|  hypothetical protein Csa_2G238760                     55.8    7e-06   Cucumis sativus [cucumbers]
ref|XP_004145402.1|  PREDICTED: RING-H2 finger protein ATL65-like     55.8    7e-06   
gb|KDP46198.1|  hypothetical protein JCGZ_10038                       55.8    7e-06   Jatropha curcas
ref|XP_006479353.1|  PREDICTED: RING-H2 finger protein ATL65-like     55.1    1e-05   Citrus sinensis [apfelsine]
ref|XP_006423159.1|  hypothetical protein CICLE_v10029919mg           55.1    1e-05   Citrus clementina [clementine]
ref|XP_008459244.1|  PREDICTED: RING-H2 finger protein ATL65          53.1    6e-05   
ref|XP_007041380.1|  RING/U-box superfamily protein                   52.0    2e-04   
ref|XP_003631115.1|  hypothetical protein MTR_8g107290                48.5    3e-04   
gb|AET05591.2|  ring-H2 finger ATL65-like protein, putative           47.8    3e-04   Medicago truncatula
ref|XP_006365491.1|  PREDICTED: RING-H2 finger protein ATL65-like     50.4    5e-04   Solanum tuberosum [potatoes]
gb|KJB16141.1|  hypothetical protein B456_002G214100                  50.1    6e-04   Gossypium raimondii
ref|XP_004230847.1|  PREDICTED: RING-H2 finger protein ATL65          50.1    7e-04   Solanum lycopersicum
ref|XP_003539029.1|  PREDICTED: RING-H2 finger protein ATL65-like     50.1    7e-04   Glycine max [soybeans]



>ref|XP_009803018.1| PREDICTED: RING-H2 finger protein ATL65 [Nicotiana sylvestris]
Length=415

 Score = 67.4 bits (163),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -3

Query  583  FASPMFMRSSGAPNGFFSSSRLRSGDPEALLSPDRFNRR  467
            FASPMFMR+S A  G FSSSRLRSGDPEALLSPDR+NRR
Sbjct  377  FASPMFMRTSAAGGGVFSSSRLRSGDPEALLSPDRYNRR  415



>ref|XP_009618632.1| PREDICTED: RING-H2 finger protein ATL65 [Nicotiana tomentosiformis]
Length=415

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 38/42 (90%), Gaps = 1/42 (2%)
 Frame = -3

Query  592  TKSFASPMFMRSSGAPNGFFSSSRLRSGDPEALLSPDRFNRR  467
            +KSFASPMFMR+S A  G FSSSRLRSGDPEALLSPDR+NRR
Sbjct  375  SKSFASPMFMRTS-ATGGVFSSSRLRSGDPEALLSPDRYNRR  415



>ref|XP_011088757.1| PREDICTED: RING-H2 finger protein ATL65 [Sesamum indicum]
Length=446

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 37/42 (88%), Gaps = 1/42 (2%)
 Frame = -3

Query  592  TKSFASPMFMRSSGAPNG-FFSSSRLRSGDPEALLSPDRFNR  470
            TKSFASPMFMRSS A  G  FSSSRLRSGDPEALLSP+R+NR
Sbjct  404  TKSFASPMFMRSSAAAAGAVFSSSRLRSGDPEALLSPERYNR  445



>gb|EPS68373.1| hypothetical protein M569_06391 [Genlisea aurea]
Length=352

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 36/43 (84%), Gaps = 1/43 (2%)
 Frame = -3

Query  592  TKSFASPMFMRSSGA-PNGFFSSSRLRSGDPEALLSPDRFNRR  467
            TKS ASPMF+RS  A P   FSSSRLRSGDPEALLSP+RFNRR
Sbjct  310  TKSMASPMFLRSGHAHPGSVFSSSRLRSGDPEALLSPERFNRR  352



>ref|XP_004309937.1| PREDICTED: RING-H2 finger protein ATL65 [Fragaria vesca subsp. 
vesca]
Length=390

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -3

Query  592  TKSFASPMFMRSSGAPNGFFSSSRLRSGDPEALLSPDRFNRR  467
            TKS  SPMFMRSS      FSSSRLR GDPEALLSP+RFNRR
Sbjct  349  TKSMTSPMFMRSSALTAAAFSSSRLRCGDPEALLSPERFNRR  390



>ref|XP_002519118.1| ring finger protein, putative [Ricinus communis]
 gb|EEF43329.1| ring finger protein, putative [Ricinus communis]
Length=402

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 34/41 (83%), Gaps = 3/41 (7%)
 Frame = -3

Query  589  KSFASPMFMRSSGAPNGFFSSSRLRSGDPEALLSPDRFNRR  467
            KS ASPMFMRSS A    FSSSRLR GDPEALLSP+RFNRR
Sbjct  365  KSMASPMFMRSSVAA---FSSSRLRCGDPEALLSPERFNRR  402



>emb|CDO97105.1| unnamed protein product [Coffea canephora]
Length=433

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 33/37 (89%), Gaps = 1/37 (3%)
 Frame = -3

Query  574  PMFMRSSG-APNGFFSSSRLRSGDPEALLSPDRFNRR  467
            PMF+R+SG A  GFFSSSR RSGDPEALLSPDR+N+R
Sbjct  397  PMFLRTSGGAAGGFFSSSRQRSGDPEALLSPDRYNKR  433



>ref|XP_004502661.1| PREDICTED: RING-H2 finger protein ATL65-like [Cicer arietinum]
Length=368

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 34/42 (81%), Gaps = 3/42 (7%)
 Frame = -3

Query  592  TKSFASPMFMRSSGAPNGFFSSSRLRSGDPEALLSPDRFNRR  467
            +KS ASPMF RSS A    FSSSRLR GDPEALLSP+RFNRR
Sbjct  329  SKSIASPMFSRSSAA---VFSSSRLRCGDPEALLSPERFNRR  367



>ref|XP_003602261.1| RING finger protein [Medicago truncatula]
 gb|AES72512.1| RING-H2 finger protein ATL4O [Medicago truncatula]
Length=358

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 34/42 (81%), Gaps = 3/42 (7%)
 Frame = -3

Query  592  TKSFASPMFMRSSGAPNGFFSSSRLRSGDPEALLSPDRFNRR  467
            +KS ASPMF RSS A    FSSSRLR GDPEALLSP+RFNRR
Sbjct  319  SKSIASPMFSRSSAA---VFSSSRLRCGDPEALLSPERFNRR  357



>ref|XP_010999537.1| PREDICTED: RING-H2 finger protein ATL65 [Populus euphratica]
Length=425

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = -3

Query  592  TKSFASPMFMRSS-GAPNGFFSSSRLRSGDPEALLSPDRFNRR  467
             KS ASP F+RSS G+    FSSSRLR GDPEALLSP+RFNRR
Sbjct  383  CKSMASPQFLRSSVGSSMAAFSSSRLRCGDPEALLSPERFNRR  425



>ref|XP_002313823.2| hypothetical protein POPTR_0009s11310g [Populus trichocarpa]
 gb|EEE87778.2| hypothetical protein POPTR_0009s11310g [Populus trichocarpa]
Length=427

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = -3

Query  592  TKSFASPMFMRSS-GAPNGFFSSSRLRSGDPEALLSPDRFNRR  467
             KS ASP F+RSS G+    FSSSRLR GDPEALLSP+RFNRR
Sbjct  385  CKSMASPQFLRSSVGSSMAAFSSSRLRCGDPEALLSPERFNRR  427



>ref|XP_007131883.1| hypothetical protein PHAVU_011G049300g [Phaseolus vulgaris]
 gb|ESW03877.1| hypothetical protein PHAVU_011G049300g [Phaseolus vulgaris]
Length=395

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -3

Query  574  PMFMRSSGAPNGFFSSSRLRSGDPEALLSPDRFNRR  467
            PMF+RSSG     FSSSRLR GDPEALLSP+RFNRR
Sbjct  360  PMFLRSSGLAAAAFSSSRLRCGDPEALLSPERFNRR  395



>gb|KGN61760.1| hypothetical protein Csa_2G238760 [Cucumis sativus]
Length=417

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 34/45 (76%), Gaps = 3/45 (7%)
 Frame = -3

Query  592  TKSFASPMFMRSS---GAPNGFFSSSRLRSGDPEALLSPDRFNRR  467
            +KS  SPMF+RSS   G     FSSSRLR GDPEALLSP+RFNRR
Sbjct  373  SKSMTSPMFLRSSVTGGGGAAAFSSSRLRCGDPEALLSPERFNRR  417



>ref|XP_004145402.1| PREDICTED: RING-H2 finger protein ATL65-like [Cucumis sativus]
 ref|XP_004153673.1| PREDICTED: RING-H2 finger protein ATL65-like [Cucumis sativus]
 ref|XP_004173235.1| PREDICTED: RING-H2 finger protein ATL65-like [Cucumis sativus]
Length=421

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 34/45 (76%), Gaps = 3/45 (7%)
 Frame = -3

Query  592  TKSFASPMFMRSS---GAPNGFFSSSRLRSGDPEALLSPDRFNRR  467
            +KS  SPMF+RSS   G     FSSSRLR GDPEALLSP+RFNRR
Sbjct  377  SKSMTSPMFLRSSVTGGGGAAAFSSSRLRCGDPEALLSPERFNRR  421



>gb|KDP46198.1| hypothetical protein JCGZ_10038 [Jatropha curcas]
Length=429

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 33/41 (80%), Gaps = 3/41 (7%)
 Frame = -3

Query  589  KSFASPMFMRSSGAPNGFFSSSRLRSGDPEALLSPDRFNRR  467
            KS ASPMF RSS A    FSSSRLR GDPEAL+SP+RFNRR
Sbjct  392  KSMASPMFQRSSVAA---FSSSRLRCGDPEALISPERFNRR  429



>ref|XP_006479353.1| PREDICTED: RING-H2 finger protein ATL65-like [Citrus sinensis]
Length=417

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 32/42 (76%), Gaps = 3/42 (7%)
 Frame = -3

Query  592  TKSFASPMFMRSSGAPNGFFSSSRLRSGDPEALLSPDRFNRR  467
            +KS  SPMF RSS      FSSSRLR GDPEALLSPDRFNRR
Sbjct  379  SKSMTSPMFPRSSALA---FSSSRLRCGDPEALLSPDRFNRR  417



>ref|XP_006423159.1| hypothetical protein CICLE_v10029919mg [Citrus clementina]
 gb|ESR36399.1| hypothetical protein CICLE_v10029919mg [Citrus clementina]
Length=417

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 32/42 (76%), Gaps = 3/42 (7%)
 Frame = -3

Query  592  TKSFASPMFMRSSGAPNGFFSSSRLRSGDPEALLSPDRFNRR  467
            +KS  SPMF RSS      FSSSRLR GDPEALLSPDRFNRR
Sbjct  379  SKSMTSPMFPRSSALA---FSSSRLRCGDPEALLSPDRFNRR  417



>ref|XP_008459244.1| PREDICTED: RING-H2 finger protein ATL65 [Cucumis melo]
 ref|XP_008459245.1| PREDICTED: RING-H2 finger protein ATL65 [Cucumis melo]
Length=409

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 34/47 (72%), Gaps = 5/47 (11%)
 Frame = -3

Query  592  TKSFASPMFMRSSGAPNGF-----FSSSRLRSGDPEALLSPDRFNRR  467
            +KS  SPMF+RSS    G      FSSSRLR GDPEALLSP+RFNRR
Sbjct  363  SKSMTSPMFLRSSVTGGGGGGGAAFSSSRLRCGDPEALLSPERFNRR  409



>ref|XP_007041380.1| RING/U-box superfamily protein [Theobroma cacao]
 gb|EOX97211.1| RING/U-box superfamily protein [Theobroma cacao]
Length=401

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -3

Query  592  TKSFASPMFMRSSGAPNGFFSSSRLRSGDPEALLSPDRFNRR  467
            TKS ASPMF+RS+ +    FSSSRLR GDPEALLSP+RFNRR
Sbjct  360  TKSMASPMFLRSAASSVAAFSSSRLRCGDPEALLSPERFNRR  401



>ref|XP_003631115.1| hypothetical protein MTR_8g107290 [Medicago truncatula]
Length=102

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 31/42 (74%), Gaps = 3/42 (7%)
 Frame = -3

Query  592  TKSFASPMFMRSSGAPNGFFSSSRLRSGDPEALLSPDRFNRR  467
            + S  SPMF RSS A    FSSSRLR G+P ALLSP+RFNR+
Sbjct  63   STSIVSPMFSRSSTA---VFSSSRLRCGNPVALLSPERFNRQ  101



>gb|AET05591.2| ring-H2 finger ATL65-like protein, putative [Medicago truncatula]
Length=71

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 31/42 (74%), Gaps = 3/42 (7%)
 Frame = -3

Query  592  TKSFASPMFMRSSGAPNGFFSSSRLRSGDPEALLSPDRFNRR  467
            + S  SPMF RSS A    FSSSRLR G+P ALLSP+RFNR+
Sbjct  32   STSIVSPMFSRSSTA---VFSSSRLRCGNPVALLSPERFNRQ  70



>ref|XP_006365491.1| PREDICTED: RING-H2 finger protein ATL65-like [Solanum tuberosum]
Length=415

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = -3

Query  589  KSFASPMFMRSSGAPNGFFSSS-RLRSGDPEALLSPDRFNRR  467
            KSFASPMFMR+S +  G   SS RLRSGDPEALLSPDR++RR
Sbjct  374  KSFASPMFMRTSASGGGGVFSSSRLRSGDPEALLSPDRYHRR  415



>gb|KJB16141.1| hypothetical protein B456_002G214100 [Gossypium raimondii]
Length=397

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -3

Query  592  TKSFASPMFMRSSGAPNGFFSSSRLRSGDPEALLSPDRFNRR  467
            +KS ASPMF+RS+ +    FSSSRLR GDPEALLSP+RFNRR
Sbjct  356  SKSMASPMFLRSAASSVAAFSSSRLRCGDPEALLSPERFNRR  397



>ref|XP_004230847.1| PREDICTED: RING-H2 finger protein ATL65 [Solanum lycopersicum]
Length=422

 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 34/43 (79%), Gaps = 2/43 (5%)
 Frame = -3

Query  589  KSFASPMFMRSSGAPNGFFSSS--RLRSGDPEALLSPDRFNRR  467
            KSFASPMFMR+SG   G    S  RLRSGDPEALLSPDR++RR
Sbjct  380  KSFASPMFMRTSGVGGGGGVYSSSRLRSGDPEALLSPDRYHRR  422



>ref|XP_003539029.1| PREDICTED: RING-H2 finger protein ATL65-like [Glycine max]
Length=399

 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 30/37 (81%), Gaps = 1/37 (3%)
 Frame = -3

Query  574  PMFMRSSGAPNGF-FSSSRLRSGDPEALLSPDRFNRR  467
            PMF+RSSG  +   FSSSRLR GDPEALLSP+RFN R
Sbjct  363  PMFLRSSGVTSAAAFSSSRLRCGDPEALLSPERFNGR  399



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1144913349700