BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF009F22

Length=739
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDP29763.1|  hypothetical protein JCGZ_18698                         399   7e-134   Jatropha curcas
ref|XP_011097478.1|  PREDICTED: uncharacterized protein At1g04910...    398   2e-133   Sesamum indicum [beniseed]
ref|XP_006353172.1|  PREDICTED: uncharacterized protein At1g04910...    398   2e-133   
ref|XP_006353173.1|  PREDICTED: uncharacterized protein At1g04910...    398   2e-133   Solanum tuberosum [potatoes]
gb|AAK84479.1|  putative auxin growth promotor protein                  395   1e-132   Solanum lycopersicum
ref|XP_010312649.1|  PREDICTED: uncharacterized protein At1g04910...    394   1e-132   Solanum lycopersicum
ref|XP_009797993.1|  PREDICTED: uncharacterized protein At1g04910...    395   2e-132   Nicotiana sylvestris
ref|XP_010312647.1|  PREDICTED: uncharacterized protein At1g04910...    395   2e-132   
ref|XP_009797995.1|  PREDICTED: uncharacterized protein At1g04910...    395   2e-132   Nicotiana sylvestris
ref|XP_010312648.1|  PREDICTED: uncharacterized protein At1g04910...    395   2e-132   
emb|CDP01562.1|  unnamed protein product                                395   3e-132   Coffea canephora [robusta coffee]
ref|XP_007207425.1|  hypothetical protein PRUPE_ppa004921mg             394   4e-132   
ref|XP_007207426.1|  hypothetical protein PRUPE_ppa004921mg             394   5e-132   
ref|XP_003534239.1|  PREDICTED: uncharacterized protein At1g04910...    394   6e-132   Glycine max [soybeans]
ref|XP_002310868.1|  hypothetical protein POPTR_0007s14280g             394   6e-132   Populus trichocarpa [western balsam poplar]
ref|XP_006587571.1|  PREDICTED: uncharacterized protein At1g04910...    394   6e-132   Glycine max [soybeans]
ref|XP_011021848.1|  PREDICTED: uncharacterized protein At1g04910       394   7e-132   Populus euphratica
ref|XP_009350347.1|  PREDICTED: uncharacterized protein At1g04910...    393   2e-131   Pyrus x bretschneideri [bai li]
gb|KCW54611.1|  hypothetical protein EUGRSUZ_I00557                     392   2e-131   Eucalyptus grandis [rose gum]
ref|XP_009350346.1|  PREDICTED: uncharacterized protein At1g04910...    393   2e-131   Pyrus x bretschneideri [bai li]
ref|XP_010027954.1|  PREDICTED: uncharacterized protein At1g04910       392   3e-131   Eucalyptus grandis [rose gum]
ref|XP_009364251.1|  PREDICTED: uncharacterized protein At1g04910...    392   5e-131   Pyrus x bretschneideri [bai li]
ref|XP_009364252.1|  PREDICTED: uncharacterized protein At1g04910...    392   6e-131   Pyrus x bretschneideri [bai li]
ref|XP_008236140.1|  PREDICTED: uncharacterized protein At1g04910...    392   8e-131   Prunus mume [ume]
ref|XP_008385667.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    392   8e-131   Malus domestica [apple tree]
ref|XP_009783617.1|  PREDICTED: uncharacterized protein At1g04910...    391   8e-131   Nicotiana sylvestris
ref|XP_002268599.2|  PREDICTED: uncharacterized protein At1g04910       391   1e-130   Vitis vinifera
ref|XP_008236135.1|  PREDICTED: uncharacterized protein At1g04910...    392   1e-130   Prunus mume [ume]
ref|XP_006573005.1|  PREDICTED: uncharacterized protein At1g04910...    391   1e-130   Glycine max [soybeans]
ref|XP_008347790.1|  PREDICTED: uncharacterized protein At1g04910...    391   1e-130   
gb|KHN14510.1|  DUF246 domain-containing protein                        391   1e-130   Glycine soja [wild soybean]
ref|XP_003517397.1|  PREDICTED: uncharacterized protein At1g04910...    391   2e-130   Glycine max [soybeans]
ref|XP_008347789.1|  PREDICTED: uncharacterized protein At1g04910...    391   2e-130   
ref|XP_011099981.1|  PREDICTED: uncharacterized protein At1g04910...    390   4e-130   Sesamum indicum [beniseed]
ref|XP_011099984.1|  PREDICTED: uncharacterized protein At1g04910...    390   4e-130   Sesamum indicum [beniseed]
gb|KJB44061.1|  hypothetical protein B456_007G232700                    385   5e-130   Gossypium raimondii
ref|XP_009623753.1|  PREDICTED: uncharacterized protein At1g04910...    388   2e-129   
gb|KCW54609.1|  hypothetical protein EUGRSUZ_I00557                     388   2e-129   Eucalyptus grandis [rose gum]
ref|XP_009623754.1|  PREDICTED: uncharacterized protein At1g04910...    387   2e-129   Nicotiana tomentosiformis
ref|XP_002533683.1|  conserved hypothetical protein                     387   4e-129   Ricinus communis
gb|KDO60569.1|  hypothetical protein CISIN_1g009234mg                   386   4e-129   Citrus sinensis [apfelsine]
ref|XP_007158370.1|  hypothetical protein PHAVU_002G147300g             387   5e-129   Phaseolus vulgaris [French bean]
gb|KJB18177.1|  hypothetical protein B456_003G038000                    381   1e-128   Gossypium raimondii
gb|KHG05570.1|  hypothetical protein F383_31127                         385   2e-128   Gossypium arboreum [tree cotton]
gb|KHG27420.1|  hypothetical protein F383_15612                         385   2e-128   Gossypium arboreum [tree cotton]
gb|KJB18178.1|  hypothetical protein B456_003G038000                    381   3e-128   Gossypium raimondii
ref|XP_006426272.1|  hypothetical protein CICLE_v10025329mg             385   3e-128   Citrus clementina [clementine]
ref|XP_006466306.1|  PREDICTED: uncharacterized protein At1g04910...    385   4e-128   Citrus sinensis [apfelsine]
gb|EYU30935.1|  hypothetical protein MIMGU_mgv1a004530mg                385   5e-128   Erythranthe guttata [common monkey flower]
gb|EYU30936.1|  hypothetical protein MIMGU_mgv1a004530mg                384   6e-128   Erythranthe guttata [common monkey flower]
gb|KJB44059.1|  hypothetical protein B456_007G232700                    384   9e-128   Gossypium raimondii
ref|XP_007047791.1|  O-fucosyltransferase family protein isoform 1      384   1e-127   
ref|XP_010523310.1|  PREDICTED: uncharacterized protein At1g04910...    381   1e-127   
ref|XP_008440542.1|  PREDICTED: uncharacterized protein At1g04910       383   1e-127   Cucumis melo [Oriental melon]
gb|EYU39303.1|  hypothetical protein MIMGU_mgv1a004838mg                382   3e-127   Erythranthe guttata [common monkey flower]
ref|XP_004288516.2|  PREDICTED: uncharacterized protein At1g04910       382   4e-127   Fragaria vesca subsp. vesca
ref|XP_006394028.1|  hypothetical protein EUTSA_v10004041mg             382   5e-127   
ref|XP_006394027.1|  hypothetical protein EUTSA_v10004041mg             381   6e-127   Eutrema salsugineum [saltwater cress]
ref|XP_009130514.1|  PREDICTED: uncharacterized protein At1g04910...    381   9e-127   Brassica rapa
emb|CDY37829.1|  BnaAnng04900D                                          381   9e-127   Brassica napus [oilseed rape]
gb|AAM13166.1|  unknown protein                                         381   1e-126   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009130513.1|  PREDICTED: uncharacterized protein At1g04910...    381   1e-126   Brassica rapa
ref|NP_201350.2|  O-fucosyltransferase family protein                   380   1e-126   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010523312.1|  PREDICTED: uncharacterized protein At1g04910...    381   1e-126   Tarenaya hassleriana [spider flower]
emb|CDY33958.1|  BnaC02g43790D                                          380   1e-126   Brassica napus [oilseed rape]
dbj|BAB11569.1|  unnamed protein product                                381   1e-126   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010113429.1|  hypothetical protein L484_026763                   382   1e-126   
ref|XP_010547595.1|  PREDICTED: uncharacterized protein At1g04910...    380   2e-126   Tarenaya hassleriana [spider flower]
ref|XP_010444520.1|  PREDICTED: uncharacterized protein At1g04910...    380   2e-126   Camelina sativa [gold-of-pleasure]
ref|XP_006280335.1|  hypothetical protein CARUB_v10026260mg             380   2e-126   
ref|XP_010523308.1|  PREDICTED: uncharacterized protein At1g04910...    380   2e-126   Tarenaya hassleriana [spider flower]
gb|KJB18179.1|  hypothetical protein B456_003G038000                    380   2e-126   Gossypium raimondii
ref|XP_010484355.1|  PREDICTED: uncharacterized protein At1g04910...    380   2e-126   Camelina sativa [gold-of-pleasure]
gb|KJB18182.1|  hypothetical protein B456_003G038000                    380   2e-126   Gossypium raimondii
ref|XP_010463027.1|  PREDICTED: uncharacterized protein At1g04910...    380   2e-126   Camelina sativa [gold-of-pleasure]
ref|XP_004509777.1|  PREDICTED: uncharacterized protein At1g04910...    379   3e-126   Cicer arietinum [garbanzo]
ref|XP_002864958.1|  hypothetical protein ARALYDRAFT_496780             379   3e-126   
ref|XP_004143441.1|  PREDICTED: DUF246 domain-containing protein ...    379   5e-126   Cucumis sativus [cucumbers]
ref|XP_009150636.1|  PREDICTED: uncharacterized protein At1g04910       379   5e-126   Brassica rapa
ref|XP_003613050.1|  DUF246 domain-containing protein                   371   6e-126   
emb|CDY14569.1|  BnaC03g48900D                                          379   6e-126   Brassica napus [oilseed rape]
dbj|BAE71212.1|  hypothetical protein                                   375   6e-126   Trifolium pratense [peavine clover]
ref|XP_010254530.1|  PREDICTED: uncharacterized protein At1g04910...    377   3e-125   Nelumbo nucifera [Indian lotus]
gb|AFK40388.1|  unknown                                                 376   5e-125   Lotus japonicus
gb|AGV54211.1|  O-fucosyltransferase family protein                     376   1e-124   Phaseolus vulgaris [French bean]
ref|XP_010519195.1|  PREDICTED: uncharacterized protein At1g04910...    375   4e-124   Tarenaya hassleriana [spider flower]
gb|EPS72903.1|  hypothetical protein M569_01846                         371   4e-123   Genlisea aurea
ref|XP_003613049.1|  DUF246 domain-containing protein                   372   4e-123   Medicago truncatula
ref|XP_010680342.1|  PREDICTED: uncharacterized protein At1g04910       371   6e-123   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010107675.1|  hypothetical protein L484_007693                   369   6e-122   
gb|ABJ96379.1|  expressed protein                                       367   2e-121   Prunus persica
ref|XP_007222858.1|  hypothetical protein PRUPE_ppa004255mg             367   3e-121   Prunus persica
ref|XP_006852943.1|  hypothetical protein AMTR_s00033p00238220          365   3e-121   
ref|XP_006338062.1|  PREDICTED: uncharacterized protein At1g04910...    366   7e-121   Solanum tuberosum [potatoes]
ref|XP_004237994.1|  PREDICTED: uncharacterized protein At1g04910       366   9e-121   Solanum lycopersicum
ref|XP_010937178.1|  PREDICTED: uncharacterized protein At1g04910...    367   1e-120   Elaeis guineensis
ref|XP_008219267.1|  PREDICTED: uncharacterized protein At1g04910...    364   4e-120   Prunus mume [ume]
ref|XP_010523344.1|  PREDICTED: uncharacterized protein At1g04910       364   4e-120   Tarenaya hassleriana [spider flower]
emb|CAN78778.1|  hypothetical protein VITISV_029752                     363   5e-120   Vitis vinifera
ref|XP_002283844.1|  PREDICTED: uncharacterized protein At1g04910...    363   7e-120   Vitis vinifera
gb|EPS73888.1|  hypothetical protein M569_00867                         363   9e-120   Genlisea aurea
ref|XP_007018221.1|  O-fucosyltransferase family protein                364   1e-119   
ref|XP_010939815.1|  PREDICTED: uncharacterized protein At1g04910...    364   1e-119   
ref|XP_009624657.1|  PREDICTED: uncharacterized protein At1g04910...    363   1e-119   Nicotiana tomentosiformis
gb|KCW68511.1|  hypothetical protein EUGRSUZ_F02148                     362   2e-119   Eucalyptus grandis [rose gum]
ref|XP_009401410.1|  PREDICTED: uncharacterized protein At1g04910...    363   2e-119   
ref|XP_010061545.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    362   3e-119   Eucalyptus grandis [rose gum]
ref|XP_009785662.1|  PREDICTED: uncharacterized protein At1g04910...    362   3e-119   Nicotiana sylvestris
emb|CDP11502.1|  unnamed protein product                                362   3e-119   Coffea canephora [robusta coffee]
ref|XP_010692399.1|  PREDICTED: uncharacterized protein At1g04910       361   3e-119   Beta vulgaris subsp. vulgaris [field beet]
gb|KHN09000.1|  DUF246 domain-containing protein                        361   6e-119   Glycine soja [wild soybean]
ref|XP_004301363.1|  PREDICTED: uncharacterized protein At1g04910       361   9e-119   Fragaria vesca subsp. vesca
ref|XP_004501643.1|  PREDICTED: uncharacterized protein At1g04910...    360   1e-118   Cicer arietinum [garbanzo]
gb|AGV54860.1|  O-fucosyltransferase family protein                     360   2e-118   Phaseolus vulgaris [French bean]
ref|XP_003526543.1|  PREDICTED: uncharacterized protein At1g04910...    359   4e-118   Glycine max [soybeans]
ref|XP_006472461.1|  PREDICTED: uncharacterized protein At1g04910...    358   8e-118   Citrus sinensis [apfelsine]
gb|KJB58883.1|  hypothetical protein B456_009G229500                    357   1e-117   Gossypium raimondii
ref|XP_006472463.1|  PREDICTED: uncharacterized protein At1g04910...    358   1e-117   
gb|KDP41479.1|  hypothetical protein JCGZ_15886                         357   2e-117   Jatropha curcas
gb|KJB58881.1|  hypothetical protein B456_009G229500                    357   2e-117   Gossypium raimondii
ref|XP_008368388.1|  PREDICTED: uncharacterized protein At1g04910...    357   2e-117   
ref|XP_010277497.1|  PREDICTED: uncharacterized protein At1g04910...    357   3e-117   Nelumbo nucifera [Indian lotus]
ref|XP_009376221.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    356   6e-117   Pyrus x bretschneideri [bai li]
ref|XP_003602912.1|  PsRT17-1 like protein                              356   6e-117   Medicago truncatula
ref|XP_002514041.1|  conserved hypothetical protein                     356   7e-117   Ricinus communis
ref|XP_009138156.1|  PREDICTED: uncharacterized protein At1g04910       356   7e-117   Brassica rapa
ref|XP_003523785.1|  PREDICTED: uncharacterized protein At1g04910...    355   9e-117   Glycine max [soybeans]
gb|KHN08263.1|  DUF246 domain-containing protein                        355   1e-116   Glycine soja [wild soybean]
ref|XP_006433826.1|  hypothetical protein CICLE_v10000880mg             355   1e-116   
ref|XP_006433827.1|  hypothetical protein CICLE_v10000880mg             355   1e-116   Citrus clementina [clementine]
emb|CAA23010.1|  PsRT17-1 like protein                                  352   2e-116   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002867661.1|  predicted protein                                  354   5e-116   Arabidopsis lyrata subsp. lyrata
ref|XP_011016934.1|  PREDICTED: uncharacterized protein At1g04910...    352   1e-115   Populus euphratica
emb|CDY03446.1|  BnaC01g16360D                                          356   1e-115   
ref|XP_011016933.1|  PREDICTED: uncharacterized protein At1g04910...    352   1e-115   Populus euphratica
ref|XP_008651492.1|  PREDICTED: LOC100283829 isoform X1                 350   3e-115   Zea mays [maize]
ref|XP_002301095.2|  hypothetical protein POPTR_0002s10600g             351   4e-115   
gb|KFK28724.1|  hypothetical protein AALP_AA7G039000                    351   4e-115   Arabis alpina [alpine rockcress]
ref|XP_010439017.1|  PREDICTED: uncharacterized protein At1g04910...    351   6e-115   
ref|NP_194184.2|  O-fucosyltransferase family protein                   351   6e-115   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010448552.1|  PREDICTED: uncharacterized protein At1g04910...    351   8e-115   Camelina sativa [gold-of-pleasure]
ref|NP_001063155.1|  Os09g0412200                                       350   1e-114   
ref|XP_010433755.1|  PREDICTED: uncharacterized protein At1g04910...    350   1e-114   Camelina sativa [gold-of-pleasure]
emb|CDY34289.1|  BnaA01g13920D                                          357   2e-114   Brassica napus [oilseed rape]
ref|XP_006661225.1|  PREDICTED: uncharacterized protein At1g04910...    348   2e-114   
ref|NP_001150199.1|  LOC100283829                                       349   3e-114   Zea mays [maize]
ref|XP_004956798.1|  PREDICTED: uncharacterized protein At1g04910...    348   6e-114   Setaria italica
ref|XP_006285210.1|  hypothetical protein CARUB_v10006569mg             347   1e-113   Capsella rubella
ref|XP_008444924.1|  PREDICTED: uncharacterized protein At1g04910...    346   4e-113   Cucumis melo [Oriental melon]
ref|XP_006413418.1|  hypothetical protein EUTSA_v10024936mg             346   4e-113   Eutrema salsugineum [saltwater cress]
dbj|BAK06980.1|  predicted protein                                      345   2e-112   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT16885.1|  hypothetical protein F775_06176                         344   2e-112   
ref|XP_002462371.1|  hypothetical protein SORBIDRAFT_02g024540          344   3e-112   Sorghum bicolor [broomcorn]
ref|XP_004152738.1|  PREDICTED: DUF246 domain-containing protein ...    344   3e-112   Cucumis sativus [cucumbers]
gb|EMS64135.1|  hypothetical protein TRIUR3_23110                       343   5e-112   Triticum urartu
gb|EEC84568.1|  hypothetical protein OsI_31345                          343   1e-111   Oryza sativa Indica Group [Indian rice]
tpg|DAA61415.1|  TPA: hypothetical protein ZEAMMB73_640362              340   5e-111   
ref|XP_003578106.1|  PREDICTED: uncharacterized protein At1g04910...    338   8e-110   Brachypodium distachyon [annual false brome]
gb|EEE69695.1|  hypothetical protein OsJ_29339                          342   4e-109   Oryza sativa Japonica Group [Japonica rice]
gb|KGN62755.1|  hypothetical protein Csa_2G370540                       344   1e-105   Cucumis sativus [cucumbers]
gb|KJB48896.1|  hypothetical protein B456_008G092600                    320   5e-103   Gossypium raimondii
gb|AAB72114.1|  PsRT17-1                                                308   8e-100   Pisum sativum [garden pea]
ref|XP_010312650.1|  PREDICTED: uncharacterized protein At1g04910...    306   6e-98    Solanum lycopersicum
ref|XP_001777077.1|  predicted protein                                  294   1e-93    
ref|XP_002967262.1|  hypothetical protein SELMODRAFT_87093              286   2e-90    
ref|XP_002960458.1|  hypothetical protein SELMODRAFT_75338              286   3e-90    
ref|XP_008802622.1|  PREDICTED: uncharacterized protein At1g04910...    275   9e-86    Phoenix dactylifera
ref|XP_007047792.1|  O-fucosyltransferase family protein isoform 2      268   4e-84    
gb|KHG22139.1|  hypothetical protein F383_05782                         264   1e-81    Gossypium arboreum [tree cotton]
ref|XP_007136338.1|  hypothetical protein PHAVU_009G0371000g            259   7e-80    Phaseolus vulgaris [French bean]
gb|KJB18181.1|  hypothetical protein B456_003G038000                    258   1e-79    Gossypium raimondii
ref|XP_010664406.1|  PREDICTED: uncharacterized protein At1g04910...    258   1e-79    Vitis vinifera
ref|XP_001765982.1|  predicted protein                                  198   2e-56    
emb|CDX92640.1|  BnaC07g38980D                                          188   8e-55    
tpg|DAA61413.1|  TPA: hypothetical protein ZEAMMB73_640362              182   3e-54    
ref|XP_002987806.1|  hypothetical protein SELMODRAFT_126689             186   1e-52    
ref|XP_002990403.1|  hypothetical protein SELMODRAFT_131659             183   2e-51    
ref|NP_001132122.1|  uncharacterized protein LOC100193539               174   1e-48    
ref|XP_006826849.1|  hypothetical protein AMTR_s00010p00112560          179   2e-48    Amborella trichopoda
ref|XP_010104478.1|  hypothetical protein L484_025447                   171   2e-48    
gb|EMT33054.1|  hypothetical protein F775_09106                         176   4e-48    
ref|XP_008669806.1|  PREDICTED: uncharacterized protein At1g04910...    176   8e-48    Zea mays [maize]
ref|XP_009390064.1|  PREDICTED: uncharacterized protein At1g04910...    176   1e-47    
ref|XP_009390063.1|  PREDICTED: uncharacterized protein At1g04910...    176   2e-47    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008669805.1|  PREDICTED: uncharacterized protein At1g04910...    176   2e-47    Zea mays [maize]
emb|CDP10650.1|  unnamed protein product                                175   5e-47    Coffea canephora [robusta coffee]
gb|AFW56213.1|  hypothetical protein ZEAMMB73_697257                    174   6e-47    
ref|XP_003578848.1|  PREDICTED: uncharacterized protein At1g04910...    174   7e-47    Brachypodium distachyon [annual false brome]
gb|EMS55867.1|  hypothetical protein TRIUR3_34733                       172   9e-47    Triticum urartu
ref|XP_008661414.1|  PREDICTED: uncharacterized protein LOC100193...    174   1e-46    Zea mays [maize]
ref|XP_010695805.1|  PREDICTED: uncharacterized protein At1g04910...    173   2e-46    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006473173.1|  PREDICTED: uncharacterized protein At1g04910...    171   2e-46    Citrus sinensis [apfelsine]
gb|KJB30799.1|  hypothetical protein B456_005G161000                    172   3e-46    Gossypium raimondii
ref|XP_010274715.1|  PREDICTED: uncharacterized protein At1g04910...    172   4e-46    Nelumbo nucifera [Indian lotus]
ref|XP_006434582.1|  hypothetical protein CICLE_v10000533mg             170   4e-46    Citrus clementina [clementine]
dbj|BAJ97328.1|  predicted protein                                      172   6e-46    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009362464.1|  PREDICTED: uncharacterized protein At1g04910...    169   1e-45    Pyrus x bretschneideri [bai li]
ref|XP_010246043.1|  PREDICTED: uncharacterized protein At1g04910...    169   1e-45    Nelumbo nucifera [Indian lotus]
ref|XP_006473171.1|  PREDICTED: uncharacterized protein At1g04910...    171   1e-45    
ref|XP_007045152.1|  O-fucosyltransferase family protein                171   2e-45    Theobroma cacao [chocolate]
ref|XP_006434583.1|  hypothetical protein CICLE_v10000533mg             171   2e-45    
ref|XP_008784225.1|  PREDICTED: uncharacterized protein At1g04910...    170   2e-45    Phoenix dactylifera
ref|XP_010262622.1|  PREDICTED: uncharacterized protein At1g04910...    170   2e-45    Nelumbo nucifera [Indian lotus]
ref|XP_010538926.1|  PREDICTED: uncharacterized protein At1g04910...    170   2e-45    Tarenaya hassleriana [spider flower]
ref|XP_006434581.1|  hypothetical protein CICLE_v10000533mg             171   2e-45    
ref|XP_004299893.1|  PREDICTED: uncharacterized protein At1g04910       170   3e-45    Fragaria vesca subsp. vesca
ref|XP_010246042.1|  PREDICTED: uncharacterized protein At1g04910...    169   3e-45    Nelumbo nucifera [Indian lotus]
emb|CBI18521.3|  unnamed protein product                                169   3e-45    Vitis vinifera
ref|XP_002441904.1|  hypothetical protein SORBIDRAFT_08g004650          169   3e-45    
ref|XP_011096470.1|  PREDICTED: uncharacterized protein At1g04910       169   4e-45    Sesamum indicum [beniseed]
ref|XP_010246041.1|  PREDICTED: uncharacterized protein At1g04910...    169   4e-45    Nelumbo nucifera [Indian lotus]
ref|XP_009420104.1|  PREDICTED: uncharacterized protein At1g04910...    169   5e-45    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010246040.1|  PREDICTED: uncharacterized protein At1g04910...    169   7e-45    Nelumbo nucifera [Indian lotus]
ref|XP_009362462.1|  PREDICTED: uncharacterized protein At1g04910...    169   8e-45    Pyrus x bretschneideri [bai li]
gb|AFK46212.1|  unknown                                                 165   9e-45    Medicago truncatula
ref|XP_002272758.2|  PREDICTED: uncharacterized protein At1g04910       169   9e-45    Vitis vinifera
ref|XP_006582446.1|  PREDICTED: uncharacterized protein At1g04910...    167   1e-44    Glycine max [soybeans]
ref|XP_009407491.1|  PREDICTED: uncharacterized protein At1g04910...    168   1e-44    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008776785.1|  PREDICTED: uncharacterized protein At1g04910...    168   1e-44    
gb|KJB15424.1|  hypothetical protein B456_002G178200                    168   1e-44    Gossypium raimondii
gb|KHN47089.1|  DUF246 domain-containing protein                        168   2e-44    Glycine soja [wild soybean]
ref|XP_008378761.1|  PREDICTED: uncharacterized protein At1g04910       166   2e-44    
ref|XP_003526401.1|  PREDICTED: uncharacterized protein At1g04910...    167   2e-44    Glycine max [soybeans]
ref|XP_006304663.1|  hypothetical protein CARUB_v10011867mg             167   2e-44    Capsella rubella
gb|KHG09805.1|  hypothetical protein F383_15167                         167   3e-44    Gossypium arboreum [tree cotton]
ref|XP_006664382.1|  PREDICTED: uncharacterized protein At1g04910...    165   3e-44    
gb|KDO64642.1|  hypothetical protein CISIN_1g008637mg                   167   3e-44    Citrus sinensis [apfelsine]
ref|XP_006469184.1|  PREDICTED: uncharacterized protein At1g04910...    167   3e-44    Citrus sinensis [apfelsine]
ref|XP_006448248.1|  hypothetical protein CICLE_v10014776mg             167   3e-44    Citrus clementina [clementine]
ref|XP_006349651.1|  PREDICTED: uncharacterized protein At1g04910...    167   3e-44    Solanum tuberosum [potatoes]
gb|AES59903.2|  O-fucosyltransferase family protein                     167   3e-44    Medicago truncatula
gb|KHG19963.1|  hypothetical protein F383_04918                         167   3e-44    Gossypium arboreum [tree cotton]
ref|XP_003589652.1|  hypothetical protein MTR_1g031590                  167   4e-44    
ref|XP_010066619.1|  PREDICTED: uncharacterized protein At1g04910       167   4e-44    Eucalyptus grandis [rose gum]
ref|XP_004238827.1|  PREDICTED: uncharacterized protein At1g04910       167   4e-44    Solanum lycopersicum
ref|XP_006397450.1|  hypothetical protein EUTSA_v10001813mg             167   4e-44    Eutrema salsugineum [saltwater cress]
ref|XP_010931259.1|  PREDICTED: uncharacterized protein At1g04910...    166   4e-44    
ref|XP_010461317.1|  PREDICTED: uncharacterized protein At1g04910...    166   5e-44    Camelina sativa [gold-of-pleasure]
ref|XP_010500036.1|  PREDICTED: uncharacterized protein At1g04910...    166   5e-44    Camelina sativa [gold-of-pleasure]
ref|XP_004977274.1|  PREDICTED: uncharacterized protein At1g04910...    166   5e-44    
ref|XP_007222464.1|  hypothetical protein PRUPE_ppa003505mg             166   6e-44    
ref|XP_010093364.1|  hypothetical protein L484_022926                   166   7e-44    Morus notabilis
dbj|BAD81763.1|  putative auxin-independent growth promoter             162   8e-44    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010931258.1|  PREDICTED: uncharacterized protein At1g04910...    166   8e-44    Elaeis guineensis
ref|XP_002284457.1|  PREDICTED: uncharacterized protein At1g04910       166   8e-44    Vitis vinifera
ref|NP_001066285.2|  Os12g0174100                                       164   1e-43    
ref|XP_004498294.1|  PREDICTED: uncharacterized protein At1g04910...    165   1e-43    Cicer arietinum [garbanzo]
ref|XP_009379852.1|  PREDICTED: uncharacterized protein At1g04910...    165   1e-43    Musa acuminata subsp. malaccensis [pisang utan]
gb|EEC68940.1|  hypothetical protein OsI_37646                          166   1e-43    Oryza sativa Indica Group [Indian rice]
ref|XP_002891187.1|  hypothetical protein ARALYDRAFT_473680             165   1e-43    
ref|XP_004498293.1|  PREDICTED: uncharacterized protein At1g04910...    165   1e-43    Cicer arietinum [garbanzo]
gb|EYU22809.1|  hypothetical protein MIMGU_mgv1a003510mg                165   1e-43    Erythranthe guttata [common monkey flower]
ref|XP_008389203.1|  PREDICTED: uncharacterized protein At1g04910...    158   1e-43    
ref|XP_003598018.1|  DUF246 domain-containing protein                   165   2e-43    
gb|EEE52851.1|  hypothetical protein OsJ_35390                          165   2e-43    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006841300.1|  hypothetical protein AMTR_s00134p00086190          164   2e-43    
gb|KJB59186.1|  hypothetical protein B456_009G243300                    163   2e-43    Gossypium raimondii
ref|XP_010912508.1|  PREDICTED: uncharacterized protein At1g04910...    164   2e-43    Elaeis guineensis
ref|NP_001044765.1|  Os01g0841200                                       162   2e-43    
ref|XP_009598681.1|  PREDICTED: uncharacterized protein At1g04910       162   2e-43    
ref|XP_004499553.1|  PREDICTED: uncharacterized protein At1g04910...    164   2e-43    Cicer arietinum [garbanzo]
ref|XP_006472724.1|  PREDICTED: uncharacterized protein At1g04910...    164   2e-43    Citrus sinensis [apfelsine]
ref|XP_004505284.1|  PREDICTED: uncharacterized protein At1g04910...    164   2e-43    Cicer arietinum [garbanzo]
ref|XP_006644988.1|  PREDICTED: uncharacterized protein At1g04910...    163   2e-43    
emb|CDY03127.1|  BnaC06g08460D                                          164   3e-43    
ref|XP_010922337.1|  PREDICTED: uncharacterized protein At1g04910...    164   3e-43    Elaeis guineensis
ref|XP_010319880.1|  PREDICTED: uncharacterized protein At1g04910...    164   3e-43    Solanum lycopersicum
ref|XP_006579000.1|  PREDICTED: uncharacterized protein At1g04910...    164   3e-43    
ref|XP_009379518.1|  PREDICTED: uncharacterized protein At1g04910...    164   3e-43    Pyrus x bretschneideri [bai li]
ref|XP_006355100.1|  PREDICTED: uncharacterized protein At1g04910...    164   3e-43    Solanum tuberosum [potatoes]
emb|CDY66921.1|  BnaAnng23210D                                          164   3e-43    Brassica napus [oilseed rape]
ref|XP_004237568.1|  PREDICTED: uncharacterized protein At1g04910...    164   3e-43    Solanum lycopersicum
gb|EYU30069.1|  hypothetical protein MIMGU_mgv1a003875mg                164   3e-43    Erythranthe guttata [common monkey flower]
gb|AAK93632.1|  putative growth regulator protein                       164   3e-43    Arabidopsis thaliana [mouse-ear cress]
ref|NP_564461.1|  O-fucosyltransferase-like protein                     164   3e-43    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009114709.1|  PREDICTED: uncharacterized protein At1g04910       164   3e-43    Brassica rapa
ref|XP_009416135.1|  PREDICTED: uncharacterized protein At1g04910...    164   3e-43    
ref|XP_007148603.1|  hypothetical protein PHAVU_005G000400g             164   3e-43    Phaseolus vulgaris [French bean]
ref|XP_008219032.1|  PREDICTED: uncharacterized protein At1g04910       163   4e-43    Prunus mume [ume]
ref|XP_004963730.1|  PREDICTED: uncharacterized protein At1g04910...    164   4e-43    
gb|KFK27807.1|  hypothetical protein AALP_AA8G431600                    164   4e-43    
ref|XP_009594772.1|  PREDICTED: uncharacterized protein At1g04910       164   4e-43    
gb|EEE55649.1|  hypothetical protein OsJ_04031                          162   4e-43    
ref|XP_006472723.1|  PREDICTED: uncharacterized protein At1g04910...    164   5e-43    
ref|XP_006578999.1|  PREDICTED: uncharacterized protein At1g04910...    164   5e-43    
gb|KHN08072.1|  DUF246 domain-containing protein                        162   6e-43    
gb|EEC71770.1|  hypothetical protein OsI_04380                          161   6e-43    
ref|XP_010478945.1|  PREDICTED: uncharacterized protein At1g04910...    163   7e-43    
gb|KJB28879.1|  hypothetical protein B456_005G074200                    163   7e-43    
ref|XP_003556095.1|  PREDICTED: uncharacterized protein At1g04910...    163   7e-43    
ref|XP_006434132.1|  hypothetical protein CICLE_v10000652mg             162   8e-43    
ref|XP_007157752.1|  hypothetical protein PHAVU_002G095600g             163   8e-43    
ref|XP_010274355.1|  PREDICTED: uncharacterized protein At1g04910...    163   9e-43    
gb|KJB50369.1|  hypothetical protein B456_008G166900                    163   9e-43    
gb|KDP34835.1|  hypothetical protein JCGZ_11197                         163   9e-43    
ref|XP_002450409.1|  hypothetical protein SORBIDRAFT_05g004890          162   1e-42    
gb|EEE51747.1|  hypothetical protein OsJ_33163                          162   1e-42    
gb|KJB28877.1|  hypothetical protein B456_005G074200                    163   1e-42    
ref|XP_009781764.1|  PREDICTED: uncharacterized protein At1g04910       162   1e-42    
ref|XP_009785418.1|  PREDICTED: uncharacterized protein At1g04910...    162   1e-42    
ref|XP_008339538.1|  PREDICTED: uncharacterized protein At1g04910...    162   1e-42    
ref|XP_009351481.1|  PREDICTED: uncharacterized protein At1g04910...    162   1e-42    
gb|EEC67779.1|  hypothetical protein OsI_35317                          162   2e-42    
ref|XP_006434133.1|  hypothetical protein CICLE_v10000652mg             162   2e-42    
ref|XP_009339689.1|  PREDICTED: uncharacterized protein At1g04910...    162   2e-42    
gb|KJB59187.1|  hypothetical protein B456_009G243300                    162   2e-42    
ref|XP_004150597.1|  PREDICTED: DUF246 domain-containing protein ...    162   2e-42    
gb|KJB59188.1|  hypothetical protein B456_009G243300                    162   2e-42    
emb|CDP00784.1|  unnamed protein product                                161   3e-42    
ref|XP_010930789.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    161   4e-42    
gb|KEH30846.1|  O-fucosyltransferase family protein                     161   4e-42    
ref|XP_002526030.1|  conserved hypothetical protein                     161   4e-42    
emb|CAN77011.1|  hypothetical protein VITISV_036881                     161   5e-42    
ref|XP_004141562.1|  PREDICTED: DUF246 domain-containing protein ...    160   5e-42    
ref|XP_004970534.1|  PREDICTED: uncharacterized protein At1g04910...    160   6e-42    
ref|XP_007225729.1|  hypothetical protein PRUPE_ppa003622mg             160   6e-42    
ref|XP_003564587.1|  PREDICTED: uncharacterized protein At1g04910...    160   6e-42    
ref|XP_008383543.1|  PREDICTED: uncharacterized protein At1g04910...    155   6e-42    
ref|XP_008349183.1|  PREDICTED: uncharacterized protein At1g04910...    155   7e-42    
ref|XP_011003993.1|  PREDICTED: uncharacterized protein At1g04910       160   7e-42    
gb|KHN43011.1|  DUF246 domain-containing protein                        159   7e-42    
ref|XP_010527785.1|  PREDICTED: uncharacterized protein At1g04910       160   8e-42    
ref|XP_008645342.1|  PREDICTED: uncharacterized protein At1g04910...    155   8e-42    
ref|XP_002315879.1|  hypothetical protein POPTR_0010s12160g             160   9e-42    
ref|XP_006847061.1|  hypothetical protein AMTR_s00017p00201590          160   9e-42    
ref|XP_004297377.1|  PREDICTED: uncharacterized protein At1g04910       160   9e-42    
ref|XP_010061979.1|  PREDICTED: uncharacterized protein At1g04910...    160   1e-41    
ref|XP_008674838.1|  PREDICTED: uncharacterized protein At1g04910...    160   1e-41    
gb|KHG28222.1|  hypothetical protein F383_11890                         158   1e-41    
ref|XP_010553860.1|  PREDICTED: uncharacterized protein At1g04910...    160   1e-41    
ref|XP_002325978.2|  hypothetical protein POPTR_0019s11020g             160   1e-41    
ref|XP_008656362.1|  PREDICTED: uncharacterized protein At1g04910...    160   1e-41    
gb|AFW82218.1|  hypothetical protein ZEAMMB73_014086                    160   1e-41    
ref|XP_001760728.1|  predicted protein                                  159   2e-41    
ref|XP_010543593.1|  PREDICTED: uncharacterized protein At1g04910...    159   2e-41    
ref|XP_003568305.1|  PREDICTED: uncharacterized protein At1g04910...    159   2e-41    
emb|CDY65925.1|  BnaC07g48790D                                          159   2e-41    
ref|XP_009101344.1|  PREDICTED: uncharacterized protein At1g04910...    159   2e-41    
dbj|BAJ88036.1|  predicted protein                                      159   2e-41    
ref|XP_009101345.1|  PREDICTED: uncharacterized protein At1g04910...    159   2e-41    
ref|XP_010543575.1|  PREDICTED: uncharacterized protein At1g04910...    159   2e-41    
gb|KDP38063.1|  hypothetical protein JCGZ_04706                         159   2e-41    
ref|XP_006398540.1|  hypothetical protein EUTSA_v10000838mg             159   3e-41    
ref|XP_010272863.1|  PREDICTED: uncharacterized protein At1g04910...    159   3e-41    
ref|XP_008467134.1|  PREDICTED: uncharacterized protein At1g04910...    159   3e-41    
ref|XP_003529417.1|  PREDICTED: uncharacterized protein At1g04910...    159   3e-41    
dbj|BAD46055.1|  putative axi 1                                         153   3e-41    
ref|XP_010513871.1|  PREDICTED: uncharacterized protein At1g04910...    158   4e-41    
ref|XP_002458744.1|  hypothetical protein SORBIDRAFT_03g039450          158   4e-41    
ref|XP_011038632.1|  PREDICTED: uncharacterized protein At1g04910       158   4e-41    
ref|XP_006307153.1|  hypothetical protein CARUB_v10008744mg             158   4e-41    
gb|KFK43757.1|  hypothetical protein AALP_AA1G168900                    158   5e-41    
ref|XP_009148881.1|  PREDICTED: uncharacterized protein At1g04910       158   5e-41    
emb|CDY36519.1|  BnaA06g09720D                                          158   5e-41    
ref|XP_007018985.1|  O-fucosyltransferase family protein isoform 2      158   5e-41    
ref|XP_002301007.2|  hypothetical protein POPTR_0002s08790g             158   5e-41    
ref|XP_008459666.1|  PREDICTED: uncharacterized protein At1g04910       157   6e-41    
ref|XP_010502128.1|  PREDICTED: uncharacterized protein At1g04910...    157   7e-41    
ref|XP_002533585.1|  conserved hypothetical protein                     158   7e-41    
gb|KJB44060.1|  hypothetical protein B456_007G232700                    155   9e-41    
emb|CDY33727.1|  BnaA09g45330D                                          157   9e-41    
ref|XP_001753764.1|  predicted protein                                  156   9e-41    
ref|XP_006290827.1|  hypothetical protein CARUB_v10016938mg             157   9e-41    
emb|CDY52384.1|  BnaCnng22220D                                          157   9e-41    
ref|XP_009117860.1|  PREDICTED: uncharacterized protein At1g04910...    157   9e-41    
emb|CDX81687.1|  BnaC08g39140D                                          157   1e-40    
ref|XP_009345471.1|  PREDICTED: uncharacterized protein At1g04910...    157   1e-40    
gb|AFW78262.1|  hypothetical protein ZEAMMB73_416738                    157   1e-40    
ref|XP_008649712.1|  PREDICTED: uncharacterized protein At1g04910...    157   1e-40    
ref|XP_010476573.1|  PREDICTED: uncharacterized protein At1g04910...    157   1e-40    
ref|XP_010476572.1|  PREDICTED: uncharacterized protein At1g04910...    157   1e-40    
ref|XP_001753325.1|  predicted protein                                  156   1e-40    
ref|XP_010691586.1|  PREDICTED: uncharacterized protein At1g04910...    156   2e-40    
ref|XP_011101082.1|  PREDICTED: uncharacterized protein At1g04910       156   2e-40    
ref|NP_178257.1|  O-fucosyltransferase family protein                   156   2e-40    
dbj|BAJ93371.1|  predicted protein                                      156   2e-40    
gb|KDP24728.1|  hypothetical protein JCGZ_25329                         155   3e-40    
ref|XP_010103337.1|  hypothetical protein L484_014377                   156   3e-40    
gb|KFK33363.1|  hypothetical protein AALP_AA5G004000                    156   3e-40    
gb|EPS60639.1|  hypothetical protein M569_14161                         155   3e-40    
gb|EMT20301.1|  hypothetical protein F775_28818                         154   3e-40    
ref|XP_009129233.1|  PREDICTED: uncharacterized protein At1g04910...    156   3e-40    
ref|XP_007020035.1|  O-fucosyltransferase family protein isoform 1      155   4e-40    
ref|XP_010496702.1|  PREDICTED: uncharacterized protein At1g04910...    155   5e-40    
ref|XP_010680244.1|  PREDICTED: uncharacterized protein At1g04910...    155   5e-40    
ref|XP_008235937.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    155   5e-40    
ref|XP_010496695.1|  PREDICTED: uncharacterized protein At1g04910...    155   5e-40    
emb|CDY11018.1|  BnaA03g46770D                                          144   5e-40    
ref|XP_010925619.1|  PREDICTED: uncharacterized protein At1g04910...    155   5e-40    
ref|XP_010680324.1|  PREDICTED: uncharacterized protein At1g04910...    155   5e-40    
ref|XP_009344152.1|  PREDICTED: uncharacterized protein At1g04910...    155   6e-40    
ref|XP_004235088.1|  PREDICTED: uncharacterized protein At1g04910...    155   6e-40    
gb|EMS46071.1|  hypothetical protein TRIUR3_08015                       153   8e-40    
ref|XP_002984324.1|  hypothetical protein SELMODRAFT_268854             154   9e-40    
ref|NP_001169204.1|  hypothetical protein                               152   1e-39    
ref|XP_006416955.1|  hypothetical protein EUTSA_v10007261mg             154   1e-39    
gb|ACF86391.1|  unknown                                                 154   1e-39    
ref|XP_009351480.1|  PREDICTED: uncharacterized protein At1g04910...    154   1e-39    
gb|EEE66244.1|  hypothetical protein OsJ_22422                          154   2e-39    
gb|EMT12043.1|  hypothetical protein F775_07612                         154   2e-39    
ref|XP_010459015.1|  PREDICTED: uncharacterized protein At1g04910...    153   2e-39    
gb|EMS47472.1|  hypothetical protein TRIUR3_14732                       152   2e-39    
ref|XP_010459016.1|  PREDICTED: uncharacterized protein At1g04910...    153   2e-39    
ref|XP_002438900.1|  hypothetical protein SORBIDRAFT_10g027900          153   2e-39    
ref|XP_011027600.1|  PREDICTED: uncharacterized protein At1g04910...    154   2e-39    
ref|XP_011027599.1|  PREDICTED: uncharacterized protein At1g04910...    154   2e-39    
gb|EEC81207.1|  hypothetical protein OsI_24239                          153   2e-39    
ref|XP_006657268.1|  PREDICTED: uncharacterized protein At1g04910...    152   4e-39    
ref|XP_002892842.1|  hypothetical protein ARALYDRAFT_471685             152   5e-39    
ref|NP_001152550.1|  auxin-independent growth promoter-like protein     152   5e-39    
ref|XP_002513766.1|  conserved hypothetical protein                     152   5e-39    
ref|XP_011023536.1|  PREDICTED: uncharacterized protein At1g04910...    152   6e-39    
ref|XP_002311505.2|  hypothetical protein POPTR_0008s12960g             152   6e-39    
dbj|BAJ98197.1|  predicted protein                                      152   6e-39    
ref|XP_009591037.1|  PREDICTED: uncharacterized protein At1g04910...    152   6e-39    
ref|XP_002973931.1|  hypothetical protein SELMODRAFT_100522             151   7e-39    
ref|XP_002969133.1|  hypothetical protein SELMODRAFT_90475              151   7e-39    
gb|KHN26036.1|  DUF246 domain-containing protein                        151   8e-39    
emb|CBI19065.3|  unnamed protein product                                152   8e-39    
emb|CDP07301.1|  unnamed protein product                                152   8e-39    
ref|XP_002307421.1|  hypothetical protein POPTR_0005s16060g             152   9e-39    
ref|XP_002533764.1|  conserved hypothetical protein                     152   9e-39    
ref|XP_002284399.1|  PREDICTED: uncharacterized protein At1g04910...    152   9e-39    
ref|XP_008649711.1|  PREDICTED: uncharacterized protein At1g04910...    152   9e-39    
ref|XP_007018984.1|  O-fucosyltransferase family protein isoform 1      152   1e-38    
ref|XP_009344792.1|  PREDICTED: uncharacterized protein At1g04910...    152   1e-38    
gb|AFW75942.1|  LOW QUALITY PROTEIN: auxin-independent growth pro...    154   1e-38    
ref|XP_010664246.1|  PREDICTED: uncharacterized protein At1g04910...    151   1e-38    
gb|EYU22927.1|  hypothetical protein MIMGU_mgv1a018388mg                150   1e-38    
ref|XP_006342312.1|  PREDICTED: uncharacterized protein At1g04910...    150   1e-38    
gb|AAF79365.1|AC007887_24  F15O4.45                                     152   2e-38    
ref|XP_011070621.1|  PREDICTED: uncharacterized protein At1g04910...    151   2e-38    
ref|XP_009391469.1|  PREDICTED: uncharacterized protein At1g04910...    151   2e-38    
ref|XP_004513833.1|  PREDICTED: uncharacterized protein At1g04910...    151   2e-38    
ref|XP_006342311.1|  PREDICTED: uncharacterized protein At1g04910...    150   2e-38    
ref|XP_003635616.2|  PREDICTED: uncharacterized protein At1g04910...    145   2e-38    
ref|XP_002312912.2|  hypothetical protein POPTR_0009s14510g             150   2e-38    
ref|XP_008243446.1|  PREDICTED: uncharacterized protein At1g04910       150   2e-38    
gb|KJB58885.1|  hypothetical protein B456_009G229500                    148   3e-38    
ref|XP_010646204.1|  PREDICTED: uncharacterized protein At1g04910...    150   3e-38    
ref|XP_009373425.1|  PREDICTED: uncharacterized protein At1g04910...    149   4e-38    
emb|CBI37793.3|  unnamed protein product                                150   4e-38    
gb|KDP32763.1|  hypothetical protein JCGZ_12055                         150   4e-38    
emb|CBI14835.3|  unnamed protein product                                143   4e-38    
ref|XP_010063352.1|  PREDICTED: uncharacterized protein At1g04910...    150   5e-38    
ref|XP_006664407.1|  PREDICTED: uncharacterized protein At1g04910...    148   5e-38    
ref|XP_011045156.1|  PREDICTED: uncharacterized protein At1g04910...    149   5e-38    
ref|XP_002972493.1|  hypothetical protein SELMODRAFT_441812             152   5e-38    
ref|XP_011046291.1|  PREDICTED: uncharacterized protein At1g04910...    149   5e-38    
ref|XP_003614789.1|  Growth regulator-related protein                   149   5e-38    
ref|XP_011046290.1|  PREDICTED: uncharacterized protein At1g04910...    149   5e-38    
ref|XP_007141089.1|  hypothetical protein PHAVU_008G166600g             149   5e-38    
ref|XP_002306226.1|  hypothetical protein POPTR_0004s19390g             149   6e-38    
ref|XP_009768450.1|  PREDICTED: uncharacterized protein At1g04910...    149   8e-38    
ref|XP_009793733.1|  PREDICTED: uncharacterized protein At1g04910...    149   8e-38    
gb|EEE52890.1|  hypothetical protein OsJ_35473                          148   8e-38    
gb|AAM67369.1|  unknown                                                 146   9e-38    
ref|XP_011088688.1|  PREDICTED: uncharacterized protein At1g04910       149   9e-38    
ref|XP_006596302.1|  PREDICTED: uncharacterized protein At1g04910...    149   9e-38    
ref|XP_010530190.1|  PREDICTED: uncharacterized protein At1g04910...    149   9e-38    
gb|KJB15940.1|  hypothetical protein B456_002G205500                    149   1e-37    
gb|KFK32890.1|  hypothetical protein AALP_AA6G300900                    149   1e-37    
ref|XP_008372993.1|  PREDICTED: uncharacterized protein At1g04910...    148   1e-37    
ref|NP_001066339.1|  Os12g0190100                                       148   1e-37    
ref|XP_008378640.1|  PREDICTED: uncharacterized protein At1g04910...    147   1e-37    
ref|XP_002451572.1|  hypothetical protein SORBIDRAFT_04g004090          148   1e-37    
ref|XP_002893927.1|  hypothetical protein ARALYDRAFT_473732             148   1e-37    
ref|XP_008444126.1|  PREDICTED: uncharacterized protein At1g04910...    148   1e-37    
ref|XP_008372992.1|  PREDICTED: uncharacterized protein At1g04910...    148   1e-37    
gb|EEC68978.1|  hypothetical protein OsI_37727                          147   2e-37    
ref|XP_009398160.1|  PREDICTED: uncharacterized protein At1g04910...    148   2e-37    
gb|AAF79229.1|AC006917_14  F10B6.36                                     147   2e-37    
ref|XP_010930931.1|  PREDICTED: uncharacterized protein At1g04910...    148   2e-37    
ref|NP_849755.1|  O-fucosyltransferase-like protein                     147   2e-37    
ref|XP_010100364.1|  hypothetical protein L484_027673                   148   2e-37    
gb|EPS69385.1|  hypothetical protein M569_05376                         148   2e-37    
ref|XP_010666088.1|  PREDICTED: uncharacterized protein At1g04910...    148   2e-37    
ref|XP_009348039.1|  PREDICTED: uncharacterized protein At1g04910...    147   2e-37    
ref|XP_003560475.2|  PREDICTED: uncharacterized protein At1g04910...    148   2e-37    
ref|XP_009390143.1|  PREDICTED: uncharacterized protein At1g04910...    147   2e-37    
ref|XP_010682284.1|  PREDICTED: uncharacterized protein At1g04910       147   2e-37    
ref|XP_009110564.1|  PREDICTED: uncharacterized protein At1g04910...    147   2e-37    
ref|XP_007041650.1|  O-fucosyltransferase family protein                148   2e-37    
gb|KHN46874.1|  DUF246 domain-containing protein                        147   2e-37    
ref|XP_002875074.1|  hypothetical protein ARALYDRAFT_484066             147   2e-37    
dbj|BAK00215.1|  predicted protein                                      146   2e-37    
emb|CDX73383.1|  BnaC05g27230D                                          147   2e-37    
ref|XP_009145111.1|  PREDICTED: uncharacterized protein At1g04910       147   3e-37    
ref|XP_003545060.2|  PREDICTED: uncharacterized protein At1g04910...    147   3e-37    
ref|XP_009373119.1|  PREDICTED: uncharacterized protein At1g04910...    147   3e-37    
ref|XP_004142690.1|  PREDICTED: DUF246 domain-containing protein ...    147   3e-37    
ref|NP_172950.1|  O-fucosyltransferase family protein                   147   3e-37    
emb|CDP01105.1|  unnamed protein product                                147   3e-37    
ref|XP_008446146.1|  PREDICTED: uncharacterized protein At1g04910       147   3e-37    
ref|XP_006581141.1|  PREDICTED: uncharacterized protein At1g04910...    146   3e-37    
ref|XP_009367298.1|  PREDICTED: uncharacterized protein At1g04910...    147   3e-37    
gb|EYU17502.1|  hypothetical protein MIMGU_mgv1a003569mg                147   3e-37    
gb|KJB14307.1|  hypothetical protein B456_002G118200                    144   4e-37    
ref|XP_004135279.1|  PREDICTED: DUF246 domain-containing protein ...    147   4e-37    
ref|XP_007221795.1|  hypothetical protein PRUPE_ppa003430mg             147   4e-37    



>gb|KDP29763.1| hypothetical protein JCGZ_18698 [Jatropha curcas]
Length=509

 Score =   399 bits (1025),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 185/211 (88%), Positives = 198/211 (94%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLA
Sbjct  299  DMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRSQGRCPLTPEEIGLLLA  358

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDN+TRLYLASHKVYGG ARIS LR LFPLME+KKSLASSEER +IKGKASLLAAVD
Sbjct  359  ALGFDNSTRLYLASHKVYGGEARISTLRTLFPLMEDKKSLASSEERAQIKGKASLLAAVD  418

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYVG+HSDIFISASPGNMHNA+VGHRTY NLKTIRPNM LLGQLFLNKN++W +FQ AV+
Sbjct  419  YYVGLHSDIFISASPGNMHNALVGHRTYKNLKTIRPNMALLGQLFLNKNISWSDFQQAVL  478

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH NRQGEIRLRKP KS+YTYPAPDCMC A
Sbjct  479  EGHENRQGEIRLRKPKKSIYTYPAPDCMCQA  509



>ref|XP_011097478.1| PREDICTED: uncharacterized protein At1g04910-like [Sesamum indicum]
Length=516

 Score =   398 bits (1023),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 184/211 (87%), Positives = 198/211 (94%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRS+GRCPLTPEE+GLLLA
Sbjct  306  DMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRSRGRCPLTPEEIGLLLA  365

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDN+TRLYLASHKVYGG ARIS LR LFP ME+KKSLASSEER +IKGKASLLAAVD
Sbjct  366  ALGFDNSTRLYLASHKVYGGEARISTLRSLFPHMEDKKSLASSEERAQIKGKASLLAAVD  425

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV MHSDIFISASPGNMHNA+VGHRTY N KTIRP+M LLGQLFLNKNLTWPEFQDAV+
Sbjct  426  YYVSMHSDIFISASPGNMHNAVVGHRTYENKKTIRPSMTLLGQLFLNKNLTWPEFQDAVV  485

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH NRQG++RLRKP +S+YTYPAPDCMCNA
Sbjct  486  EGHKNRQGQLRLRKPQQSIYTYPAPDCMCNA  516



>ref|XP_006353172.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Solanum tuberosum]
Length=506

 Score =   398 bits (1022),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 185/211 (88%), Positives = 197/211 (93%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAE L+LAKYRQ+ W GRV+NSQFTDEELRSQGRCPLTPEEVGLLLA
Sbjct  296  DMAAHSACDFGGGKAENLALAKYRQVIWGGRVINSQFTDEELRSQGRCPLTPEEVGLLLA  355

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDNNTRLYLASHKVYGG  R+SALR LFPLME+KKSLASSEER  IKGKASLLAAVD
Sbjct  356  ALGFDNNTRLYLASHKVYGGERRVSALRSLFPLMEDKKSLASSEERALIKGKASLLAAVD  415

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYVGMHSDIF+SASPGNMHNAMVGHRTY+N+KTIRPNM LLGQLFLNK LTWPEFQ++VI
Sbjct  416  YYVGMHSDIFVSASPGNMHNAMVGHRTYNNMKTIRPNMALLGQLFLNKTLTWPEFQESVI  475

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH NRQG+IRLRKP +SLYTYPAPDCMC A
Sbjct  476  EGHQNRQGQIRLRKPKQSLYTYPAPDCMCQA  506



>ref|XP_006353173.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Solanum tuberosum]
Length=505

 Score =   398 bits (1022),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 185/211 (88%), Positives = 197/211 (93%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAE L+LAKYRQ+ W GRV+NSQFTDEELRSQGRCPLTPEEVGLLLA
Sbjct  295  DMAAHSACDFGGGKAENLALAKYRQVIWGGRVINSQFTDEELRSQGRCPLTPEEVGLLLA  354

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDNNTRLYLASHKVYGG  R+SALR LFPLME+KKSLASSEER  IKGKASLLAAVD
Sbjct  355  ALGFDNNTRLYLASHKVYGGERRVSALRSLFPLMEDKKSLASSEERALIKGKASLLAAVD  414

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYVGMHSDIF+SASPGNMHNAMVGHRTY+N+KTIRPNM LLGQLFLNK LTWPEFQ++VI
Sbjct  415  YYVGMHSDIFVSASPGNMHNAMVGHRTYNNMKTIRPNMALLGQLFLNKTLTWPEFQESVI  474

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH NRQG+IRLRKP +SLYTYPAPDCMC A
Sbjct  475  EGHQNRQGQIRLRKPKQSLYTYPAPDCMCQA  505



>gb|AAK84479.1| putative auxin growth promotor protein [Solanum lycopersicum]
Length=478

 Score =   395 bits (1015),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 184/211 (87%), Positives = 196/211 (93%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAE L+LAKYRQ+ W GRV+NSQFTDEELRSQGRCPLTPEEVGLLLA
Sbjct  268  DMAAHSACDFGGGKAENLALAKYRQVIWGGRVINSQFTDEELRSQGRCPLTPEEVGLLLA  327

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDNNTRLYLASHKVYGG  R+SALR LFPLME+KKSLASSEER  IKGKASLLAAVD
Sbjct  328  ALGFDNNTRLYLASHKVYGGERRVSALRSLFPLMEDKKSLASSEERALIKGKASLLAAVD  387

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYVGMHSDIF+SASPGNMHNAMVG RTY+N+KTIRPNM LLGQLFLNK LTWPEFQ++VI
Sbjct  388  YYVGMHSDIFVSASPGNMHNAMVGQRTYNNMKTIRPNMALLGQLFLNKTLTWPEFQESVI  447

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH NRQG+IRLRKP +SLYTYPAPDCMC A
Sbjct  448  EGHQNRQGQIRLRKPKQSLYTYPAPDCMCQA  478



>ref|XP_010312649.1| PREDICTED: uncharacterized protein At1g04910 isoform X3 [Solanum 
lycopersicum]
Length=470

 Score =   394 bits (1013),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 184/211 (87%), Positives = 196/211 (93%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAE L+LAKYRQ+ W GRV+NSQFTDEELRSQGRCPLTPEEVGLLLA
Sbjct  260  DMAAHSACDFGGGKAENLALAKYRQVIWGGRVINSQFTDEELRSQGRCPLTPEEVGLLLA  319

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDNNTRLYLASHKVYGG  R+SALR LFPLME+KKSLASSEER  IKGKASLLAAVD
Sbjct  320  ALGFDNNTRLYLASHKVYGGERRVSALRSLFPLMEDKKSLASSEERALIKGKASLLAAVD  379

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYVGMHSDIF+SASPGNMHNAMVG RTY+N+KTIRPNM LLGQLFLNK LTWPEFQ++VI
Sbjct  380  YYVGMHSDIFVSASPGNMHNAMVGQRTYNNMKTIRPNMALLGQLFLNKTLTWPEFQESVI  439

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH NRQG+IRLRKP +SLYTYPAPDCMC A
Sbjct  440  EGHQNRQGQIRLRKPKQSLYTYPAPDCMCQA  470



>ref|XP_009797993.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Nicotiana sylvestris]
 ref|XP_009797994.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Nicotiana sylvestris]
Length=504

 Score =   395 bits (1015),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 184/211 (87%), Positives = 197/211 (93%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAE L+LAKYRQ+ W GRV+NSQFTDEELRSQGRCPLTPEEVGLLLA
Sbjct  294  DMAAHSACDFGGGKAENLALAKYRQVIWGGRVINSQFTDEELRSQGRCPLTPEEVGLLLA  353

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDN+TRLYLASHKVYGG  RISALR LFPLME+KKSLASSEER  IKGKASLLAAVD
Sbjct  354  ALGFDNSTRLYLASHKVYGGERRISALRNLFPLMEDKKSLASSEERALIKGKASLLAAVD  413

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYVGMHSDIF+SASPGNMHNAMVGHRTY+N+KTIRPNM LLGQLFLNK LTWPEFQ++V+
Sbjct  414  YYVGMHSDIFVSASPGNMHNAMVGHRTYNNMKTIRPNMALLGQLFLNKTLTWPEFQESVV  473

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH NRQG+IRLRKP +SLYTYPAPDCMC A
Sbjct  474  EGHKNRQGQIRLRKPKQSLYTYPAPDCMCQA  504



>ref|XP_010312647.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Solanum 
lycopersicum]
Length=506

 Score =   395 bits (1015),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 184/211 (87%), Positives = 196/211 (93%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAE L+LAKYRQ+ W GRV+NSQFTDEELRSQGRCPLTPEEVGLLLA
Sbjct  296  DMAAHSACDFGGGKAENLALAKYRQVIWGGRVINSQFTDEELRSQGRCPLTPEEVGLLLA  355

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDNNTRLYLASHKVYGG  R+SALR LFPLME+KKSLASSEER  IKGKASLLAAVD
Sbjct  356  ALGFDNNTRLYLASHKVYGGERRVSALRSLFPLMEDKKSLASSEERALIKGKASLLAAVD  415

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYVGMHSDIF+SASPGNMHNAMVG RTY+N+KTIRPNM LLGQLFLNK LTWPEFQ++VI
Sbjct  416  YYVGMHSDIFVSASPGNMHNAMVGQRTYNNMKTIRPNMALLGQLFLNKTLTWPEFQESVI  475

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH NRQG+IRLRKP +SLYTYPAPDCMC A
Sbjct  476  EGHQNRQGQIRLRKPKQSLYTYPAPDCMCQA  506



>ref|XP_009797995.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Nicotiana sylvestris]
Length=503

 Score =   395 bits (1015),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 184/211 (87%), Positives = 197/211 (93%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAE L+LAKYRQ+ W GRV+NSQFTDEELRSQGRCPLTPEEVGLLLA
Sbjct  293  DMAAHSACDFGGGKAENLALAKYRQVIWGGRVINSQFTDEELRSQGRCPLTPEEVGLLLA  352

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDN+TRLYLASHKVYGG  RISALR LFPLME+KKSLASSEER  IKGKASLLAAVD
Sbjct  353  ALGFDNSTRLYLASHKVYGGERRISALRNLFPLMEDKKSLASSEERALIKGKASLLAAVD  412

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYVGMHSDIF+SASPGNMHNAMVGHRTY+N+KTIRPNM LLGQLFLNK LTWPEFQ++V+
Sbjct  413  YYVGMHSDIFVSASPGNMHNAMVGHRTYNNMKTIRPNMALLGQLFLNKTLTWPEFQESVV  472

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH NRQG+IRLRKP +SLYTYPAPDCMC A
Sbjct  473  EGHKNRQGQIRLRKPKQSLYTYPAPDCMCQA  503



>ref|XP_010312648.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Solanum 
lycopersicum]
Length=505

 Score =   395 bits (1015),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 184/211 (87%), Positives = 196/211 (93%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAE L+LAKYRQ+ W GRV+NSQFTDEELRSQGRCPLTPEEVGLLLA
Sbjct  295  DMAAHSACDFGGGKAENLALAKYRQVIWGGRVINSQFTDEELRSQGRCPLTPEEVGLLLA  354

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDNNTRLYLASHKVYGG  R+SALR LFPLME+KKSLASSEER  IKGKASLLAAVD
Sbjct  355  ALGFDNNTRLYLASHKVYGGERRVSALRSLFPLMEDKKSLASSEERALIKGKASLLAAVD  414

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYVGMHSDIF+SASPGNMHNAMVG RTY+N+KTIRPNM LLGQLFLNK LTWPEFQ++VI
Sbjct  415  YYVGMHSDIFVSASPGNMHNAMVGQRTYNNMKTIRPNMALLGQLFLNKTLTWPEFQESVI  474

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH NRQG+IRLRKP +SLYTYPAPDCMC A
Sbjct  475  EGHQNRQGQIRLRKPKQSLYTYPAPDCMCQA  505



>emb|CDP01562.1| unnamed protein product [Coffea canephora]
Length=514

 Score =   395 bits (1015),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 185/211 (88%), Positives = 196/211 (93%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GL+LA
Sbjct  304  DMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRSQGRCPLTPEEIGLVLA  363

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDNNTRLYLASHKVYGG ARIS LR LFPLME+KKSLASSEER +IKGKASLLAAVD
Sbjct  364  ALGFDNNTRLYLASHKVYGGEARISTLRSLFPLMEDKKSLASSEERVKIKGKASLLAAVD  423

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV MHSDIF+SASPGNMHNAMVGHRTY N+KTIRPNM LLG LFLNKNLTWPEFQ+A+I
Sbjct  424  YYVSMHSDIFVSASPGNMHNAMVGHRTYINMKTIRPNMALLGPLFLNKNLTWPEFQEAII  483

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH NRQG IRLRK  +SLYTYPAPDCMC A
Sbjct  484  EGHKNRQGIIRLRKKEQSLYTYPAPDCMCQA  514



>ref|XP_007207425.1| hypothetical protein PRUPE_ppa004921mg [Prunus persica]
 gb|EMJ08624.1| hypothetical protein PRUPE_ppa004921mg [Prunus persica]
Length=474

 Score =   394 bits (1011),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 180/211 (85%), Positives = 197/211 (93%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLA
Sbjct  264  DMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRSQGRCPLTPEEIGLLLA  323

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDN+TRLYLASHKVYGG ARIS LRRLFPLME+KKSLASSEER +IKGKASLLAA D
Sbjct  324  ALGFDNSTRLYLASHKVYGGEARISTLRRLFPLMEDKKSLASSEERAQIKGKASLLAAAD  383

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV MHSDIFISASPGNMHNA+VGHRTY NLKTIRP+M LLGQLFLNK+++W +FQ +V+
Sbjct  384  YYVSMHSDIFISASPGNMHNALVGHRTYENLKTIRPSMSLLGQLFLNKSISWSDFQQSVV  443

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH NRQG+IRLRKP +S+YTYPAPDCMC A
Sbjct  444  EGHQNRQGQIRLRKPKQSIYTYPAPDCMCQA  474



>ref|XP_007207426.1| hypothetical protein PRUPE_ppa004921mg [Prunus persica]
 gb|EMJ08625.1| hypothetical protein PRUPE_ppa004921mg [Prunus persica]
Length=485

 Score =   394 bits (1011),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 180/211 (85%), Positives = 197/211 (93%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLA
Sbjct  275  DMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRSQGRCPLTPEEIGLLLA  334

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDN+TRLYLASHKVYGG ARIS LRRLFPLME+KKSLASSEER +IKGKASLLAA D
Sbjct  335  ALGFDNSTRLYLASHKVYGGEARISTLRRLFPLMEDKKSLASSEERAQIKGKASLLAAAD  394

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV MHSDIFISASPGNMHNA+VGHRTY NLKTIRP+M LLGQLFLNK+++W +FQ +V+
Sbjct  395  YYVSMHSDIFISASPGNMHNALVGHRTYENLKTIRPSMSLLGQLFLNKSISWSDFQQSVV  454

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH NRQG+IRLRKP +S+YTYPAPDCMC A
Sbjct  455  EGHQNRQGQIRLRKPKQSIYTYPAPDCMCQA  485



>ref|XP_003534239.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Glycine max]
 gb|KHN38876.1| DUF246 domain-containing protein [Glycine soja]
Length=515

 Score =   394 bits (1013),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 181/211 (86%), Positives = 197/211 (93%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCP+TPEEVGLLLA
Sbjct  305  DMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRSQGRCPMTPEEVGLLLA  364

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            A+GFDN+TRLYLASHKVYGG ARIS LR LFPLME+KKSLASSEER +IKGKASLLAA+D
Sbjct  365  AMGFDNSTRLYLASHKVYGGEARISTLRELFPLMEDKKSLASSEERSQIKGKASLLAALD  424

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYVG+HSDIFISASPGNMHNA+VGHRTY NLKTIRPNM L+GQLFLNK + W EFQDAV+
Sbjct  425  YYVGLHSDIFISASPGNMHNALVGHRTYLNLKTIRPNMALMGQLFLNKTIEWSEFQDAVV  484

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH NRQGE+RLRKP +S+YTYPAPDCMC A
Sbjct  485  EGHQNRQGELRLRKPKQSIYTYPAPDCMCQA  515



>ref|XP_002310868.1| hypothetical protein POPTR_0007s14280g [Populus trichocarpa]
 gb|ABK95421.1| unknown [Populus trichocarpa]
 gb|EEE91318.1| hypothetical protein POPTR_0007s14280g [Populus trichocarpa]
Length=506

 Score =   394 bits (1012),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 181/211 (86%), Positives = 198/211 (94%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLA
Sbjct  296  DMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRSQGRCPLTPEEIGLLLA  355

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDN+TRLYLASHKVYGG ARIS LR+LFPLME+KKSLASSEER +IKGKASLLAAVD
Sbjct  356  ALGFDNSTRLYLASHKVYGGEARISTLRKLFPLMEDKKSLASSEERSQIKGKASLLAAVD  415

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYVG+HSDIF+SASPGNMHNA+VGHRTY NLKTIRPNM LLGQLFLNK ++W +FQ AV+
Sbjct  416  YYVGLHSDIFVSASPGNMHNALVGHRTYKNLKTIRPNMALLGQLFLNKTISWTDFQQAVV  475

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH NRQG+IRLRKP +S+YTYPAPDCMC A
Sbjct  476  EGHENRQGQIRLRKPKQSIYTYPAPDCMCYA  506



>ref|XP_006587571.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Glycine max]
Length=516

 Score =   394 bits (1013),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 181/211 (86%), Positives = 197/211 (93%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCP+TPEEVGLLLA
Sbjct  306  DMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRSQGRCPMTPEEVGLLLA  365

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            A+GFDN+TRLYLASHKVYGG ARIS LR LFPLME+KKSLASSEER +IKGKASLLAA+D
Sbjct  366  AMGFDNSTRLYLASHKVYGGEARISTLRELFPLMEDKKSLASSEERSQIKGKASLLAALD  425

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYVG+HSDIFISASPGNMHNA+VGHRTY NLKTIRPNM L+GQLFLNK + W EFQDAV+
Sbjct  426  YYVGLHSDIFISASPGNMHNALVGHRTYLNLKTIRPNMALMGQLFLNKTIEWSEFQDAVV  485

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH NRQGE+RLRKP +S+YTYPAPDCMC A
Sbjct  486  EGHQNRQGELRLRKPKQSIYTYPAPDCMCQA  516



>ref|XP_011021848.1| PREDICTED: uncharacterized protein At1g04910 [Populus euphratica]
Length=506

 Score =   394 bits (1012),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 181/211 (86%), Positives = 198/211 (94%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLA
Sbjct  296  DMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRSQGRCPLTPEEIGLLLA  355

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDN+TRLYLASHKVYGG ARIS LR+LFPLME+KKSLASSEER +IKGKASLLAAVD
Sbjct  356  ALGFDNSTRLYLASHKVYGGEARISTLRKLFPLMEDKKSLASSEERSQIKGKASLLAAVD  415

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYVG+HSDIF+SASPGNMHNA+VGHRTY NLKTIRPNM LLGQLFLNK ++W +FQ AV+
Sbjct  416  YYVGLHSDIFVSASPGNMHNALVGHRTYKNLKTIRPNMALLGQLFLNKTISWTDFQQAVV  475

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH NRQG+IRLRKP +S+YTYPAPDCMC A
Sbjct  476  EGHENRQGQIRLRKPKQSIYTYPAPDCMCYA  506



>ref|XP_009350347.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Pyrus x bretschneideri]
Length=513

 Score =   393 bits (1010),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 180/211 (85%), Positives = 197/211 (93%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLA
Sbjct  303  DMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRSQGRCPLTPEEIGLLLA  362

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDNNTRLYLASHKVYGG ARI+ LR+LFPLME+KKSLASSEER +IKGKASLLAAVD
Sbjct  363  ALGFDNNTRLYLASHKVYGGEARIATLRKLFPLMEDKKSLASSEERAQIKGKASLLAAVD  422

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV MHSDIFISASPGNMHNA+VGHRTY NLKTIRP+M LLGQLFLNK L+W EFQ +V+
Sbjct  423  YYVSMHSDIFISASPGNMHNALVGHRTYENLKTIRPSMSLLGQLFLNKTLSWSEFQQSVV  482

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            +GH +RQG+IR+RKP KS+YTYPAPDCMC A
Sbjct  483  KGHESRQGQIRIRKPKKSIYTYPAPDCMCEA  513



>gb|KCW54611.1| hypothetical protein EUGRSUZ_I00557 [Eucalyptus grandis]
Length=484

 Score =   392 bits (1007),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 178/211 (84%), Positives = 199/211 (94%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLA
Sbjct  274  DMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRSQGRCPLTPEEIGLLLA  333

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDN TRLYLASHKVYGG ARIS LR++FPLME+KKSLAS++ER +IKGKASLLAA+D
Sbjct  334  ALGFDNTTRLYLASHKVYGGEARISMLRKMFPLMEDKKSLASADERAQIKGKASLLAALD  393

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YY+ MHSDIFISASPGNMHNA+VGHRTY N+KTIRP+M LLGQLFLNKN++W EFQ+A+I
Sbjct  394  YYISMHSDIFISASPGNMHNALVGHRTYENMKTIRPSMALLGQLFLNKNISWSEFQEAII  453

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH NRQG+IRLRKP +SLYTYPAPDCMC+A
Sbjct  454  EGHKNRQGQIRLRKPKQSLYTYPAPDCMCSA  484



>ref|XP_009350346.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Pyrus x bretschneideri]
Length=524

 Score =   393 bits (1010),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 180/211 (85%), Positives = 197/211 (93%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLA
Sbjct  314  DMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRSQGRCPLTPEEIGLLLA  373

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDNNTRLYLASHKVYGG ARI+ LR+LFPLME+KKSLASSEER +IKGKASLLAAVD
Sbjct  374  ALGFDNNTRLYLASHKVYGGEARIATLRKLFPLMEDKKSLASSEERAQIKGKASLLAAVD  433

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV MHSDIFISASPGNMHNA+VGHRTY NLKTIRP+M LLGQLFLNK L+W EFQ +V+
Sbjct  434  YYVSMHSDIFISASPGNMHNALVGHRTYENLKTIRPSMSLLGQLFLNKTLSWSEFQQSVV  493

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            +GH +RQG+IR+RKP KS+YTYPAPDCMC A
Sbjct  494  KGHESRQGQIRIRKPKKSIYTYPAPDCMCEA  524



>ref|XP_010027954.1| PREDICTED: uncharacterized protein At1g04910 [Eucalyptus grandis]
 gb|KCW54610.1| hypothetical protein EUGRSUZ_I00557 [Eucalyptus grandis]
Length=505

 Score =   392 bits (1008),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 178/211 (84%), Positives = 199/211 (94%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLA
Sbjct  295  DMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRSQGRCPLTPEEIGLLLA  354

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDN TRLYLASHKVYGG ARIS LR++FPLME+KKSLAS++ER +IKGKASLLAA+D
Sbjct  355  ALGFDNTTRLYLASHKVYGGEARISMLRKMFPLMEDKKSLASADERAQIKGKASLLAALD  414

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YY+ MHSDIFISASPGNMHNA+VGHRTY N+KTIRP+M LLGQLFLNKN++W EFQ+A+I
Sbjct  415  YYISMHSDIFISASPGNMHNALVGHRTYENMKTIRPSMALLGQLFLNKNISWSEFQEAII  474

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH NRQG+IRLRKP +SLYTYPAPDCMC+A
Sbjct  475  EGHKNRQGQIRLRKPKQSLYTYPAPDCMCSA  505



>ref|XP_009364251.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Pyrus 
x bretschneideri]
Length=524

 Score =   392 bits (1008),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 179/211 (85%), Positives = 197/211 (93%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLA
Sbjct  314  DMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRSQGRCPLTPEEIGLLLA  373

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDNNTRLYLASHKVYGG ARI+ LR++FPLME+KKSLASSEER +IKGKASLLAAVD
Sbjct  374  ALGFDNNTRLYLASHKVYGGEARIATLRKVFPLMEDKKSLASSEERAQIKGKASLLAAVD  433

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV MHSDIFISASPGNMHNA+VGHRTY NLKTIRP+M LLGQLFLNK L+W EFQ +V+
Sbjct  434  YYVSMHSDIFISASPGNMHNALVGHRTYENLKTIRPSMPLLGQLFLNKTLSWSEFQQSVV  493

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            +GH NRQG+IR+RKP +S+YTYPAPDCMC A
Sbjct  494  KGHENRQGQIRIRKPKQSIYTYPAPDCMCQA  524



>ref|XP_009364252.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Pyrus 
x bretschneideri]
Length=513

 Score =   392 bits (1006),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 179/211 (85%), Positives = 197/211 (93%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLA
Sbjct  303  DMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRSQGRCPLTPEEIGLLLA  362

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDNNTRLYLASHKVYGG ARI+ LR++FPLME+KKSLASSEER +IKGKASLLAAVD
Sbjct  363  ALGFDNNTRLYLASHKVYGGEARIATLRKVFPLMEDKKSLASSEERAQIKGKASLLAAVD  422

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV MHSDIFISASPGNMHNA+VGHRTY NLKTIRP+M LLGQLFLNK L+W EFQ +V+
Sbjct  423  YYVSMHSDIFISASPGNMHNALVGHRTYENLKTIRPSMPLLGQLFLNKTLSWSEFQQSVV  482

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            +GH NRQG+IR+RKP +S+YTYPAPDCMC A
Sbjct  483  KGHENRQGQIRIRKPKQSIYTYPAPDCMCQA  513



>ref|XP_008236140.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Prunus 
mume]
Length=518

 Score =   392 bits (1006),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 180/211 (85%), Positives = 197/211 (93%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLA
Sbjct  308  DMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRSQGRCPLTPEEIGLLLA  367

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDN+TRLYLASHKVYGG ARIS LRRLFPLME+KKSLASSEER +IKGKASLLAAVD
Sbjct  368  ALGFDNSTRLYLASHKVYGGEARISTLRRLFPLMEDKKSLASSEERAQIKGKASLLAAVD  427

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV MHSDIFISASPGNMHNA+VGHRTY NLKTIRP+M LLGQLFLNK+++W +FQ +V+
Sbjct  428  YYVSMHSDIFISASPGNMHNALVGHRTYENLKTIRPSMSLLGQLFLNKSISWSDFQQSVV  487

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH NR G+IRLRKP +S+YTYPAPDCMC A
Sbjct  488  EGHQNRHGQIRLRKPKQSIYTYPAPDCMCQA  518



>ref|XP_008385667.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein At1g04910 
[Malus domestica]
Length=524

 Score =   392 bits (1006),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 178/211 (84%), Positives = 197/211 (93%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLA
Sbjct  314  DMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRSQGRCPLTPEEIGLLLA  373

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDNNTRLYLASHKVYGG ARI+ LR++FPLME+KKSLASSEER +IKGKASLLAAVD
Sbjct  374  ALGFDNNTRLYLASHKVYGGEARIATLRKVFPLMEDKKSLASSEERAQIKGKASLLAAVD  433

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV MHSDIF+SASPGNMHNA+VGHRTY NLKTIRP+M LLGQLFLNK L+W EFQ +V+
Sbjct  434  YYVSMHSDIFVSASPGNMHNALVGHRTYENLKTIRPSMPLLGQLFLNKTLSWSEFQQSVV  493

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            +GH NRQG+IR+RKP +S+YTYPAPDCMC A
Sbjct  494  KGHENRQGQIRIRKPKQSIYTYPAPDCMCQA  524



>ref|XP_009783617.1| PREDICTED: uncharacterized protein At1g04910-like [Nicotiana 
sylvestris]
Length=512

 Score =   391 bits (1005),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 182/209 (87%), Positives = 196/209 (94%), Gaps = 0/209 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLA
Sbjct  302  DMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRSQGRCPLTPEEIGLLLA  361

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDN+TRLYLASHKVYGG ARIS LR LFPLME+KKSLASS+ER  IKGKASLLAAVD
Sbjct  362  ALGFDNSTRLYLASHKVYGGEARISTLRSLFPLMEDKKSLASSDERALIKGKASLLAAVD  421

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV MHSDIFISASPGNMHNAMVGHRTY+NLKTIRP M LLGQLFLNK L+WPEF++AV+
Sbjct  422  YYVSMHSDIFISASPGNMHNAMVGHRTYYNLKTIRPKMALLGQLFLNKTLSWPEFKEAVV  481

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMC  112
            EGH NR+G+IRLRKP +SLYTYPAPDCMC
Sbjct  482  EGHKNRKGQIRLRKPNQSLYTYPAPDCMC  510



>ref|XP_002268599.2| PREDICTED: uncharacterized protein At1g04910 [Vitis vinifera]
 emb|CBI38269.3| unnamed protein product [Vitis vinifera]
Length=510

 Score =   391 bits (1005),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 183/211 (87%), Positives = 195/211 (92%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ  WQGRVLNSQFTDEELR+QGRCPLTPEE+GLLLA
Sbjct  300  DMAAHSACDFGGGKAEKLALAKYRQTIWQGRVLNSQFTDEELRNQGRCPLTPEEIGLLLA  359

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDN TRLYLASHKVYGGAARIS LR LFPLME+KKSLASS+ER +IKGKASLLAAVD
Sbjct  360  ALGFDNTTRLYLASHKVYGGAARISTLRELFPLMEDKKSLASSDERAQIKGKASLLAAVD  419

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV MHSDIFISASPGNMHNA+VGHRTY NLKTIRPNM LLGQLFLNK++ W EFQ AV+
Sbjct  420  YYVSMHSDIFISASPGNMHNALVGHRTYENLKTIRPNMALLGQLFLNKSIGWSEFQQAVV  479

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH NRQG+IRLRK  +SLYTYPAPDCMCNA
Sbjct  480  EGHENRQGQIRLRKSEQSLYTYPAPDCMCNA  510



>ref|XP_008236135.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Prunus 
mume]
Length=529

 Score =   392 bits (1006),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 180/211 (85%), Positives = 197/211 (93%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLA
Sbjct  319  DMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRSQGRCPLTPEEIGLLLA  378

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDN+TRLYLASHKVYGG ARIS LRRLFPLME+KKSLASSEER +IKGKASLLAAVD
Sbjct  379  ALGFDNSTRLYLASHKVYGGEARISTLRRLFPLMEDKKSLASSEERAQIKGKASLLAAVD  438

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV MHSDIFISASPGNMHNA+VGHRTY NLKTIRP+M LLGQLFLNK+++W +FQ +V+
Sbjct  439  YYVSMHSDIFISASPGNMHNALVGHRTYENLKTIRPSMSLLGQLFLNKSISWSDFQQSVV  498

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH NR G+IRLRKP +S+YTYPAPDCMC A
Sbjct  499  EGHQNRHGQIRLRKPKQSIYTYPAPDCMCQA  529



>ref|XP_006573005.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Glycine max]
Length=515

 Score =   391 bits (1004),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 181/211 (86%), Positives = 195/211 (92%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCP+TPEEVGLLLA
Sbjct  305  DMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRSQGRCPMTPEEVGLLLA  364

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            A+GFDN+TRLYLASHKVYGG ARIS LR LFP ME+KKSLASSEER EIKGKASLLAA+D
Sbjct  365  AMGFDNSTRLYLASHKVYGGEARISTLRELFPRMEDKKSLASSEERSEIKGKASLLAALD  424

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYVG+HSDIFISASPGNMHNA+VGHRTY NLKTIRPNM L+GQLFLNK + W EFQDAV+
Sbjct  425  YYVGLHSDIFISASPGNMHNALVGHRTYLNLKTIRPNMALMGQLFLNKTIEWSEFQDAVV  484

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH NRQGE RLRKP +S+YTYPAPDCMC A
Sbjct  485  EGHQNRQGEPRLRKPKQSIYTYPAPDCMCQA  515



>ref|XP_008347790.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Malus domestica]
Length=513

 Score =   391 bits (1004),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 178/209 (85%), Positives = 196/209 (94%), Gaps = 0/209 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLA
Sbjct  303  DMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRSQGRCPLTPEEIGLLLA  362

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDNNTRLYLASHKVYGG ARI+ LR+LFPLME+KKSLASSEER +IKGKASLLAAVD
Sbjct  363  ALGFDNNTRLYLASHKVYGGEARIATLRKLFPLMEDKKSLASSEERAQIKGKASLLAAVD  422

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV MHSDIF+SASPGNMHNA+VGHRTY NLKTIRP+M LLGQLFLNK L+W EFQ +V+
Sbjct  423  YYVSMHSDIFVSASPGNMHNALVGHRTYENLKTIRPSMSLLGQLFLNKTLSWSEFQQSVV  482

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMC  112
            +GH NRQG+IR+RKP +S+YTYPAPDCMC
Sbjct  483  KGHENRQGQIRIRKPKQSIYTYPAPDCMC  511



>gb|KHN14510.1| DUF246 domain-containing protein [Glycine soja]
Length=516

 Score =   391 bits (1004),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 181/211 (86%), Positives = 195/211 (92%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCP+TPEEVGLLLA
Sbjct  306  DMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRSQGRCPMTPEEVGLLLA  365

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            A+GFDN+TRLYLASHKVYGG ARIS LR LFP ME+KKSLASSEER EIKGKASLLAA+D
Sbjct  366  AMGFDNSTRLYLASHKVYGGEARISTLRELFPRMEDKKSLASSEERSEIKGKASLLAALD  425

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYVG+HSDIFISASPGNMHNA+VGHRTY NLKTIRPNM L+GQLFLNK + W EFQDAV+
Sbjct  426  YYVGLHSDIFISASPGNMHNALVGHRTYLNLKTIRPNMALMGQLFLNKTIEWSEFQDAVV  485

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH NRQGE RLRKP +S+YTYPAPDCMC A
Sbjct  486  EGHQNRQGEPRLRKPKQSIYTYPAPDCMCQA  516



>ref|XP_003517397.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Glycine max]
Length=516

 Score =   391 bits (1004),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 181/211 (86%), Positives = 195/211 (92%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCP+TPEEVGLLLA
Sbjct  306  DMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRSQGRCPMTPEEVGLLLA  365

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            A+GFDN+TRLYLASHKVYGG ARIS LR LFP ME+KKSLASSEER EIKGKASLLAA+D
Sbjct  366  AMGFDNSTRLYLASHKVYGGEARISTLRELFPRMEDKKSLASSEERSEIKGKASLLAALD  425

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYVG+HSDIFISASPGNMHNA+VGHRTY NLKTIRPNM L+GQLFLNK + W EFQDAV+
Sbjct  426  YYVGLHSDIFISASPGNMHNALVGHRTYLNLKTIRPNMALMGQLFLNKTIEWSEFQDAVV  485

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH NRQGE RLRKP +S+YTYPAPDCMC A
Sbjct  486  EGHQNRQGEPRLRKPKQSIYTYPAPDCMCQA  516



>ref|XP_008347789.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Malus domestica]
Length=524

 Score =   391 bits (1004),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 178/209 (85%), Positives = 196/209 (94%), Gaps = 0/209 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLA
Sbjct  314  DMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRSQGRCPLTPEEIGLLLA  373

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDNNTRLYLASHKVYGG ARI+ LR+LFPLME+KKSLASSEER +IKGKASLLAAVD
Sbjct  374  ALGFDNNTRLYLASHKVYGGEARIATLRKLFPLMEDKKSLASSEERAQIKGKASLLAAVD  433

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV MHSDIF+SASPGNMHNA+VGHRTY NLKTIRP+M LLGQLFLNK L+W EFQ +V+
Sbjct  434  YYVSMHSDIFVSASPGNMHNALVGHRTYENLKTIRPSMSLLGQLFLNKTLSWSEFQQSVV  493

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMC  112
            +GH NRQG+IR+RKP +S+YTYPAPDCMC
Sbjct  494  KGHENRQGQIRIRKPKQSIYTYPAPDCMC  522



>ref|XP_011099981.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Sesamum indicum]
 ref|XP_011099982.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Sesamum indicum]
 ref|XP_011099983.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Sesamum indicum]
Length=518

 Score =   390 bits (1001),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 180/211 (85%), Positives = 198/211 (94%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLA
Sbjct  308  DMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRSQGRCPLTPEEIGLLLA  367

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDN+TRLYLASHKVYGGAARIS LR +FP ME+KKSLAS+EER +IKGKASLLAAVD
Sbjct  368  ALGFDNSTRLYLASHKVYGGAARISTLRSIFPFMEDKKSLASTEERAQIKGKASLLAAVD  427

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV MHSDIFISASPGNMHNA+VGHRTY NLKTIRPNM LLGQLFLNK+LTW EFQ+AV+
Sbjct  428  YYVSMHSDIFISASPGNMHNAVVGHRTYENLKTIRPNMALLGQLFLNKSLTWLEFQEAVV  487

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            +GH +RQG +RLRKP +S+YTYPAPDCMC+A
Sbjct  488  KGHKSRQGLLRLRKPEQSIYTYPAPDCMCSA  518



>ref|XP_011099984.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Sesamum indicum]
Length=517

 Score =   390 bits (1001),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 180/211 (85%), Positives = 198/211 (94%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLA
Sbjct  307  DMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRSQGRCPLTPEEIGLLLA  366

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDN+TRLYLASHKVYGGAARIS LR +FP ME+KKSLAS+EER +IKGKASLLAAVD
Sbjct  367  ALGFDNSTRLYLASHKVYGGAARISTLRSIFPFMEDKKSLASTEERAQIKGKASLLAAVD  426

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV MHSDIFISASPGNMHNA+VGHRTY NLKTIRPNM LLGQLFLNK+LTW EFQ+AV+
Sbjct  427  YYVSMHSDIFISASPGNMHNAVVGHRTYENLKTIRPNMALLGQLFLNKSLTWLEFQEAVV  486

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            +GH +RQG +RLRKP +S+YTYPAPDCMC+A
Sbjct  487  KGHKSRQGLLRLRKPEQSIYTYPAPDCMCSA  517



>gb|KJB44061.1| hypothetical protein B456_007G232700 [Gossypium raimondii]
Length=401

 Score =   385 bits (990),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 178/211 (84%), Positives = 196/211 (93%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ  WQGRVLNSQFTD+ELRSQGRCPLTPEEVGLLLA
Sbjct  191  DMAAHSACDFGGGKAEKLALAKYRQTIWQGRVLNSQFTDKELRSQGRCPLTPEEVGLLLA  250

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDNNTRLYLASHKVYGG ARIS LR LFPLME+KKSLASS ER  IKGKASLLAAVD
Sbjct  251  ALGFDNNTRLYLASHKVYGGEARISTLRNLFPLMEDKKSLASSAERVHIKGKASLLAAVD  310

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            Y+VGMHSDIF+SASPGNMHNA+VGHRT+ N+KTIRPNM LLGQLFLNKN++W +F+ AV+
Sbjct  311  YHVGMHSDIFVSASPGNMHNALVGHRTFENMKTIRPNMVLLGQLFLNKNISWSQFRQAVV  370

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH NRQG++RLRKP +S+YTYPAPDCMC+A
Sbjct  371  EGHQNRQGQLRLRKPKQSIYTYPAPDCMCHA  401



>ref|XP_009623753.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Nicotiana tomentosiformis]
Length=504

 Score =   388 bits (996),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 181/211 (86%), Positives = 194/211 (92%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAE L+LAKYRQ+ W GRV+NSQFTDEELRSQGRCPLTPEEVGLLLA
Sbjct  294  DMAAHSACDFGGGKAENLALAKYRQVIWGGRVINSQFTDEELRSQGRCPLTPEEVGLLLA  353

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDN+TRLYLASHKVYGG  RISALR LFPLME+KKSLASSEER  IKGKASLLAAVD
Sbjct  354  ALGFDNSTRLYLASHKVYGGERRISALRNLFPLMEDKKSLASSEERALIKGKASLLAAVD  413

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYVGMHSDIF+SASPGNMHNAMVGHRTY+N+K IRPNM LLGQLFLNK L WPEFQ++V+
Sbjct  414  YYVGMHSDIFVSASPGNMHNAMVGHRTYNNMKIIRPNMALLGQLFLNKTLNWPEFQESVV  473

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH NRQG+IRLRK  +SLYTYPAPDCMC A
Sbjct  474  EGHKNRQGQIRLRKAKQSLYTYPAPDCMCQA  504



>gb|KCW54609.1| hypothetical protein EUGRSUZ_I00557 [Eucalyptus grandis]
Length=506

 Score =   388 bits (996),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 178/212 (84%), Positives = 199/212 (94%), Gaps = 1/212 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLA
Sbjct  295  DMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRSQGRCPLTPEEIGLLLA  354

Query  558  ALGFDNNTRLYLASHKV-YGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAV  382
            ALGFDN TRLYLASHKV YGG ARIS LR++FPLME+KKSLAS++ER +IKGKASLLAA+
Sbjct  355  ALGFDNTTRLYLASHKVVYGGEARISMLRKMFPLMEDKKSLASADERAQIKGKASLLAAL  414

Query  381  DYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAV  202
            DYY+ MHSDIFISASPGNMHNA+VGHRTY N+KTIRP+M LLGQLFLNKN++W EFQ+A+
Sbjct  415  DYYISMHSDIFISASPGNMHNALVGHRTYENMKTIRPSMALLGQLFLNKNISWSEFQEAI  474

Query  201  IEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            IEGH NRQG+IRLRKP +SLYTYPAPDCMC+A
Sbjct  475  IEGHKNRQGQIRLRKPKQSLYTYPAPDCMCSA  506



>ref|XP_009623754.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Nicotiana tomentosiformis]
Length=503

 Score =   387 bits (995),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 181/211 (86%), Positives = 194/211 (92%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAE L+LAKYRQ+ W GRV+NSQFTDEELRSQGRCPLTPEEVGLLLA
Sbjct  293  DMAAHSACDFGGGKAENLALAKYRQVIWGGRVINSQFTDEELRSQGRCPLTPEEVGLLLA  352

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDN+TRLYLASHKVYGG  RISALR LFPLME+KKSLASSEER  IKGKASLLAAVD
Sbjct  353  ALGFDNSTRLYLASHKVYGGERRISALRNLFPLMEDKKSLASSEERALIKGKASLLAAVD  412

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYVGMHSDIF+SASPGNMHNAMVGHRTY+N+K IRPNM LLGQLFLNK L WPEFQ++V+
Sbjct  413  YYVGMHSDIFVSASPGNMHNAMVGHRTYNNMKIIRPNMALLGQLFLNKTLNWPEFQESVV  472

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH NRQG+IRLRK  +SLYTYPAPDCMC A
Sbjct  473  EGHKNRQGQIRLRKAKQSLYTYPAPDCMCQA  503



>ref|XP_002533683.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28699.1| conserved hypothetical protein [Ricinus communis]
Length=509

 Score =   387 bits (994),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 177/211 (84%), Positives = 195/211 (92%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCP+TPEE+G+ LA
Sbjct  299  DMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRSQGRCPMTPEEIGIFLA  358

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDN+TRLYLASHKVYGG ARIS LR LFPLME+KKSLASSEER +IKGKASLLAAVD
Sbjct  359  ALGFDNSTRLYLASHKVYGGEARISVLRELFPLMEDKKSLASSEERAQIKGKASLLAAVD  418

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV MHSDIF+SAS GNMHNA+VGHRTY NLKTIRPNM LLGQLFLNKN++W EFQ +V+
Sbjct  419  YYVAMHSDIFLSASRGNMHNALVGHRTYENLKTIRPNMPLLGQLFLNKNISWSEFQQSVL  478

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH +RQGEIR+R+P +SLYTYPAPDCMC A
Sbjct  479  EGHEDRQGEIRVRRPKQSLYTYPAPDCMCQA  509



>gb|KDO60569.1| hypothetical protein CISIN_1g009234mg [Citrus sinensis]
Length=473

 Score =   386 bits (991),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 178/210 (85%), Positives = 197/210 (94%), Gaps = 0/210 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLA
Sbjct  263  DMAAHSACDFGGGKAEKLALAKYRQMIWQGRVLNSQFTDEELRSQGRCPLTPEEIGLLLA  322

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFD +TRLYLASHKVYGG ARISALRRLFPLME+KKSLASSEER  +KGKASLLAA+D
Sbjct  323  ALGFDKSTRLYLASHKVYGGEARISALRRLFPLMEDKKSLASSEERAGVKGKASLLAALD  382

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV MHS+IFISASPGNMHNA++GHRTY NLKTI+PNM LLGQLFLNK+L+W EFQ AV+
Sbjct  383  YYVSMHSNIFISASPGNMHNALMGHRTYENLKTIKPNMALLGQLFLNKSLSWSEFQQAVV  442

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCN  109
            EGH NRQG+IR+RKP +S+YTYPAPDCMC+
Sbjct  443  EGHENRQGQIRIRKPKQSIYTYPAPDCMCH  472



>ref|XP_007158370.1| hypothetical protein PHAVU_002G147300g [Phaseolus vulgaris]
 gb|ESW30364.1| hypothetical protein PHAVU_002G147300g [Phaseolus vulgaris]
Length=514

 Score =   387 bits (994),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 177/211 (84%), Positives = 195/211 (92%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELR QGRCP+TPEEVGLLLA
Sbjct  304  DMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRGQGRCPMTPEEVGLLLA  363

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDN+TRLYLASHKVYGG ARIS LR LFPLME+KKSLASS++R +IKGKASLLAA+D
Sbjct  364  ALGFDNSTRLYLASHKVYGGEARISTLRELFPLMEDKKSLASSDQRAQIKGKASLLAALD  423

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYVG+HSDIFISASPGNMHNA+VGHRTY NLKTIRPNM L+GQLFLNK + W EF DAV+
Sbjct  424  YYVGLHSDIFISASPGNMHNALVGHRTYLNLKTIRPNMALMGQLFLNKTIEWSEFHDAVV  483

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH NRQG++RLRKP +S+YTYPAPDCMC A
Sbjct  484  EGHQNRQGQVRLRKPKQSIYTYPAPDCMCQA  514



>gb|KJB18177.1| hypothetical protein B456_003G038000 [Gossypium raimondii]
Length=367

 Score =   381 bits (978),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 179/211 (85%), Positives = 193/211 (91%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ  W GRVLNSQFTDEELRSQGRCPLTPEE+GLLLA
Sbjct  157  DMAAHSACDFGGGKAEKLALAKYRQRIWGGRVLNSQFTDEELRSQGRCPLTPEEIGLLLA  216

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDN+TRLYLASHKVYGG ARIS LR  FP ME+KKSLASSEER  IKGKASLLAAVD
Sbjct  217  ALGFDNSTRLYLASHKVYGGEARISTLRDQFPKMESKKSLASSEERVLIKGKASLLAAVD  276

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYVGMHSDIF+SASPGNMHNA+VGHRT+ NLKTIRPNM LLGQLFLNKN+TW EF+ AV+
Sbjct  277  YYVGMHSDIFVSASPGNMHNALVGHRTFENLKTIRPNMPLLGQLFLNKNITWLEFRQAVV  336

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH NRQG++RLRKP +S+YTYPAPDCMC A
Sbjct  337  EGHQNRQGQLRLRKPKQSIYTYPAPDCMCQA  367



>gb|KHG05570.1| hypothetical protein F383_31127 [Gossypium arboreum]
Length=518

 Score =   385 bits (990),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 179/211 (85%), Positives = 194/211 (92%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ  W GRVLNSQFTDEELRSQGRCPLTPEE+GLLLA
Sbjct  308  DMAAHSACDFGGGKAEKLALAKYRQTIWGGRVLNSQFTDEELRSQGRCPLTPEEIGLLLA  367

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDN+TRLYLASHKVYGG ARIS LR LFPLMENKKSLASSEER  IKGKASLLAAVD
Sbjct  368  ALGFDNSTRLYLASHKVYGGEARISTLRELFPLMENKKSLASSEERARIKGKASLLAAVD  427

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYVGMHSDIF+SASPGNMHNA+VGHRT+ N+KTIRPNM LLGQLFL+KN+TW EF+ AV 
Sbjct  428  YYVGMHSDIFVSASPGNMHNALVGHRTFENMKTIRPNMALLGQLFLDKNITWLEFRQAVA  487

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH NRQG+++LRKP +S+YTYPAPDCMC A
Sbjct  488  EGHQNRQGQLKLRKPKQSIYTYPAPDCMCRA  518



>gb|KHG27420.1| hypothetical protein F383_15612 [Gossypium arboreum]
Length=498

 Score =   385 bits (988),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 176/211 (83%), Positives = 197/211 (93%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ  WQGRV+NSQFTD+ELRSQGRCPLTPEEVGLLLA
Sbjct  288  DMAAHSACDFGGGKAEKLALAKYRQTIWQGRVINSQFTDKELRSQGRCPLTPEEVGLLLA  347

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDNNTRLYLASHKVYGG ARIS LR++FPLME+KKSLASS ER  IKGKASLLAAVD
Sbjct  348  ALGFDNNTRLYLASHKVYGGEARISTLRKIFPLMEDKKSLASSAERVHIKGKASLLAAVD  407

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYVGMHSDIF+SASPGNMHNA+VGHRT+ N+KTIRPNM LLGQLFLNKN++W +F+ A++
Sbjct  408  YYVGMHSDIFVSASPGNMHNALVGHRTFENMKTIRPNMVLLGQLFLNKNISWSQFRQAMV  467

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH NRQG++RLRKP +S+YTYPAPDCMC+A
Sbjct  468  EGHQNRQGQLRLRKPKQSIYTYPAPDCMCHA  498



>gb|KJB18178.1| hypothetical protein B456_003G038000 [Gossypium raimondii]
Length=401

 Score =   381 bits (979),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 179/211 (85%), Positives = 193/211 (91%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ  W GRVLNSQFTDEELRSQGRCPLTPEE+GLLLA
Sbjct  191  DMAAHSACDFGGGKAEKLALAKYRQRIWGGRVLNSQFTDEELRSQGRCPLTPEEIGLLLA  250

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDN+TRLYLASHKVYGG ARIS LR  FP ME+KKSLASSEER  IKGKASLLAAVD
Sbjct  251  ALGFDNSTRLYLASHKVYGGEARISTLRDQFPKMESKKSLASSEERVLIKGKASLLAAVD  310

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYVGMHSDIF+SASPGNMHNA+VGHRT+ NLKTIRPNM LLGQLFLNKN+TW EF+ AV+
Sbjct  311  YYVGMHSDIFVSASPGNMHNALVGHRTFENLKTIRPNMPLLGQLFLNKNITWLEFRQAVV  370

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH NRQG++RLRKP +S+YTYPAPDCMC A
Sbjct  371  EGHQNRQGQLRLRKPKQSIYTYPAPDCMCQA  401



>ref|XP_006426272.1| hypothetical protein CICLE_v10025329mg [Citrus clementina]
 gb|ESR39512.1| hypothetical protein CICLE_v10025329mg [Citrus clementina]
 gb|KDO60568.1| hypothetical protein CISIN_1g009234mg [Citrus sinensis]
Length=539

 Score =   385 bits (990),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 178/210 (85%), Positives = 197/210 (94%), Gaps = 0/210 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLA
Sbjct  329  DMAAHSACDFGGGKAEKLALAKYRQMIWQGRVLNSQFTDEELRSQGRCPLTPEEIGLLLA  388

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFD +TRLYLASHKVYGG ARISALRRLFPLME+KKSLASSEER  +KGKASLLAA+D
Sbjct  389  ALGFDKSTRLYLASHKVYGGEARISALRRLFPLMEDKKSLASSEERAGVKGKASLLAALD  448

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV MHS+IFISASPGNMHNA++GHRTY NLKTI+PNM LLGQLFLNK+L+W EFQ AV+
Sbjct  449  YYVSMHSNIFISASPGNMHNALMGHRTYENLKTIKPNMALLGQLFLNKSLSWSEFQQAVV  508

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCN  109
            EGH NRQG+IR+RKP +S+YTYPAPDCMC+
Sbjct  509  EGHENRQGQIRIRKPKQSIYTYPAPDCMCH  538



>ref|XP_006466306.1| PREDICTED: uncharacterized protein At1g04910-like [Citrus sinensis]
Length=539

 Score =   385 bits (990),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 178/210 (85%), Positives = 197/210 (94%), Gaps = 0/210 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLA
Sbjct  329  DMAAHSACDFGGGKAEKLALAKYRQMIWQGRVLNSQFTDEELRSQGRCPLTPEEIGLLLA  388

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFD +TRLYLASHKVYGG ARISALRRLFPLME+KKSLASSEER  +KGKASLLAA+D
Sbjct  389  ALGFDKSTRLYLASHKVYGGEARISALRRLFPLMEDKKSLASSEERAGVKGKASLLAALD  448

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV MHS+IFISASPGNMHNA++GHRTY NLKTI+PNM LLGQLFLNK+L+W EFQ AV+
Sbjct  449  YYVSMHSNIFISASPGNMHNALMGHRTYENLKTIKPNMALLGQLFLNKSLSWSEFQQAVV  508

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCN  109
            EGH NRQG+IR+RKP +S+YTYPAPDCMC+
Sbjct  509  EGHENRQGQIRIRKPKQSIYTYPAPDCMCH  538



>gb|EYU30935.1| hypothetical protein MIMGU_mgv1a004530mg [Erythranthe guttata]
Length=522

 Score =   385 bits (988),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 178/211 (84%), Positives = 194/211 (92%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLA
Sbjct  311  DMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRSQGRCPLTPEEIGLLLA  370

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDN TRLYLASHKVYGG ARISALR LFPLME+KKSLASSEER +IKGKASLLAAVD
Sbjct  371  ALGFDNTTRLYLASHKVYGGEARISALRSLFPLMEDKKSLASSEERAQIKGKASLLAAVD  430

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            +YV +HSDIF+SASPGNMHNA+VGHRTY N KTIRPNM LLGQLFLNK+L W EF+ AV+
Sbjct  431  HYVSIHSDIFVSASPGNMHNAVVGHRTYRNTKTIRPNMALLGQLFLNKSLDWAEFEKAVV  490

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH +RQG +RLRK  +S+YTYPAPDCMCNA
Sbjct  491  EGHKSRQGMLRLRKSEQSIYTYPAPDCMCNA  521



>gb|EYU30936.1| hypothetical protein MIMGU_mgv1a004530mg [Erythranthe guttata]
 gb|EYU30937.1| hypothetical protein MIMGU_mgv1a004530mg [Erythranthe guttata]
Length=511

 Score =   384 bits (986),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 178/211 (84%), Positives = 194/211 (92%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLA
Sbjct  300  DMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRSQGRCPLTPEEIGLLLA  359

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDN TRLYLASHKVYGG ARISALR LFPLME+KKSLASSEER +IKGKASLLAAVD
Sbjct  360  ALGFDNTTRLYLASHKVYGGEARISALRSLFPLMEDKKSLASSEERAQIKGKASLLAAVD  419

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            +YV +HSDIF+SASPGNMHNA+VGHRTY N KTIRPNM LLGQLFLNK+L W EF+ AV+
Sbjct  420  HYVSIHSDIFVSASPGNMHNAVVGHRTYRNTKTIRPNMALLGQLFLNKSLDWAEFEKAVV  479

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH +RQG +RLRK  +S+YTYPAPDCMCNA
Sbjct  480  EGHKSRQGMLRLRKSEQSIYTYPAPDCMCNA  510



>gb|KJB44059.1| hypothetical protein B456_007G232700 [Gossypium raimondii]
Length=518

 Score =   384 bits (986),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 178/211 (84%), Positives = 196/211 (93%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ  WQGRVLNSQFTD+ELRSQGRCPLTPEEVGLLLA
Sbjct  308  DMAAHSACDFGGGKAEKLALAKYRQTIWQGRVLNSQFTDKELRSQGRCPLTPEEVGLLLA  367

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDNNTRLYLASHKVYGG ARIS LR LFPLME+KKSLASS ER  IKGKASLLAAVD
Sbjct  368  ALGFDNNTRLYLASHKVYGGEARISTLRNLFPLMEDKKSLASSAERVHIKGKASLLAAVD  427

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            Y+VGMHSDIF+SASPGNMHNA+VGHRT+ N+KTIRPNM LLGQLFLNKN++W +F+ AV+
Sbjct  428  YHVGMHSDIFVSASPGNMHNALVGHRTFENMKTIRPNMVLLGQLFLNKNISWSQFRQAVV  487

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH NRQG++RLRKP +S+YTYPAPDCMC+A
Sbjct  488  EGHQNRQGQLRLRKPKQSIYTYPAPDCMCHA  518



>ref|XP_007047791.1| O-fucosyltransferase family protein isoform 1 [Theobroma cacao]
 gb|EOX91948.1| O-fucosyltransferase family protein isoform 1 [Theobroma cacao]
Length=518

 Score =   384 bits (986),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 177/211 (84%), Positives = 196/211 (93%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ  WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLA
Sbjct  308  DMAAHSACDFGGGKAEKLALAKYRQTIWQGRVLNSQFTDEELRSQGRCPLTPEEIGLLLA  367

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDN+TRLYLASHKVYGG ARIS LR LFPLME+KKSLASSEER  IKGKASLLAAVD
Sbjct  368  ALGFDNSTRLYLASHKVYGGEARISTLRELFPLMEDKKSLASSEERVHIKGKASLLAAVD  427

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYVGMHSDIF+SASPGNMHNA++GHRT+ NLKTI+PNM LLGQLFLNK+++W EF+ AV+
Sbjct  428  YYVGMHSDIFVSASPGNMHNALMGHRTFENLKTIKPNMALLGQLFLNKSISWSEFRQAVV  487

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH NRQG+++LRKP +S+YTYPAPDCMC A
Sbjct  488  EGHQNRQGQLKLRKPKQSIYTYPAPDCMCQA  518



>ref|XP_010523310.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Tarenaya hassleriana]
Length=445

 Score =   381 bits (979),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 176/211 (83%), Positives = 194/211 (92%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLA
Sbjct  235  DMAAHSACDFGGGKAEKLALAKYRQMIWQGRVLNSQFTDEELRSQGRCPLTPEEMGLLLA  294

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDNNTRLYLASHKVYGG AR+SALR++FP ME+K+SLASS ER  IKGKASLLAAVD
Sbjct  295  ALGFDNNTRLYLASHKVYGGEARVSALRQVFPRMEDKRSLASSGERARIKGKASLLAAVD  354

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV MHSDIF+SASPGNMHNA+VGHRT+ N+KTIRPNM L+GQ+FLNK+LTW EFQ  V 
Sbjct  355  YYVSMHSDIFVSASPGNMHNALVGHRTFENMKTIRPNMALIGQIFLNKSLTWIEFQQKVG  414

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH NRQG+IRLRKP +SLYTYPAPDCMC+ 
Sbjct  415  EGHVNRQGQIRLRKPKQSLYTYPAPDCMCHV  445



>ref|XP_008440542.1| PREDICTED: uncharacterized protein At1g04910 [Cucumis melo]
Length=513

 Score =   383 bits (984),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 176/211 (83%), Positives = 192/211 (91%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLL+A
Sbjct  303  DMAAHSACDFGGGKAEKLALAKYRQVLWQGRVLNSQFTDEELRSQGRCPLTPEEIGLLMA  362

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDNNTRLYLASHKVYGG ARIS LR LFPLME+KKSL S  E  +IKGKASLLAAVD
Sbjct  363  ALGFDNNTRLYLASHKVYGGEARISTLRSLFPLMEDKKSLTSGSELAQIKGKASLLAAVD  422

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV MHSDIFISASPGNMHNAMVGHRTY NLKTIRPNM LLGQLF+NK++ W +FQ A +
Sbjct  423  YYVSMHSDIFISASPGNMHNAMVGHRTYENLKTIRPNMALLGQLFMNKSIIWSDFQQATV  482

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH NRQG+IRLRKP +S+YTYPAPDC+C+A
Sbjct  483  EGHKNRQGQIRLRKPKQSIYTYPAPDCVCHA  513



>gb|EYU39303.1| hypothetical protein MIMGU_mgv1a004838mg [Erythranthe guttata]
Length=507

 Score =   382 bits (981),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 174/210 (83%), Positives = 197/210 (94%), Gaps = 0/210 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRS+GRCPLTPEE+GLLLA
Sbjct  296  DMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRSRGRCPLTPEEIGLLLA  355

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDN+TRLYLASHKVYGG ARIS LR +FPLME+KKSLASSEER +I+GKASLLAA+D
Sbjct  356  ALGFDNSTRLYLASHKVYGGEARISTLRSMFPLMEDKKSLASSEERAQIQGKASLLAALD  415

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV MHSDIFISASPGNMHNA+VGHRTY N+KTIRPNM LLGQLFLNK+L W EF++AV+
Sbjct  416  YYVSMHSDIFISASPGNMHNAVVGHRTYENMKTIRPNMGLLGQLFLNKSLIWTEFEEAVM  475

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCN  109
            +GH +RQG++RLRKP +S+YTYPAPDCMC+
Sbjct  476  QGHKSRQGQLRLRKPRQSIYTYPAPDCMCS  505



>ref|XP_004288516.2| PREDICTED: uncharacterized protein At1g04910 [Fragaria vesca 
subsp. vesca]
Length=529

 Score =   382 bits (982),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 176/211 (83%), Positives = 194/211 (92%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTD+ELRSQGRCPLTPEE+GLLLA
Sbjct  319  DMAAHSACDFGGGKAEKLALAKYRQVLWQGRVLNSQFTDKELRSQGRCPLTPEEIGLLLA  378

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDN+TRLYLASHKVYGG ARI  LR LFPLME+KKSLASSEER  IKGKASLLAA+D
Sbjct  379  ALGFDNSTRLYLASHKVYGGEARIENLRHLFPLMEDKKSLASSEERALIKGKASLLAALD  438

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV MHSDIF+SASPGNMHNA+VGHRTY NLKTIRP+M LLGQLFLNK++TW +FQ +V+
Sbjct  439  YYVSMHSDIFVSASPGNMHNALVGHRTYENLKTIRPSMGLLGQLFLNKSITWSDFQQSVV  498

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH NRQG+IR RKP +S+YTYPAPDCMC A
Sbjct  499  EGHENRQGQIRFRKPKQSIYTYPAPDCMCQA  529



>ref|XP_006394028.1| hypothetical protein EUTSA_v10004041mg [Eutrema salsugineum]
 gb|ESQ31314.1| hypothetical protein EUTSA_v10004041mg [Eutrema salsugineum]
Length=507

 Score =   382 bits (980),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 176/211 (83%), Positives = 195/211 (92%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLA
Sbjct  297  DMAAHSACDFGGGKAEKLALAKYRQMIWQGRVLNSQFTDEELRSQGRCPLTPEEMGLLLA  356

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            A GFDNNTRLYLASHKVYGG ARISALR++FP ME+K+SLASSEER  IKGKASLLAA+D
Sbjct  357  AFGFDNNTRLYLASHKVYGGEARISALRQVFPRMEDKRSLASSEERARIKGKASLLAALD  416

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV MHSDIFISASPGNMHNA+VGHRT+ NLKTIRPNM L+GQLFLNK++TW +FQ A+ 
Sbjct  417  YYVSMHSDIFISASPGNMHNALVGHRTFENLKTIRPNMALIGQLFLNKSITWVDFQQALG  476

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH NRQG+IRLRKP +S+YTYPAPDCMC+ 
Sbjct  477  EGHVNRQGQIRLRKPKQSIYTYPAPDCMCHV  507



>ref|XP_006394027.1| hypothetical protein EUTSA_v10004041mg [Eutrema salsugineum]
 gb|ESQ31313.1| hypothetical protein EUTSA_v10004041mg [Eutrema salsugineum]
Length=506

 Score =   381 bits (979),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 176/211 (83%), Positives = 195/211 (92%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLA
Sbjct  296  DMAAHSACDFGGGKAEKLALAKYRQMIWQGRVLNSQFTDEELRSQGRCPLTPEEMGLLLA  355

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            A GFDNNTRLYLASHKVYGG ARISALR++FP ME+K+SLASSEER  IKGKASLLAA+D
Sbjct  356  AFGFDNNTRLYLASHKVYGGEARISALRQVFPRMEDKRSLASSEERARIKGKASLLAALD  415

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV MHSDIFISASPGNMHNA+VGHRT+ NLKTIRPNM L+GQLFLNK++TW +FQ A+ 
Sbjct  416  YYVSMHSDIFISASPGNMHNALVGHRTFENLKTIRPNMALIGQLFLNKSITWVDFQQALG  475

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH NRQG+IRLRKP +S+YTYPAPDCMC+ 
Sbjct  476  EGHVNRQGQIRLRKPKQSIYTYPAPDCMCHV  506



>ref|XP_009130514.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Brassica rapa]
Length=505

 Score =   381 bits (978),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 175/211 (83%), Positives = 195/211 (92%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLA
Sbjct  295  DMAAHSACDFGGGKAEKLALAKYRQMIWQGRVLNSQFTDEELRSQGRCPLTPEEMGLLLA  354

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            A GFDNNTRLYLASHKVYGG ARISALR++FP ME+K+SLASSEER  IKGKASLLAA+D
Sbjct  355  AFGFDNNTRLYLASHKVYGGEARISALRQVFPRMEDKRSLASSEERARIKGKASLLAALD  414

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV MHSD+FISASPGNMHNA+VGHRT+ NLKTIRPNM L+GQLFLNK++TW +FQ A+ 
Sbjct  415  YYVSMHSDVFISASPGNMHNALVGHRTFENLKTIRPNMALIGQLFLNKSITWVDFQQAIG  474

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH NRQG+IRLRKP +S+YTYPAPDCMC+ 
Sbjct  475  EGHVNRQGQIRLRKPKQSIYTYPAPDCMCHV  505



>emb|CDY37829.1| BnaAnng04900D [Brassica napus]
Length=505

 Score =   381 bits (978),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 175/211 (83%), Positives = 195/211 (92%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLA
Sbjct  295  DMAAHSACDFGGGKAEKLALAKYRQMIWQGRVLNSQFTDEELRSQGRCPLTPEEMGLLLA  354

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            A GFDNNTRLYLASHKVYGG ARISALR++FP ME+K+SLASSEER  IKGKASLLAA+D
Sbjct  355  AFGFDNNTRLYLASHKVYGGEARISALRQVFPRMEDKRSLASSEERARIKGKASLLAALD  414

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV MHSD+FISASPGNMHNA+VGHRT+ NLKTIRPNM L+GQLFLNK++TW +FQ A+ 
Sbjct  415  YYVSMHSDVFISASPGNMHNALVGHRTFENLKTIRPNMALIGQLFLNKSITWVDFQQAIG  474

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH NRQG+IRLRKP +S+YTYPAPDCMC+ 
Sbjct  475  EGHVNRQGQIRLRKPKQSIYTYPAPDCMCHV  505



>gb|AAM13166.1| unknown protein [Arabidopsis thaliana]
 gb|AAM91219.1| unknown protein [Arabidopsis thaliana]
Length=504

 Score =   381 bits (978),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 176/211 (83%), Positives = 194/211 (92%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKLSLAKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLA
Sbjct  294  DMAAHSACDFGGGKAEKLSLAKYRQMIWQGRVLNSQFTDEELRSQGRCPLTPEEMGLLLA  353

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            A GFDNNTRLYLASHKVYGG ARIS LR++FP ME+K+SLASSEER  IKGKASLLAA+D
Sbjct  354  AFGFDNNTRLYLASHKVYGGEARISTLRQVFPKMEDKRSLASSEERARIKGKASLLAALD  413

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV MHSDIFISASPGNMHNA+VGHRT+ NLKTIRPNM L+GQLFLNK++TW +FQ A+ 
Sbjct  414  YYVSMHSDIFISASPGNMHNALVGHRTFENLKTIRPNMALIGQLFLNKSITWVDFQQALG  473

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH NRQG+IRLRKP +S+YTYPAPDCMC+ 
Sbjct  474  EGHVNRQGQIRLRKPKQSIYTYPAPDCMCHV  504



>ref|XP_009130513.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Brassica rapa]
Length=506

 Score =   381 bits (978),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 175/211 (83%), Positives = 195/211 (92%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLA
Sbjct  296  DMAAHSACDFGGGKAEKLALAKYRQMIWQGRVLNSQFTDEELRSQGRCPLTPEEMGLLLA  355

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            A GFDNNTRLYLASHKVYGG ARISALR++FP ME+K+SLASSEER  IKGKASLLAA+D
Sbjct  356  AFGFDNNTRLYLASHKVYGGEARISALRQVFPRMEDKRSLASSEERARIKGKASLLAALD  415

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV MHSD+FISASPGNMHNA+VGHRT+ NLKTIRPNM L+GQLFLNK++TW +FQ A+ 
Sbjct  416  YYVSMHSDVFISASPGNMHNALVGHRTFENLKTIRPNMALIGQLFLNKSITWVDFQQAIG  475

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH NRQG+IRLRKP +S+YTYPAPDCMC+ 
Sbjct  476  EGHVNRQGQIRLRKPKQSIYTYPAPDCMCHV  506



>ref|NP_201350.2| O-fucosyltransferase family protein [Arabidopsis thaliana]
 dbj|BAE99053.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED98060.1| O-fucosyltransferase family protein [Arabidopsis thaliana]
Length=504

 Score =   380 bits (977),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 176/211 (83%), Positives = 194/211 (92%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKLSLAKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLA
Sbjct  294  DMAAHSACDFGGGKAEKLSLAKYRQMIWQGRVLNSQFTDEELRSQGRCPLTPEEMGLLLA  353

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            A GFDNNTRLYLASHKVYGG ARIS LR++FP ME+K+SLASSEER  IKGKASLLAA+D
Sbjct  354  AFGFDNNTRLYLASHKVYGGEARISTLRQVFPRMEDKRSLASSEERARIKGKASLLAALD  413

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV MHSDIFISASPGNMHNA+VGHRT+ NLKTIRPNM L+GQLFLNK++TW +FQ A+ 
Sbjct  414  YYVSMHSDIFISASPGNMHNALVGHRTFENLKTIRPNMALIGQLFLNKSITWVDFQQALG  473

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH NRQG+IRLRKP +S+YTYPAPDCMC+ 
Sbjct  474  EGHVNRQGQIRLRKPKQSIYTYPAPDCMCHV  504



>ref|XP_010523312.1| PREDICTED: uncharacterized protein At1g04910-like [Tarenaya hassleriana]
Length=517

 Score =   381 bits (978),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 177/211 (84%), Positives = 194/211 (92%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLA
Sbjct  307  DMAAHSACDFGGGKAEKLALAKYRQMIWQGRVLNSQFTDEELRSQGRCPLTPEEMGLLLA  366

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDNNTRLYLASHKVYGG AR+SALR++FP ME+K+SLASS ER  IKGKASLLAAVD
Sbjct  367  ALGFDNNTRLYLASHKVYGGEARVSALRQVFPRMEDKRSLASSGERARIKGKASLLAAVD  426

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV MHSDIFISASPGNMHNA+VGHRT+ N+KTIRPNM L+GQ+FLNK+LTW EFQ  V 
Sbjct  427  YYVSMHSDIFISASPGNMHNALVGHRTFENMKTIRPNMALIGQIFLNKSLTWIEFQQKVG  486

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH NRQG+IRLRKP +SLYTYPAPDCMC+ 
Sbjct  487  EGHVNRQGQIRLRKPKQSLYTYPAPDCMCHV  517



>emb|CDY33958.1| BnaC02g43790D [Brassica napus]
Length=505

 Score =   380 bits (977),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 175/211 (83%), Positives = 195/211 (92%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLA
Sbjct  295  DMAAHSACDFGGGKAEKLALAKYRQMIWQGRVLNSQFTDEELRSQGRCPLTPEEMGLLLA  354

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            A GFDNNTRLYLASHKVYGG ARISALR++FP ME+K+SLASSEER  IKGKASLLAA+D
Sbjct  355  AFGFDNNTRLYLASHKVYGGEARISALRQVFPRMEDKRSLASSEERARIKGKASLLAALD  414

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV MHSD+FISASPGNMHNA+VGHRT+ NLKTIRPNM L+GQLFLNK++TW +FQ A+ 
Sbjct  415  YYVSMHSDVFISASPGNMHNALVGHRTFENLKTIRPNMALIGQLFLNKSITWVDFQQALG  474

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH NRQG+IRLRKP +S+YTYPAPDCMC+ 
Sbjct  475  EGHVNRQGQIRLRKPKQSIYTYPAPDCMCHV  505



>dbj|BAB11569.1| unnamed protein product [Arabidopsis thaliana]
Length=523

 Score =   381 bits (979),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 176/211 (83%), Positives = 194/211 (92%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKLSLAKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLA
Sbjct  313  DMAAHSACDFGGGKAEKLSLAKYRQMIWQGRVLNSQFTDEELRSQGRCPLTPEEMGLLLA  372

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            A GFDNNTRLYLASHKVYGG ARIS LR++FP ME+K+SLASSEER  IKGKASLLAA+D
Sbjct  373  AFGFDNNTRLYLASHKVYGGEARISTLRQVFPRMEDKRSLASSEERARIKGKASLLAALD  432

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV MHSDIFISASPGNMHNA+VGHRT+ NLKTIRPNM L+GQLFLNK++TW +FQ A+ 
Sbjct  433  YYVSMHSDIFISASPGNMHNALVGHRTFENLKTIRPNMALIGQLFLNKSITWVDFQQALG  492

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH NRQG+IRLRKP +S+YTYPAPDCMC+ 
Sbjct  493  EGHVNRQGQIRLRKPKQSIYTYPAPDCMCHV  523



>ref|XP_010113429.1| hypothetical protein L484_026763 [Morus notabilis]
 gb|EXC35456.1| hypothetical protein L484_026763 [Morus notabilis]
Length=553

 Score =   382 bits (981),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 174/211 (82%), Positives = 195/211 (92%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ  WQGRVLNSQFTDEELR+QGRCPLTPEE+G+LLA
Sbjct  343  DMAAHSACDFGGGKAEKLALAKYRQTIWQGRVLNSQFTDEELRNQGRCPLTPEEIGILLA  402

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDN+TRLYLASHKVYGG ARIS LR+LFP ME+KKSLASSEER +I GKASLLAAVD
Sbjct  403  ALGFDNSTRLYLASHKVYGGEARISTLRQLFPFMEDKKSLASSEERSQITGKASLLAAVD  462

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV MHSDIFISASPGNMHNAMVGHRTY+NLKTIRPNM L+GQLFLNK+++W +FQ +V+
Sbjct  463  YYVSMHSDIFISASPGNMHNAMVGHRTYNNLKTIRPNMALMGQLFLNKSISWSDFQQSVM  522

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH +RQG+IRLR P +S+YTYP+PDCMC A
Sbjct  523  EGHQSRQGQIRLRNPKQSIYTYPSPDCMCEA  553



>ref|XP_010547595.1| PREDICTED: uncharacterized protein At1g04910-like [Tarenaya hassleriana]
Length=513

 Score =   380 bits (977),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 176/211 (83%), Positives = 194/211 (92%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLA
Sbjct  303  DMAAHSACDFGGGKAEKLALAKYRQMIWQGRVLNSQFTDEELRSQGRCPLTPEEMGLLLA  362

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDN+TRLYLASHKVYGG AR+SALR++FP ME+K+SLASSEER  IKGKASLLAAVD
Sbjct  363  ALGFDNSTRLYLASHKVYGGEARVSALRQVFPRMEDKRSLASSEERARIKGKASLLAAVD  422

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV MHSDIFISASPGNMHNA+VGHRT+ N+KT+RPNM L+ QLFL KN+TW EFQ AV 
Sbjct  423  YYVSMHSDIFISASPGNMHNALVGHRTFENMKTVRPNMALIEQLFLRKNITWMEFQQAVG  482

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH NRQG+IRLRKP +SLYTYPAPDCMC+ 
Sbjct  483  EGHVNRQGQIRLRKPKQSLYTYPAPDCMCHV  513



>ref|XP_010444520.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=507

 Score =   380 bits (976),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 175/211 (83%), Positives = 194/211 (92%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLA
Sbjct  297  DMAAHSACDFGGGKAEKLALAKYRQMIWQGRVLNSQFTDEELRSQGRCPLTPEEMGLLLA  356

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            A GFDNNTRLYLASHKVYGG ARIS LR++FP ME+K+SLASSEER  IKGKASLLAA+D
Sbjct  357  AFGFDNNTRLYLASHKVYGGEARISTLRQVFPRMEDKRSLASSEERARIKGKASLLAALD  416

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV MHSDIFISASPGNMHNA+VGHRT+ NLKTIRPNM L+GQLFLNK++TW +FQ A+ 
Sbjct  417  YYVSMHSDIFISASPGNMHNALVGHRTFENLKTIRPNMALIGQLFLNKSITWVDFQQALG  476

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH NRQG+IRLRKP +S+YTYPAPDCMC+ 
Sbjct  477  EGHVNRQGQIRLRKPKQSIYTYPAPDCMCHV  507



>ref|XP_006280335.1| hypothetical protein CARUB_v10026260mg [Capsella rubella]
 gb|EOA13233.1| hypothetical protein CARUB_v10026260mg [Capsella rubella]
Length=508

 Score =   380 bits (976),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 175/211 (83%), Positives = 194/211 (92%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLA
Sbjct  298  DMAAHSACDFGGGKAEKLALAKYRQMIWQGRVLNSQFTDEELRSQGRCPLTPEEMGLLLA  357

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            A GFDNNTRLYLASHKVYGG ARIS LR++FP ME+K+SLASSEER  IKGKASLLAA+D
Sbjct  358  AFGFDNNTRLYLASHKVYGGEARISTLRQVFPRMEDKRSLASSEERARIKGKASLLAALD  417

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV MHSDIFISASPGNMHNA+VGHRT+ NLKTIRPNM L+GQLFLNK++TW +FQ A+ 
Sbjct  418  YYVSMHSDIFISASPGNMHNALVGHRTFENLKTIRPNMALIGQLFLNKSITWADFQQALG  477

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH NRQG+IRLRKP +S+YTYPAPDCMC+ 
Sbjct  478  EGHVNRQGQIRLRKPKQSIYTYPAPDCMCHV  508



>ref|XP_010523308.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Tarenaya hassleriana]
 ref|XP_010523309.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Tarenaya hassleriana]
Length=517

 Score =   380 bits (977),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 176/211 (83%), Positives = 194/211 (92%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLA
Sbjct  307  DMAAHSACDFGGGKAEKLALAKYRQMIWQGRVLNSQFTDEELRSQGRCPLTPEEMGLLLA  366

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDNNTRLYLASHKVYGG AR+SALR++FP ME+K+SLASS ER  IKGKASLLAAVD
Sbjct  367  ALGFDNNTRLYLASHKVYGGEARVSALRQVFPRMEDKRSLASSGERARIKGKASLLAAVD  426

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV MHSDIF+SASPGNMHNA+VGHRT+ N+KTIRPNM L+GQ+FLNK+LTW EFQ  V 
Sbjct  427  YYVSMHSDIFVSASPGNMHNALVGHRTFENMKTIRPNMALIGQIFLNKSLTWIEFQQKVG  486

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH NRQG+IRLRKP +SLYTYPAPDCMC+ 
Sbjct  487  EGHVNRQGQIRLRKPKQSLYTYPAPDCMCHV  517



>gb|KJB18179.1| hypothetical protein B456_003G038000 [Gossypium raimondii]
 gb|KJB18180.1| hypothetical protein B456_003G038000 [Gossypium raimondii]
 gb|KJB18183.1| hypothetical protein B456_003G038000 [Gossypium raimondii]
 gb|KJB18184.1| hypothetical protein B456_003G038000 [Gossypium raimondii]
Length=518

 Score =   380 bits (977),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 179/211 (85%), Positives = 193/211 (91%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ  W GRVLNSQFTDEELRSQGRCPLTPEE+GLLLA
Sbjct  308  DMAAHSACDFGGGKAEKLALAKYRQRIWGGRVLNSQFTDEELRSQGRCPLTPEEIGLLLA  367

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDN+TRLYLASHKVYGG ARIS LR  FP ME+KKSLASSEER  IKGKASLLAAVD
Sbjct  368  ALGFDNSTRLYLASHKVYGGEARISTLRDQFPKMESKKSLASSEERVLIKGKASLLAAVD  427

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYVGMHSDIF+SASPGNMHNA+VGHRT+ NLKTIRPNM LLGQLFLNKN+TW EF+ AV+
Sbjct  428  YYVGMHSDIFVSASPGNMHNALVGHRTFENLKTIRPNMPLLGQLFLNKNITWLEFRQAVV  487

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH NRQG++RLRKP +S+YTYPAPDCMC A
Sbjct  488  EGHQNRQGQLRLRKPKQSIYTYPAPDCMCQA  518



>ref|XP_010484355.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=508

 Score =   380 bits (976),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 175/211 (83%), Positives = 194/211 (92%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLA
Sbjct  298  DMAAHSACDFGGGKAEKLALAKYRQMIWQGRVLNSQFTDEELRSQGRCPLTPEEMGLLLA  357

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            A GFDNNTRLYLASHKVYGG ARIS LR++FP ME+K+SLASSEER  IKGKASLLAA+D
Sbjct  358  AFGFDNNTRLYLASHKVYGGEARISTLRQVFPRMEDKRSLASSEERARIKGKASLLAALD  417

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV MHSDIFISASPGNMHNA+VGHRT+ NLKTIRPNM L+GQLFLNK++TW +FQ A+ 
Sbjct  418  YYVSMHSDIFISASPGNMHNALVGHRTFENLKTIRPNMALIGQLFLNKSITWVDFQQALG  477

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH NRQG+IRLRKP +S+YTYPAPDCMC+ 
Sbjct  478  EGHVNRQGQIRLRKPKQSIYTYPAPDCMCHV  508



>gb|KJB18182.1| hypothetical protein B456_003G038000 [Gossypium raimondii]
Length=519

 Score =   380 bits (976),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 179/211 (85%), Positives = 193/211 (91%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ  W GRVLNSQFTDEELRSQGRCPLTPEE+GLLLA
Sbjct  309  DMAAHSACDFGGGKAEKLALAKYRQRIWGGRVLNSQFTDEELRSQGRCPLTPEEIGLLLA  368

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDN+TRLYLASHKVYGG ARIS LR  FP ME+KKSLASSEER  IKGKASLLAAVD
Sbjct  369  ALGFDNSTRLYLASHKVYGGEARISTLRDQFPKMESKKSLASSEERVLIKGKASLLAAVD  428

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYVGMHSDIF+SASPGNMHNA+VGHRT+ NLKTIRPNM LLGQLFLNKN+TW EF+ AV+
Sbjct  429  YYVGMHSDIFVSASPGNMHNALVGHRTFENLKTIRPNMPLLGQLFLNKNITWLEFRQAVV  488

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH NRQG++RLRKP +S+YTYPAPDCMC A
Sbjct  489  EGHQNRQGQLRLRKPKQSIYTYPAPDCMCQA  519



>ref|XP_010463027.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=508

 Score =   380 bits (975),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 175/211 (83%), Positives = 194/211 (92%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLA
Sbjct  298  DMAAHSACDFGGGKAEKLALAKYRQMIWQGRVLNSQFTDEELRSQGRCPLTPEEMGLLLA  357

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            A GFDNNTRLYLASHKVYGG ARIS LR++FP ME+K+SLASSEER  IKGKASLLAA+D
Sbjct  358  AFGFDNNTRLYLASHKVYGGEARISTLRQVFPRMEDKRSLASSEERARIKGKASLLAALD  417

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV MHSDIFISASPGNMHNA+VGHRT+ NLKTIRPNM L+GQLFLNK++TW +FQ A+ 
Sbjct  418  YYVSMHSDIFISASPGNMHNALVGHRTFENLKTIRPNMALIGQLFLNKSITWVDFQQALG  477

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH NRQG+IRLRKP +S+YTYPAPDCMC+ 
Sbjct  478  EGHVNRQGQIRLRKPKQSIYTYPAPDCMCHV  508



>ref|XP_004509777.1| PREDICTED: uncharacterized protein At1g04910-like [Cicer arietinum]
Length=501

 Score =   379 bits (974),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 173/211 (82%), Positives = 194/211 (92%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCP+TPEEVGLLLA
Sbjct  291  DMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRSQGRCPMTPEEVGLLLA  350

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            A+GFDN+T LYLASHKVYGG ARIS LR+LFPLME+KK+LASS ER +IKGKASLLAA+D
Sbjct  351  AMGFDNSTHLYLASHKVYGGGARISTLRQLFPLMEDKKTLASSFERAQIKGKASLLAALD  410

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YY+ +HSDIFISASPGNMHNA+VGHRTY NLKTIRPNM L+GQLFLNK + W EF+ AV+
Sbjct  411  YYISVHSDIFISASPGNMHNALVGHRTYLNLKTIRPNMALMGQLFLNKTMEWSEFEHAVV  470

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH NRQG++RLRKP +S+YTYPAPDCMC A
Sbjct  471  EGHENRQGQLRLRKPKQSIYTYPAPDCMCQA  501



>ref|XP_002864958.1| hypothetical protein ARALYDRAFT_496780 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41217.1| hypothetical protein ARALYDRAFT_496780 [Arabidopsis lyrata subsp. 
lyrata]
Length=504

 Score =   379 bits (974),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 175/211 (83%), Positives = 194/211 (92%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLA
Sbjct  294  DMAAHSACDFGGGKAEKLALAKYRQMIWQGRVLNSQFTDEELRSQGRCPLTPEEMGLLLA  353

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            A GFDNNTRLYLASHKVYGG ARIS LR++FP ME+K+SLASSEER  IKGKASLLAA+D
Sbjct  354  AFGFDNNTRLYLASHKVYGGEARISTLRQVFPRMEDKRSLASSEERARIKGKASLLAALD  413

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV MHSDIFISASPGNMHNA+VGHRT+ NLKTIRPNM L+GQLFLNK++TW +FQ A+ 
Sbjct  414  YYVSMHSDIFISASPGNMHNALVGHRTFENLKTIRPNMALIGQLFLNKSITWVDFQQALG  473

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH NRQG+IRLRKP +S+YTYPAPDCMC+ 
Sbjct  474  EGHVNRQGQIRLRKPKQSIYTYPAPDCMCHV  504



>ref|XP_004143441.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis 
sativus]
 ref|XP_004160919.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis 
sativus]
 gb|KGN48703.1| hypothetical protein Csa_6G498990 [Cucumis sativus]
Length=513

 Score =   379 bits (974),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 174/211 (82%), Positives = 191/211 (91%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLL+A
Sbjct  303  DMAAHSACDFGGGKAEKLALAKYRQVLWQGRVLNSQFTDEELRSQGRCPLTPEEIGLLMA  362

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDNNTRLYLASHKVYGG ARIS LR LFPLME+KKSL S  E  +IKGKASLLAAVD
Sbjct  363  ALGFDNNTRLYLASHKVYGGEARISTLRSLFPLMEDKKSLTSGSELAQIKGKASLLAAVD  422

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV M+SDIFISASPGNMHNAMVGHRTY NLKTIRPNM LLGQLF+NK++ W +F  A +
Sbjct  423  YYVSMYSDIFISASPGNMHNAMVGHRTYENLKTIRPNMALLGQLFMNKSIIWSDFHQATV  482

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH NRQG+IRLRKP +S+YTYPAPDC+C+A
Sbjct  483  EGHKNRQGQIRLRKPKQSIYTYPAPDCVCHA  513



>ref|XP_009150636.1| PREDICTED: uncharacterized protein At1g04910 [Brassica rapa]
 emb|CDY08790.1| BnaA06g24340D [Brassica napus]
Length=503

 Score =   379 bits (973),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 175/211 (83%), Positives = 194/211 (92%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLA
Sbjct  293  DMAAHSACDFGGGKAEKLALAKYRQMIWQGRVLNSQFTDEELRSQGRCPLTPEEMGLLLA  352

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            A GFDNNTRLYLASHKVYGG ARISALR++FP ME+K+SLASS ER  IKGKASLLAA+D
Sbjct  353  AFGFDNNTRLYLASHKVYGGEARISALRQVFPRMEDKRSLASSAERARIKGKASLLAALD  412

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV MHSDIFISASPGNMHNA+VGHRT+ NLKTIRPNM L+GQLFLNK++TW +FQ A+ 
Sbjct  413  YYVSMHSDIFISASPGNMHNALVGHRTFENLKTIRPNMALIGQLFLNKSITWVDFQQALG  472

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH NRQG+IRLRKP +S+YTYPAPDCMC+ 
Sbjct  473  EGHVNRQGQIRLRKPKQSIYTYPAPDCMCHV  503



>ref|XP_003613050.1| DUF246 domain-containing protein [Medicago truncatula]
Length=282

 Score =   371 bits (952),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 170/209 (81%), Positives = 190/209 (91%), Gaps = 0/209 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCP+TPEEVGLLLA
Sbjct  72   DMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRSQGRCPMTPEEVGLLLA  131

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDN+TRLYLASHKVYGGAARIS L++LFPLME+KKSL    ER  IKGKASLLAA+D
Sbjct  132  ALGFDNSTRLYLASHKVYGGAARISTLKQLFPLMEDKKSLTLPFERALIKGKASLLAALD  191

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YY+ +HSDIFISASPGNMHNA+VGHRTY NLKTIRPNM L+GQLFLNK + W EF+ AV+
Sbjct  192  YYISIHSDIFISASPGNMHNALVGHRTYLNLKTIRPNMALMGQLFLNKTMEWSEFEHAVV  251

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMC  112
            EGH +RQG++RLRKP +S+YTYP PDCMC
Sbjct  252  EGHESRQGQLRLRKPKQSIYTYPVPDCMC  280



>emb|CDY14569.1| BnaC03g48900D [Brassica napus]
Length=503

 Score =   379 bits (972),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 175/211 (83%), Positives = 194/211 (92%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLA
Sbjct  293  DMAAHSACDFGGGKAEKLALAKYRQMIWQGRVLNSQFTDEELRSQGRCPLTPEEMGLLLA  352

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            A GFDNNTRLYLASHKVYGG ARISALR++FP ME+K+SLASS ER  IKGKASLLAA+D
Sbjct  353  AFGFDNNTRLYLASHKVYGGEARISALRQVFPRMEDKRSLASSAERARIKGKASLLAALD  412

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV MHSDIFISASPGNMHNA+VGHRT+ NLKTIRPNM L+GQLFLNK++TW +FQ A+ 
Sbjct  413  YYVSMHSDIFISASPGNMHNALVGHRTFENLKTIRPNMALIGQLFLNKSITWVDFQQALG  472

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH NRQG+IRLRKP +S+YTYPAPDCMC+ 
Sbjct  473  EGHVNRQGQIRLRKPKQSIYTYPAPDCMCHV  503



>dbj|BAE71212.1| hypothetical protein [Trifolium pratense]
Length=404

 Score =   375 bits (963),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 172/211 (82%), Positives = 191/211 (91%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCP+TPEEVGLLLA
Sbjct  194  DMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRSQGRCPMTPEEVGLLLA  253

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDN+TRLYLASHKVYGG ARI+ L+ LFPLME+KKSL S  ER  IKGKASLLAA+D
Sbjct  254  ALGFDNSTRLYLASHKVYGGGARIATLKELFPLMEDKKSLTSPFERTLIKGKASLLAALD  313

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YY+ MHSDIFISASPGNMHNA+VGHR+Y NLKTIRPNMQL+GQLFLNK + W EF+ AV+
Sbjct  314  YYISMHSDIFISASPGNMHNALVGHRSYLNLKTIRPNMQLMGQLFLNKTMEWSEFEHAVV  373

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH  RQG++RLRKP +S+YTYPAPDCMC A
Sbjct  374  EGHETRQGQLRLRKPKQSIYTYPAPDCMCQA  404



>ref|XP_010254530.1| PREDICTED: uncharacterized protein At1g04910-like [Nelumbo nucifera]
Length=522

 Score =   377 bits (969),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 175/211 (83%), Positives = 194/211 (92%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLA
Sbjct  303  DMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRSQGRCPLTPEEIGLLLA  362

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDN+T LYLASHKVYGG ARIS+LR+LFPLME+KKSLAS EER +I+GKASLLAAVD
Sbjct  363  ALGFDNSTHLYLASHKVYGGEARISSLRKLFPLMEDKKSLASEEERVKIEGKASLLAAVD  422

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV MHSDIFISASPGNMHNA+VGHR Y NLKTIRPNM LLGQLFLNK++ W +FQ AV+
Sbjct  423  YYVSMHSDIFISASPGNMHNALVGHRAYQNLKTIRPNMALLGQLFLNKSMGWSDFQRAVL  482

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH +RQG+IRL+K  +S+YTYPAPDCMC A
Sbjct  483  EGHKDRQGQIRLKKEKQSIYTYPAPDCMCRA  513



>gb|AFK40388.1| unknown [Lotus japonicus]
Length=502

 Score =   376 bits (966),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 173/211 (82%), Positives = 193/211 (91%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEK +LAKYRQ+ WQGR+LNSQFTDEELRSQGRCP+TPEEVGLLLA
Sbjct  292  DMAAHSACDFGGGKAEKFALAKYRQVIWQGRLLNSQFTDEELRSQGRCPMTPEEVGLLLA  351

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDN+ RLYLASHKVYGG ARIS LR+LFPLME+KKSLASS ER +IKGKASLL A+D
Sbjct  352  ALGFDNSARLYLASHKVYGGEARISTLRQLFPLMEDKKSLASSYERFQIKGKASLLTALD  411

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYVG+HSDIFISASPGNMHNA+VGHRTY NLKTIRPN+ L+GQLFLNK + W EF+ AV+
Sbjct  412  YYVGLHSDIFISASPGNMHNAVVGHRTYLNLKTIRPNLVLMGQLFLNKTMEWSEFEHAVV  471

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH NRQG++RLRKP +S+YTYPAPDCMC A
Sbjct  472  EGHQNRQGQLRLRKPKQSIYTYPAPDCMCQA  502



>gb|AGV54211.1| O-fucosyltransferase family protein [Phaseolus vulgaris]
Length=511

 Score =   376 bits (965),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 172/207 (83%), Positives = 191/207 (92%), Gaps = 0/207 (0%)
 Frame = -2

Query  726  HSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLAALGF  547
            H +CDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELR QGRCP+TPEEVGLLLAALGF
Sbjct  305  HISCDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRGQGRCPMTPEEVGLLLAALGF  364

Query  546  DNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVDYYVG  367
            DN+TRLYLASHKVYGG ARIS LR LFPLME+KKSLASS++R +IKGKASLLAA+DYYVG
Sbjct  365  DNSTRLYLASHKVYGGEARISTLRELFPLMEDKKSLASSDQRAQIKGKASLLAALDYYVG  424

Query  366  MHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEGHA  187
            +HSDIFISASPGNMHNA+VGHRTY NLKTIRPNM L+GQLFLNK + W EF DAV+EGH 
Sbjct  425  LHSDIFISASPGNMHNALVGHRTYLNLKTIRPNMALMGQLFLNKTIEWSEFHDAVVEGHQ  484

Query  186  NRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            NRQG++RLRKP +S+YTYPAPDCMC A
Sbjct  485  NRQGQVRLRKPKQSIYTYPAPDCMCQA  511



>ref|XP_010519195.1| PREDICTED: uncharacterized protein At1g04910-like [Tarenaya hassleriana]
Length=518

 Score =   375 bits (962),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 173/211 (82%), Positives = 191/211 (91%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GL+LA
Sbjct  308  DMAAHSACDFGGGKAEKLALAKYRQMIWQGRVLNSQFTDEELRSQGRCPLTPEEIGLVLA  367

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDN+TRLYLASHKVYGG AR+S LR++FP ME+K+SLASS +R  IKGKASLLAAVD
Sbjct  368  ALGFDNSTRLYLASHKVYGGEARVSTLRQVFPRMEDKRSLASSSDRARIKGKASLLAAVD  427

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV MHSDIFISASPGNMHNA+VGHRT+ N KTIRPNM L+GQLFLNKN+TW EFQ AV 
Sbjct  428  YYVSMHSDIFISASPGNMHNALVGHRTFENRKTIRPNMALIGQLFLNKNITWTEFQQAVG  487

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH NR G+IRLRK  +SLYTYPAPDCMC+ 
Sbjct  488  EGHVNRHGQIRLRKTKQSLYTYPAPDCMCHV  518



>gb|EPS72903.1| hypothetical protein M569_01846, partial [Genlisea aurea]
Length=497

 Score =   371 bits (953),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 173/210 (82%), Positives = 186/210 (89%), Gaps = 0/210 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ  WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLA
Sbjct  288  DMAAHSACDFGGGKAEKLALAKYRQTIWQGRVLNSQFTDEELRSQGRCPLTPEEIGLLLA  347

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDN TRLYLASHKVYGG ARIS LR LFPLME+KKSL + EE   IKGKASLLAAVD
Sbjct  348  ALGFDNTTRLYLASHKVYGGEARISTLRSLFPLMEDKKSLTTEEELSRIKGKASLLAAVD  407

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV M SDIFISASPGNMHNA+VGHRT  N KTIRPNM LLGQLFLNK+LTW EF+D+V 
Sbjct  408  YYVSMQSDIFISASPGNMHNALVGHRTLENKKTIRPNMPLLGQLFLNKSLTWSEFRDSVF  467

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCN  109
             GH +RQG++R RKP +SLYTYPAPDCMC+
Sbjct  468  VGHKSRQGQLRFRKPQQSLYTYPAPDCMCS  497



>ref|XP_003613049.1| DUF246 domain-containing protein [Medicago truncatula]
 gb|AES96007.1| GDP-fucose protein O-fucosyltransferase [Medicago truncatula]
Length=503

 Score =   372 bits (954),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 170/209 (81%), Positives = 190/209 (91%), Gaps = 0/209 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCP+TPEEVGLLLA
Sbjct  293  DMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRSQGRCPMTPEEVGLLLA  352

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDN+TRLYLASHKVYGGAARIS L++LFPLME+KKSL    ER  IKGKASLLAA+D
Sbjct  353  ALGFDNSTRLYLASHKVYGGAARISTLKQLFPLMEDKKSLTLPFERALIKGKASLLAALD  412

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YY+ +HSDIFISASPGNMHNA+VGHRTY NLKTIRPNM L+GQLFLNK + W EF+ AV+
Sbjct  413  YYISIHSDIFISASPGNMHNALVGHRTYLNLKTIRPNMALMGQLFLNKTMEWSEFEHAVV  472

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMC  112
            EGH +RQG++RLRKP +S+YTYP PDCMC
Sbjct  473  EGHESRQGQLRLRKPKQSIYTYPVPDCMC  501



>ref|XP_010680342.1| PREDICTED: uncharacterized protein At1g04910 [Beta vulgaris subsp. 
vulgaris]
Length=506

 Score =   371 bits (953),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 169/211 (80%), Positives = 195/211 (92%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LA+YRQ+ WQGRVLNSQFTDEELRSQGRCP+TPEEVGLLLA
Sbjct  296  DMAAHSACDFGGGKAEKLALARYRQVMWQGRVLNSQFTDEELRSQGRCPMTPEEVGLLLA  355

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDN+TRLYLASHKVYGG AR++ L++LFPLME+KKSLAS++ER  IKGKASLLAA+D
Sbjct  356  ALGFDNSTRLYLASHKVYGGRARLATLKKLFPLMEDKKSLASADERARIKGKASLLAALD  415

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV MHSDIFISASPGNMHNA+VGHRT+ +LKTIRPNM LLGQLFL+KN++W +F+ AV+
Sbjct  416  YYVSMHSDIFISASPGNMHNALVGHRTFESLKTIRPNMGLLGQLFLDKNMSWVDFRQAVV  475

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH  R G++RLRKP +S+YTYPAPDCMC A
Sbjct  476  EGHHYRHGQLRLRKPKQSIYTYPAPDCMCRA  506



>ref|XP_010107675.1| hypothetical protein L484_007693 [Morus notabilis]
 gb|EXC16648.1| hypothetical protein L484_007693 [Morus notabilis]
Length=529

 Score =   369 bits (948),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 170/211 (81%), Positives = 192/211 (91%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELR++GRCPLTPEE+GLLLA
Sbjct  319  DMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRNKGRCPLTPEEIGLLLA  378

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGF N TRLYLASHKVYGG ARIS L +LFPLME+KKSL+S++ER +++GKASLLAAVD
Sbjct  379  ALGFSNRTRLYLASHKVYGGEARISTLCKLFPLMEDKKSLSSADERSKVEGKASLLAAVD  438

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV MHSDIFISASPGNMHNA+VGHR   N+KTIRPNM LLGQLFLNK + WPEFQ AV+
Sbjct  439  YYVSMHSDIFISASPGNMHNALVGHRALLNMKTIRPNMGLLGQLFLNKTMEWPEFQQAVV  498

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            +GH NRQG+IRLRK  +S+YTYPAPDCMC+A
Sbjct  499  DGHKNRQGQIRLRKEKQSIYTYPAPDCMCSA  529



>gb|ABJ96379.1| expressed protein [Prunus persica]
Length=517

 Score =   367 bits (943),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 169/211 (80%), Positives = 192/211 (91%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVL SQFTDEELR+QGRCPLTPEE+GLLLA
Sbjct  307  DMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLKSQFTDEELRNQGRCPLTPEEIGLLLA  366

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGF+N+TRLYLASHKVYGG ARIS LRRLFPLME+KKSLAS+EER +++GKASLLAAVD
Sbjct  367  ALGFNNSTRLYLASHKVYGGEARISTLRRLFPLMEDKKSLASAEERAKVEGKASLLAAVD  426

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV M SDIFISASPGNMHNA+V HR Y NLKTIRP+M LLG+LF+NK++ W EFQ AV+
Sbjct  427  YYVSMQSDIFISASPGNMHNALVSHRAYMNLKTIRPSMSLLGKLFVNKSMEWSEFQHAVL  486

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            +GH +RQG+IRLRK  +S+YTYPAPDCMC A
Sbjct  487  DGHKSRQGQIRLRKEKQSIYTYPAPDCMCQA  517



>ref|XP_007222858.1| hypothetical protein PRUPE_ppa004255mg [Prunus persica]
 gb|EMJ24057.1| hypothetical protein PRUPE_ppa004255mg [Prunus persica]
Length=520

 Score =   367 bits (943),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 169/211 (80%), Positives = 192/211 (91%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVL SQFTDEELR+QGRCPLTPEE+GLLLA
Sbjct  310  DMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLKSQFTDEELRNQGRCPLTPEEIGLLLA  369

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGF+N+TRLYLASHKVYGG ARIS LRRLFPLME+KKSLAS+EER +++GKASLLAAVD
Sbjct  370  ALGFNNSTRLYLASHKVYGGEARISTLRRLFPLMEDKKSLASAEERAKVEGKASLLAAVD  429

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV M SDIFISASPGNMHNA+V HR Y NLKTIRP+M LLG+LF+NK++ W EFQ AV+
Sbjct  430  YYVSMQSDIFISASPGNMHNALVSHRAYMNLKTIRPSMSLLGKLFVNKSMEWSEFQHAVL  489

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            +GH +RQG+IRLRK  +S+YTYPAPDCMC A
Sbjct  490  DGHKSRQGQIRLRKEKQSIYTYPAPDCMCQA  520



>ref|XP_006852943.1| hypothetical protein AMTR_s00033p00238220 [Amborella trichopoda]
 gb|ERN14410.1| hypothetical protein AMTR_s00033p00238220 [Amborella trichopoda]
Length=446

 Score =   365 bits (936),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 169/211 (80%), Positives = 190/211 (90%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELR+QGRCPLTPEE+GLLLA
Sbjct  235  DMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRNQGRCPLTPEEIGLLLA  294

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDNNTRLYLASHKVYGG ARIS LR LFPLME+KKSLAS EE   ++GKAS+LAA+D
Sbjct  295  ALGFDNNTRLYLASHKVYGGEARISTLRELFPLMEDKKSLASKEELAMVEGKASMLAALD  354

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV +HSD+FISASPGNMHNAMVGHRTY NLKTIRPNM LLGQL+LNK++ W +FQ AV 
Sbjct  355  YYVSLHSDVFISASPGNMHNAMVGHRTYLNLKTIRPNMGLLGQLYLNKSMGWSDFQAAVR  414

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            +GH  RQG++RLRK  +S+YTYPAPDCMC +
Sbjct  415  KGHEQRQGKMRLRKAKQSIYTYPAPDCMCGS  445



>ref|XP_006338062.1| PREDICTED: uncharacterized protein At1g04910-like [Solanum tuberosum]
Length=516

 Score =   366 bits (940),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 168/211 (80%), Positives = 189/211 (90%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELR QGRCPLTPEE+GLLL+
Sbjct  306  DMAAHSACDFGGGKAEKLALAKYRQVLWQGRVLNSQFTDEELRGQGRCPLTPEEIGLLLS  365

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGF+N+TRLYLASHKVYGG ARIS+LR+LFP ME+KKSLASS E  E++GKASLLAAVD
Sbjct  366  ALGFNNSTRLYLASHKVYGGEARISSLRQLFPFMEDKKSLASSHELSEVEGKASLLAAVD  425

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV M SDIFISASPGNMHNA++GHR Y NLKTIRPNM LLG+LFLNK + W EFQ AV 
Sbjct  426  YYVSMQSDIFISASPGNMHNALLGHRAYKNLKTIRPNMTLLGKLFLNKTMQWSEFQQAVQ  485

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            +GH NRQG++R+RK  +S+YTYPAPDCMC A
Sbjct  486  QGHKNRQGQMRIRKEKQSIYTYPAPDCMCKA  516



>ref|XP_004237994.1| PREDICTED: uncharacterized protein At1g04910 [Solanum lycopersicum]
Length=516

 Score =   366 bits (939),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 168/211 (80%), Positives = 189/211 (90%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELR QGRCPLTPEE+GLLL+
Sbjct  306  DMAAHSACDFGGGKAEKLALAKYRQVLWQGRVLNSQFTDEELRGQGRCPLTPEEIGLLLS  365

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGF+N+TRLYLASHKVYGG ARISALR+LFP ME+KKSLASS E  E++GKASLLAAVD
Sbjct  366  ALGFNNSTRLYLASHKVYGGEARISALRQLFPFMEDKKSLASSHELSEVEGKASLLAAVD  425

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV M SDIFISASPGNMHNA++GHR Y NLKT+RPNM LLG+LFLNK + W EFQ AV 
Sbjct  426  YYVSMQSDIFISASPGNMHNALLGHRAYKNLKTVRPNMTLLGKLFLNKTIEWSEFQQAVQ  485

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            +GH NRQG++R+RK  +S+YTYPAPDCMC A
Sbjct  486  QGHKNRQGQMRIRKEKQSIYTYPAPDCMCKA  516



>ref|XP_010937178.1| PREDICTED: uncharacterized protein At1g04910-like [Elaeis guineensis]
Length=560

 Score =   367 bits (943),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 170/210 (81%), Positives = 188/210 (90%), Gaps = 0/210 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAE+L+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLA
Sbjct  350  DMAAHSACDFGGGKAERLALAKYRQVIWQGRVLNSQFTDEELRSQGRCPLTPEEIGLLLA  409

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFD+ TRLYLASHKVYGG ARIS+LR+LFPLME+KKSLAS EE  +++GKASLLAAVD
Sbjct  410  ALGFDSRTRLYLASHKVYGGEARISSLRKLFPLMEDKKSLASEEELAKVEGKASLLAAVD  469

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV M SD+FISASPGNMHNA+VG RTY NLKTIRPNM LLGQLFLNK++ W EFQ  V 
Sbjct  470  YYVSMQSDVFISASPGNMHNAVVGRRTYLNLKTIRPNMSLLGQLFLNKSMEWSEFQQVVQ  529

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCN  109
             GH NRQG+IR RKP +S+YTYPAPDCMC 
Sbjct  530  AGHKNRQGQIRPRKPKQSIYTYPAPDCMCQ  559



>ref|XP_008219267.1| PREDICTED: uncharacterized protein At1g04910-like [Prunus mume]
Length=520

 Score =   364 bits (935),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 168/211 (80%), Positives = 191/211 (91%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVL SQFTDEELR+QGRCPLTPEE+GLLLA
Sbjct  310  DMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLKSQFTDEELRNQGRCPLTPEEIGLLLA  369

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGF+N+TRLYLASH VYGG ARIS LRRLFPLME+KKSLAS+EER +++GKASLLAAVD
Sbjct  370  ALGFNNSTRLYLASHMVYGGEARISTLRRLFPLMEDKKSLASAEERAKVEGKASLLAAVD  429

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV M SDIFISASPGNMHNA+V HR Y NLKTIRP+M LLG+LF+NK++ W EFQ AV+
Sbjct  430  YYVSMQSDIFISASPGNMHNALVSHRAYMNLKTIRPSMSLLGKLFVNKSMEWSEFQHAVL  489

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            +GH +RQG+IRLRK  +S+YTYPAPDCMC A
Sbjct  490  DGHKSRQGQIRLRKEKQSIYTYPAPDCMCRA  520



>ref|XP_010523344.1| PREDICTED: uncharacterized protein At1g04910 [Tarenaya hassleriana]
 ref|XP_010523345.1| PREDICTED: uncharacterized protein At1g04910 [Tarenaya hassleriana]
Length=519

 Score =   364 bits (935),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 169/211 (80%), Positives = 188/211 (89%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELR +GRCPLTPEEVGLLLA
Sbjct  307  DMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRGKGRCPLTPEEVGLLLA  366

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGF+NNTRLYLASH+VYGG  RISALR+LFP MENKKSLAS EE  +++GKASLLAAVD
Sbjct  367  ALGFNNNTRLYLASHQVYGGEQRISALRKLFPEMENKKSLASMEELADVEGKASLLAAVD  426

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV M SDIFISASPGNMHNA++ HR Y NLKTIRPNM LLGQLFLNK++ WPEF+ AV+
Sbjct  427  YYVSMKSDIFISASPGNMHNALLAHRAYLNLKTIRPNMVLLGQLFLNKSIGWPEFERAVV  486

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
              H NRQG+IR+RK  +S+YTYPAPDCMC A
Sbjct  487  NSHKNRQGQIRIRKEKQSIYTYPAPDCMCKA  517



>emb|CAN78778.1| hypothetical protein VITISV_029752 [Vitis vinifera]
Length=507

 Score =   363 bits (933),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 168/211 (80%), Positives = 187/211 (89%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEK++LAKYRQ+ WQGRVL SQFTDEELR+QGRCPLTPEE+GLLLA
Sbjct  297  DMAAHSACDFGGGKAEKMALAKYRQVIWQGRVLKSQFTDEELRNQGRCPLTPEEIGLLLA  356

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGF N TRLYLASHKVYGG ARIS LR+LFPLME+KKSLAS+EE  +++GKASLLAAVD
Sbjct  357  ALGFSNTTRLYLASHKVYGGEARISTLRKLFPLMEDKKSLASAEELAKVEGKASLLAAVD  416

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV MHSDIFISASPGNMHNA+VGHR Y NLKTIRPNM LLGQLFLNK++ W EFQ AV+
Sbjct  417  YYVSMHSDIFISASPGNMHNALVGHRAYKNLKTIRPNMALLGQLFLNKSIEWSEFQQAVL  476

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
             GH +RQG+IR RK  +S+YTYP  DCMC A
Sbjct  477  NGHKSRQGQIRFRKENQSIYTYPITDCMCQA  507



>ref|XP_002283844.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Vitis 
vinifera]
 emb|CBI19265.3| unnamed protein product [Vitis vinifera]
Length=515

 Score =   363 bits (933),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 168/211 (80%), Positives = 187/211 (89%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEK++LAKYRQ+ WQGRVL SQFTDEELR+QGRCPLTPEE+GLLLA
Sbjct  305  DMAAHSACDFGGGKAEKMALAKYRQVIWQGRVLKSQFTDEELRNQGRCPLTPEEIGLLLA  364

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGF N TRLYLASHKVYGG ARIS LR+LFPLME+KKSLAS+EE  +++GKASLLAAVD
Sbjct  365  ALGFSNTTRLYLASHKVYGGEARISTLRKLFPLMEDKKSLASAEELAKVEGKASLLAAVD  424

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV MHSDIFISASPGNMHNA+VGHR Y NLKTIRPNM LLGQLFLNK++ W EFQ AV+
Sbjct  425  YYVSMHSDIFISASPGNMHNALVGHRAYKNLKTIRPNMALLGQLFLNKSIEWSEFQQAVL  484

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
             GH +RQG+IR RK  +S+YTYP  DCMC A
Sbjct  485  NGHKSRQGQIRFRKENQSIYTYPITDCMCQA  515



>gb|EPS73888.1| hypothetical protein M569_00867, partial [Genlisea aurea]
Length=498

 Score =   363 bits (931),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 168/210 (80%), Positives = 190/210 (90%), Gaps = 1/210 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLA
Sbjct  289  DMAAHSACDFGGGKAEKLALAKYRQVVWQGRVLNSQFTDEELRSQGRCPLTPEEIGLLLA  348

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDN TRLYLASHKVYGG ARISALR LFPLME+KKSL+S+EER  I GKASL+AAVD
Sbjct  349  ALGFDNTTRLYLASHKVYGGEARISALRSLFPLMEDKKSLSSAEERRRINGKASLMAAVD  408

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFL-NKNLTWPEFQDAV  202
            Y+VG+ SDIF+SASPGNMHN MVGHR+Y N KTIRPNM LLGQLFL  KNL+W EF++ V
Sbjct  409  YHVGLRSDIFVSASPGNMHNLMVGHRSYENKKTIRPNMALLGQLFLTTKNLSWTEFENGV  468

Query  201  IEGHANRQGEIRLRKPAKSLYTYPAPDCMC  112
            I+GH +R+G ++LR+P +S+YTYPAPDCMC
Sbjct  469  IDGHKDRRGILKLRRPKQSIYTYPAPDCMC  498



>ref|XP_007018221.1| O-fucosyltransferase family protein [Theobroma cacao]
 gb|EOY15446.1| O-fucosyltransferase family protein [Theobroma cacao]
Length=540

 Score =   364 bits (934),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 171/211 (81%), Positives = 189/211 (90%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTD+ELR+QGRCPLTPEE+GLLLA
Sbjct  330  DMAAHSACDFGGGKAEKLALAKYRQVLWQGRVLNSQFTDKELRNQGRCPLTPEEIGLLLA  389

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGF+N+TRLYLASHKVYGG ARIS LR+LFPLME+KKSLAS +E  EI+GKASLLAAVD
Sbjct  390  ALGFNNSTRLYLASHKVYGGEARISTLRKLFPLMEDKKSLASVKELAEIEGKASLLAAVD  449

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV + SDIFISASPGNMHNA+VGHR Y NLKTIRPNM LLG LFLNK++ W EFQ AVI
Sbjct  450  YYVSLQSDIFISASPGNMHNALVGHRAYLNLKTIRPNMLLLGPLFLNKSMEWSEFQHAVI  509

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
              H NRQG+IRLRK  +S+YTYPAPDCMC A
Sbjct  510  NRHKNRQGQIRLRKEEQSIYTYPAPDCMCRA  540



>ref|XP_010939815.1| PREDICTED: uncharacterized protein At1g04910-like [Elaeis guineensis]
Length=558

 Score =   364 bits (935),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 167/210 (80%), Positives = 188/210 (90%), Gaps = 0/210 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAE+L+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLA
Sbjct  348  DMAAHSACDFGGGKAERLALAKYRQVIWQGRVLNSQFTDEELRSQGRCPLTPEEIGLLLA  407

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFD+ TRLYLASHKVYGG ARI++LR+LFPLME+KKSLAS EE  +++GKASLLAAVD
Sbjct  408  ALGFDSKTRLYLASHKVYGGEARIASLRKLFPLMEDKKSLASEEELAKVEGKASLLAAVD  467

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV M SD+FISASPGNMHNA+VG RTY NLKTIRPNM LLGQLFLNK++ W EFQ  + 
Sbjct  468  YYVSMRSDVFISASPGNMHNAVVGRRTYLNLKTIRPNMALLGQLFLNKSMEWSEFQQVIQ  527

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCN  109
             GH NRQG+IR RKP +S+YTYP+PDCMC 
Sbjct  528  SGHKNRQGQIRQRKPKQSIYTYPSPDCMCQ  557



>ref|XP_009624657.1| PREDICTED: uncharacterized protein At1g04910-like [Nicotiana 
tomentosiformis]
Length=516

 Score =   363 bits (931),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 167/209 (80%), Positives = 187/209 (89%), Gaps = 0/209 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELR QGRCPLTPEE+GLLL 
Sbjct  306  DMAAHSACDFGGGKAEKLALAKYRQVLWQGRVLNSQFTDEELRGQGRCPLTPEEIGLLLT  365

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGF+N+TRLYLASHKVYGG ARISALR+LFP ME+KKSLASS E  E++GKASLLAA+D
Sbjct  366  ALGFNNSTRLYLASHKVYGGEARISALRQLFPFMEDKKSLASSHELSEVEGKASLLAALD  425

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV M SDIFISASPGNMHNA++GHR Y NLKTIRPNM LLG+LFLNK + W EFQ A+ 
Sbjct  426  YYVSMQSDIFISASPGNMHNALLGHRAYKNLKTIRPNMTLLGKLFLNKTMEWSEFQRAIQ  485

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMC  112
            +GH NRQG++RLRK  +S+YTYPAPDCMC
Sbjct  486  QGHKNRQGQMRLRKEKQSIYTYPAPDCMC  514



>gb|KCW68511.1| hypothetical protein EUGRSUZ_F02148 [Eucalyptus grandis]
Length=491

 Score =   362 bits (929),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 165/211 (78%), Positives = 189/211 (90%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAE+++LAKYRQ+ WQGRV+NSQFT+EELR QGRCPLTPE++GLLLA
Sbjct  281  DMAAHSACDFGGGKAERMALAKYRQVIWQGRVVNSQFTNEELRGQGRCPLTPEQIGLLLA  340

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGF N+TRLYLASHKVYGG +RIS LR+LFPLME+KKSL S+EER ++KGKASLLAAVD
Sbjct  341  ALGFSNSTRLYLASHKVYGGESRISTLRKLFPLMEDKKSLTSAEERAKVKGKASLLAAVD  400

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV M SD+FISASPGNMHNA++GHR + NLKTIRPNM LLGQLFLNK++ W +FQ AVI
Sbjct  401  YYVSMQSDVFISASPGNMHNAVLGHRAFLNLKTIRPNMALLGQLFLNKSMEWSDFQHAVI  460

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH  RQG IRLRK  +S+YTYPAPDCMC A
Sbjct  461  EGHIKRQGHIRLRKEKQSIYTYPAPDCMCQA  491



>ref|XP_009401410.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Musa acuminata subsp. malaccensis]
 ref|XP_009401411.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=518

 Score =   363 bits (931),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 168/210 (80%), Positives = 189/210 (90%), Gaps = 0/210 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGG+AE+L+LAKYRQ+ WQGRVLNSQFTDEELR QGRCPLTPEE+GLLLA
Sbjct  308  DMAAHSACDFGGGRAERLALAKYRQVIWQGRVLNSQFTDEELRGQGRCPLTPEEIGLLLA  367

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFD++TRLYLASHKVYGG ARIS+LR LFPLM++KKSLAS EE  +++GKASLLAAVD
Sbjct  368  ALGFDSSTRLYLASHKVYGGEARISSLRMLFPLMDDKKSLASEEELAKVEGKASLLAAVD  427

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            Y+V MHSDIFISASPGNMHNA++G+RTY NLKTIRPNM LLGQLFLNK + W EFQ AV 
Sbjct  428  YHVSMHSDIFISASPGNMHNAVLGYRTYENLKTIRPNMGLLGQLFLNKTMDWSEFQRAVQ  487

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCN  109
             GH  RQG+IRLRKP +S+YTYPAPDCMC 
Sbjct  488  AGHKARQGQIRLRKPKQSIYTYPAPDCMCQ  517



>ref|XP_010061545.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein At1g04910 
[Eucalyptus grandis]
Length=517

 Score =   362 bits (929),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 165/211 (78%), Positives = 189/211 (90%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAE+++LAKYRQ+ WQGRV+NSQFT+EELR QGRCPLTPE++GLLLA
Sbjct  307  DMAAHSACDFGGGKAERMALAKYRQVIWQGRVVNSQFTNEELRGQGRCPLTPEQIGLLLA  366

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGF N+TRLYLASHKVYGG +RIS LR+LFPLME+KKSL S+EER ++KGKASLLAAVD
Sbjct  367  ALGFSNSTRLYLASHKVYGGESRISTLRKLFPLMEDKKSLTSAEERAKVKGKASLLAAVD  426

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV M SD+FISASPGNMHNA++GHR + NLKTIRPNM LLGQLFLNK++ W +FQ AVI
Sbjct  427  YYVSMQSDVFISASPGNMHNAVLGHRAFLNLKTIRPNMALLGQLFLNKSMEWSDFQHAVI  486

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH  RQG IRLRK  +S+YTYPAPDCMC A
Sbjct  487  EGHIKRQGHIRLRKEKQSIYTYPAPDCMCQA  517



>ref|XP_009785662.1| PREDICTED: uncharacterized protein At1g04910-like [Nicotiana 
sylvestris]
Length=516

 Score =   362 bits (929),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 167/211 (79%), Positives = 187/211 (89%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELR QGRCPLTPEE+GLLL 
Sbjct  306  DMAAHSACDFGGGKAEKLALAKYRQVLWQGRVLNSQFTDEELRGQGRCPLTPEEIGLLLT  365

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGF+N+TRLYLASHKVYGG ARISAL +LFP ME+KKSLA+S E  E++GKASLLAA+D
Sbjct  366  ALGFNNSTRLYLASHKVYGGEARISALHQLFPFMEDKKSLAASHELSEVEGKASLLAALD  425

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV M SDIFISASPGNMHNA++GHR Y NLKTIRPNM LLG+LFLNK + W EFQ AV 
Sbjct  426  YYVSMQSDIFISASPGNMHNALLGHRAYKNLKTIRPNMTLLGKLFLNKTMEWSEFQRAVQ  485

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            +GH NRQG++RLRK  +S+YTYPAPDCMC A
Sbjct  486  QGHKNRQGQMRLRKEKQSIYTYPAPDCMCKA  516



>emb|CDP11502.1| unnamed protein product [Coffea canephora]
Length=515

 Score =   362 bits (929),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 166/211 (79%), Positives = 188/211 (89%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+L KYRQ+ WQGRVLNSQFTDEELR QGRCPLTPEE+GLLLA
Sbjct  305  DMAAHSACDFGGGKAEKLALGKYRQVLWQGRVLNSQFTDEELRIQGRCPLTPEEIGLLLA  364

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGF+N+T LYLASHKVYGG ARIS L++LFP ME+KKSL+S+EER ++ GK+SLLAAVD
Sbjct  365  ALGFNNSTTLYLASHKVYGGEARISTLKKLFPYMEDKKSLSSAEERAKVDGKSSLLAAVD  424

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYVGM SDIF+SASPGNMHNA+VGHRTY+NLKTIRPNM LLG+LFLNK L W +FQ AV 
Sbjct  425  YYVGMQSDIFVSASPGNMHNALVGHRTYNNLKTIRPNMVLLGKLFLNKTLEWSDFQQAVK  484

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
             GH NRQG++RLRK  +S+YTYP PDCMC A
Sbjct  485  NGHKNRQGQLRLRKEKQSIYTYPIPDCMCQA  515



>ref|XP_010692399.1| PREDICTED: uncharacterized protein At1g04910 [Beta vulgaris subsp. 
vulgaris]
Length=503

 Score =   361 bits (927),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 162/209 (78%), Positives = 190/209 (91%), Gaps = 0/209 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGG+AEKL+LA+YRQ+ WQGRVL +QFT+EELR+QGRCPLTPEE+GLLLA
Sbjct  293  DMAAHSACDFGGGRAEKLALARYRQVIWQGRVLKTQFTNEELRNQGRCPLTPEEIGLLLA  352

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGF NNTRLYLASHKVYGG ARIS LR+LFP +E+K+SLA+++ER +++GKASLLAAVD
Sbjct  353  ALGFSNNTRLYLASHKVYGGEARISTLRKLFPRIEDKRSLATADERKKVEGKASLLAAVD  412

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV MHSDIFISASPGNMHNAM+GHR Y NLKTIRPNM LLGQLFLN+++ WP FQ+AV+
Sbjct  413  YYVSMHSDIFISASPGNMHNAMLGHRAYQNLKTIRPNMALLGQLFLNQSIDWPGFQNAVV  472

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMC  112
             GH NRQG+IR+RK  +S+YTYP PDCMC
Sbjct  473  VGHKNRQGQIRVRKEKQSIYTYPVPDCMC  501



>gb|KHN09000.1| DUF246 domain-containing protein [Glycine soja]
Length=510

 Score =   361 bits (927),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 167/211 (79%), Positives = 188/211 (89%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELR+QGRCPLTPEE+GLLLA
Sbjct  300  DMAAHSACDFGGGKAEKLALAKYRQVLWQGRVLNSQFTDEELRNQGRCPLTPEEIGLLLA  359

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGF+N TRLYLASHKVYGG AR++ L +LFPLME+KKSL S+EE  ++KGKASLLAAVD
Sbjct  360  ALGFNNRTRLYLASHKVYGGEARLATLSKLFPLMEDKKSLVSTEEMAKVKGKASLLAAVD  419

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV M SDIFISASPGNMHNA+  HR Y NLKTIRPNM+LLGQLF NK++ W EFQ AV+
Sbjct  420  YYVSMQSDIFISASPGNMHNALEAHRAYMNLKTIRPNMRLLGQLFQNKSIGWSEFQLAVL  479

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            +GH NRQG+IRLRK  +S+YTYPAPDCMC A
Sbjct  480  DGHKNRQGQIRLRKENQSIYTYPAPDCMCRA  510



>ref|XP_004301363.1| PREDICTED: uncharacterized protein At1g04910 [Fragaria vesca 
subsp. vesca]
Length=513

 Score =   361 bits (926),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 167/211 (79%), Positives = 188/211 (89%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVL SQFTDEELR QGRCPLTPEE+GLLLA
Sbjct  303  DMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLKSQFTDEELRIQGRCPLTPEEIGLLLA  362

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGF+N+TRLYLASHKVYGG ARIS LRRLFPLME+KKSL S++ER +++GKASL AAVD
Sbjct  363  ALGFNNSTRLYLASHKVYGGEARISTLRRLFPLMEDKKSLTSAKERAKVEGKASLSAAVD  422

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV M SDIFISASPGNMHNA+V HR Y NLKTIRP+M LL +LFLNK++ W EFQ AV+
Sbjct  423  YYVSMQSDIFISASPGNMHNALVCHRAYMNLKTIRPSMTLLSKLFLNKSMQWSEFQQAVL  482

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            +GH NRQG+IRLRK  +S+YTYPAPDCMC A
Sbjct  483  DGHKNRQGQIRLRKEKQSIYTYPAPDCMCQA  513



>ref|XP_004501643.1| PREDICTED: uncharacterized protein At1g04910-like [Cicer arietinum]
Length=513

 Score =   360 bits (925),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 166/211 (79%), Positives = 187/211 (89%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLA
Sbjct  303  DMAAHSACDFGGGKAEKLALAKYRQVLWQGRVLNSQFTDEELRSQGRCPLTPEEIGLLLA  362

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGF+N+TRLYLASHKVYGG AR+  L +LFP ME+KKSL S+E+  +IKGKASLLAAVD
Sbjct  363  ALGFNNSTRLYLASHKVYGGKARLETLSKLFPFMEDKKSLVSAEKLTKIKGKASLLAAVD  422

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            Y+V +HSDIFISASPGNMHNA+V HR Y NLKTIRPNM LLGQLF NK++ W EFQ  V+
Sbjct  423  YHVSLHSDIFISASPGNMHNALVAHRAYRNLKTIRPNMALLGQLFQNKSIGWSEFQRTVL  482

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            +GH NRQG+IRLRK  +S+YTYPAPDCMC A
Sbjct  483  DGHKNRQGQIRLRKEKQSIYTYPAPDCMCKA  513



>gb|AGV54860.1| O-fucosyltransferase family protein [Phaseolus vulgaris]
Length=516

 Score =   360 bits (924),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 165/211 (78%), Positives = 187/211 (89%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLA
Sbjct  306  DMAAHSACDFGGGKAEKLALAKYRQVLWQGRVLNSQFTDEELRSQGRCPLTPEEIGLLLA  365

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGF+N TRLYLASHKVYGG AR++ L +LFPLME+KKSL S+EE  ++KGKASLLA+VD
Sbjct  366  ALGFNNRTRLYLASHKVYGGEARLATLSKLFPLMEDKKSLVSTEELAKVKGKASLLASVD  425

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV MHSDIFISASPGNMHNA+V HR Y NLKTIRP+M  LG LF NK+++W EFQ  V+
Sbjct  426  YYVSMHSDIFISASPGNMHNALVAHRAYMNLKTIRPSMGSLGHLFQNKSVSWSEFQRVVL  485

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            +GH NRQG+IRLRK  +S+YTYPAPDCMC A
Sbjct  486  DGHKNRQGQIRLRKEKQSIYTYPAPDCMCRA  516



>ref|XP_003526543.1| PREDICTED: uncharacterized protein At1g04910-like [Glycine max]
Length=511

 Score =   359 bits (921),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 166/211 (79%), Positives = 187/211 (89%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELR+QGRCPLTPEE+GLLLA
Sbjct  301  DMAAHSACDFGGGKAEKLALAKYRQVLWQGRVLNSQFTDEELRNQGRCPLTPEEIGLLLA  360

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            AL F+N TRLYLASHKVYGG AR++ L +LFPLME+KKSL S+EE  ++KGKASLLAAVD
Sbjct  361  ALSFNNRTRLYLASHKVYGGEARLATLSKLFPLMEDKKSLVSTEEMAKVKGKASLLAAVD  420

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV M SDIFISASPGNMHNA+  HR Y NLKTIRPNM+LLGQLF NK++ W EFQ AV+
Sbjct  421  YYVSMQSDIFISASPGNMHNALEAHRAYMNLKTIRPNMRLLGQLFQNKSIGWSEFQLAVL  480

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            +GH NRQG+IRLRK  +S+YTYPAPDCMC A
Sbjct  481  DGHKNRQGQIRLRKENQSIYTYPAPDCMCRA  511



>ref|XP_006472461.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Citrus sinensis]
 ref|XP_006472462.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Citrus sinensis]
Length=517

 Score =   358 bits (919),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 168/211 (80%), Positives = 187/211 (89%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELR+QGRCPLTPEE+GLLLA
Sbjct  307  DMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRNQGRCPLTPEEIGLLLA  366

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGF+N TRLYLASHKVYGG ARIS L++LFPLME+KKS+AS+EE  +I+GKASL AAVD
Sbjct  367  ALGFNNGTRLYLASHKVYGGEARISTLQKLFPLMEDKKSIASAEELAKIEGKASLSAAVD  426

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV M SDIFISASPGNMHNA+VGHR Y NLKTIRPNM LLG+LFLNK++ W EFQ AV 
Sbjct  427  YYVSMQSDIFISASPGNMHNALVGHRAYLNLKTIRPNMTLLGKLFLNKSMGWTEFQHAVR  486

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
             GH NR G IRLRK  +S+YTYPAPDCMC +
Sbjct  487  NGHKNRLGHIRLRKSKQSIYTYPAPDCMCQS  517



>gb|KJB58883.1| hypothetical protein B456_009G229500 [Gossypium raimondii]
Length=489

 Score =   357 bits (917),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 166/211 (79%), Positives = 185/211 (88%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTD ELR+QGRCPLTPEE+GLLL 
Sbjct  279  DMAAHSACDFGGGKAEKLALAKYRQVLWQGRVLNSQFTDHELRNQGRCPLTPEEIGLLLT  338

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGF+NNT LYLASHKVYGG ARIS LR +FPLME+KKSLAS+ E  E++GKASL+AAVD
Sbjct  339  ALGFNNNTHLYLASHKVYGGEARISTLRTMFPLMEDKKSLASAIELAEVEGKASLMAAVD  398

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV + SDIFISASPGNMHNA++GHR Y NLKTIRPNM LLG LFLNK + W EFQ AVI
Sbjct  399  YYVSLKSDIFISASPGNMHNALLGHRAYLNLKTIRPNMLLLGPLFLNKTIEWSEFQHAVI  458

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
             GH NRQG++RLRK  +S+YTYPAPDCMC A
Sbjct  459  NGHKNRQGQMRLRKEKQSIYTYPAPDCMCRA  489



>ref|XP_006472463.1| PREDICTED: uncharacterized protein At1g04910-like isoform X3 
[Citrus sinensis]
Length=514

 Score =   358 bits (919),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 168/211 (80%), Positives = 187/211 (89%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELR+QGRCPLTPEE+GLLLA
Sbjct  304  DMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRNQGRCPLTPEEIGLLLA  363

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGF+N TRLYLASHKVYGG ARIS L++LFPLME+KKS+AS+EE  +I+GKASL AAVD
Sbjct  364  ALGFNNGTRLYLASHKVYGGEARISTLQKLFPLMEDKKSIASAEELAKIEGKASLSAAVD  423

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV M SDIFISASPGNMHNA+VGHR Y NLKTIRPNM LLG+LFLNK++ W EFQ AV 
Sbjct  424  YYVSMQSDIFISASPGNMHNALVGHRAYLNLKTIRPNMTLLGKLFLNKSMGWTEFQHAVR  483

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
             GH NR G IRLRK  +S+YTYPAPDCMC +
Sbjct  484  NGHKNRLGHIRLRKSKQSIYTYPAPDCMCQS  514



>gb|KDP41479.1| hypothetical protein JCGZ_15886 [Jatropha curcas]
Length=513

 Score =   357 bits (917),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 166/210 (79%), Positives = 184/210 (88%), Gaps = 0/210 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLA
Sbjct  303  DMAAHSACDFGGGKAEKLALAKYRQVLWQGRVLNSQFTDEELRSQGRCPLTPEEIGLLLA  362

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGF N+TRLYLASHKVYGG ARIS L++LFP ME+KKSLAS EE  E++GKASLLAAVD
Sbjct  363  ALGFSNSTRLYLASHKVYGGEARISTLKQLFPFMEDKKSLASEEELAEVEGKASLLAAVD  422

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV + SDIFISASPGNMHNA++GHR Y NLKTIRPNM LLG LFLNK+L W  FQ AV+
Sbjct  423  YYVSLQSDIFISASPGNMHNALLGHRAYLNLKTIRPNMLLLGPLFLNKSLEWSAFQVAVV  482

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCN  109
             GH NRQG++R RK  +S+YTYP PDCMC 
Sbjct  483  NGHKNRQGQVRSRKEKQSIYTYPIPDCMCQ  512



>gb|KJB58881.1| hypothetical protein B456_009G229500 [Gossypium raimondii]
 gb|KJB58882.1| hypothetical protein B456_009G229500 [Gossypium raimondii]
Length=518

 Score =   357 bits (917),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 166/211 (79%), Positives = 185/211 (88%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTD ELR+QGRCPLTPEE+GLLL 
Sbjct  308  DMAAHSACDFGGGKAEKLALAKYRQVLWQGRVLNSQFTDHELRNQGRCPLTPEEIGLLLT  367

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGF+NNT LYLASHKVYGG ARIS LR +FPLME+KKSLAS+ E  E++GKASL+AAVD
Sbjct  368  ALGFNNNTHLYLASHKVYGGEARISTLRTMFPLMEDKKSLASAIELAEVEGKASLMAAVD  427

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV + SDIFISASPGNMHNA++GHR Y NLKTIRPNM LLG LFLNK + W EFQ AVI
Sbjct  428  YYVSLKSDIFISASPGNMHNALLGHRAYLNLKTIRPNMLLLGPLFLNKTIEWSEFQHAVI  487

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
             GH NRQG++RLRK  +S+YTYPAPDCMC A
Sbjct  488  NGHKNRQGQMRLRKEKQSIYTYPAPDCMCRA  518



>ref|XP_008368388.1| PREDICTED: uncharacterized protein At1g04910-like [Malus domestica]
Length=519

 Score =   357 bits (917),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 165/211 (78%), Positives = 187/211 (89%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVL SQFTDEELR+QGRCPLTPEE+GLLLA
Sbjct  309  DMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLKSQFTDEELRNQGRCPLTPEEIGLLLA  368

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGF+N TRLYLASHKVYGG ARIS LRRLFP M++KK LAS+EER +++GKASLLAAVD
Sbjct  369  ALGFNNTTRLYLASHKVYGGEARISTLRRLFPDMDDKKGLASAEERAKVEGKASLLAAVD  428

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV M SDIFISASPGNMHNA+VGHR Y NLKTIRPNM LLG+LF+NK+  W +FQ AV 
Sbjct  429  YYVSMQSDIFISASPGNMHNALVGHRAYMNLKTIRPNMALLGKLFVNKSXEWSDFQRAVS  488

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            +GH  RQG++RLRK  +S+YTYPAPDCMC +
Sbjct  489  DGHKTRQGQMRLRKEKQSIYTYPAPDCMCQS  519



>ref|XP_010277497.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Nelumbo nucifera]
Length=514

 Score =   357 bits (916),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 173/211 (82%), Positives = 192/211 (91%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEK++LAKYRQ+ WQGRV+NSQFTDEELRSQGRCPLTPEE+GLLLA
Sbjct  304  DMAAHSACDFGGGKAEKMALAKYRQVIWQGRVMNSQFTDEELRSQGRCPLTPEEIGLLLA  363

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALG DN+TRLYLASHKVYGG ARI ALR LFPLME+KKSLAS EER +I+GKASLLAAVD
Sbjct  364  ALGLDNSTRLYLASHKVYGGEARIQALRNLFPLMEDKKSLASEEERAKIEGKASLLAAVD  423

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV MHSDIFISASPGNMHNA+VGHRTY NLKTIRP+M LLGQL LNK++ W +FQ AV+
Sbjct  424  YYVSMHSDIFISASPGNMHNALVGHRTYENLKTIRPSMALLGQLLLNKSIEWSKFQQAVL  483

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH NRQG+IRLRK  +S+YTYPAPDCMC+ 
Sbjct  484  EGHKNRQGQIRLRKEKQSIYTYPAPDCMCHV  514



>ref|XP_009376221.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein At1g04910 
[Pyrus x bretschneideri]
Length=520

 Score =   356 bits (914),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 165/211 (78%), Positives = 188/211 (89%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVL SQFTDE+LR+QGRCPLTPEE+GLLLA
Sbjct  310  DMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLKSQFTDEDLRNQGRCPLTPEEIGLLLA  369

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGF+N TRLYLAS+KVYGG ARIS LRRLFP ME+KKSLAS+EER +++GKASLLAAVD
Sbjct  370  ALGFNNTTRLYLASYKVYGGEARISTLRRLFPDMEDKKSLASAEERAKVEGKASLLAAVD  429

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV M SDIFISASPGNMHNA+VGHR Y NLKTIRPNM LLG+LF+NK++ W +FQ AV 
Sbjct  430  YYVSMQSDIFISASPGNMHNALVGHRAYMNLKTIRPNMALLGKLFVNKSMEWSDFQRAVS  489

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            +GH  R G++RLRK  +S+YTYPAPDCMC A
Sbjct  490  DGHKTRXGQMRLRKEKQSIYTYPAPDCMCRA  520



>ref|XP_003602912.1| PsRT17-1 like protein [Medicago truncatula]
 gb|AES73163.1| GDP-fucose protein O-fucosyltransferase [Medicago truncatula]
Length=517

 Score =   356 bits (914),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 164/211 (78%), Positives = 183/211 (87%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQF DEELR+QGRCPLTPEE+GLLLA
Sbjct  307  DMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFNDEELRNQGRCPLTPEEIGLLLA  366

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGF+N TRLYLASHKVYGG AR+  L  LFP ME+KKSL S+E   ++ GKASLLAAVD
Sbjct  367  ALGFNNRTRLYLASHKVYGGKARLETLSTLFPFMEDKKSLVSAETMAKVNGKASLLAAVD  426

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV MHSDIFISASPGNMHNA+V HR Y NLKTIRPNM LLGQLF NK++ W +FQ AV+
Sbjct  427  YYVSMHSDIFISASPGNMHNALVAHRAYKNLKTIRPNMALLGQLFQNKSIGWSDFQRAVL  486

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            +GH NRQG+IRLRK  +S+YTYPAPDCMC A
Sbjct  487  DGHKNRQGQIRLRKEKQSIYTYPAPDCMCRA  517



>ref|XP_002514041.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48624.1| conserved hypothetical protein [Ricinus communis]
Length=519

 Score =   356 bits (914),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 164/210 (78%), Positives = 186/210 (89%), Gaps = 0/210 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHS+CDFGGGKAE+L+LAKYRQ+ WQGRVLNSQFTDEELR QGRCPLTPEE+GLLLA
Sbjct  302  DMAAHSSCDFGGGKAERLALAKYRQVLWQGRVLNSQFTDEELRGQGRCPLTPEEIGLLLA  361

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGF N+TRLYLASHKVYGG AR+S L++LFP ME+KKSLAS+EE   ++GKASLLAAVD
Sbjct  362  ALGFSNSTRLYLASHKVYGGEARVSTLKQLFPSMEDKKSLASAEELALVEGKASLLAAVD  421

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV + SDIFISASPGNMHNA+VGHR Y NLKTIRPNM LLG LFLNK++ W EFQ AV+
Sbjct  422  YYVSLQSDIFISASPGNMHNALVGHRAYLNLKTIRPNMVLLGPLFLNKSVEWSEFQTAVV  481

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCN  109
            +GH NRQG+IRLRK  +S+YTYP PDCMC 
Sbjct  482  KGHKNRQGQIRLRKEKQSIYTYPIPDCMCQ  511



>ref|XP_009138156.1| PREDICTED: uncharacterized protein At1g04910 [Brassica rapa]
Length=515

 Score =   356 bits (913),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 162/211 (77%), Positives = 187/211 (89%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHS CDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELR++GRCPLTPEE+GLLL+
Sbjct  304  DMAAHSGCDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRNKGRCPLTPEEIGLLLS  363

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGF NNTRLYLASH+VYGG ARIS LR+LFP++ENKKSLAS+EE  E++GKASL+AAVD
Sbjct  364  ALGFTNNTRLYLASHQVYGGEARISTLRKLFPVLENKKSLASAEELAEVEGKASLMAAVD  423

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV M SDIFISASPGNMHNA++ HR Y NLKTI PNM LLGQ+ +NK+L W EF+ AV+
Sbjct  424  YYVSMKSDIFISASPGNMHNALLAHRAYLNLKTINPNMILLGQVLVNKSLGWSEFEGAVV  483

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
             GH NRQG++RLRK  +S+YTYPAPDCMC A
Sbjct  484  NGHKNRQGQLRLRKQKQSIYTYPAPDCMCKA  514



>ref|XP_003523785.1| PREDICTED: uncharacterized protein At1g04910-like [Glycine max]
Length=511

 Score =   355 bits (912),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 163/211 (77%), Positives = 186/211 (88%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+L KYRQ+ WQGRVLNSQFTDEELR+QGRCPLTPEE+GLLLA
Sbjct  301  DMAAHSACDFGGGKAEKLALVKYRQVLWQGRVLNSQFTDEELRNQGRCPLTPEEIGLLLA  360

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGF+N TRLYLASHKVYGG AR++ L +LFPLME+KKSL S+EE  ++KGKASLLAAVD
Sbjct  361  ALGFNNRTRLYLASHKVYGGEARLATLSKLFPLMEDKKSLVSTEEMAKVKGKASLLAAVD  420

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV M SDIFISASPGNMHNA+  +R Y NLKTIRP+M LLGQLF NK++ W EFQ A++
Sbjct  421  YYVSMQSDIFISASPGNMHNALAANRAYMNLKTIRPSMGLLGQLFQNKSIGWSEFQRAIL  480

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            +GH NRQG+IRLRK  +S+YTYPAPDCMC A
Sbjct  481  DGHKNRQGQIRLRKEKQSIYTYPAPDCMCRA  511



>gb|KHN08263.1| DUF246 domain-containing protein [Glycine soja]
Length=511

 Score =   355 bits (912),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 163/211 (77%), Positives = 186/211 (88%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+L KYRQ+ WQGRVLNSQFTDEELR+QGRCPLTPEE+GLLLA
Sbjct  301  DMAAHSACDFGGGKAEKLALVKYRQVLWQGRVLNSQFTDEELRNQGRCPLTPEEIGLLLA  360

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGF+N TRLYLASHKVYGG AR++ L +LFPLME+KKSL S+EE  ++KGKASLLAAVD
Sbjct  361  ALGFNNRTRLYLASHKVYGGEARLATLSKLFPLMEDKKSLVSTEEMAKVKGKASLLAAVD  420

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV M SDIFISASPGNMHNA+  +R Y NLKTIRP+M LLGQLF NK++ W EFQ A++
Sbjct  421  YYVSMQSDIFISASPGNMHNALAANRAYMNLKTIRPSMGLLGQLFQNKSIGWSEFQRAIL  480

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            +GH NRQG+IRLRK  +S+YTYPAPDCMC A
Sbjct  481  DGHKNRQGQIRLRKEKQSIYTYPAPDCMCRA  511



>ref|XP_006433826.1| hypothetical protein CICLE_v10000880mg [Citrus clementina]
 gb|ESR47066.1| hypothetical protein CICLE_v10000880mg [Citrus clementina]
Length=514

 Score =   355 bits (912),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 167/211 (79%), Positives = 186/211 (88%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELR+QGRCPLTPEE+GLLLA
Sbjct  304  DMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRNQGRCPLTPEEIGLLLA  363

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGF+N TRLYLASHKVYGG ARIS L++LFPLME+KKS+AS+EE  +I+GKASL AAVD
Sbjct  364  ALGFNNGTRLYLASHKVYGGEARISTLQKLFPLMEDKKSIASAEELTKIEGKASLSAAVD  423

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV M SDIFISASPGNMHNA+VGHR Y  LKTIRPNM LLG+LFLNK++ W EFQ AV 
Sbjct  424  YYVSMQSDIFISASPGNMHNALVGHRAYLKLKTIRPNMTLLGKLFLNKSMGWTEFQHAVR  483

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
             GH NR G IRLRK  +S+YTYPAPDCMC +
Sbjct  484  NGHKNRLGHIRLRKTKQSIYTYPAPDCMCQS  514



>ref|XP_006433827.1| hypothetical protein CICLE_v10000880mg [Citrus clementina]
 gb|ESR47067.1| hypothetical protein CICLE_v10000880mg [Citrus clementina]
Length=517

 Score =   355 bits (912),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 167/211 (79%), Positives = 186/211 (88%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELR+QGRCPLTPEE+GLLLA
Sbjct  307  DMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRNQGRCPLTPEEIGLLLA  366

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGF+N TRLYLASHKVYGG ARIS L++LFPLME+KKS+AS+EE  +I+GKASL AAVD
Sbjct  367  ALGFNNGTRLYLASHKVYGGEARISTLQKLFPLMEDKKSIASAEELTKIEGKASLSAAVD  426

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV M SDIFISASPGNMHNA+VGHR Y  LKTIRPNM LLG+LFLNK++ W EFQ AV 
Sbjct  427  YYVSMQSDIFISASPGNMHNALVGHRAYLKLKTIRPNMTLLGKLFLNKSMGWTEFQHAVR  486

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
             GH NR G IRLRK  +S+YTYPAPDCMC +
Sbjct  487  NGHKNRLGHIRLRKTKQSIYTYPAPDCMCQS  517



>emb|CAA23010.1| PsRT17-1 like protein [Arabidopsis thaliana]
 emb|CAB79363.1| PsRT17-1 like protein [Arabidopsis thaliana]
Length=431

 Score =   352 bits (902),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 161/209 (77%), Positives = 185/209 (89%), Gaps = 0/209 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHS CDF GGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELR++GRCPLTPEE+GLLL+
Sbjct  220  DMAAHSGCDFEGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRNKGRCPLTPEEIGLLLS  279

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGF NNTRLYLASH+VYGG ARIS LR+LFP +ENKKSLAS+EE  +++GKASL+AAVD
Sbjct  280  ALGFSNNTRLYLASHQVYGGEARISTLRKLFPGIENKKSLASAEELADVQGKASLMAAVD  339

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV M SDIFISASPGNMHNA+  HR Y NLKTIRPNM LLGQ+F+NK+L W EF+ AV+
Sbjct  340  YYVSMKSDIFISASPGNMHNALQAHRAYLNLKTIRPNMILLGQVFVNKSLDWSEFEGAVM  399

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMC  112
             GH NRQG++RLRK  +S+YTYPAPDCMC
Sbjct  400  NGHKNRQGQLRLRKQKQSIYTYPAPDCMC  428



>ref|XP_002867661.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43920.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=519

 Score =   354 bits (908),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 162/211 (77%), Positives = 187/211 (89%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHS CDF GGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELR++GRCPLTPEE+GLLL+
Sbjct  308  DMAAHSGCDFEGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRNKGRCPLTPEEIGLLLS  367

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGF NNTRLYLASH+VYGG ARIS LR+LFP +ENKKSLAS+EE  +++GKASL+AAVD
Sbjct  368  ALGFSNNTRLYLASHQVYGGEARISTLRKLFPGIENKKSLASAEELADVQGKASLMAAVD  427

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV M SDIFISASPGNMHNA++ HR Y NLKTIRPNM LLGQ+F+NK+L W EF+ AV+
Sbjct  428  YYVSMKSDIFISASPGNMHNALLAHRAYLNLKTIRPNMILLGQVFVNKSLEWSEFEGAVV  487

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
             GH NRQG++RLRK  +S+YTYPAPDCMC A
Sbjct  488  NGHRNRQGQLRLRKQKQSIYTYPAPDCMCKA  518



>ref|XP_011016934.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Populus 
euphratica]
Length=495

 Score =   352 bits (904),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 162/211 (77%), Positives = 187/211 (89%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHS+CDFGGGKAE+L+LAKYRQ+ WQGRVLNSQFTDE LR QGRCPLTPEE+GLLLA
Sbjct  285  DMAAHSSCDFGGGKAERLALAKYRQVLWQGRVLNSQFTDEALRKQGRCPLTPEEIGLLLA  344

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGF N+TRLYLASHKVYGG ARISAL++LFPL+++KKSLAS+EE  ++ GKASLLAAVD
Sbjct  345  ALGFSNSTRLYLASHKVYGGEARISALKKLFPLVDHKKSLASAEELAKVDGKASLLAAVD  404

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV + SDIFISASPGNMHNA+VGHR Y NLKTIRPNM +LG LFLNK++ WPEFQ AV+
Sbjct  405  YYVSLQSDIFISASPGNMHNALVGHRAYLNLKTIRPNMVMLGPLFLNKSMEWPEFQHAVL  464

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
             GH +RQG+IRLRK  +S+YTYP PDC C +
Sbjct  465  SGHKSRQGQIRLRKERQSIYTYPIPDCSCQS  495



>emb|CDY03446.1| BnaC01g16360D [Brassica napus]
Length=613

 Score =   356 bits (913),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 162/211 (77%), Positives = 187/211 (89%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHS CDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELR++GRCPLTPEE+GLLL+
Sbjct  402  DMAAHSGCDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRNKGRCPLTPEEIGLLLS  461

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGF NNTRLYLASH+VYGG ARIS LR+LFP++ENKKSLAS+EE  E++GKASL+AAVD
Sbjct  462  ALGFTNNTRLYLASHQVYGGEARISTLRKLFPVLENKKSLASAEELAEVEGKASLMAAVD  521

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV M SDIFISASPGNMHNA++ HR Y NLKTI PNM LLGQ+ +NK+L W EF+ AV+
Sbjct  522  YYVSMKSDIFISASPGNMHNALLAHRAYLNLKTINPNMILLGQVLVNKSLGWSEFEGAVV  581

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
             GH NRQG++RLRK  +S+YTYPAPDCMC A
Sbjct  582  NGHKNRQGQLRLRKQKQSIYTYPAPDCMCKA  612



>ref|XP_011016933.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Populus 
euphratica]
Length=513

 Score =   352 bits (904),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 162/211 (77%), Positives = 187/211 (89%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHS+CDFGGGKAE+L+LAKYRQ+ WQGRVLNSQFTDE LR QGRCPLTPEE+GLLLA
Sbjct  303  DMAAHSSCDFGGGKAERLALAKYRQVLWQGRVLNSQFTDEALRKQGRCPLTPEEIGLLLA  362

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGF N+TRLYLASHKVYGG ARISAL++LFPL+++KKSLAS+EE  ++ GKASLLAAVD
Sbjct  363  ALGFSNSTRLYLASHKVYGGEARISALKKLFPLVDHKKSLASAEELAKVDGKASLLAAVD  422

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV + SDIFISASPGNMHNA+VGHR Y NLKTIRPNM +LG LFLNK++ WPEFQ AV+
Sbjct  423  YYVSLQSDIFISASPGNMHNALVGHRAYLNLKTIRPNMVMLGPLFLNKSMEWPEFQHAVL  482

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
             GH +RQG+IRLRK  +S+YTYP PDC C +
Sbjct  483  SGHKSRQGQIRLRKERQSIYTYPIPDCSCQS  513



>ref|XP_008651492.1| PREDICTED: LOC100283829 isoform X1 [Zea mays]
 gb|ACF82519.1| unknown [Zea mays]
 tpg|DAA61414.1| TPA: hypothetical protein ZEAMMB73_640362 [Zea mays]
Length=447

 Score =   350 bits (897),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 158/210 (75%), Positives = 182/210 (87%), Gaps = 0/210 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGG+AE+L+LAKYRQ+ WQGRVLNSQ TDEELR+ GRCPLTPEE+GLLL 
Sbjct  237  DMAAHSACDFGGGRAEQLALAKYRQVIWQGRVLNSQLTDEELRNTGRCPLTPEEIGLLLV  296

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDN TRLYLASHKVYGG ARIS+LR+LFPLME+K+SLAS +E   ++GKAS+LAA+D
Sbjct  297  ALGFDNRTRLYLASHKVYGGEARISSLRKLFPLMEDKRSLASEDELANVEGKASVLAALD  356

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YY+ MHSDIFISASPGNMHNA+V HR+Y NLKTIRPNM LLG+ F NK++ WPEFQ  V 
Sbjct  357  YYISMHSDIFISASPGNMHNALVAHRSYENLKTIRPNMALLGRTFANKSMEWPEFQQVVQ  416

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCN  109
             GH  R G+IRLRK  +S+YTYPAPDCMC 
Sbjct  417  AGHKGRYGQIRLRKATQSIYTYPAPDCMCQ  446



>ref|XP_002301095.2| hypothetical protein POPTR_0002s10600g [Populus trichocarpa]
 gb|EEE80368.2| hypothetical protein POPTR_0002s10600g [Populus trichocarpa]
Length=513

 Score =   351 bits (901),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 162/211 (77%), Positives = 187/211 (89%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHS+CDFGGGKAE+L+LAKYRQ+ WQGRVLNSQFTDE LR QGRCPLTPEE+GLLLA
Sbjct  303  DMAAHSSCDFGGGKAERLALAKYRQLLWQGRVLNSQFTDEALRKQGRCPLTPEEIGLLLA  362

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGF N+TRLYLASHKVYGG ARISAL++LFPL+++KKSLAS+EE  ++ GKASLLAAVD
Sbjct  363  ALGFSNSTRLYLASHKVYGGEARISALKKLFPLVDHKKSLASAEELAKVDGKASLLAAVD  422

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV + SDIFISASPGNMHNA+VGHR Y NLKTIRPNM +LG LFLNK++ WPEFQ AV+
Sbjct  423  YYVSLQSDIFISASPGNMHNALVGHRAYLNLKTIRPNMVMLGPLFLNKSMEWPEFQYAVL  482

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
             GH +RQG+IRLRK  +S+YTYP PDC C +
Sbjct  483  SGHKSRQGQIRLRKERQSIYTYPIPDCSCQS  513



>gb|KFK28724.1| hypothetical protein AALP_AA7G039000 [Arabis alpina]
Length=513

 Score =   351 bits (901),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 160/211 (76%), Positives = 185/211 (88%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHS CDFGGGKAEKL+LAKYRQ+ WQGRVLNS  TDEELR++GRCPLTPEE+GLLL+
Sbjct  301  DMAAHSGCDFGGGKAEKLALAKYRQVIWQGRVLNSLLTDEELRNKGRCPLTPEEIGLLLS  360

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGF NNTRLYLASH+VYGG ARIS LR+LFP+MENKKSLAS EE  +++GKASL+AAVD
Sbjct  361  ALGFSNNTRLYLASHQVYGGEARISTLRKLFPVMENKKSLASVEELADVEGKASLMAAVD  420

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV M SDIFISASPGNMHNA++ HR Y NLKTIRPNM LLGQ+ +NK+L W EF+ +V+
Sbjct  421  YYVSMKSDIFISASPGNMHNALLAHRAYLNLKTIRPNMILLGQVLVNKSLDWSEFEGSVL  480

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
             GH NRQG++RLRK  +S+YTYPAPDCMC A
Sbjct  481  NGHKNRQGQLRLRKEKQSIYTYPAPDCMCKA  511



>ref|XP_010439017.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Camelina sativa]
 ref|XP_010439018.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Camelina sativa]
 ref|XP_010439019.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Camelina sativa]
Length=518

 Score =   351 bits (901),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 161/211 (76%), Positives = 184/211 (87%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHS CDF GGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELR++GRCPLTPEE+GLLL+
Sbjct  307  DMAAHSGCDFEGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRNKGRCPLTPEEIGLLLS  366

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGF NNTRLYLASH+VYGG ARIS LR+LFP MENKKSLAS+EE  +I+GKASL+AAVD
Sbjct  367  ALGFSNNTRLYLASHQVYGGEARISTLRKLFPGMENKKSLASAEELADIEGKASLMAAVD  426

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV M SDIFISASPGNMHNA++ HR Y NLKTIRPNM LLGQ+F+NK+L W EF+ AV+
Sbjct  427  YYVSMKSDIFISASPGNMHNALLAHRAYLNLKTIRPNMILLGQVFVNKSLDWSEFEGAVV  486

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
             GH NR G++RLRK  +S+YTYP PDCMC  
Sbjct  487  NGHKNRHGQLRLRKQKQSIYTYPVPDCMCKV  517



>ref|NP_194184.2| O-fucosyltransferase family protein [Arabidopsis thaliana]
 gb|AAP68214.1| At4g24530 [Arabidopsis thaliana]
 dbj|BAE99793.1| PsRT17-1 like protein [Arabidopsis thaliana]
 gb|AEE84921.1| O-fucosyltransferase family protein [Arabidopsis thaliana]
Length=519

 Score =   351 bits (901),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 161/209 (77%), Positives = 185/209 (89%), Gaps = 0/209 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHS CDF GGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELR++GRCPLTPEE+GLLL+
Sbjct  308  DMAAHSGCDFEGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRNKGRCPLTPEEIGLLLS  367

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGF NNTRLYLASH+VYGG ARIS LR+LFP +ENKKSLAS+EE  +++GKASL+AAVD
Sbjct  368  ALGFSNNTRLYLASHQVYGGEARISTLRKLFPGIENKKSLASAEELADVQGKASLMAAVD  427

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV M SDIFISASPGNMHNA+  HR Y NLKTIRPNM LLGQ+F+NK+L W EF+ AV+
Sbjct  428  YYVSMKSDIFISASPGNMHNALQAHRAYLNLKTIRPNMILLGQVFVNKSLDWSEFEGAVM  487

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMC  112
             GH NRQG++RLRK  +S+YTYPAPDCMC
Sbjct  488  NGHKNRQGQLRLRKQKQSIYTYPAPDCMC  516



>ref|XP_010448552.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=518

 Score =   351 bits (900),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 160/211 (76%), Positives = 184/211 (87%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHS CDF GGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELR++GRCPLTPEE+GLLL+
Sbjct  307  DMAAHSGCDFEGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRNKGRCPLTPEEIGLLLS  366

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGF NNTRLYLASH+VYGG ARIS LR+LFP MENKKSLAS+EE  +++GKASL+AAVD
Sbjct  367  ALGFSNNTRLYLASHQVYGGEARISTLRKLFPGMENKKSLASAEELADVEGKASLMAAVD  426

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV M SDIFISASPGNMHNA++ HR Y NLKTIRPNM LLGQ+F+NK+L W EF+ AV+
Sbjct  427  YYVSMKSDIFISASPGNMHNALLAHRAYLNLKTIRPNMILLGQVFVNKSLDWSEFEGAVV  486

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
             GH NR G++RLRK  +S+YTYP PDCMC  
Sbjct  487  NGHKNRHGQLRLRKQKQSIYTYPVPDCMCKV  517



>ref|NP_001063155.1| Os09g0412200 [Oryza sativa Japonica Group]
 dbj|BAD28369.1| putative auxin-independent growth promoter [Oryza sativa Japonica 
Group]
 dbj|BAF25069.1| Os09g0412200 [Oryza sativa Japonica Group]
 dbj|BAG90088.1| unnamed protein product [Oryza sativa Japonica Group]
Length=512

 Score =   350 bits (898),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 157/210 (75%), Positives = 187/210 (89%), Gaps = 0/210 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGG+AE+L+LAKYRQ+ WQGRVLNSQ TDEELR+ GRCPLTPEE+GLLLA
Sbjct  302  DMAAHSACDFGGGRAERLALAKYRQVIWQGRVLNSQLTDEELRNLGRCPLTPEEIGLLLA  361

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFD+ TR+YLASHKVYGG ARIS+LR+LFPLME+K+SLAS EE   ++GKAS+LAA+D
Sbjct  362  ALGFDSRTRIYLASHKVYGGEARISSLRKLFPLMEDKRSLASEEELTNVEGKASVLAALD  421

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YY+ MHSDIFISASPGNMHNA++ HRT+ N+KTIRPNM LLG++F+NK++ W EFQ+AV 
Sbjct  422  YYISMHSDIFISASPGNMHNALMAHRTFENMKTIRPNMALLGRIFVNKSMEWLEFQEAVQ  481

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCN  109
             GH  R G+IRLRKP +S+YTYPAPDCMC 
Sbjct  482  AGHKGRYGQIRLRKPKQSIYTYPAPDCMCQ  511



>ref|XP_010433755.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=529

 Score =   350 bits (899),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 160/211 (76%), Positives = 185/211 (88%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHS CDF GGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELR++GRCPLTPEE+GLLL+
Sbjct  318  DMAAHSGCDFEGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRNKGRCPLTPEEIGLLLS  377

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGF NNTRLYLASH+VYGG ARIS LR+LFP MENKKSLAS+EE  +++GKASL+AAVD
Sbjct  378  ALGFSNNTRLYLASHQVYGGEARISTLRKLFPGMENKKSLASAEELADVEGKASLMAAVD  437

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV M SDIFISASPGNMHNA++ HR Y NLKTIRPNM LLGQ+F+NK+L W EF+ AV+
Sbjct  438  YYVSMKSDIFISASPGNMHNALLAHRAYLNLKTIRPNMILLGQVFVNKSLDWSEFEGAVV  497

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
             GH NR G++R+RK  +S+YTYPAPDCMC  
Sbjct  498  NGHKNRHGQLRIRKQNQSIYTYPAPDCMCKV  528



>emb|CDY34289.1| BnaA01g13920D [Brassica napus]
Length=792

 Score =   357 bits (917),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 162/211 (77%), Positives = 187/211 (89%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHS CDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELR++GRCPLTPEE+GLLL+
Sbjct  581  DMAAHSGCDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRNKGRCPLTPEEIGLLLS  640

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGF NNTRLYLASH+VYGG ARIS LR+LFP++ENKKSLAS+EE  E++GKASL+AAVD
Sbjct  641  ALGFTNNTRLYLASHQVYGGEARISTLRKLFPVLENKKSLASAEELAEVEGKASLMAAVD  700

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV M SDIFISASPGNMHNA++ HR Y NLKTI PNM LLGQ+ +NK+L W EF+ AV+
Sbjct  701  YYVSMKSDIFISASPGNMHNALLAHRAYLNLKTINPNMILLGQVLVNKSLGWSEFEGAVV  760

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
             GH NRQG++RLRK  +S+YTYPAPDCMC A
Sbjct  761  NGHKNRQGQLRLRKQKQSIYTYPAPDCMCKA  791



>ref|XP_006661225.1| PREDICTED: uncharacterized protein At1g04910-like, partial [Oryza 
brachyantha]
Length=492

 Score =   348 bits (894),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 157/210 (75%), Positives = 185/210 (88%), Gaps = 0/210 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGG+AE+L+LAKYRQ+ WQGRVLNSQ TD ELR+ GRCPLTPEE+GLLLA
Sbjct  282  DMAAHSACDFGGGRAERLALAKYRQVIWQGRVLNSQLTDVELRNTGRCPLTPEEIGLLLA  341

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFD+ TR+YLASHKVYGG ARI +LR+LFPLME+K+SLAS EE   ++GKASLLAA+D
Sbjct  342  ALGFDSRTRIYLASHKVYGGEARILSLRKLFPLMEDKRSLASEEELANVEGKASLLAALD  401

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YY+ MHSDIFISASPGNMHNA++ HRT+ NLKTIRPNM LLG++F+NK++ W EFQ+AV 
Sbjct  402  YYISMHSDIFISASPGNMHNALMAHRTFENLKTIRPNMALLGRIFVNKSMEWSEFQEAVQ  461

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCN  109
             GH  R G+IRLRKP +S+YTYPAPDCMC 
Sbjct  462  AGHKGRYGQIRLRKPKQSIYTYPAPDCMCQ  491



>ref|NP_001150199.1| LOC100283829 [Zea mays]
 gb|ACG38224.1| psRT17-1 like protein [Zea mays]
 tpg|DAA61416.1| TPA: psRT17-1 like protein [Zea mays]
Length=511

 Score =   349 bits (895),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 158/210 (75%), Positives = 182/210 (87%), Gaps = 0/210 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGG+AE+L+LAKYRQ+ WQGRVLNSQ TDEELR+ GRCPLTPEE+GLLL 
Sbjct  301  DMAAHSACDFGGGRAEQLALAKYRQVIWQGRVLNSQLTDEELRNTGRCPLTPEEIGLLLV  360

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDN TRLYLASHKVYGG ARIS+LR+LFPLME+K+SLAS +E   ++GKAS+LAA+D
Sbjct  361  ALGFDNRTRLYLASHKVYGGEARISSLRKLFPLMEDKRSLASEDELANVEGKASVLAALD  420

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YY+ MHSDIFISASPGNMHNA+V HR+Y NLKTIRPNM LLG+ F NK++ WPEFQ  V 
Sbjct  421  YYISMHSDIFISASPGNMHNALVAHRSYENLKTIRPNMALLGRTFANKSMEWPEFQQVVQ  480

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCN  109
             GH  R G+IRLRK  +S+YTYPAPDCMC 
Sbjct  481  AGHKGRYGQIRLRKATQSIYTYPAPDCMCQ  510



>ref|XP_004956798.1| PREDICTED: uncharacterized protein At1g04910-like [Setaria italica]
Length=512

 Score =   348 bits (893),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 156/210 (74%), Positives = 187/210 (89%), Gaps = 0/210 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHS+CDFGGG+AEKL+LAKYR++ WQGRVLNSQ TDEELR+ GRCPLTPEE+GL+L 
Sbjct  302  DMAAHSSCDFGGGRAEKLALAKYRKVIWQGRVLNSQLTDEELRNTGRCPLTPEEIGLVLV  361

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFD+ TRLYLASHKVYGG ARIS+LR+LFPLME+K+SLAS EE  +++GKAS+LAA+D
Sbjct  362  ALGFDSRTRLYLASHKVYGGEARISSLRKLFPLMEDKRSLASEEELADVEGKASVLAALD  421

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YY+ MHSDIFISASPGNMHNA++ HRTY NLKTIRPNM LLG++F+NK++ W +FQ AV 
Sbjct  422  YYISMHSDIFISASPGNMHNALLAHRTYENLKTIRPNMALLGRIFVNKSMEWLDFQQAVQ  481

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCN  109
             GH  R G+IRLRKP +S+YTYPAPDCMC+
Sbjct  482  AGHKGRYGQIRLRKPKQSIYTYPAPDCMCH  511



>ref|XP_006285210.1| hypothetical protein CARUB_v10006569mg [Capsella rubella]
 gb|EOA18108.1| hypothetical protein CARUB_v10006569mg [Capsella rubella]
Length=521

 Score =   347 bits (891),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 159/211 (75%), Positives = 184/211 (87%), Gaps = 0/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHS CDF GGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELR++GRCPLTPEE+GLLL+
Sbjct  310  DMAAHSGCDFEGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRNKGRCPLTPEEIGLLLS  369

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGF NNTRLYLASH+VYGG ARIS LR+LFP +ENKKSLAS+EE  +++GKASL+AAVD
Sbjct  370  ALGFSNNTRLYLASHQVYGGEARISTLRKLFPGVENKKSLASAEELADVEGKASLMAAVD  429

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV M SDIFISASPGNMHNA++ HR Y NLKTIRPNM LLGQ+ +NK+L W EF+ AV+
Sbjct  430  YYVSMKSDIFISASPGNMHNALLAHRAYLNLKTIRPNMILLGQVLVNKSLDWSEFEGAVV  489

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
             GH NR G++RLRK  +S+YTYPAPDCMC  
Sbjct  490  NGHKNRHGQLRLRKQKQSIYTYPAPDCMCKV  520



>ref|XP_008444924.1| PREDICTED: uncharacterized protein At1g04910-like [Cucumis melo]
Length=515

 Score =   346 bits (888),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 158/209 (76%), Positives = 182/209 (87%), Gaps = 0/209 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSAC+FGGGKAE+L+LAKYRQ+ WQGRV NSQFTDEELR QGRCPLTPEE+GL+LA
Sbjct  304  DMAAHSACEFGGGKAERLALAKYRQVIWQGRVPNSQFTDEELRYQGRCPLTPEEIGLVLA  363

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGF N TR+YLA H+VYGG ARIS LR++FPL+E+KKSL S  ER  + GKASL AAVD
Sbjct  364  ALGFSNTTRVYLAIHEVYGGEARISTLRKVFPLLEDKKSLTSPMERAGVAGKASLSAAVD  423

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV +HSD+FISASPGNMHNA+VGHR Y N+KTIRPNM LLGQLFLNK++ W EF+ AV+
Sbjct  424  YYVSLHSDVFISASPGNMHNALVGHRAYLNMKTIRPNMVLLGQLFLNKSMEWSEFKKAVL  483

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMC  112
             GH NRQG+IRLRK  +S+YTYPAPDCMC
Sbjct  484  TGHRNRQGQIRLRKEKQSIYTYPAPDCMC  512



>ref|XP_006413418.1| hypothetical protein EUTSA_v10024936mg [Eutrema salsugineum]
 gb|ESQ54871.1| hypothetical protein EUTSA_v10024936mg [Eutrema salsugineum]
Length=518

 Score =   346 bits (888),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 157/209 (75%), Positives = 184/209 (88%), Gaps = 0/209 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHS CDFGGGKAEKL+LAKYR++ WQGRVLNSQFTDEELR++GRCPLTPEE+GLLL+
Sbjct  307  DMAAHSGCDFGGGKAEKLALAKYREVIWQGRVLNSQFTDEELRNKGRCPLTPEEIGLLLS  366

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGF NNTR+YLASH+VYGG ARIS LR+LFP+MENKKSLAS+EE   ++G+ASL+AAVD
Sbjct  367  ALGFSNNTRIYLASHQVYGGEARISTLRKLFPVMENKKSLASAEELAGVEGRASLMAAVD  426

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV M SDIFISASPGNMHNA++ HR Y NLKTI PNM LLGQ+ +NK+L W EF+  V+
Sbjct  427  YYVSMKSDIFISASPGNMHNALLAHRAYLNLKTINPNMILLGQVLVNKSLEWSEFEGRVL  486

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMC  112
             GH NRQG++RLRK  +S+YTYPAPDCMC
Sbjct  487  NGHKNRQGQLRLRKQKQSIYTYPAPDCMC  515



>dbj|BAK06980.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=512

 Score =   345 bits (884),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 154/209 (74%), Positives = 183/209 (88%), Gaps = 0/209 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGG+AEKL+LAKYRQ+ WQGRVLNSQ +DEELR+ GRCPLTPEE+GL+L 
Sbjct  302  DMAAHSACDFGGGRAEKLALAKYRQVIWQGRVLNSQLSDEELRNTGRCPLTPEEIGLILV  361

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFD+ TR YLASHKVYGG ARIS+LR+LFPLM +K+SLAS++E   I+GKAS+LAA+D
Sbjct  362  ALGFDSKTRFYLASHKVYGGEARISSLRKLFPLMVDKRSLASADELASIEGKASVLAALD  421

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            Y++ MHSD+FISASPGNMHNA++ HRTY NLKTIRPNM LLG +F+NK++ W EFQ AV 
Sbjct  422  YHISMHSDVFISASPGNMHNALLAHRTYRNLKTIRPNMTLLGHIFVNKSMEWSEFQQAVQ  481

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMC  112
             GH  R G+IRLRKP +S+YTYPAPDCMC
Sbjct  482  AGHKGRYGQIRLRKPKQSIYTYPAPDCMC  510



>gb|EMT16885.1| hypothetical protein F775_06176 [Aegilops tauschii]
Length=511

 Score =   344 bits (883),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 153/210 (73%), Positives = 183/210 (87%), Gaps = 0/210 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGG+AEKL+LAKYRQ+ WQGRVLNSQ +DEELR+ GRCPLTPEE+GL+L 
Sbjct  301  DMAAHSACDFGGGRAEKLALAKYRQVIWQGRVLNSQLSDEELRNTGRCPLTPEEIGLILV  360

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFD+ TR YLASHKVYGG ARIS+LR+LFPLME+K+SLAS++E   ++GKAS+LAA+D
Sbjct  361  ALGFDSTTRFYLASHKVYGGEARISSLRKLFPLMEDKRSLASADELANVEGKASVLAALD  420

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            Y++ MHSD+FISASPGNMHNA++ HR Y NLKTIRPNM LLG +F+NK++ W EFQ AV 
Sbjct  421  YHISMHSDVFISASPGNMHNALLAHRAYRNLKTIRPNMTLLGHIFVNKSMEWSEFQQAVQ  480

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCN  109
             GH  R G+IRLRKP +S+YTYPAPDCMC 
Sbjct  481  AGHKGRYGQIRLRKPKQSIYTYPAPDCMCQ  510



>ref|XP_002462371.1| hypothetical protein SORBIDRAFT_02g024540 [Sorghum bicolor]
 gb|EER98892.1| hypothetical protein SORBIDRAFT_02g024540 [Sorghum bicolor]
Length=511

 Score =   344 bits (882),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 155/210 (74%), Positives = 182/210 (87%), Gaps = 0/210 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGG+AE+L+LAKYRQ+ WQGRVLNSQ TD ELR+ GRCPLTPEE+GLLL 
Sbjct  301  DMAAHSACDFGGGRAEQLALAKYRQVIWQGRVLNSQLTDRELRNTGRCPLTPEEIGLLLV  360

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFD+ TRLYLASHKVYGG ARIS+LR+LFPLME+K+SLAS +E   ++GKAS+LAA+D
Sbjct  361  ALGFDSKTRLYLASHKVYGGEARISSLRKLFPLMEDKRSLASEDELANVEGKASVLAALD  420

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YY+ MHSDIFISASPGNMHNA++ HRTY NLKTIRPNM LLG++F+NK++ W EFQ  V 
Sbjct  421  YYISMHSDIFISASPGNMHNALMAHRTYENLKTIRPNMALLGRIFVNKSMEWQEFQQVVQ  480

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCN  109
             GH  R G+IRLRK  +S+YTYPAPDCMC 
Sbjct  481  AGHKGRYGQIRLRKATQSIYTYPAPDCMCQ  510



>ref|XP_004152738.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis 
sativus]
 ref|XP_004163454.1| PREDICTED: DUF246 domain-containing protein At1g04910-like [Cucumis 
sativus]
Length=515

 Score =   344 bits (882),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 157/209 (75%), Positives = 181/209 (87%), Gaps = 0/209 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSAC+FGGGKAE+L+LAKYRQ+ WQGRV NSQFTDEELR QGRCPLTPEE+GLLLA
Sbjct  304  DMAAHSACEFGGGKAERLALAKYRQVIWQGRVPNSQFTDEELRYQGRCPLTPEEIGLLLA  363

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGF N TR+YLA H+VYGG ARIS LR++FPL+E+KKSL S  ER  + GKASL AAVD
Sbjct  364  ALGFSNTTRVYLAIHEVYGGEARISTLRKVFPLLEDKKSLTSPMERAGVAGKASLSAAVD  423

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YYV +HSD+FISASPGNMHNA++GHR Y N+KTIRPNM LLG LFLNK++ W EF+ AV+
Sbjct  424  YYVSLHSDVFISASPGNMHNALLGHRAYLNMKTIRPNMVLLGPLFLNKSMEWSEFKKAVL  483

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMC  112
             GH NRQG+IRLRK  +S+YTYPAPDCMC
Sbjct  484  TGHRNRQGQIRLRKETQSIYTYPAPDCMC  512



>gb|EMS64135.1| hypothetical protein TRIUR3_23110 [Triticum urartu]
Length=493

 Score =   343 bits (879),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 152/210 (72%), Positives = 181/210 (86%), Gaps = 0/210 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGG+AEKL+LAKYRQ+ WQGRVLNSQ +DEELR+ GRCPLTPEE+GL+L 
Sbjct  283  DMAAHSACDFGGGRAEKLALAKYRQVIWQGRVLNSQLSDEELRNTGRCPLTPEEIGLILV  342

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFD+ TR YLASHKVYGG ARIS+LR+LFPLME+K+SLAS++E   ++GKAS+LAA+D
Sbjct  343  ALGFDSTTRFYLASHKVYGGEARISSLRKLFPLMEDKRSLASADELANVEGKASVLAALD  402

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            Y++ MHSD+FISASPGNMHNA++ HR Y N KTIRPNM LLG +F NK++ W EFQ AV 
Sbjct  403  YHISMHSDVFISASPGNMHNALLAHRAYRNFKTIRPNMTLLGHIFANKSMEWSEFQQAVQ  462

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCN  109
             GH  R G+IRLRKP +S+YTYPAPDCMC 
Sbjct  463  AGHKGRYGQIRLRKPKQSIYTYPAPDCMCQ  492



>gb|EEC84568.1| hypothetical protein OsI_31345 [Oryza sativa Indica Group]
Length=519

 Score =   343 bits (879),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 155/209 (74%), Positives = 185/209 (89%), Gaps = 0/209 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGG+AE+L+LAKYRQ+ WQGRVLNSQ TDEELR+ GRCPLTPEE+GLLLA
Sbjct  274  DMAAHSACDFGGGRAERLALAKYRQVIWQGRVLNSQLTDEELRNLGRCPLTPEEIGLLLA  333

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFD+ TR+YLASHKVYGG ARIS+LR+LFPLME+K+SLAS EE   ++GKAS+LAA+D
Sbjct  334  ALGFDSRTRIYLASHKVYGGEARISSLRKLFPLMEDKRSLASEEELTNVEGKASVLAALD  393

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YY+ MHSDIFISASPGNMHNA++ HRT+ N+KTIRPNM LLG++F+NK++ W EFQ+AV 
Sbjct  394  YYISMHSDIFISASPGNMHNALMAHRTFENMKTIRPNMALLGRIFVNKSMEWLEFQEAVQ  453

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMC  112
             GH  R G+IRLRKP +S+YTYPAPD  C
Sbjct  454  AGHKGRYGQIRLRKPKQSIYTYPAPDFCC  482



>tpg|DAA61415.1| TPA: hypothetical protein ZEAMMB73_640362 [Zea mays]
Length=486

 Score =   340 bits (872),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 155/206 (75%), Positives = 179/206 (87%), Gaps = 0/206 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGG+AE+L+LAKYRQ+ WQGRVLNSQ TDEELR+ GRCPLTPEE+GLLL 
Sbjct  266  DMAAHSACDFGGGRAEQLALAKYRQVIWQGRVLNSQLTDEELRNTGRCPLTPEEIGLLLV  325

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDN TRLYLASHKVYGG ARIS+LR+LFPLME+K+SLAS +E   ++GKAS+LAA+D
Sbjct  326  ALGFDNRTRLYLASHKVYGGEARISSLRKLFPLMEDKRSLASEDELANVEGKASVLAALD  385

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YY+ MHSDIFISASPGNMHNA+V HR+Y NLKTIRPNM LLG+ F NK++ WPEFQ  V 
Sbjct  386  YYISMHSDIFISASPGNMHNALVAHRSYENLKTIRPNMALLGRTFANKSMEWPEFQQVVQ  445

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPD  121
             GH  R G+IRLRK  +S+YTYPAPD
Sbjct  446  AGHKGRYGQIRLRKATQSIYTYPAPD  471



>ref|XP_003578106.1| PREDICTED: uncharacterized protein At1g04910-like [Brachypodium 
distachyon]
Length=512

 Score =   338 bits (866),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 153/209 (73%), Positives = 182/209 (87%), Gaps = 0/209 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSAC+FGGG+AEKL+LAKYRQ+ WQGRVLNSQ +DEELR+ GRCPLTPEE GLL+A
Sbjct  302  DMAAHSACEFGGGRAEKLALAKYRQVIWQGRVLNSQLSDEELRNTGRCPLTPEETGLLMA  361

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDN+TRLYLASHKVYGG ARIS+LR+LFPLM +K+SLAS EE   ++GKAS+LAA+D
Sbjct  362  ALGFDNSTRLYLASHKVYGGEARISSLRKLFPLMVDKRSLASEEELANVQGKASVLAALD  421

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YY+ +HSDIFISASPGNMHNA++  R Y+N+KTI+PNM LLG +F+NK+  W EFQ AV 
Sbjct  422  YYISIHSDIFISASPGNMHNAVMAQRAYNNMKTIKPNMALLGHIFVNKSNEWSEFQQAVQ  481

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMC  112
             GH  R G+IRLRKP +S+YTYPAPDCMC
Sbjct  482  AGHKGRYGQIRLRKPKQSIYTYPAPDCMC  510



>gb|EEE69695.1| hypothetical protein OsJ_29339 [Oryza sativa Japonica Group]
Length=722

 Score =   342 bits (877),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 154/206 (75%), Positives = 184/206 (89%), Gaps = 0/206 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGG+AE+L+LAKYRQ+ WQGRVLNSQ TDEELR+ GRCPLTPEE+GLLLA
Sbjct  302  DMAAHSACDFGGGRAERLALAKYRQVIWQGRVLNSQLTDEELRNLGRCPLTPEEIGLLLA  361

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFD+ TR+YLASHKVYGG ARIS+LR+LFPLME+K+SLAS EE   ++GKAS+LAA+D
Sbjct  362  ALGFDSRTRIYLASHKVYGGEARISSLRKLFPLMEDKRSLASEEELTNVEGKASVLAALD  421

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
            YY+ MHSDIFISASPGNMHNA++ HRT+ N+KTIRPNM LLG++F+NK++ W EFQ+AV 
Sbjct  422  YYISMHSDIFISASPGNMHNALMAHRTFENMKTIRPNMALLGRIFVNKSMEWLEFQEAVQ  481

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPD  121
             GH  R G+IRLRKP +S+YTYPAPD
Sbjct  482  AGHKGRYGQIRLRKPKQSIYTYPAPD  507



>gb|KGN62755.1| hypothetical protein Csa_2G370540 [Cucumis sativus]
Length=1445

 Score =   344 bits (883),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 157/209 (75%), Positives = 181/209 (87%), Gaps = 0/209 (0%)
 Frame = -2

Query  738   DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
             DM AHSAC+FGGGKAE+L+LAKYRQ+ WQGRV NSQFTDEELR QGRCPLTPEE+GLLLA
Sbjct  1234  DMAAHSACEFGGGKAERLALAKYRQVIWQGRVPNSQFTDEELRYQGRCPLTPEEIGLLLA  1293

Query  558   ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
             ALGF N TR+YLA H+VYGG ARIS LR++FPL+E+KKSL S  ER  + GKASL AAVD
Sbjct  1294  ALGFSNTTRVYLAIHEVYGGEARISTLRKVFPLLEDKKSLTSPMERAGVAGKASLSAAVD  1353

Query  378   YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
             YYV +HSD+FISASPGNMHNA++GHR Y N+KTIRPNM LLG LFLNK++ W EF+ AV+
Sbjct  1354  YYVSLHSDVFISASPGNMHNALLGHRAYLNMKTIRPNMVLLGPLFLNKSMEWSEFKKAVL  1413

Query  198   EGHANRQGEIRLRKPAKSLYTYPAPDCMC  112
              GH NRQG+IRLRK  +S+YTYPAPDCMC
Sbjct  1414  TGHRNRQGQIRLRKETQSIYTYPAPDCMC  1442



>gb|KJB48896.1| hypothetical protein B456_008G092600, partial [Gossypium raimondii]
Length=495

 Score =   320 bits (819),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 162/245 (66%), Positives = 177/245 (72%), Gaps = 44/245 (18%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            D  AHSACDFGG          YRQ  W GRVLNSQFTDEELRSQGRCPLTPEE+GLLLA
Sbjct  261  DTAAHSACDFGG----------YRQTIWGGRVLNSQFTDEELRSQGRCPLTPEEIGLLLA  310

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDN+TRLYLASHKVYGG ARIS LR LFPLMENKKSLASSEER  IKGKASLLAAVD
Sbjct  311  ALGFDNSTRLYLASHKVYGGEARISTLRELFPLMENKKSLASSEERARIKGKASLLAAVD  370

Query  378  YYVGMHSDIFISASPGNMHNAMVG----HRTYHNLKTIRP--------------------  271
            YYVGMHSDIF+SASPGNMHNA+ G    +R +H   T+                      
Sbjct  371  YYVGMHSDIFVSASPGNMHNALPGITYRYRAFHFAATVPKVYMWKISNNYVQLQCFYNFF  430

Query  270  ----------NMQLLGQLFLNKNLTWPEFQDAVIEGHANRQGEIRLRKPAKSLYTYPAPD  121
                      +M LLGQLFLNKN+TW EF+ AV EGH NRQG+++LRKP +S+YTYPAPD
Sbjct  431  LFPSASVNEHDMALLGQLFLNKNITWLEFRQAVAEGHQNRQGQLKLRKPKQSIYTYPAPD  490

Query  120  CMCNA  106
            CMC A
Sbjct  491  CMCRA  495



>gb|AAB72114.1| PsRT17-1 [Pisum sativum]
Length=406

 Score =   308 bits (790),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 143/170 (84%), Positives = 158/170 (93%), Gaps = 0/170 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCP+TPEEVGLLLA
Sbjct  232  DMAAHSACDFGGGKAEKLALAKYRQVIWQGRVLNSQFTDEELRSQGRCPMTPEEVGLLLA  291

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDN+TRLYLASHKVYGG ARI+ L++LFPLME+KKSL S  ER +IKGKASLLAA+D
Sbjct  292  ALGFDNSTRLYLASHKVYGGGARIATLKQLFPLMEDKKSLTSPFERAQIKGKASLLAALD  351

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNL  229
            YY+ +HSDIFISASPGNMHNA+VGHRTY NLKTIRPNM L+GQLFLNK +
Sbjct  352  YYISIHSDIFISASPGNMHNALVGHRTYLNLKTIRPNMALMGQLFLNKTM  401



>ref|XP_010312650.1| PREDICTED: uncharacterized protein At1g04910 isoform X4 [Solanum 
lycopersicum]
Length=468

 Score =   306 bits (783),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 149/211 (71%), Positives = 160/211 (76%), Gaps = 38/211 (18%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAE L+LAKYRQ+ W GRV+NSQFTDEELRSQGRCPLTPEEVGLLLA
Sbjct  296  DMAAHSACDFGGGKAENLALAKYRQVIWGGRVINSQFTDEELRSQGRCPLTPEEVGLLLA  355

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDNNTRLYLASHKVYGG  R+SALR LFPLME+KKSLASSE                
Sbjct  356  ALGFDNNTRLYLASHKVYGGERRVSALRSLFPLMEDKKSLASSE----------------  399

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVI  199
                                  VG RTY+N+KTIRPNM LLGQLFLNK LTWPEFQ++VI
Sbjct  400  ----------------------VGQRTYNNMKTIRPNMALLGQLFLNKTLTWPEFQESVI  437

Query  198  EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            EGH NRQG+IRLRKP +SLYTYPAPDCMC A
Sbjct  438  EGHQNRQGQIRLRKPKQSLYTYPAPDCMCQA  468



>ref|XP_001777077.1| predicted protein [Physcomitrella patens]
 gb|EDQ58070.1| predicted protein, partial [Physcomitrella patens]
Length=437

 Score =   294 bits (752),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 131/212 (62%), Positives = 170/212 (80%), Gaps = 1/212 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAE+L+LAKYR + WQGRV N+Q +D+ELR +G+CP++PEEVG++L 
Sbjct  208  DMAAHSACDFGGGKAERLALAKYRGVVWQGRVSNAQLSDKELRDKGKCPMSPEEVGIMLV  267

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGF   T +YLAS+ VYGG+AR+  L  LFP M  K +LA++EE     GKAS LAA+D
Sbjct  268  ALGFSPKTHVYLASYTVYGGSARMDFLHNLFPNMVTKYTLATAEELAPFAGKASQLAAID  327

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNL-KTIRPNMQLLGQLFLNKNLTWPEFQDAV  202
            Y V +HSDIF+SAS GNMHN++  HRTY N+ KTI+P+M L+ +LF +KNLTWPEF+ +V
Sbjct  328  YLVSLHSDIFLSASRGNMHNSLAAHRTYLNVRKTIKPDMNLMARLFAHKNLTWPEFRRSV  387

Query  201  IEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            +EGH NR G++ LR+P +S+YTYPAPDCMC +
Sbjct  388  VEGHKNRMGQVALRQPTQSIYTYPAPDCMCTS  419



>ref|XP_002967262.1| hypothetical protein SELMODRAFT_87093 [Selaginella moellendorffii]
 gb|EFJ31861.1| hypothetical protein SELMODRAFT_87093 [Selaginella moellendorffii]
Length=476

 Score =   286 bits (733),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 132/212 (62%), Positives = 167/212 (79%), Gaps = 1/212 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGG+ E+L+LA YR   WQGRV NS+ T ++LR  G+CPLTPEE GL LA
Sbjct  258  DMAAHSACDFGGGRVEQLALAYYRHKVWQGRVPNSRLTVQQLRLLGKCPLTPEEAGLTLA  317

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGF  +TR+YLASH++YGG AR+S L+ +FPLM++K SLA   E    + KASL AA+D
Sbjct  318  ALGFGPHTRVYLASHQIYGGEARLSFLKNIFPLMQDKASLAIDAELRPFERKASLSAALD  377

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNL-KTIRPNMQLLGQLFLNKNLTWPEFQDAV  202
            YYV + SD F+SASPGNMHNA++GHRTY N+ KT+RP+M LL +LF N ++ WPEFQ+ V
Sbjct  378  YYVCLKSDFFLSASPGNMHNAVIGHRTYQNVQKTLRPDMVLLSRLFSNSSMEWPEFQNRV  437

Query  201  IEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
              GH NR G++RLR+P +S+YTYPAPDCMC +
Sbjct  438  YNGHRNRLGQVRLRQPKQSIYTYPAPDCMCKS  469



>ref|XP_002960458.1| hypothetical protein SELMODRAFT_75338 [Selaginella moellendorffii]
 gb|EFJ37997.1| hypothetical protein SELMODRAFT_75338 [Selaginella moellendorffii]
Length=464

 Score =   286 bits (731),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 131/210 (62%), Positives = 167/210 (80%), Gaps = 1/210 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGG+ E+L+LA YR   WQGRV NS+ T ++LR  G+CPLTPEE GL LA
Sbjct  246  DMAAHSACDFGGGRVEQLALAYYRHKVWQGRVPNSRLTVQQLRLLGKCPLTPEEAGLTLA  305

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGF  +TR+YLASH++YGG AR+S L+ +FPLM++K S+A  +E    + KASL AA+D
Sbjct  306  ALGFGPHTRVYLASHQIYGGEARLSFLKNIFPLMQDKASVAIDDELRPFERKASLSAALD  365

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNL-KTIRPNMQLLGQLFLNKNLTWPEFQDAV  202
            YYV + SD F+SASPGNMHNA++GHRTY N+ KT+RP+M LL +LF N ++ WPEFQ+ V
Sbjct  366  YYVCLKSDFFLSASPGNMHNAVIGHRTYQNVQKTLRPDMVLLSRLFSNSSMEWPEFQNRV  425

Query  201  IEGHANRQGEIRLRKPAKSLYTYPAPDCMC  112
              GH NR G++RLR+P +S+YTYPAPDCMC
Sbjct  426  YNGHRNRLGQVRLRQPKQSIYTYPAPDCMC  455



>ref|XP_008802622.1| PREDICTED: uncharacterized protein At1g04910-like, partial [Phoenix 
dactylifera]
Length=495

 Score =   275 bits (704),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAE+L+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLA
Sbjct  345  DMAAHSACDFGGGKAERLALAKYRQVIWQGRVLNSQFTDEELRSQGRCPLTPEEIGLLLA  404

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFD+ TRLYLASHKVYGG ARIS+LR+LFPLME+KKSL S EE  +++GKASLLAAVD
Sbjct  405  ALGFDSKTRLYLASHKVYGGEARISSLRKLFPLMEDKKSLTSEEELAKVEGKASLLAAVD  464

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHNL  286
            YYV MHSD+FISASPGNMHNA+VGHRTY N+
Sbjct  465  YYVSMHSDVFISASPGNMHNAVVGHRTYLNM  495



>ref|XP_007047792.1| O-fucosyltransferase family protein isoform 2, partial [Theobroma 
cacao]
 gb|EOX91949.1| O-fucosyltransferase family protein isoform 2, partial [Theobroma 
cacao]
Length=403

 Score =   268 bits (686),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 128/142 (90%), Positives = 134/142 (94%), Gaps = 0/142 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ  WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLA
Sbjct  262  DMAAHSACDFGGGKAEKLALAKYRQTIWQGRVLNSQFTDEELRSQGRCPLTPEEIGLLLA  321

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDN+TRLYLASHKVYGG ARIS LR LFPLME+KKSLASSEER  IKGKASLLAAVD
Sbjct  322  ALGFDNSTRLYLASHKVYGGEARISTLRELFPLMEDKKSLASSEERVHIKGKASLLAAVD  381

Query  378  YYVGMHSDIFISASPGNMHNAM  313
            YYVGMHSDIF+SASPGNMHNA+
Sbjct  382  YYVGMHSDIFVSASPGNMHNAL  403



>gb|KHG22139.1| hypothetical protein F383_05782 [Gossypium arboreum]
Length=467

 Score =   264 bits (674),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 129/147 (88%), Positives = 136/147 (93%), Gaps = 1/147 (1%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ  W GRVLNSQFTDEELRSQGRCPLTPEE+GLLLA
Sbjct  308  DMAAHSACDFGGGKAEKLALAKYRQRIWGGRVLNSQFTDEELRSQGRCPLTPEEIGLLLA  367

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDN+TRLYLASHKVYGG ARIS LR LFP MENKKSLASSEER  IKGKASLLAAVD
Sbjct  368  ALGFDNSTRLYLASHKVYGGEARISTLRELFPKMENKKSLASSEERVLIKGKASLLAAVD  427

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRT  298
            YYVGMHSDIF+SASPGNMHNA++ HR+
Sbjct  428  YYVGMHSDIFVSASPGNMHNALL-HRS  453



>ref|XP_007136338.1| hypothetical protein PHAVU_009G0371000g, partial [Phaseolus vulgaris]
 gb|ESW08332.1| hypothetical protein PHAVU_009G0371000g, partial [Phaseolus vulgaris]
Length=449

 Score =   259 bits (661),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ+ WQGRVLNSQFTDEELRSQGRCPLTPEE+GLLLA
Sbjct  308  DMAAHSACDFGGGKAEKLALAKYRQVLWQGRVLNSQFTDEELRSQGRCPLTPEEIGLLLA  367

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGF+N TRLYLASHKVYGG AR++ L +LFPLME+KKSL S+EE  ++KGKASLLA+VD
Sbjct  368  ALGFNNRTRLYLASHKVYGGEARLATLSKLFPLMEDKKSLVSTEELAKVKGKASLLASVD  427

Query  378  YYVGMHSDIFISASPGNMHNAM  313
            YYV MHSDIFISASPGNMHNA+
Sbjct  428  YYVSMHSDIFISASPGNMHNAL  449



>gb|KJB18181.1| hypothetical protein B456_003G038000 [Gossypium raimondii]
Length=451

 Score =   258 bits (659),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 125/142 (88%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEKL+LAKYRQ  W GRVLNSQFTDEELRSQGRCPLTPEE+GLLLA
Sbjct  308  DMAAHSACDFGGGKAEKLALAKYRQRIWGGRVLNSQFTDEELRSQGRCPLTPEEIGLLLA  367

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGFDN+TRLYLASHKVYGG ARIS LR  FP ME+KKSLASSEER  IKGKASLLAAVD
Sbjct  368  ALGFDNSTRLYLASHKVYGGEARISTLRDQFPKMESKKSLASSEERVLIKGKASLLAAVD  427

Query  378  YYVGMHSDIFISASPGNMHNAM  313
            YYVGMHSDIF+SASPGNMHNA+
Sbjct  428  YYVGMHSDIFVSASPGNMHNAL  449



>ref|XP_010664406.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Vitis 
vinifera]
Length=446

 Score =   258 bits (659),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSACDFGGGKAEK++LAKYRQ+ WQGRVL SQFTDEELR+QGRCPLTPEE+GLLLA
Sbjct  305  DMAAHSACDFGGGKAEKMALAKYRQVIWQGRVLKSQFTDEELRNQGRCPLTPEEIGLLLA  364

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            ALGF N TRLYLASHKVYGG ARIS LR+LFPLME+KKSLAS+EE  +++GKASLLAAVD
Sbjct  365  ALGFSNTTRLYLASHKVYGGEARISTLRKLFPLMEDKKSLASAEELAKVEGKASLLAAVD  424

Query  378  YYVGMHSDIFISASPGNMHNAM  313
            YYV MHSDIFISASPGNMHNA+
Sbjct  425  YYVSMHSDIFISASPGNMHNAL  446



>ref|XP_001765982.1| predicted protein [Physcomitrella patens]
 gb|EDQ69303.1| predicted protein, partial [Physcomitrella patens]
Length=451

 Score =   198 bits (503),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 96/211 (45%), Positives = 139/211 (66%), Gaps = 1/211 (0%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM AHSAC +GGG+AEK +LA +R   W+G V  +++  E LR  G CPLTP+E+GLLL+
Sbjct  234  DMIAHSACYYGGGRAEKRALAAFRAKIWRGGVSKTRYKPEALRMNGSCPLTPDEMGLLLS  293

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
             LGF  +T +Y+AS  +YGG ARI  L+ +FP++E+K +LAS++E       +  LAA+D
Sbjct  294  GLGFPISTPVYMASKNLYGGVARIKPLKEIFPILESKYTLASTKELRPFLPYSHKLAALD  353

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHN-LKTIRPNMQLLGQLFLNKNLTWPEFQDAV  202
            + V ++SD+F+S + GN  N + G RT++   K+I  + +LL  LF   +++W EF   V
Sbjct  354  FLVLLNSDVFMSNAAGNFPNVLSGQRTFYGPRKSIHADKRLLAHLFSKSSISWLEFSSQV  413

Query  201  IEGHANRQGEIRLRKPAKSLYTYPAPDCMCN  109
             EGH +R G    R P  S++ YPAPDCMC 
Sbjct  414  TEGHLSRLGSPVRRMPKYSIFRYPAPDCMCQ  444



>emb|CDX92640.1| BnaC07g38980D [Brassica napus]
Length=261

 Score =   188 bits (478),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 122/190 (64%), Gaps = 47/190 (25%)
 Frame = -2

Query  681  LAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLAALGFDNNTRLYLASHKVYG  502
            +AKYRQ+ WQGRVLNSQ TDEELR++       EE+GLLL+AL                 
Sbjct  116  VAKYRQVIWQGRVLNSQLTDEELRNKD------EEIGLLLSAL-----------------  152

Query  501  GAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASPGNMH  322
                                 AS+EE  E++GKAS++AAVDYYV M SDIFISASPGNMH
Sbjct  153  ---------------------ASAEELAEVEGKASVMAAVDYYVSMKSDIFISASPGNMH  191

Query  321  NAMVGHRTYHNLKTIRPNMQLLGQLFLNKNLTWPEFQDAVIEGHANRQGEIRLRKPAKSL  142
            NA++ H  Y NL T+ PN  LLGQ+ +N+++ W EF+ AV++GH N QG++RLR   KS+
Sbjct  192  NALLAHGAYLNLMTVNPNTILLGQVLVNRSIGWSEFEGAVLKGHKNSQGQLRLR---KSI  248

Query  141  YTYPAPDCMC  112
            YTYPAPDCMC
Sbjct  249  YTYPAPDCMC  258



>tpg|DAA61413.1| TPA: hypothetical protein ZEAMMB73_640362 [Zea mays]
Length=118

 Score =   182 bits (462),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 96/116 (83%), Gaps = 0/116 (0%)
 Frame = -2

Query  459  MENKKSLASSEERGEIKGKASLLAAVDYYVGMHSDIFISASPGNMHNAMVGHRTYHNLKT  280
            ME+K+SLAS +E   ++GKAS+LAA+DYY+ MHSDIFISASPGNMHNA+V HR+Y NLKT
Sbjct  1    MEDKRSLASEDELANVEGKASVLAALDYYISMHSDIFISASPGNMHNALVAHRSYENLKT  60

Query  279  IRPNMQLLGQLFLNKNLTWPEFQDAVIEGHANRQGEIRLRKPAKSLYTYPAPDCMC  112
            IRPNM LLG+ F NK++ WPEFQ  V  GH  R G+IRLRK  +S+YTYPAPDCMC
Sbjct  61   IRPNMALLGRTFANKSMEWPEFQQVVQAGHKGRYGQIRLRKATQSIYTYPAPDCMC  116



>ref|XP_002987806.1| hypothetical protein SELMODRAFT_126689, partial [Selaginella 
moellendorffii]
 gb|EFJ11109.1| hypothetical protein SELMODRAFT_126689, partial [Selaginella 
moellendorffii]
Length=399

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/212 (43%), Positives = 128/212 (60%), Gaps = 3/212 (1%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM A+S+CDFGGG+AE+ +LA +R   W  RV+ +     +LR  G CPLTPEE+GLLLA
Sbjct  181  DMLAYSSCDFGGGQAEQKALASFRYQVWSNRVIKALKRPSDLRRNGSCPLTPEEIGLLLA  240

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            A GF   T LY+A   VYGG  R+  L+ LFPL+ENK SLA+ +E    +  A  L A+D
Sbjct  241  AFGFTATTPLYIAGKAVYGGPRRMEPLKSLFPLVENKHSLATRQELAPFRNFAHKLTALD  300

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHN-LKTIRPNMQLLGQLFLNKN--LTWPEFQD  208
            + V  +SD+++S + GN+ N + GHR+Y     ++ P+   L  L  ++     W  F +
Sbjct  301  FRVLFNSDVYMSNAAGNLPNVLTGHRSYFGPYASVHPDKARLATLLSDERHATNWTSFAE  360

Query  207  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMC  112
                 H +R G I  RK   S++ YPAPDCMC
Sbjct  361  RAFAAHESRMGAIEPRKSRYSVFRYPAPDCMC  392



>ref|XP_002990403.1| hypothetical protein SELMODRAFT_131659, partial [Selaginella 
moellendorffii]
 gb|EFJ08496.1| hypothetical protein SELMODRAFT_131659, partial [Selaginella 
moellendorffii]
Length=399

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 92/212 (43%), Positives = 127/212 (60%), Gaps = 3/212 (1%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEELRSQGRCPLTPEEVGLLLA  559
            DM A+S+CDFGGG+AE+ +LA +R   W  RV+ +     +LR  G CPLTPEEVGLLLA
Sbjct  181  DMLAYSSCDFGGGQAEQKALASFRYQVWSNRVIKALKRPSDLRRNGSCPLTPEEVGLLLA  240

Query  558  ALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAAVD  379
            A GF   T LY+A   VYGG  R+  L+ LFPL+ENK SLA+ +E    +  A  L A+D
Sbjct  241  AFGFTATTPLYIAGKAVYGGPRRMEPLKSLFPLVENKHSLATRQELAPFRNFAHKLTALD  300

Query  378  YYVGMHSDIFISASPGNMHNAMVGHRTYHN-LKTIRPNMQLLGQLFLNKN--LTWPEFQD  208
            + V  +SD+++S + GN+ N + GHR+Y     ++ P+   L  L  ++     W  F +
Sbjct  301  FRVLFNSDVYMSNAAGNLPNVLTGHRSYFGPYASVHPDKARLATLLSDERHATNWTSFAE  360

Query  207  AVIEGHANRQGEIRLRKPAKSLYTYPAPDCMC  112
                 H +R G I  RK   S++  PAPDCMC
Sbjct  361  RAFAAHESRMGAIEPRKSRYSVFRCPAPDCMC  392



>ref|NP_001132122.1| uncharacterized protein LOC100193539 [Zea mays]
 gb|ACF80826.1| unknown [Zea mays]
Length=313

 Score =   174 bits (440),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 93/220 (42%), Positives = 133/220 (60%), Gaps = 16/220 (7%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQG------RVLNSQFTDEELRSQGRCPLTPEE  577
            DM A S C + GG  EK  +   R+  W+G      RV+N     E  R  G+CPLTP E
Sbjct  93   DMVAFSCCTYDGGWREKTEMDNARERSWRGKFRRHGRVINP----EANRRDGKCPLTPLE  148

Query  576  VGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKAS  397
            VG++L  +GFDN T LY+AS K+Y     ++ LR++FPL+  K SLA  EE  + KG +S
Sbjct  149  VGMMLRGMGFDNTTSLYVASGKIYNSEKYMAPLRQMFPLLTTKDSLALPEELAQFKGHSS  208

Query  396  LLAAVDYYVGMHSDIFISASPGNMHNAMVGHRTYH---NLKTIRPNMQLLGQLFLNKNLT  226
             LAA+DY V +HS++F++   GN  + ++GHR Y    N KTI+P+ + L   F + N+ 
Sbjct  209  QLAALDYTVCVHSEVFVTTQGGNFPHFLMGHRRYMFGGNAKTIKPDKRKLVLSFDDPNIR  268

Query  225  WPEFQDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  112
            W +F+  + E   H++ +  I LRKP  S+YT+P PDCMC
Sbjct  269  WDQFKQNMQEILQHSDMRS-IALRKPNDSVYTFPMPDCMC  307



>ref|XP_006826849.1| hypothetical protein AMTR_s00010p00112560 [Amborella trichopoda]
 gb|ERM94086.1| hypothetical protein AMTR_s00010p00112560 [Amborella trichopoda]
Length=554

 Score =   179 bits (453),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 89/218 (41%), Positives = 137/218 (63%), Gaps = 8/218 (4%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNS--QFTDEELRSQGRCPLTPEEVGLL  565
            DM A S C F GG+ EKL +   R+  W+G+   +        +R  G+CPLTP EVGL+
Sbjct  326  DMVAFSCCVFDGGEQEKLEMNAARERGWRGKFTRAGRVIRPGAIRINGKCPLTPLEVGLM  385

Query  564  LAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAA  385
            L  +GFDNNT ++LAS ++Y     ++ L ++FPL++ K++LAS EE    K  +S +AA
Sbjct  386  LRGMGFDNNTAIFLASGRIYKAENTMAPLLQMFPLLQTKETLASDEELAPFKNYSSRMAA  445

Query  384  VDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEF  214
            +DY V +HS++F++   GN  + ++GHR +    + KTIRP+ + L Q+F N N+ W  F
Sbjct  446  IDYTVCLHSEVFVTTQGGNFPHFLMGHRRFLYGGHSKTIRPDKRKLVQIFGNPNIGWKNF  505

Query  213  --QDAVIEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
              Q  V+  H++ +G + +R+P  S+YT+P PDCMC A
Sbjct  506  KRQMLVMRSHSDAKG-MEIRRPNDSIYTFPCPDCMCRA  542



>ref|XP_010104478.1| hypothetical protein L484_025447 [Morus notabilis]
 gb|EXC01079.1| hypothetical protein L484_025447 [Morus notabilis]
Length=256

 Score =   171 bits (434),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/217 (40%), Positives = 134/217 (62%), Gaps = 8/217 (4%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQG--RVLNSQFTDEELRSQGRCPLTPEEVGLL  565
            DM A S C++ GG+ EK  +   R+  W+G  R           R  G+CPLTP EVG++
Sbjct  26   DMVAFSCCEYDGGEEEKREMDIARERSWRGKFRRRGRVIRPGANRVDGKCPLTPLEVGMM  85

Query  564  LAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAA  385
            L  +GFDN T +Y+A+ K+Y     ++ L+++FP +E K +LA+ EE    KG +S LAA
Sbjct  86   LRGMGFDNTTSVYVAAGKIYKAEKYMAPLKQMFPRLETKDTLATPEELSPFKGHSSRLAA  145

Query  384  VDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEF  214
            +DY V +HS++F++   GN  + ++GHR Y    + KTI+P+ + L  LF N  + W +F
Sbjct  146  LDYTVCLHSEVFVTTQGGNFPHFLMGHRRYLYGGHAKTIKPDKRKLAVLFDNPKIRWEDF  205

Query  213  QDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMCN  109
            +  + +   H++++G I LRKP+ SLYT+P PDCMC 
Sbjct  206  KRQMRDMLRHSDQKG-IELRKPSGSLYTFPMPDCMCK  241



>gb|EMT33054.1| hypothetical protein F775_09106 [Aegilops tauschii]
Length=463

 Score =   176 bits (446),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 92/220 (42%), Positives = 137/220 (62%), Gaps = 16/220 (7%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQG------RVLNSQFTDEELRSQGRCPLTPEE  577
            DM A S C + GG+ EK+ +   R+  W+G      RV+N     E  R  G+CPLTP E
Sbjct  244  DMVAFSCCTYDGGRKEKIEMENARERSWRGKFHRPGRVINP----EANRRDGKCPLTPLE  299

Query  576  VGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKAS  397
            VG++L  +GFDN T LY+AS K+Y  A  ++ LR++FPL++ K +LA SEE  + +G +S
Sbjct  300  VGMMLRGMGFDNTTFLYVASGKIYNAAKYMAPLRQMFPLLQTKDTLALSEELAKFEGYSS  359

Query  396  LLAAVDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLT  226
             LAA+DY V + S++F++   GN  + ++GHR Y    N KTI+P+ + L   F + N+ 
Sbjct  360  RLAALDYTVCVQSEVFVTTQGGNFPHFLMGHRRYLLGGNAKTIKPDKRKLVLSFDDPNIR  419

Query  225  WPEFQDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  112
            W  F+  ++E   H++ +G I  RKP  S+YT+P PDCMC
Sbjct  420  WSRFKHHMLEILHHSDIRG-IAFRKPNDSIYTFPMPDCMC  458



>ref|XP_008669806.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Zea mays]
Length=497

 Score =   176 bits (446),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 91/220 (41%), Positives = 132/220 (60%), Gaps = 16/220 (7%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQG------RVLNSQFTDEELRSQGRCPLTPEE  577
            DM A S C++ GG  E  ++   R+  W+G      RV+N     E  R  GRCPLTP E
Sbjct  270  DMVAFSCCNYDGGSTENNAMENARERSWRGKFHRPGRVINP----EANRRNGRCPLTPLE  325

Query  576  VGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKAS  397
            VG++L  +GFDN T LY+AS K+Y     ++ LRRLFP ++ K +L + EE  + KG +S
Sbjct  326  VGMMLRGMGFDNTTSLYVASGKIYNAEKYMTPLRRLFPFLQTKHALVTPEELAQFKGHSS  385

Query  396  LLAAVDYYVGMHSDIFISASPGNMHNAMVGHRTYH---NLKTIRPNMQLLGQLFLNKNLT  226
             LAA+DY + +HS++F+     N  + ++GHR Y    + KTI+P+ + L QLF N N+ 
Sbjct  386  RLAALDYTICLHSEVFVMTQGSNFPHFLMGHRRYMYGGHAKTIKPDKRKLVQLFDNPNIR  445

Query  225  WPEFQDAV--IEGHANRQGEIRLRKPAKSLYTYPAPDCMC  112
            W  F+  +  +  H+  +G   LRKP +S+YT P PDCMC
Sbjct  446  WDRFKHHMQDMRRHSEMKG-FALRKPQESIYTLPMPDCMC  484



>ref|XP_009390064.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=521

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 94/216 (44%), Positives = 134/216 (62%), Gaps = 8/216 (4%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQG--RVLNSQFTDEELRSQGRCPLTPEEVGLL  565
            DM A S C + GG+ EK  + K R+  W+G  R      + E  R  G+CPLTP EVG++
Sbjct  302  DMVAFSCCTYDGGQQEKNEMDKARERSWRGKFRRPGRVISPEANRRNGKCPLTPLEVGMM  361

Query  564  LAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAA  385
            L  +GF N T +Y+AS K+Y     ++ LR+LFPL+E K++LAS++E    KG +S LAA
Sbjct  362  LRGMGFGNTTSVYVASGKIYNAEKYMAPLRQLFPLLETKETLASADELAPFKGHSSQLAA  421

Query  384  VDYYVGMHSDIFISASPGNMHNAMVGHRTYHN---LKTIRPNMQLLGQLFLNKNLTWPEF  214
            +DY V  HS++F++   GN  + ++GHR Y N    KTI P+ + L   F N N+ W +F
Sbjct  422  LDYTVCAHSEVFVTTQGGNFPHFLMGHRRYLNEGHSKTINPDKKKLVLSFDNPNIRWDKF  481

Query  213  QDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  112
            +  + E   H++ +G I LRKP  SLYT+P PDCMC
Sbjct  482  KRNMQEVLHHSDLKG-ITLRKPDASLYTFPMPDCMC  516



>ref|XP_009390063.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=541

 Score =   176 bits (445),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 94/216 (44%), Positives = 134/216 (62%), Gaps = 8/216 (4%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQG--RVLNSQFTDEELRSQGRCPLTPEEVGLL  565
            DM A S C + GG+ EK  + K R+  W+G  R      + E  R  G+CPLTP EVG++
Sbjct  322  DMVAFSCCTYDGGQQEKNEMDKARERSWRGKFRRPGRVISPEANRRNGKCPLTPLEVGMM  381

Query  564  LAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAA  385
            L  +GF N T +Y+AS K+Y     ++ LR+LFPL+E K++LAS++E    KG +S LAA
Sbjct  382  LRGMGFGNTTSVYVASGKIYNAEKYMAPLRQLFPLLETKETLASADELAPFKGHSSQLAA  441

Query  384  VDYYVGMHSDIFISASPGNMHNAMVGHRTYHN---LKTIRPNMQLLGQLFLNKNLTWPEF  214
            +DY V  HS++F++   GN  + ++GHR Y N    KTI P+ + L   F N N+ W +F
Sbjct  442  LDYTVCAHSEVFVTTQGGNFPHFLMGHRRYLNEGHSKTINPDKKKLVLSFDNPNIRWDKF  501

Query  213  QDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  112
            +  + E   H++ +G I LRKP  SLYT+P PDCMC
Sbjct  502  KRNMQEVLHHSDLKG-ITLRKPDASLYTFPMPDCMC  536



>ref|XP_008669805.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Zea mays]
Length=544

 Score =   176 bits (445),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 91/220 (41%), Positives = 132/220 (60%), Gaps = 16/220 (7%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQG------RVLNSQFTDEELRSQGRCPLTPEE  577
            DM A S C++ GG  E  ++   R+  W+G      RV+N     E  R  GRCPLTP E
Sbjct  317  DMVAFSCCNYDGGSTENNAMENARERSWRGKFHRPGRVINP----EANRRNGRCPLTPLE  372

Query  576  VGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKAS  397
            VG++L  +GFDN T LY+AS K+Y     ++ LRRLFP ++ K +L + EE  + KG +S
Sbjct  373  VGMMLRGMGFDNTTSLYVASGKIYNAEKYMTPLRRLFPFLQTKHALVTPEELAQFKGHSS  432

Query  396  LLAAVDYYVGMHSDIFISASPGNMHNAMVGHRTYH---NLKTIRPNMQLLGQLFLNKNLT  226
             LAA+DY + +HS++F+     N  + ++GHR Y    + KTI+P+ + L QLF N N+ 
Sbjct  433  RLAALDYTICLHSEVFVMTQGSNFPHFLMGHRRYMYGGHAKTIKPDKRKLVQLFDNPNIR  492

Query  225  WPEFQDAV--IEGHANRQGEIRLRKPAKSLYTYPAPDCMC  112
            W  F+  +  +  H+  +G   LRKP +S+YT P PDCMC
Sbjct  493  WDRFKHHMQDMRRHSEMKG-FALRKPQESIYTLPMPDCMC  531



>emb|CDP10650.1| unnamed protein product [Coffea canephora]
Length=573

 Score =   175 bits (443),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 90/216 (42%), Positives = 133/216 (62%), Gaps = 8/216 (4%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEEL--RSQGRCPLTPEEVGLL  565
            DM A S C + GG+ EK  +   R+  W+G+             R  G+CPLTP EVG++
Sbjct  343  DMVAFSCCVYDGGEEEKREMDIARERSWRGKFRRRGRIIRPGANRRDGKCPLTPLEVGMM  402

Query  564  LAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAA  385
            L  +GFDNNT +Y+A+ K+Y     ++ L+++FP +E K +LAS EE    KG +S LAA
Sbjct  403  LRGMGFDNNTFIYVAAGKIYQAEKYMAPLKQMFPHLETKDTLASPEELAPFKGHSSRLAA  462

Query  384  VDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEF  214
            +DY V +HS++F+S   GN  + +VGHR Y    + KTI+P+ + L  LF N N+ W +F
Sbjct  463  LDYTVCLHSEVFVSTQGGNFPHFLVGHRRYLYEGHAKTIKPDKRKLALLFDNPNIRWKDF  522

Query  213  QDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  112
            +  + +   H++ +G +  RKP+ SLYTYP PDCMC
Sbjct  523  KRQLQDMLRHSDVKG-VETRKPSGSLYTYPMPDCMC  557



>gb|AFW56213.1| hypothetical protein ZEAMMB73_697257 [Zea mays]
Length=518

 Score =   174 bits (440),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 93/220 (42%), Positives = 133/220 (60%), Gaps = 16/220 (7%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQG------RVLNSQFTDEELRSQGRCPLTPEE  577
            DM A S C + GG  EK  +   R+  W+G      RV+N     E  R  G+CPLTP E
Sbjct  298  DMVAFSCCTYDGGWREKTEMDNARERSWRGKFRRHGRVINP----EANRRDGKCPLTPLE  353

Query  576  VGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKAS  397
            VG++L  +GFDN T LY+AS K+Y     ++ LR++FPL+  K SLA  EE  + KG +S
Sbjct  354  VGMMLRGMGFDNTTSLYVASGKIYNSEKYMAPLRQMFPLLTTKDSLALPEELAQFKGHSS  413

Query  396  LLAAVDYYVGMHSDIFISASPGNMHNAMVGHRTYH---NLKTIRPNMQLLGQLFLNKNLT  226
             LAA+DY V +HS++F++   GN  + ++GHR Y    N KTI+P+ + L   F + N+ 
Sbjct  414  QLAALDYTVCVHSEVFVTTQGGNFPHFLMGHRRYMFGGNAKTIKPDKRKLVLSFDDPNIR  473

Query  225  WPEFQDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  112
            W +F+  + E   H++ +  I LRKP  S+YT+P PDCMC
Sbjct  474  WDQFKQNMQEILQHSDMRS-IALRKPNDSVYTFPMPDCMC  512



>ref|XP_003578848.1| PREDICTED: uncharacterized protein At1g04910-like [Brachypodium 
distachyon]
Length=558

 Score =   174 bits (441),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 92/219 (42%), Positives = 134/219 (61%), Gaps = 14/219 (6%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQG------RVLNSQFTDEELRSQGRCPLTPEE  577
            DM A S C + GG  EK+ +   R+  W+G      RV+N     E  R  G+CPLTP E
Sbjct  339  DMVAFSCCTYDGGWKEKIEMENARERSWRGKFHRPGRVINP----EANRRDGKCPLTPLE  394

Query  576  VGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKAS  397
            VG++L  +GFD++T LY+AS K+Y  A  ++ LR++FPL+E K+SLA  EE  E +G +S
Sbjct  395  VGMMLRGMGFDHSTFLYVASGKIYNAAKYMAPLRQMFPLLETKESLALPEELAEFEGYSS  454

Query  396  LLAAVDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLT  226
             LAA+DY V + S++F++   GN  + ++GHR Y    N KTI+P+ + L   F + N+ 
Sbjct  455  RLAAIDYTVCVQSEVFVTTQGGNFPHFLMGHRRYLFGGNAKTIKPDKRKLVLSFDDPNIR  514

Query  225  WPEFQDAVIEG-HANRQGEIRLRKPAKSLYTYPAPDCMC  112
            W +F+  + E  H +    I  RKP  S+YT+P PDCMC
Sbjct  515  WSQFKRHMQEILHHSDIKSIAFRKPNDSIYTFPMPDCMC  553



>gb|EMS55867.1| hypothetical protein TRIUR3_34733 [Triticum urartu]
Length=463

 Score =   172 bits (437),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 91/220 (41%), Positives = 136/220 (62%), Gaps = 16/220 (7%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQG------RVLNSQFTDEELRSQGRCPLTPEE  577
            DM A S C + GG+ EK+ +   R+  W+G      RV+N     E  R  G+CPLTP E
Sbjct  244  DMVAFSCCTYDGGRKEKIEMENARERSWRGKFHRPGRVINP----EANRRDGKCPLTPLE  299

Query  576  VGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKAS  397
            VG++L  +GFDN T LY+AS K+Y  A  ++ L ++FPL++ K +LA SEE  + +G +S
Sbjct  300  VGMMLRGMGFDNTTFLYVASGKIYNAAKYMAPLGQMFPLLQTKDTLALSEELAKFEGYSS  359

Query  396  LLAAVDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLT  226
             LAA+DY V + S++F++   GN  + ++GHR Y    N KTI+P+ + L   F + N+ 
Sbjct  360  RLAALDYTVCVQSEVFVTTPGGNFPHFLMGHRRYLLGGNAKTIKPDKRKLVLSFDDPNIR  419

Query  225  WPEFQDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  112
            W  F+  ++E   H++ +G I  RKP  S+YT+P PDCMC
Sbjct  420  WSRFKHHMLEILHHSDIRG-IAFRKPNDSIYTFPMPDCMC  458



>ref|XP_008661414.1| PREDICTED: uncharacterized protein LOC100193539 isoform X1 [Zea 
mays]
Length=564

 Score =   174 bits (440),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 93/220 (42%), Positives = 133/220 (60%), Gaps = 16/220 (7%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQG------RVLNSQFTDEELRSQGRCPLTPEE  577
            DM A S C + GG  EK  +   R+  W+G      RV+N     E  R  G+CPLTP E
Sbjct  344  DMVAFSCCTYDGGWREKTEMDNARERSWRGKFRRHGRVINP----EANRRDGKCPLTPLE  399

Query  576  VGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKAS  397
            VG++L  +GFDN T LY+AS K+Y     ++ LR++FPL+  K SLA  EE  + KG +S
Sbjct  400  VGMMLRGMGFDNTTSLYVASGKIYNSEKYMAPLRQMFPLLTTKDSLALPEELAQFKGHSS  459

Query  396  LLAAVDYYVGMHSDIFISASPGNMHNAMVGHRTYH---NLKTIRPNMQLLGQLFLNKNLT  226
             LAA+DY V +HS++F++   GN  + ++GHR Y    N KTI+P+ + L   F + N+ 
Sbjct  460  QLAALDYTVCVHSEVFVTTQGGNFPHFLMGHRRYMFGGNAKTIKPDKRKLVLSFDDPNIR  519

Query  225  WPEFQDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  112
            W +F+  + E   H++ +  I LRKP  S+YT+P PDCMC
Sbjct  520  WDQFKQNMQEILQHSDMRS-IALRKPNDSVYTFPMPDCMC  558



>ref|XP_010695805.1| PREDICTED: uncharacterized protein At1g04910-like [Beta vulgaris 
subsp. vulgaris]
Length=572

 Score =   173 bits (439),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 87/216 (40%), Positives = 131/216 (61%), Gaps = 8/216 (4%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQ--FTDEELRSQGRCPLTPEEVGLL  565
            DM A S C F GGK EKL +   R+  W+G+            +R  G+CPLTP EVGL+
Sbjct  344  DMVAFSCCIFDGGKQEKLDMEAARERGWRGKFTKPGRIIRPGAIRINGKCPLTPLEVGLM  403

Query  564  LAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAA  385
            L  +GFD NT +YLAS K+Y     ++ L  +FPL++ K+ LAS EE    +  +S +AA
Sbjct  404  LRGMGFDRNTSIYLASGKIYDAERNMAPLFEMFPLLQTKEMLASPEELASYQNYSSRMAA  463

Query  384  VDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEF  214
            +DY V +HS++F++   GN  + ++GHR Y    + KTIRP+ + L Q+F N N+ W  F
Sbjct  464  IDYTVCLHSEVFVTTQGGNFPHFLMGHRRYLYGGHAKTIRPDKRKLAQIFDNPNIGWKTF  523

Query  213  QDAVI--EGHANRQGEIRLRKPAKSLYTYPAPDCMC  112
            +  ++    H++ +G   L++P  S+Y++P PDCMC
Sbjct  524  KRHMLNMRSHSDSKG-FELKRPNDSIYSFPCPDCMC  558



>ref|XP_006473173.1| PREDICTED: uncharacterized protein At1g04910-like isoform X3 
[Citrus sinensis]
 gb|KDO83869.1| hypothetical protein CISIN_1g008308mg [Citrus sinensis]
Length=445

 Score =   171 bits (432),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 87/216 (40%), Positives = 132/216 (61%), Gaps = 8/216 (4%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQG--RVLNSQFTDEELRSQGRCPLTPEEVGLL  565
            DM A S C++ GG+ EK  +   R+  W+G  R           R  G+CPLTP EVG++
Sbjct  214  DMVAFSCCEYDGGEEEKREMDIARERSWRGKFRKRGRVIRPGANRVDGKCPLTPLEVGMM  273

Query  564  LAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAA  385
            L  +GFDN T +Y+A+ K+Y     ++ LR++FP +E K +LA+ EE    KG +S LAA
Sbjct  274  LRGMGFDNTTSVYVAAGKIYKAEKYVAPLRQMFPRLETKDTLATPEELAAFKGHSSRLAA  333

Query  384  VDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEF  214
            +DY V +HS++F++   GN  + ++GHR Y    + KTI+P+ + L  LF   N+ W +F
Sbjct  334  LDYTVCLHSEVFVTTQGGNFPHFLMGHRRYLYGGHAKTIKPDKRKLALLFDRPNIRWDDF  393

Query  213  QDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  112
            +  + +   H++ +G   LRKP+ SLYT+P PDCMC
Sbjct  394  KRQMKDMLSHSDVKGS-ELRKPSASLYTFPMPDCMC  428



>gb|KJB30799.1| hypothetical protein B456_005G161000 [Gossypium raimondii]
Length=561

 Score =   172 bits (437),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 87/218 (40%), Positives = 133/218 (61%), Gaps = 8/218 (4%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNS--QFTDEELRSQGRCPLTPEEVGLL  565
            DM A S C F GG+ EK  + K R+  W+G+            +R  G+CPLTP EVGL+
Sbjct  333  DMVAFSCCVFDGGEQEKEDMKKARERGWKGKFTKPGRVIRPGAIRINGKCPLTPLEVGLM  392

Query  564  LAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAA  385
            L  +GFDNNT ++LAS K+Y     +++L  +FP ++ K+ LAS EE    K  +S +AA
Sbjct  393  LRGMGFDNNTYIFLASGKIYNAEKTMASLLEMFPNLQTKEMLASEEELAPYKNFSSRMAA  452

Query  384  VDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEF  214
            +DY V +HS++F++   GN  + ++GHR Y    + KTIRP+ + L  LF N N+ W  F
Sbjct  453  IDYTVCLHSEVFVTTQGGNFPHFLMGHRRYLHGGHSKTIRPDKRKLALLFDNPNIGWKSF  512

Query  213  QDAVI--EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            +  ++    H++ +G   L++P+ S+YT+P PDCMC+ 
Sbjct  513  KRQMLNMRSHSDSKG-FELKRPSDSIYTFPCPDCMCHT  549



>ref|XP_010274715.1| PREDICTED: uncharacterized protein At1g04910-like [Nelumbo nucifera]
Length=558

 Score =   172 bits (436),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 89/216 (41%), Positives = 130/216 (60%), Gaps = 8/216 (4%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNS--QFTDEELRSQGRCPLTPEEVGLL  565
            DM A S C F GGK E   +   R+  W+G+            +R  G+CPLTP EVGL+
Sbjct  330  DMVAFSCCVFDGGKEEMQEMNAARERGWRGKFTKPGRVIRPGAIRINGKCPLTPLEVGLM  389

Query  564  LAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAA  385
            L  +GFDN+T +YLAS K+Y     ++ L  +FPL++ K +LAS EE    K  +S +AA
Sbjct  390  LRGMGFDNSTSIYLASGKIYKAEKTMAPLLEMFPLLQTKDTLASMEELAPFKNFSSRMAA  449

Query  384  VDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEF  214
            +DY V +HS++F++   GN  + ++GHR Y    + KTIRP+ + L  LF N N+ W  F
Sbjct  450  IDYTVCLHSEVFVTTQGGNFPHFLMGHRRYLYGGHSKTIRPDKRKLALLFDNPNIGWKTF  509

Query  213  QDAVI--EGHANRQGEIRLRKPAKSLYTYPAPDCMC  112
            +  V+    H++ +G I L++P  S+YT+P PDCMC
Sbjct  510  KRHVLNMRSHSDAKG-IELKRPNDSIYTFPCPDCMC  544



>ref|XP_006434582.1| hypothetical protein CICLE_v10000533mg [Citrus clementina]
 gb|ESR47822.1| hypothetical protein CICLE_v10000533mg [Citrus clementina]
Length=445

 Score =   170 bits (431),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 87/216 (40%), Positives = 132/216 (61%), Gaps = 8/216 (4%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQG--RVLNSQFTDEELRSQGRCPLTPEEVGLL  565
            DM A S C++ GG+ EK  +   R+  W+G  R           R  G+CPLTP EVG++
Sbjct  214  DMVAFSCCEYDGGEEEKHEMDIARERSWRGKFRKRGRVIRPGANRVDGKCPLTPLEVGMM  273

Query  564  LAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAA  385
            L  +GFDN T +Y+A+ K+Y     ++ LR++FP +E K +LA+ EE    KG +S LAA
Sbjct  274  LRGMGFDNTTSVYVAAGKIYKAEKYVAPLRQMFPRLETKDTLATPEELAAFKGHSSRLAA  333

Query  384  VDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEF  214
            +DY V +HS++F++   GN  + ++GHR Y    + KTI+P+ + L  LF   N+ W +F
Sbjct  334  LDYTVCLHSEVFVTTQGGNFPHFLMGHRRYLYGGHAKTIKPDKRKLALLFDRPNIRWDDF  393

Query  213  QDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  112
            +  + +   H++ +G   LRKP+ SLYT+P PDCMC
Sbjct  394  KRQMKDMLSHSDVKGS-ELRKPSASLYTFPMPDCMC  428



>dbj|BAJ97328.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=557

 Score =   172 bits (435),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 91/219 (42%), Positives = 131/219 (60%), Gaps = 14/219 (6%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQG------RVLNSQFTDEELRSQGRCPLTPEE  577
            DM A S C + GG+ EK+ +   R+  W+G      RV+N     E  R  G+CPLTP E
Sbjct  338  DMVAFSCCTYDGGRKEKIEMENARERSWRGKFHRPGRVINP----EANRRDGKCPLTPLE  393

Query  576  VGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKAS  397
            VG++L  +GFDN T LY+AS K+Y  A  ++ LR++FPL++ K +LA  EE  E +G +S
Sbjct  394  VGMMLRGMGFDNTTFLYVASGKIYNAAKYMAPLRQMFPLLQTKDTLALPEELAEFEGYSS  453

Query  396  LLAAVDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLT  226
             LAA+DY V + S++F++   GN  + ++GHR Y    N KTI+P+   L   F + N+ 
Sbjct  454  RLAALDYTVCVQSEVFVTTQGGNFPHFLMGHRRYLLGGNAKTIKPDKWKLVLSFDDPNIR  513

Query  225  WPEFQDAVIEG-HANRQGEIRLRKPAKSLYTYPAPDCMC  112
            W  F+  + E  H +    I  RKP  S+YT+P PDCMC
Sbjct  514  WSRFKHHMQEILHNSDIRGIAFRKPNDSIYTFPMPDCMC  552



>ref|XP_009362464.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Pyrus x bretschneideri]
Length=442

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/216 (40%), Positives = 135/216 (63%), Gaps = 8/216 (4%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQG--RVLNSQFTDEELRSQGRCPLTPEEVGLL  565
            DM A S C++ GG+ EK  +   R+  W+G  R           R  G+CPLTP EVG++
Sbjct  217  DMVAFSCCEYDGGEEEKHEMDIARERSWRGKFRRRGRVIRPGANRVDGKCPLTPLEVGMM  276

Query  564  LAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAA  385
            L  +GFDN T +Y+A+ K+Y     ++ L+++FP +E K +LA++EE    KG  S LAA
Sbjct  277  LRGMGFDNTTSVYVAAGKIYKAEKYMAPLKQMFPHLEMKDTLATAEELAPFKGHLSRLAA  336

Query  384  VDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEF  214
            +DY V +HS++F++   GN  + ++GHR Y    + KTI+P+ + L  LF N N+ W +F
Sbjct  337  LDYTVCLHSEVFVTTQGGNFPHFLMGHRRYLYGGHSKTIKPDKRKLALLFDNPNIRWEDF  396

Query  213  QDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  112
            +  + +   H++++G + L+KP+ SLYT+P PDCMC
Sbjct  397  KRQMQDMLRHSDQKG-VELKKPSASLYTFPMPDCMC  431



>ref|XP_010246043.1| PREDICTED: uncharacterized protein At1g04910 isoform X4 [Nelumbo 
nucifera]
Length=456

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 87/216 (40%), Positives = 135/216 (63%), Gaps = 8/216 (4%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQ--FTDEELRSQGRCPLTPEEVGLL  565
            DM A S C + GG+ EK  +   R+  W+G+   +        +R  G+CPLTP EVG++
Sbjct  226  DMVAFSCCIYDGGEEEKREMDIARERGWRGKFNKTGRIIRPGAIRMDGKCPLTPLEVGMM  285

Query  564  LAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAA  385
            L  +GFDN T +Y+A+ K+Y     ++ LR+LFPL+E K++LA  EE    KG +S LAA
Sbjct  286  LRGMGFDNTTSVYIAAGKIYKAEKFMAPLRQLFPLLETKETLALPEELAPFKGHSSRLAA  345

Query  384  VDYYVGMHSDIFISASPGNMHNAMVGHRTYH---NLKTIRPNMQLLGQLFLNKNLTWPEF  214
            +DY V ++S++F++   GN  + ++GHR Y    + KTI+P+ + L  LF + N+ W  F
Sbjct  346  LDYTVCLNSEVFVTTQGGNFPHFLMGHRRYFFGGHAKTIKPDKRKLALLFDSPNIRWEYF  405

Query  213  QDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  112
            +  + E   H++ +G I ++KP+ SLYT+P PDCMC
Sbjct  406  KRQMQEMLHHSDLKG-IEMKKPSSSLYTFPIPDCMC  440



>ref|XP_006473171.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Citrus sinensis]
 gb|KDO83865.1| hypothetical protein CISIN_1g008308mg [Citrus sinensis]
 gb|KDO83866.1| hypothetical protein CISIN_1g008308mg [Citrus sinensis]
Length=570

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 87/216 (40%), Positives = 132/216 (61%), Gaps = 8/216 (4%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQG--RVLNSQFTDEELRSQGRCPLTPEEVGLL  565
            DM A S C++ GG+ EK  +   R+  W+G  R           R  G+CPLTP EVG++
Sbjct  339  DMVAFSCCEYDGGEEEKREMDIARERSWRGKFRKRGRVIRPGANRVDGKCPLTPLEVGMM  398

Query  564  LAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAA  385
            L  +GFDN T +Y+A+ K+Y     ++ LR++FP +E K +LA+ EE    KG +S LAA
Sbjct  399  LRGMGFDNTTSVYVAAGKIYKAEKYVAPLRQMFPRLETKDTLATPEELAAFKGHSSRLAA  458

Query  384  VDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEF  214
            +DY V +HS++F++   GN  + ++GHR Y    + KTI+P+ + L  LF   N+ W +F
Sbjct  459  LDYTVCLHSEVFVTTQGGNFPHFLMGHRRYLYGGHAKTIKPDKRKLALLFDRPNIRWDDF  518

Query  213  QDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  112
            +  + +   H++ +G   LRKP+ SLYT+P PDCMC
Sbjct  519  KRQMKDMLSHSDVKGS-ELRKPSASLYTFPMPDCMC  553



>ref|XP_007045152.1| O-fucosyltransferase family protein [Theobroma cacao]
 gb|EOY00984.1| O-fucosyltransferase family protein [Theobroma cacao]
Length=561

 Score =   171 bits (432),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 87/216 (40%), Positives = 130/216 (60%), Gaps = 8/216 (4%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNS--QFTDEELRSQGRCPLTPEEVGLL  565
            DM A S C F GG+ EK  + K R+  W+G+            +R  G+CPLTP EVGL+
Sbjct  333  DMVAFSCCVFDGGQQEKEDMKKARERGWKGKFTKPGRVIRPGAIRINGKCPLTPLEVGLM  392

Query  564  LAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAA  385
            L  +GFDNNT ++LAS K+Y     ++ L  +FP ++ K+ LAS EE    K  +S +AA
Sbjct  393  LRGMGFDNNTYIFLASGKIYNAEKTMAPLLEMFPNLQTKEMLASEEELAPYKNFSSRMAA  452

Query  384  VDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEF  214
            +DY V +HS++F++   GN  + ++GHR Y    + KTIRP+ + L  LF N N+ W  F
Sbjct  453  IDYTVCLHSEVFVTTQGGNFPHFLMGHRRYLYGGHSKTIRPDKRKLALLFDNPNIGWKSF  512

Query  213  QDAVI--EGHANRQGEIRLRKPAKSLYTYPAPDCMC  112
            +  ++    H++ +G   L++P  S+YT+P PDCMC
Sbjct  513  KRQMLNMRSHSDSKG-FELKRPNDSIYTFPCPDCMC  547



>ref|XP_006434583.1| hypothetical protein CICLE_v10000533mg [Citrus clementina]
 ref|XP_006434584.1| hypothetical protein CICLE_v10000533mg [Citrus clementina]
 gb|ESR47823.1| hypothetical protein CICLE_v10000533mg [Citrus clementina]
 gb|ESR47824.1| hypothetical protein CICLE_v10000533mg [Citrus clementina]
Length=570

 Score =   171 bits (432),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 87/216 (40%), Positives = 132/216 (61%), Gaps = 8/216 (4%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQG--RVLNSQFTDEELRSQGRCPLTPEEVGLL  565
            DM A S C++ GG+ EK  +   R+  W+G  R           R  G+CPLTP EVG++
Sbjct  339  DMVAFSCCEYDGGEEEKHEMDIARERSWRGKFRKRGRVIRPGANRVDGKCPLTPLEVGMM  398

Query  564  LAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAA  385
            L  +GFDN T +Y+A+ K+Y     ++ LR++FP +E K +LA+ EE    KG +S LAA
Sbjct  399  LRGMGFDNTTSVYVAAGKIYKAEKYVAPLRQMFPRLETKDTLATPEELAAFKGHSSRLAA  458

Query  384  VDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEF  214
            +DY V +HS++F++   GN  + ++GHR Y    + KTI+P+ + L  LF   N+ W +F
Sbjct  459  LDYTVCLHSEVFVTTQGGNFPHFLMGHRRYLYGGHAKTIKPDKRKLALLFDRPNIRWDDF  518

Query  213  QDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  112
            +  + +   H++ +G   LRKP+ SLYT+P PDCMC
Sbjct  519  KRQMKDMLSHSDVKGS-ELRKPSASLYTFPMPDCMC  553



>ref|XP_008784225.1| PREDICTED: uncharacterized protein At1g04910-like [Phoenix dactylifera]
Length=552

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 92/216 (43%), Positives = 128/216 (59%), Gaps = 8/216 (4%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQG--RVLNSQFTDEELRSQGRCPLTPEEVGLL  565
            DM A S C + GGK EK  +   R+  W+G  R    +   E  R  GRCPLTP EVG++
Sbjct  333  DMVAFSCCTYDGGKEEKREMDIARERSWRGKFRRHGRKINPEANRMDGRCPLTPLEVGMM  392

Query  564  LAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAA  385
            L  +GFDN T +Y+AS K+Y     +  LR+LFP +E K +LAS++E    KG +S LAA
Sbjct  393  LRGMGFDNTTSVYVASGKIYNAKKYMDPLRQLFPRLETKDTLASADELAPFKGHSSRLAA  452

Query  384  VDYYVGMHSDIFISASPGNMHNAMVGHRTY----HNLKTIRPNMQLLGQLFLNKNLTWPE  217
            +DY V  HS++F++   GN  + M+GHR Y    H+ KTI+P+ + L   F N N+ W  
Sbjct  453  LDYTVCAHSEVFVTTQGGNFPHFMMGHRRYLYEGHS-KTIKPDKRRLVLSFDNPNIRWDR  511

Query  216  FQDAVIEG-HANRQGEIRLRKPAKSLYTYPAPDCMC  112
            F+  + E  H +    + LRK   +LYT+P PDCMC
Sbjct  512  FERNMQEMLHYSDLKGVALRKSNATLYTFPMPDCMC  547



>ref|XP_010262622.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Nelumbo nucifera]
Length=563

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 87/215 (40%), Positives = 128/215 (60%), Gaps = 6/215 (3%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNS--QFTDEELRSQGRCPLTPEEVGLL  565
            DM A S C F GG+ EK  +   R+  W+G+            +R  G+CPLTP EVGL+
Sbjct  335  DMVAFSCCVFDGGEEEKHDMNAARERGWRGKFTKPGRVIKPGAIRINGKCPLTPLEVGLM  394

Query  564  LAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAA  385
            L  +GFDN+T +YLAS K+Y     ++ L  +FPL++ K++LAS EE    K  +S +AA
Sbjct  395  LRGMGFDNSTSIYLASGKIYKAEKTMAPLLEMFPLLQTKETLASVEELAPFKNYSSRMAA  454

Query  384  VDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEF  214
            +DY V +HS++F++   GN  + ++GHR Y    + KTIRP+ + L  LF N N+ W  F
Sbjct  455  LDYTVCLHSEVFVTTQGGNFPHFLMGHRRYLYGGHSKTIRPDKRKLALLFDNPNIGWKTF  514

Query  213  QDAVIEGHANRQGE-IRLRKPAKSLYTYPAPDCMC  112
            +  ++   A    + I L++P  S YT+P PDCMC
Sbjct  515  KHNMLNMRAQSDAKGIELKRPNDSTYTFPCPDCMC  549



>ref|XP_010538926.1| PREDICTED: uncharacterized protein At1g04910-like [Tarenaya hassleriana]
Length=571

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 88/216 (41%), Positives = 134/216 (62%), Gaps = 8/216 (4%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQG--RVLNSQFTDEELRSQGRCPLTPEEVGLL  565
            DM A S C++  G ++K  + K R+  W+G  R         + R  G+CPLTP EVG++
Sbjct  348  DMVAFSCCEYDFGMSDKQEMDKAREKGWRGKFRRRGRVIRPGQNRVDGKCPLTPLEVGMM  407

Query  564  LAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAA  385
            L  +GFDN T +Y+A+  +Y     ++ L+++FPL++ K +LA+ EE    KG +S LAA
Sbjct  408  LRGMGFDNTTLVYVAAGNIYKAEKYMAPLKQMFPLLQTKDTLATPEELAPFKGHSSRLAA  467

Query  384  VDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEF  214
            +DY V +HS++F+S   GN  + ++GHR Y    + KTI+P+ + L QLF N N+ W  F
Sbjct  468  LDYTVCLHSEVFVSTQGGNFPHFLMGHRRYLYKGHAKTIKPDKRKLVQLFDNPNIRWDYF  527

Query  213  QDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  112
            +  + +   H + +G + LRKPA SLYT+P PDCMC
Sbjct  528  KKQMQDMLRHNDAKG-VELRKPASSLYTFPMPDCMC  562



>ref|XP_006434581.1| hypothetical protein CICLE_v10000533mg [Citrus clementina]
 gb|ESR47821.1| hypothetical protein CICLE_v10000533mg [Citrus clementina]
Length=656

 Score =   171 bits (433),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 87/216 (40%), Positives = 132/216 (61%), Gaps = 8/216 (4%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQG--RVLNSQFTDEELRSQGRCPLTPEEVGLL  565
            DM A S C++ GG+ EK  +   R+  W+G  R           R  G+CPLTP EVG++
Sbjct  425  DMVAFSCCEYDGGEEEKHEMDIARERSWRGKFRKRGRVIRPGANRVDGKCPLTPLEVGMM  484

Query  564  LAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAA  385
            L  +GFDN T +Y+A+ K+Y     ++ LR++FP +E K +LA+ EE    KG +S LAA
Sbjct  485  LRGMGFDNTTSVYVAAGKIYKAEKYVAPLRQMFPRLETKDTLATPEELAAFKGHSSRLAA  544

Query  384  VDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEF  214
            +DY V +HS++F++   GN  + ++GHR Y    + KTI+P+ + L  LF   N+ W +F
Sbjct  545  LDYTVCLHSEVFVTTQGGNFPHFLMGHRRYLYGGHAKTIKPDKRKLALLFDRPNIRWDDF  604

Query  213  QDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  112
            +  + +   H++ +G   LRKP+ SLYT+P PDCMC
Sbjct  605  KRQMKDMLSHSDVKGS-ELRKPSASLYTFPMPDCMC  639



>ref|XP_004299893.1| PREDICTED: uncharacterized protein At1g04910 [Fragaria vesca 
subsp. vesca]
Length=564

 Score =   170 bits (430),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 86/216 (40%), Positives = 135/216 (63%), Gaps = 8/216 (4%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQG--RVLNSQFTDEELRSQGRCPLTPEEVGLL  565
            DM A S C++ GGK EK  +   R+  W+G  R           R  G+CPLTP EVG++
Sbjct  335  DMVAFSCCEYDGGKEEKHEMDIARERSWRGKFRRRGRVIRPGANRVDGKCPLTPLEVGMM  394

Query  564  LAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAA  385
            L  +GFDN T +Y+A+ K+Y     ++ L+++FP ++ K +LA+SEE    KG  S LAA
Sbjct  395  LMGMGFDNTTSVYIAAGKIYKAEKYMAPLKQMFPRLQMKDTLATSEELAPYKGHLSRLAA  454

Query  384  VDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEF  214
            +DY V +HS++F++   GN  + ++GHR Y    + KTI+P+ + L  LF N ++ W +F
Sbjct  455  LDYTVCLHSEVFVTTQGGNFPHFLIGHRRYLYGGHSKTIKPDKRKLALLFDNPSIRWEDF  514

Query  213  QDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  112
            +  + +   H++++G + +RKP+ SLYT+P PDCMC
Sbjct  515  KRQMQDMLRHSDQKG-VEVRKPSASLYTFPMPDCMC  549



>ref|XP_010246042.1| PREDICTED: uncharacterized protein At1g04910 isoform X3 [Nelumbo 
nucifera]
Length=510

 Score =   169 bits (428),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 87/216 (40%), Positives = 135/216 (63%), Gaps = 8/216 (4%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQ--FTDEELRSQGRCPLTPEEVGLL  565
            DM A S C + GG+ EK  +   R+  W+G+   +        +R  G+CPLTP EVG++
Sbjct  280  DMVAFSCCIYDGGEEEKREMDIARERGWRGKFNKTGRIIRPGAIRMDGKCPLTPLEVGMM  339

Query  564  LAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAA  385
            L  +GFDN T +Y+A+ K+Y     ++ LR+LFPL+E K++LA  EE    KG +S LAA
Sbjct  340  LRGMGFDNTTSVYIAAGKIYKAEKFMAPLRQLFPLLETKETLALPEELAPFKGHSSRLAA  399

Query  384  VDYYVGMHSDIFISASPGNMHNAMVGHRTYH---NLKTIRPNMQLLGQLFLNKNLTWPEF  214
            +DY V ++S++F++   GN  + ++GHR Y    + KTI+P+ + L  LF + N+ W  F
Sbjct  400  LDYTVCLNSEVFVTTQGGNFPHFLMGHRRYFFGGHAKTIKPDKRKLALLFDSPNIRWEYF  459

Query  213  QDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  112
            +  + E   H++ +G I ++KP+ SLYT+P PDCMC
Sbjct  460  KRQMQEMLHHSDLKG-IEMKKPSSSLYTFPIPDCMC  494



>emb|CBI18521.3| unnamed protein product [Vitis vinifera]
Length=492

 Score =   169 bits (427),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 87/217 (40%), Positives = 135/217 (62%), Gaps = 10/217 (5%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQ---FTDEELRSQGRCPLTPEEVGL  568
            DM A S C + GG+ EK  +   R+  W+G+  N +        +R  G+CPLTP EVG+
Sbjct  262  DMVAFSCCMYDGGEEEKHEMDIARERGWRGK-FNKRGRIIRPGAIRMDGKCPLTPLEVGM  320

Query  567  LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  388
            +L  +GFDN T +Y+A+ K+Y     ++ LR++FP +E K +LAS EE    KG +S LA
Sbjct  321  MLRGMGFDNTTSVYVAAGKIYKAERYMAPLRQMFPRLETKDTLASPEELAPFKGHSSRLA  380

Query  387  AVDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPE  217
            A+DY V +HS++F++   GN  + ++GHR Y    + KTI+P+ + L  LF + +++W  
Sbjct  381  ALDYTVCLHSEVFVTTQGGNFPHFLMGHRRYLYGGHAKTIKPDKRKLALLFDSPDISWDN  440

Query  216  FQDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  112
            F+  + +   H++ +G   LRKP+ SLYT+P PDCMC
Sbjct  441  FKSQMQDMLRHSDSKGS-ELRKPSSSLYTFPMPDCMC  476



>ref|XP_002441904.1| hypothetical protein SORBIDRAFT_08g004650 [Sorghum bicolor]
 gb|EES15742.1| hypothetical protein SORBIDRAFT_08g004650 [Sorghum bicolor]
Length=533

 Score =   169 bits (428),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 90/219 (41%), Positives = 129/219 (59%), Gaps = 14/219 (6%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQG------RVLNSQFTDEELRSQGRCPLTPEE  577
            DM A S C + GG  EK  +   R+  W+G      RV+N     E  R  G+CPLTP E
Sbjct  313  DMVAFSCCTYDGGWREKTEMDNARERSWRGKFRRHGRVINP----EANRRDGKCPLTPLE  368

Query  576  VGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKAS  397
            VG++L  +GFDN T LY+AS K+Y     ++ LR++FPL+  K SLA  EE  + KG +S
Sbjct  369  VGMMLRGMGFDNTTSLYVASGKIYNSEKYMAPLRQMFPLLTTKDSLALPEELAQFKGHSS  428

Query  396  LLAAVDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLT  226
             LAA+DY V + S++F++   GN  + ++GHR Y    N KTI+P+ + L   F + N+ 
Sbjct  429  QLAALDYTVCVQSEVFVTTQGGNFPHFLMGHRRYLFGGNAKTIKPDKRKLVLSFDDPNIR  488

Query  225  WPEFQDAVIEG-HANRQGEIRLRKPAKSLYTYPAPDCMC  112
            W +F+  + E  H +    I  RKP  S+YT+P P+CMC
Sbjct  489  WDQFKQNMQEILHHSDMKSIAFRKPNDSVYTFPMPECMC  527



>ref|XP_011096470.1| PREDICTED: uncharacterized protein At1g04910 [Sesamum indicum]
Length=586

 Score =   169 bits (429),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 91/216 (42%), Positives = 129/216 (60%), Gaps = 8/216 (4%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQG--RVLNSQFTDEELRSQGRCPLTPEEVGLL  565
            DM A S C F GG+ EK  +   R+  W+G  R           R  G+CPLTP EVG++
Sbjct  356  DMVAFSCCVFDGGEEEKREMDIVRERSWRGKFRRRGRVIRPGANRVDGKCPLTPLEVGMM  415

Query  564  LAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAA  385
            L  +GFDN T LY+A+ K+Y     ++ L+++FP +E K SLAS EE     G +S LAA
Sbjct  416  LRGMGFDNTTSLYVAAGKIYKVEKHMAPLKQMFPGLETKDSLASPEELAPFMGHSSRLAA  475

Query  384  VDYYVGMHSDIFISASPGNMHNAMVGHRTYH---NLKTIRPNMQLLGQLFLNKNLTWPEF  214
            +DY V +HS++F++   GN  + +VGHR Y    + KTIRP+ + L QLF   ++ W +F
Sbjct  476  LDYTVCLHSEVFVTTQGGNFPHFLVGHRRYFYEGHAKTIRPDKRKLAQLFDKPSIRWQDF  535

Query  213  QDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  112
            +  + +   H + +G   LRKP+ SLY YP PDCMC
Sbjct  536  KRQLQDMLRHNDVKGS-ELRKPSNSLYMYPMPDCMC  570



>ref|XP_010246041.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Nelumbo 
nucifera]
Length=532

 Score =   169 bits (428),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 87/216 (40%), Positives = 135/216 (63%), Gaps = 8/216 (4%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQ--FTDEELRSQGRCPLTPEEVGLL  565
            DM A S C + GG+ EK  +   R+  W+G+   +        +R  G+CPLTP EVG++
Sbjct  302  DMVAFSCCIYDGGEEEKREMDIARERGWRGKFNKTGRIIRPGAIRMDGKCPLTPLEVGMM  361

Query  564  LAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAA  385
            L  +GFDN T +Y+A+ K+Y     ++ LR+LFPL+E K++LA  EE    KG +S LAA
Sbjct  362  LRGMGFDNTTSVYIAAGKIYKAEKFMAPLRQLFPLLETKETLALPEELAPFKGHSSRLAA  421

Query  384  VDYYVGMHSDIFISASPGNMHNAMVGHRTYH---NLKTIRPNMQLLGQLFLNKNLTWPEF  214
            +DY V ++S++F++   GN  + ++GHR Y    + KTI+P+ + L  LF + N+ W  F
Sbjct  422  LDYTVCLNSEVFVTTQGGNFPHFLMGHRRYFFGGHAKTIKPDKRKLALLFDSPNIRWEYF  481

Query  213  QDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  112
            +  + E   H++ +G I ++KP+ SLYT+P PDCMC
Sbjct  482  KRQMQEMLHHSDLKG-IEMKKPSSSLYTFPIPDCMC  516



>ref|XP_009420104.1| PREDICTED: uncharacterized protein At1g04910-like [Musa acuminata 
subsp. malaccensis]
Length=571

 Score =   169 bits (429),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 86/217 (40%), Positives = 132/217 (61%), Gaps = 10/217 (5%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNS--QFTDEELRSQGRCPLTPEEVGLL  565
            DM A S C F GG+ EK  +   R+  W+G+            +R  G+CPLTP EVGL+
Sbjct  343  DMVAFSCCVFDGGEEEKQEMNAARERGWRGKFTKRGRVIRPGTIRINGKCPLTPLEVGLM  402

Query  564  LAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAA  385
            L  +GF NNT +YLAS K+Y     +  L  +FPL++ K++LAS+EE    K  +S +AA
Sbjct  403  LRGMGFGNNTAIYLASGKIYKAEKTMVPLLEMFPLLQTKETLASTEELAPFKNYSSRMAA  462

Query  384  VDYYVGMHSDIFISASPGNMHNAMVGHRTY----HNLKTIRPNMQLLGQLFLNKNLTWPE  217
            +DY V +HS++F++   GN  + ++GHR Y    H+ KTI+P+ + L  LF N N+ W  
Sbjct  463  IDYSVCLHSEVFVTTQGGNFPHFLIGHRRYLYGGHS-KTIKPDKRKLALLFDNPNIGWKS  521

Query  216  FQDAVI--EGHANRQGEIRLRKPAKSLYTYPAPDCMC  112
             +  ++    H++ +G + +++P+ SLYT+P PDCMC
Sbjct  522  LKRQLLNMRAHSDAKG-MEMKRPSDSLYTFPCPDCMC  557



>ref|XP_010246040.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Nelumbo 
nucifera]
Length=576

 Score =   169 bits (428),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 87/216 (40%), Positives = 135/216 (63%), Gaps = 8/216 (4%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQ--FTDEELRSQGRCPLTPEEVGLL  565
            DM A S C + GG+ EK  +   R+  W+G+   +        +R  G+CPLTP EVG++
Sbjct  346  DMVAFSCCIYDGGEEEKREMDIARERGWRGKFNKTGRIIRPGAIRMDGKCPLTPLEVGMM  405

Query  564  LAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAA  385
            L  +GFDN T +Y+A+ K+Y     ++ LR+LFPL+E K++LA  EE    KG +S LAA
Sbjct  406  LRGMGFDNTTSVYIAAGKIYKAEKFMAPLRQLFPLLETKETLALPEELAPFKGHSSRLAA  465

Query  384  VDYYVGMHSDIFISASPGNMHNAMVGHRTYH---NLKTIRPNMQLLGQLFLNKNLTWPEF  214
            +DY V ++S++F++   GN  + ++GHR Y    + KTI+P+ + L  LF + N+ W  F
Sbjct  466  LDYTVCLNSEVFVTTQGGNFPHFLMGHRRYFFGGHAKTIKPDKRKLALLFDSPNIRWEYF  525

Query  213  QDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  112
            +  + E   H++ +G I ++KP+ SLYT+P PDCMC
Sbjct  526  KRQMQEMLHHSDLKG-IEMKKPSSSLYTFPIPDCMC  560



>ref|XP_009362462.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Pyrus x bretschneideri]
Length=582

 Score =   169 bits (427),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 86/216 (40%), Positives = 135/216 (63%), Gaps = 8/216 (4%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQG--RVLNSQFTDEELRSQGRCPLTPEEVGLL  565
            DM A S C++ GG+ EK  +   R+  W+G  R           R  G+CPLTP EVG++
Sbjct  357  DMVAFSCCEYDGGEEEKHEMDIARERSWRGKFRRRGRVIRPGANRVDGKCPLTPLEVGMM  416

Query  564  LAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAA  385
            L  +GFDN T +Y+A+ K+Y     ++ L+++FP +E K +LA++EE    KG  S LAA
Sbjct  417  LRGMGFDNTTSVYVAAGKIYKAEKYMAPLKQMFPHLEMKDTLATAEELAPFKGHLSRLAA  476

Query  384  VDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEF  214
            +DY V +HS++F++   GN  + ++GHR Y    + KTI+P+ + L  LF N N+ W +F
Sbjct  477  LDYTVCLHSEVFVTTQGGNFPHFLMGHRRYLYGGHSKTIKPDKRKLALLFDNPNIRWEDF  536

Query  213  QDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  112
            +  + +   H++++G + L+KP+ SLYT+P PDCMC
Sbjct  537  KRQMQDMLRHSDQKG-VELKKPSASLYTFPMPDCMC  571



>gb|AFK46212.1| unknown [Medicago truncatula]
Length=359

 Score =   165 bits (417),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 83/216 (38%), Positives = 133/216 (62%), Gaps = 8/216 (4%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQ--FTDEELRSQGRCPLTPEEVGLL  565
            DM A S C++ GG  EK  +   R+  W+G+             R  GRCPLTP EVG++
Sbjct  127  DMVAFSCCEYDGGAEEKREMDIARERSWRGKFKRKHRIIKPGANRVDGRCPLTPLEVGMM  186

Query  564  LAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAA  385
            L  +GFDN T +Y+A+ K+Y     ++ L+++FP ++ K +LA+ EE  + KG +S LAA
Sbjct  187  LRGMGFDNTTLVYVAAGKIYKEQKYMAPLKQMFPRLQTKDTLATPEELAQFKGHSSRLAA  246

Query  384  VDYYVGMHSDIFISASPGNMHNAMVGHRTYH---NLKTIRPNMQLLGQLFLNKNLTWPEF  214
            +DY V +HS++F++   GN  + ++GHR Y    + KTI+P+ + L  LF N N+ W  F
Sbjct  247  LDYTVCLHSEVFVTTQGGNFPHFLMGHRRYMYGGHSKTIKPDKRRLALLFDNPNIRWEVF  306

Query  213  QDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  112
            +  + +   H++++G   ++K ++SLYT+P PDCMC
Sbjct  307  KQQMKDMLRHSDQKG-TGVKKASESLYTFPMPDCMC  341



>ref|XP_002272758.2| PREDICTED: uncharacterized protein At1g04910 [Vitis vinifera]
Length=582

 Score =   169 bits (427),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 87/217 (40%), Positives = 135/217 (62%), Gaps = 10/217 (5%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQ---FTDEELRSQGRCPLTPEEVGL  568
            DM A S C + GG+ EK  +   R+  W+G+  N +        +R  G+CPLTP EVG+
Sbjct  352  DMVAFSCCMYDGGEEEKHEMDIARERGWRGK-FNKRGRIIRPGAIRMDGKCPLTPLEVGM  410

Query  567  LLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLA  388
            +L  +GFDN T +Y+A+ K+Y     ++ LR++FP +E K +LAS EE    KG +S LA
Sbjct  411  MLRGMGFDNTTSVYVAAGKIYKAERYMAPLRQMFPRLETKDTLASPEELAPFKGHSSRLA  470

Query  387  AVDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPE  217
            A+DY V +HS++F++   GN  + ++GHR Y    + KTI+P+ + L  LF + +++W  
Sbjct  471  ALDYTVCLHSEVFVTTQGGNFPHFLMGHRRYLYGGHAKTIKPDKRKLALLFDSPDISWDN  530

Query  216  FQDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  112
            F+  + +   H++ +G   LRKP+ SLYT+P PDCMC
Sbjct  531  FKSQMQDMLRHSDSKGS-ELRKPSSSLYTFPMPDCMC  566



>ref|XP_006582446.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Glycine max]
Length=500

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 84/216 (39%), Positives = 132/216 (61%), Gaps = 8/216 (4%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQ--FTDEELRSQGRCPLTPEEVGLL  565
            DM A S C++ GGK EKL +   R+  W+G+             R  GRCPLTP EVG++
Sbjct  268  DMVAFSCCEYDGGKEEKLEMDIARERSWRGKFRRKHRIIKPGANRVDGRCPLTPLEVGMM  327

Query  564  LAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAA  385
            L  +GFDN T +Y+A+ K+Y     ++ L+++FP ++ K +LA+ EE  +  G ++ LAA
Sbjct  328  LRGMGFDNTTSVYVAAGKIYKEQKYMAPLKQMFPRLQTKNTLATPEELAQFMGHSTRLAA  387

Query  384  VDYYVGMHSDIFISASPGNMHNAMVGHRTYH---NLKTIRPNMQLLGQLFLNKNLTWPEF  214
            +DY V +HS++FI+   GN  + ++GHR Y    + KTI+P+ + L  LF N N+ W  F
Sbjct  388  LDYTVCLHSEVFITTQGGNFPHFLMGHRRYMYGGHAKTIKPDKRRLALLFDNPNIRWEVF  447

Query  213  QDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  112
            +  + +   H++++G   ++K   SLYT+P PDCMC
Sbjct  448  KQQMTDMLRHSDQKG-TEIKKAGGSLYTFPMPDCMC  482



>ref|XP_009407491.1| PREDICTED: uncharacterized protein At1g04910-like [Musa acuminata 
subsp. malaccensis]
Length=569

 Score =   168 bits (426),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 85/217 (39%), Positives = 131/217 (60%), Gaps = 10/217 (5%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQ--FTDEELRSQGRCPLTPEEVGLL  565
            DM A S C F GG+ EK  +   R+  W+G+            +R  G+CPLTP EVGL+
Sbjct  341  DMVAFSCCIFDGGEEEKQDMIAARERGWRGKFTKPGRIIRPGAIRINGKCPLTPLEVGLM  400

Query  564  LAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAA  385
            L  +GF N+T +YLAS K+Y     ++ L  +FPL++ K++LAS+EE    +  +S +AA
Sbjct  401  LRGMGFSNDTAIYLASGKIYKAEKTMAPLLEMFPLLQTKETLASAEELAPFENYSSRMAA  460

Query  384  VDYYVGMHSDIFISASPGNMHNAMVGHRTY----HNLKTIRPNMQLLGQLFLNKNLTWPE  217
            +DY V +HS++F+S   GN    ++GHR Y    H+ KTI+P+ + L  LF N N+ W  
Sbjct  461  IDYSVCLHSEVFVSTQGGNFPQILIGHRRYLYGGHS-KTIKPDKRKLALLFDNPNIGWKS  519

Query  216  FQDAVI--EGHANRQGEIRLRKPAKSLYTYPAPDCMC  112
             +  ++    H++ +G I +++P  S+Y+YP PDCMC
Sbjct  520  LKRQLLNMRAHSDAKG-IEMKRPNDSIYSYPCPDCMC  555



>ref|XP_008776785.1| PREDICTED: uncharacterized protein At1g04910-like [Phoenix dactylifera]
Length=563

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 85/218 (39%), Positives = 131/218 (60%), Gaps = 8/218 (4%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNS--QFTDEELRSQGRCPLTPEEVGLL  565
            DM A S C F GG+ E   +   R+  W+G+            +R  G+CPLTP EVGL+
Sbjct  335  DMVAFSCCIFDGGEEENQDMNAARERGWRGKFTKPGRVIRPGVIRMNGKCPLTPLEVGLI  394

Query  564  LAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAA  385
            L  +GF NNT +YLAS K+Y     ++ L  +FPL++ K++LAS+EE    K  +S +AA
Sbjct  395  LQGMGFSNNTAIYLASGKIYKAEKTMAPLLEMFPLLQTKETLASAEELAPFKNYSSRMAA  454

Query  384  VDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEF  214
            VDY V +HS++F++   GN  + ++GHR Y    + KTI+P+ + L  LF N  ++W   
Sbjct  455  VDYSVCLHSEVFLTTQGGNFPHFLIGHRRYLYGGHSKTIKPDKRKLALLFDNPKVSWKAL  514

Query  213  QDAVI--EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            +  ++    H++ +G I +++P  S+YTYP PDCMC +
Sbjct  515  KRQLLNMRAHSDAKG-IEIKRPNDSIYTYPCPDCMCRS  551



>gb|KJB15424.1| hypothetical protein B456_002G178200 [Gossypium raimondii]
 gb|KJB15426.1| hypothetical protein B456_002G178200 [Gossypium raimondii]
Length=561

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 87/216 (40%), Positives = 130/216 (60%), Gaps = 8/216 (4%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNS--QFTDEELRSQGRCPLTPEEVGLL  565
            DM A S C F GG+ EK  + K R+  W+G+            +R  G+CPLTP EVGL+
Sbjct  333  DMVAFSCCVFDGGELEKEDMKKARERGWKGKFTKPGRVIRPGAIRINGKCPLTPLEVGLM  392

Query  564  LAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAA  385
            L  +GFDNNT ++LAS K+Y     ++ L  +FP ++ K+ LAS EE    K  +S +AA
Sbjct  393  LRGMGFDNNTYIFLASGKIYNSEKTMAPLLEMFPNLQTKEMLASEEELVPYKRFSSRMAA  452

Query  384  VDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEF  214
            +DY V +HS++F++   GN  + ++GHR Y    + KTIRP+ + L  LF N N+ W  F
Sbjct  453  IDYTVCLHSEVFVTTQGGNFPHFLMGHRRYLYSGHSKTIRPDKRRLALLFDNPNIGWRTF  512

Query  213  QDAVI--EGHANRQGEIRLRKPAKSLYTYPAPDCMC  112
            +  ++    H++ +G   L++P  S+YT+P PDCMC
Sbjct  513  KRQMLNMRSHSDTKG-FELKRPNDSIYTFPCPDCMC  547



>gb|KHN47089.1| DUF246 domain-containing protein [Glycine soja]
Length=566

 Score =   168 bits (425),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/216 (39%), Positives = 133/216 (62%), Gaps = 8/216 (4%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQ--FTDEELRSQGRCPLTPEEVGLL  565
            DM A S C++ GGK EKL +   R+  W+G+             R  GRCPLTP EVG++
Sbjct  334  DMVAFSCCEYDGGKEEKLEMDIARERSWRGKFRRKHRIIKPGANRVDGRCPLTPLEVGMM  393

Query  564  LAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAA  385
            L  +GFDN T +Y+A+ K+Y     ++ L+++FP ++ K +LA+ EE  +  G ++ LAA
Sbjct  394  LRGMGFDNTTSVYVAAGKIYKEQKYMAPLKQMFPRLQTKNTLATPEELAQFMGHSTRLAA  453

Query  384  VDYYVGMHSDIFISASPGNMHNAMVGHRTYH---NLKTIRPNMQLLGQLFLNKNLTWPEF  214
            +DY V +HS++F++   GN  + ++GHR Y    + KTI+P+ + L  LF N N+ W  F
Sbjct  454  LDYTVCLHSEVFVTTQGGNFPHFLMGHRRYMYGGHAKTIKPDKRRLALLFDNPNIRWEVF  513

Query  213  QDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  112
            +  + +   H++++G   L+K  +SLYT+P PDCMC
Sbjct  514  KQQMKDMLRHSDQKG-TELKKAGESLYTFPMPDCMC  548



>ref|XP_008378761.1| PREDICTED: uncharacterized protein At1g04910 [Malus domestica]
Length=455

 Score =   166 bits (420),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 87/221 (39%), Positives = 135/221 (61%), Gaps = 18/221 (8%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQG------RVLNSQFTDEELRSQGRCPLTPEE  577
            DM A S C++ GG+ EK  +   R+  W+G      RV+         R  G+CPLTP E
Sbjct  221  DMVAFSCCEYDGGEEEKREMDIARERSWRGKFRRRGRVIRPGAN----RVDGKCPLTPLE  276

Query  576  VGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKAS  397
            VG++L  +GFDN T +Y+A+  +Y     +S L+ +FP +E K +LA++EE    KG  S
Sbjct  277  VGMMLRGMGFDNATSVYIAAGNIYNAEKYMSPLKLMFPRLEMKDTLATAEELAPFKGHLS  336

Query  396  LLAAVDYYVGMHSDIFISASPGNMHNAMVGHRTY----HNLKTIRPNMQLLGQLFLNKNL  229
             LAA+DY V +HS++F++   GN  + ++GHR Y    H+ KTI+P+ + L  LF + N+
Sbjct  337  RLAALDYTVCLHSEVFVTTQGGNFPHFLMGHRRYLYGGHS-KTIKPDKRKLALLFDBPNI  395

Query  228  TWPEFQDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  112
             W +F+  + +   H++++G   L+KP+ SLYT+P PDCMC
Sbjct  396  RWEDFKRQMQDMLRHSDQKG-FELKKPSASLYTFPMPDCMC  435



>ref|XP_003526401.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Glycine max]
 gb|KHN20543.1| DUF246 domain-containing protein [Glycine soja]
Length=566

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/216 (39%), Positives = 132/216 (61%), Gaps = 8/216 (4%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQ--FTDEELRSQGRCPLTPEEVGLL  565
            DM A S C++ GGK EKL +   R+  W+G+             R  GRCPLTP EVG++
Sbjct  334  DMVAFSCCEYDGGKEEKLEMDIARERSWRGKFRRKHRIIKPGANRVDGRCPLTPLEVGMM  393

Query  564  LAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAA  385
            L  +GFDN T +Y+A+ K+Y     ++ L+++FP ++ K +LA+ EE  +  G ++ LAA
Sbjct  394  LRGMGFDNTTSVYVAAGKIYKEQKYMAPLKQMFPRLQTKNTLATPEELAQFMGHSTRLAA  453

Query  384  VDYYVGMHSDIFISASPGNMHNAMVGHRTYH---NLKTIRPNMQLLGQLFLNKNLTWPEF  214
            +DY V +HS++FI+   GN  + ++GHR Y    + KTI+P+ + L  LF N N+ W  F
Sbjct  454  LDYTVCLHSEVFITTQGGNFPHFLMGHRRYMYGGHAKTIKPDKRRLALLFDNPNIRWEVF  513

Query  213  QDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  112
            +  + +   H++++G   ++K   SLYT+P PDCMC
Sbjct  514  KQQMTDMLRHSDQKG-TEIKKAGGSLYTFPMPDCMC  548



>ref|XP_006304663.1| hypothetical protein CARUB_v10011867mg [Capsella rubella]
 gb|EOA37561.1| hypothetical protein CARUB_v10011867mg [Capsella rubella]
Length=580

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 88/216 (41%), Positives = 134/216 (62%), Gaps = 8/216 (4%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQG--RVLNSQFTDEELRSQGRCPLTPEEVGLL  565
            DM A S C++  G+AEKL +   R+  W+G  R           R  G+CPLTP EVG++
Sbjct  352  DMVAFSCCEYDFGEAEKLEMDLARERGWKGKFRRRGRVIRPGANRIDGKCPLTPLEVGMM  411

Query  564  LAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAA  385
            L  +GF+NNT +Y+A+  +Y     ++ LR++FPL++ K +LA++EE    KG +S LAA
Sbjct  412  LRGMGFNNNTLVYVAAGNIYKADKYMAPLRQMFPLLQTKDTLATTEELAPFKGHSSRLAA  471

Query  384  VDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEF  214
            +DY V +HS++F+S   GN  + ++GHR Y    + +TI+P+ + L QL    ++ W  F
Sbjct  472  LDYTVCLHSEVFVSTQGGNFPHFLIGHRRYLYKGHAETIKPDKRKLVQLLDKPSIRWDYF  531

Query  213  QDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  112
            +  + +   H + +G I LRKPA SLYT+P PDCMC
Sbjct  532  KKQMQDMLRHNDAKG-IELRKPAASLYTFPMPDCMC  566



>gb|KHG09805.1| hypothetical protein F383_15167 [Gossypium arboreum]
Length=561

 Score =   167 bits (423),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 87/216 (40%), Positives = 130/216 (60%), Gaps = 8/216 (4%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNS--QFTDEELRSQGRCPLTPEEVGLL  565
            DM A S C F GG+ EK  + K R+  W+G+            +R  G+CPLTP EVGL+
Sbjct  333  DMVAFSCCVFDGGELEKEDMKKARERGWKGKFTKPGRVIRPGAIRINGKCPLTPLEVGLM  392

Query  564  LAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAA  385
            L  +GFDNNT ++LAS K+Y     ++ L  +FP ++ K+ LAS EE    K  +S +AA
Sbjct  393  LRGMGFDNNTYIFLASGKIYNSEKTMAPLLEMFPNLQTKEMLASEEELVPYKRFSSRMAA  452

Query  384  VDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEF  214
            +DY V +HS++F++   GN  + ++GHR Y    + KTIRP+ + L  LF N N+ W  F
Sbjct  453  IDYTVCLHSEVFLTTQGGNFPHFLMGHRRYLYGGHSKTIRPDKRRLALLFDNPNIGWRTF  512

Query  213  QDAVI--EGHANRQGEIRLRKPAKSLYTYPAPDCMC  112
            +  ++    H++ +G   L++P  S+YT+P PDCMC
Sbjct  513  KRQMLNMRSHSDTKG-FELKRPNDSIYTFPCPDCMC  547



>ref|XP_006664382.1| PREDICTED: uncharacterized protein At1g04910-like [Oryza brachyantha]
Length=431

 Score =   165 bits (418),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 89/220 (40%), Positives = 131/220 (60%), Gaps = 16/220 (7%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQG------RVLNSQFTDEELRSQGRCPLTPEE  577
            DM A S C + GG  EK+ +   R+  W+G      RV+N     E  R  G+CPLTP E
Sbjct  211  DMVAFSCCIYDGGLKEKIEMENARERSWKGKFHRHGRVINP----EANRRDGKCPLTPLE  266

Query  576  VGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKAS  397
            VG++L  +GFDN T LY+AS K+Y     ++ LR++FPL+  K +LA  EE  E +G +S
Sbjct  267  VGMMLRGMGFDNTTSLYVASGKIYNAEKYMAPLRQMFPLLATKDTLALPEELAEFEGHSS  326

Query  396  LLAAVDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLT  226
             LAA+DY V + S++F++   GN  + ++GHR Y    N KTI+P+ + L   F + N+ 
Sbjct  327  RLAALDYTVCLPSEVFVTTQGGNFPHFLMGHRRYLFGGNAKTIKPDKRKLVLSFDDPNIR  386

Query  225  WPEFQDAV--IEGHANRQGEIRLRKPAKSLYTYPAPDCMC  112
            W  F+  +  I  H++ +G    RKP  S+YT+P P+CMC
Sbjct  387  WNRFKRHMQDILHHSDMRGTA-FRKPNDSIYTFPMPECMC  425



>gb|KDO64642.1| hypothetical protein CISIN_1g008637mg [Citrus sinensis]
Length=558

 Score =   167 bits (422),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 87/218 (40%), Positives = 130/218 (60%), Gaps = 8/218 (4%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNS--QFTDEELRSQGRCPLTPEEVGLL  565
            DM A S C F GG+ EK  + + R+  W+G+            +R  G+CPLTP EVGL+
Sbjct  336  DMVAFSCCVFDGGEREKEDMKEARERGWKGKFTKPGRVIRPGAIRINGKCPLTPLEVGLM  395

Query  564  LAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAA  385
            L  +GFD NT ++LAS K+Y     ++ L  +FP ++ K+ LAS EE    K  +S +AA
Sbjct  396  LRGMGFDKNTYIFLASGKIYNAEKTMAPLIEMFPNLQTKEMLASEEELAPFKNFSSRMAA  455

Query  384  VDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEF  214
            VDY V +HS++F++   GN  + ++GHR Y    + KTIRP+ + L  LF N N+ W  F
Sbjct  456  VDYTVCLHSEVFVTTQGGNFPHFLMGHRRYLYGGHSKTIRPDKRKLALLFDNPNIGWRSF  515

Query  213  QDAVI--EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            +  ++    H++ +G   L++P+ S YT+P PDCMC A
Sbjct  516  KRQMLSMRSHSDSKG-YELKRPSDSPYTFPCPDCMCRA  552



>ref|XP_006469184.1| PREDICTED: uncharacterized protein At1g04910-like [Citrus sinensis]
Length=558

 Score =   167 bits (422),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 87/218 (40%), Positives = 130/218 (60%), Gaps = 8/218 (4%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNS--QFTDEELRSQGRCPLTPEEVGLL  565
            DM A S C F GG+ EK  + + R+  W+G+            +R  G+CPLTP EVGL+
Sbjct  336  DMVAFSCCVFDGGEREKEDMKEARERGWKGKFTKPGRVIRPGAIRINGKCPLTPLEVGLM  395

Query  564  LAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAA  385
            L  +GFD NT ++LAS K+Y     ++ L  +FP ++ K+ LAS EE    K  +S +AA
Sbjct  396  LRGMGFDKNTYIFLASGKIYNAEKTMAPLLEMFPNLQTKEMLASEEELSPFKNFSSRMAA  455

Query  384  VDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEF  214
            VDY V +HS++F++   GN  + ++GHR Y    + KTIRP+ + L  LF N N+ W  F
Sbjct  456  VDYTVCLHSEVFVTTQGGNFPHFLMGHRRYLYGGHSKTIRPDKRKLALLFDNPNIGWRSF  515

Query  213  QDAVI--EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            +  ++    H++ +G   L++P+ S YT+P PDCMC A
Sbjct  516  KRQMLSMRSHSDSKG-YELKRPSDSPYTFPCPDCMCRA  552



>ref|XP_006448248.1| hypothetical protein CICLE_v10014776mg [Citrus clementina]
 gb|ESR61488.1| hypothetical protein CICLE_v10014776mg [Citrus clementina]
Length=558

 Score =   167 bits (422),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 87/218 (40%), Positives = 130/218 (60%), Gaps = 8/218 (4%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNS--QFTDEELRSQGRCPLTPEEVGLL  565
            DM A S C F GG+ EK  + + R+  W+G+            +R  G+CPLTP EVGL+
Sbjct  336  DMVAFSCCVFDGGEREKEDMKEARERGWKGKFTKPGRVIRPGAIRINGKCPLTPLEVGLM  395

Query  564  LAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAA  385
            L  +GFD NT ++LAS K+Y     ++ L  +FP ++ K+ LAS EE    K  +S +AA
Sbjct  396  LRGMGFDKNTYIFLASGKIYNAEKTMAPLLEMFPNLQTKEMLASEEELSPFKNFSSRMAA  455

Query  384  VDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEF  214
            VDY V +HS++F++   GN  + ++GHR Y    + KTIRP+ + L  LF N N+ W  F
Sbjct  456  VDYTVCLHSEVFVTTQGGNFPHFLMGHRRYLYGGHSKTIRPDKRKLALLFDNPNIGWRSF  515

Query  213  QDAVI--EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            +  ++    H++ +G   L++P+ S YT+P PDCMC A
Sbjct  516  KRQMLSMRSHSDSKG-YELKRPSDSPYTFPCPDCMCRA  552



>ref|XP_006349651.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Solanum tuberosum]
Length=571

 Score =   167 bits (423),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 86/216 (40%), Positives = 135/216 (63%), Gaps = 8/216 (4%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQG--RVLNSQFTDEELRSQGRCPLTPEEVGLL  565
            DM A S C + GG+ EK  +   R+  W+G  R           R  G+CPLTP EVG++
Sbjct  341  DMVAFSCCTYDGGEEEKHEMDIARERSWRGKFRRRGRVIRPGANRVDGKCPLTPLEVGMM  400

Query  564  LAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAA  385
            L  +GFDNNT LY+A+ K+Y     ++ L+++FP +E+K +LAS+EE    +G +S LAA
Sbjct  401  LRGMGFDNNTSLYVAAGKIYKAEKYMTPLKQMFPRLESKDTLASTEELAPFEGHSSRLAA  460

Query  384  VDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEF  214
            +DY V ++S+ F++   GN  + +VGHR Y    + KTI+P+ + L  LF + ++ W +F
Sbjct  461  LDYTVCLYSEAFVTTQGGNFPHFLVGHRRYLYEGHAKTIKPDKRKLALLFDSPDIRWNDF  520

Query  213  QDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  112
            +  + +   H++ +G + L+KP+ SLYT+P PDCMC
Sbjct  521  KSQLQDMLHHSDTKG-VELKKPSSSLYTFPMPDCMC  555



>gb|AES59903.2| O-fucosyltransferase family protein [Medicago truncatula]
Length=549

 Score =   167 bits (422),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 85/219 (39%), Positives = 131/219 (60%), Gaps = 10/219 (5%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNS--QFTDEELRSQGRCPLTPEEVGLL  565
            DM A S C F GGK E+  +   R+  W+G+            +R  G+CPLTP EVGL+
Sbjct  332  DMVAFSCCVFDGGKEERDDMIAARERGWKGKFTKRGRVIRPGAIRIDGKCPLTPLEVGLM  391

Query  564  LAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAA  385
            L  +GF  NT +YLAS K+Y G   ++ LR +FP +  K++LAS EE    K  +S +AA
Sbjct  392  LRGMGFTKNTSIYLASGKIYNGEKTMAPLREMFPNLHTKETLASEEELAPFKNYSSRMAA  451

Query  384  VDYYVGMHSDIFISASPGNMHNAMVGHRTY----HNLKTIRPNMQLLGQLFLNKNLTWPE  217
            +DY V +HS++F++   GN  + ++GHR Y    H+ KTI+P+ + L  LF + N+ W  
Sbjct  452  IDYTVCLHSEVFVTTQGGNFPHFLLGHRRYLYGGHS-KTIKPDKRKLALLFDSTNIGWKS  510

Query  216  FQDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
             +  ++    H++ +G + L++P  S Y++P PDCMC+A
Sbjct  511  LKHQLLSMRSHSDSKG-VELKRPNDSTYSFPCPDCMCHA  548



>gb|KHG19963.1| hypothetical protein F383_04918 [Gossypium arboreum]
Length=561

 Score =   167 bits (422),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 86/216 (40%), Positives = 128/216 (59%), Gaps = 8/216 (4%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNS--QFTDEELRSQGRCPLTPEEVGLL  565
            DM A S C F GG+ EK  +   R+  W+G+            +R  G+CPLTP EVGL+
Sbjct  333  DMVAFSCCVFDGGEQEKEDMKNARERGWKGKFTKPGRVIRPGAIRINGKCPLTPLEVGLM  392

Query  564  LAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAA  385
            L  +GF NNT ++LAS K+Y     ++ L  +FP ++ K+ LAS EE    K  +S +AA
Sbjct  393  LRGMGFGNNTYIFLASGKIYNAEKTMAPLLDMFPNLQTKEMLASEEELAPYKNFSSRMAA  452

Query  384  VDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEF  214
            +DY V +HS++F++   GN  + ++GHR Y    + KTIRP+ + L  LF N N+ W  F
Sbjct  453  IDYTVCLHSEVFVTTQGGNFPHFLMGHRRYLFGGHSKTIRPDKRKLALLFDNPNIGWKSF  512

Query  213  QDAVI--EGHANRQGEIRLRKPAKSLYTYPAPDCMC  112
            +  ++    H++ +G   L+KP  S+YT+P PDCMC
Sbjct  513  KRQMLNMRSHSDSKG-FELKKPVDSIYTFPCPDCMC  547



>ref|XP_003589652.1| hypothetical protein MTR_1g031590 [Medicago truncatula]
Length=614

 Score =   167 bits (423),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 85/219 (39%), Positives = 131/219 (60%), Gaps = 10/219 (5%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNS--QFTDEELRSQGRCPLTPEEVGLL  565
            DM A S C F GGK E+  +   R+  W+G+            +R  G+CPLTP EVGL+
Sbjct  397  DMVAFSCCVFDGGKEERDDMIAARERGWKGKFTKRGRVIRPGAIRIDGKCPLTPLEVGLM  456

Query  564  LAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAA  385
            L  +GF  NT +YLAS K+Y G   ++ LR +FP +  K++LAS EE    K  +S +AA
Sbjct  457  LRGMGFTKNTSIYLASGKIYNGEKTMAPLREMFPNLHTKETLASEEELAPFKNYSSRMAA  516

Query  384  VDYYVGMHSDIFISASPGNMHNAMVGHRTY----HNLKTIRPNMQLLGQLFLNKNLTWPE  217
            +DY V +HS++F++   GN  + ++GHR Y    H+ KTI+P+ + L  LF + N+ W  
Sbjct  517  IDYTVCLHSEVFVTTQGGNFPHFLLGHRRYLYGGHS-KTIKPDKRKLALLFDSTNIGWKS  575

Query  216  FQDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
             +  ++    H++ +G + L++P  S Y++P PDCMC+A
Sbjct  576  LKHQLLSMRSHSDSKG-VELKRPNDSTYSFPCPDCMCHA  613



>ref|XP_010066619.1| PREDICTED: uncharacterized protein At1g04910 [Eucalyptus grandis]
 gb|KCW64583.1| hypothetical protein EUGRSUZ_G02181 [Eucalyptus grandis]
Length=564

 Score =   167 bits (422),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 83/217 (38%), Positives = 130/217 (60%), Gaps = 8/217 (4%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNS--QFTDEELRSQGRCPLTPEEVGLL  565
            DM A S C F GG+ EK+ +   R+  W+G+            +R  G+CPLTP EVGL+
Sbjct  336  DMVAFSCCVFDGGEQEKIDMIAAREKGWRGKFTKPGRVIRPGSIRINGKCPLTPLEVGLM  395

Query  564  LAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAA  385
            L  +GFD +T ++LAS K+Y     ++ L  +FP ++ K+ LAS EE    K  +S +AA
Sbjct  396  LRGMGFDKSTSIFLASGKIYNAEKTMAPLLEMFPQLKTKEMLASEEELAPFKNYSSRMAA  455

Query  384  VDYYVGMHSDIFISASPGNMHNAMVGHRTYH---NLKTIRPNMQLLGQLFLNKNLTWPEF  214
            +DY V +HS++F++   GN  + ++GHR Y    + KTIRP+ + L  +F N NL W  F
Sbjct  456  IDYTVCLHSEVFVTTQGGNFPHFLLGHRRYMYGGHSKTIRPDKRKLALIFDNPNLGWKNF  515

Query  213  QDAVI--EGHANRQGEIRLRKPAKSLYTYPAPDCMCN  109
            +  ++    H++ +G   L++P  S+Y++P PDCMC+
Sbjct  516  KRQMLNMRSHSDSKG-FELKRPNDSIYSFPCPDCMCH  551



>ref|XP_004238827.1| PREDICTED: uncharacterized protein At1g04910 [Solanum lycopersicum]
 ref|XP_010320701.1| PREDICTED: uncharacterized protein At1g04910 [Solanum lycopersicum]
Length=581

 Score =   167 bits (422),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 84/218 (39%), Positives = 130/218 (60%), Gaps = 8/218 (4%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNS--QFTDEELRSQGRCPLTPEEVGLL  565
            DM A S C + GG+ EK  +   R+  W+G+            +R  G+CPLTP EVGL+
Sbjct  353  DMVAFSCCIYDGGEEEKRDMDAARERGWKGKFTKPGRVIRPGAIRINGKCPLTPLEVGLM  412

Query  564  LAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAA  385
            L  +GFD  T +YLAS K+Y     +  L  +FPL++ K+ LAS EE G  +  +S +AA
Sbjct  413  LRGMGFDKFTSIYLASGKIYDSERHMKPLLEMFPLLQTKEMLASPEELGPFQNYSSRMAA  472

Query  384  VDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEF  214
            +DY V +HS++F++   GN  + ++GHR Y    + +TIRP+ + L  L+ N N+ W  F
Sbjct  473  IDYTVCLHSEVFVTTQGGNFPHFLLGHRRYLYGGHSRTIRPDKRKLALLYDNPNIGWKSF  532

Query  213  QDAV--IEGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            +  +  I  H++ +G I +++P  S+YT+P PDCMC +
Sbjct  533  KRQMHSIRAHSDSKG-IEIKRPNDSIYTFPCPDCMCRS  569



>ref|XP_006397450.1| hypothetical protein EUTSA_v10001813mg [Eutrema salsugineum]
 gb|ESQ38903.1| hypothetical protein EUTSA_v10001813mg [Eutrema salsugineum]
Length=571

 Score =   167 bits (422),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 87/216 (40%), Positives = 133/216 (62%), Gaps = 8/216 (4%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQG--RVLNSQFTDEELRSQGRCPLTPEEVGLL  565
            DM A S C++  GK EKL +   R+  W+G  R           R  G+CPLTP EVG++
Sbjct  345  DMVAFSCCEYDFGKTEKLEMDMARERGWKGKFRRRGRVIRPGANRIDGKCPLTPLEVGMI  404

Query  564  LAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAA  385
            L  +GF+N+T +Y+A+  +Y     ++ LR++FPL++ K +LA+ EE    KG +S LAA
Sbjct  405  LRGMGFNNSTLVYVAAGNIYKADKYMAPLRQMFPLLQTKDTLATPEELAPFKGHSSRLAA  464

Query  384  VDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEF  214
            +DY V +HS++F+S   GN  + ++GHR Y    + +TI+P+ + L QLF   ++ W  F
Sbjct  465  LDYTVCLHSEVFVSTQGGNFPHFLIGHRRYLYKGHAETIKPDKRKLVQLFDKPSIRWDYF  524

Query  213  QDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  112
            +  + +   H + +G + LRKPA SLYT+P PDCMC
Sbjct  525  KKQMQDMLRHNDAKG-VELRKPAASLYTFPMPDCMC  559



>ref|XP_010931259.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Elaeis guineensis]
Length=497

 Score =   166 bits (419),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 84/218 (39%), Positives = 130/218 (60%), Gaps = 8/218 (4%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNSQFTDEE--LRSQGRCPLTPEEVGLL  565
            DM A S C F GG+ EK  +   R+  W+G+            +R  G+CPLTP EVGL+
Sbjct  269  DMVAFSCCIFDGGEEEKQDMNAARERGWRGKFTKPGRVIRPGVIRMSGKCPLTPLEVGLI  328

Query  564  LAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAA  385
            L  +GF NNT +YLAS K+Y     ++ L  +FPL++ K++LAS+EE    K  +S +AA
Sbjct  329  LRGMGFSNNTAIYLASGKIYKAEKAMAPLLEMFPLLQTKETLASAEELAPFKNYSSRMAA  388

Query  384  VDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEF  214
            VDY V +H ++F++   GN  + ++GHR Y    + KTI+P+ + L  L  N  ++W   
Sbjct  389  VDYSVCLHGEVFVTTQGGNFPHFLIGHRRYLYGGHSKTIKPDKRKLALLLDNPKVSWKAL  448

Query  213  QDAVI--EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            +  ++    H++ +G I +++P  S+YTYP PDCMC +
Sbjct  449  KRQLLNMRAHSDAKG-IEIKRPNDSIYTYPCPDCMCRS  485



>ref|XP_010461317.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=577

 Score =   166 bits (421),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 88/216 (41%), Positives = 133/216 (62%), Gaps = 8/216 (4%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQG--RVLNSQFTDEELRSQGRCPLTPEEVGLL  565
            DM A S C++  G+AEKL +   R+  W+G  R           R  G+CPLTP EVG++
Sbjct  351  DMVAFSCCEYDFGEAEKLEMDLARERGWKGKFRRRGRVIRPGANRIDGKCPLTPLEVGMM  410

Query  564  LAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAA  385
            L  +GF+N+T +Y+A+  +Y     ++ LR++FPL++ K +LAS EE    KG +S LAA
Sbjct  411  LRGMGFNNSTLVYVAAGNIYKADKYMAPLRQMFPLLQTKDTLASPEELAPFKGHSSRLAA  470

Query  384  VDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEF  214
            +DY V +HS++F+S   GN  + ++GHR Y    + +TI+P+ + L QL    N+ W  F
Sbjct  471  LDYTVCLHSEVFVSTQGGNFPHFLIGHRRYLYKGHAETIKPDKRKLVQLLDKPNIRWDYF  530

Query  213  QDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  112
            +  + +   H + +G + LRKPA SLYT+P PDCMC
Sbjct  531  KKQMQDMLRHNDAKG-VELRKPAASLYTFPMPDCMC  565



>ref|XP_010500036.1| PREDICTED: uncharacterized protein At1g04910-like [Camelina sativa]
Length=577

 Score =   166 bits (421),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 88/216 (41%), Positives = 133/216 (62%), Gaps = 8/216 (4%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQG--RVLNSQFTDEELRSQGRCPLTPEEVGLL  565
            DM A S C++  G+AEKL +   R+  W+G  R           R  G+CPLTP EVG++
Sbjct  351  DMVAFSCCEYDFGEAEKLEMDLARERGWKGKFRRRGRVIRPGANRIDGKCPLTPLEVGMM  410

Query  564  LAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAA  385
            L  +GF+N+T +Y+A+  +Y     ++ LR++FPL++ K +LAS EE    KG +S LAA
Sbjct  411  LRGMGFNNSTLVYVAAGNIYKADKYMAPLRQMFPLLQTKDTLASPEELAPFKGHSSRLAA  470

Query  384  VDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEF  214
            +DY V +HS++F+S   GN  + ++GHR Y    + +TI+P+ + L QL    N+ W  F
Sbjct  471  LDYTVCLHSEVFVSTQGGNFPHFLIGHRRYLYKGHAETIKPDKRKLVQLLDKPNIRWDYF  530

Query  213  QDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  112
            +  + +   H + +G + LRKPA SLYT+P PDCMC
Sbjct  531  KKQMQDMLRHNDAKG-VELRKPAASLYTFPMPDCMC  565



>ref|XP_004977274.1| PREDICTED: uncharacterized protein At1g04910-like [Setaria italica]
Length=511

 Score =   166 bits (419),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 90/220 (41%), Positives = 129/220 (59%), Gaps = 16/220 (7%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQG------RVLNSQFTDEELRSQGRCPLTPEE  577
            DM A S C + GG  EK  +   R+  W+G      RV+N     E  R  G+CPLTP E
Sbjct  291  DMVAFSCCTYDGGLKEKTEMDNARERSWRGKFRRHGRVINP----EANRRDGKCPLTPLE  346

Query  576  VGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKAS  397
            VG++L  +GFDN T LY+AS K+Y     ++ LR++FPL+  K SLA   E  + KG +S
Sbjct  347  VGMMLRGMGFDNTTSLYVASGKIYNSEKYMAPLRQMFPLLATKDSLAIPVELAQFKGHSS  406

Query  396  LLAAVDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLT  226
             LAA+DY V + S++F++   GN  + ++GHR Y    N KTI+P+ + L   F + N+ 
Sbjct  407  RLAALDYTVCVQSEVFVTTQGGNFPHFLMGHRRYLFRGNSKTIKPDKRKLVLSFDDPNIR  466

Query  225  WPEFQDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  112
            W  F+  + E   H++ +  I  RKP  S+YT+P PDCMC
Sbjct  467  WDRFKQNMQEILQHSDVRS-IAFRKPNDSIYTFPMPDCMC  505



>ref|XP_007222464.1| hypothetical protein PRUPE_ppa003505mg [Prunus persica]
 gb|EMJ23663.1| hypothetical protein PRUPE_ppa003505mg [Prunus persica]
Length=569

 Score =   166 bits (420),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 85/216 (39%), Positives = 134/216 (62%), Gaps = 8/216 (4%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQG--RVLNSQFTDEELRSQGRCPLTPEEVGLL  565
            DM A S C++ GG+ EK  +   R+  W+G  R           R  G+CPLTP EVG++
Sbjct  335  DMVAFSCCEYDGGEEEKREMDIARERGWRGKFRRRGRVIRPGANRVDGKCPLTPLEVGMM  394

Query  564  LAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAA  385
            L  +GFDN T +Y+A+ K+Y     ++ L+++FP +E K +LA++EE    +G  S LAA
Sbjct  395  LRGMGFDNTTSVYIAAGKIYKAEKYMAPLKQMFPRLEMKDTLATAEELAPFQGHLSRLAA  454

Query  384  VDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEF  214
            +DY V +HS++F++   GN  + ++GHR Y    + KTI P+ + L  LF N ++ W +F
Sbjct  455  LDYTVCLHSEVFVTTQGGNFPHFLMGHRRYLYGGHSKTINPDKRKLALLFDNPSIRWEDF  514

Query  213  QDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  112
            +  V +   H++++G + L+KP+ SLYT+P PDCMC
Sbjct  515  KRQVQDMLRHSDQKG-VELKKPSASLYTFPMPDCMC  549



>ref|XP_010093364.1| hypothetical protein L484_022926 [Morus notabilis]
 gb|EXB53958.1| hypothetical protein L484_022926 [Morus notabilis]
Length=562

 Score =   166 bits (420),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 86/216 (40%), Positives = 128/216 (59%), Gaps = 8/216 (4%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNS--QFTDEELRSQGRCPLTPEEVGLL  565
            DM A S C F GG+ EK  +   R+  W+G+            +R  G+CPLTP EVGL+
Sbjct  334  DMVAFSCCIFDGGEQEKEDMEAARERGWKGKFTKPGRVIRPGAIRINGKCPLTPLEVGLM  393

Query  564  LAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAA  385
            L  +GFD +T +YLAS K+Y     ++ L  +FP ++ K+ LAS EE    K  +S +AA
Sbjct  394  LRGMGFDKSTFIYLASGKIYNAEKTMAPLLEMFPNLQTKEMLASEEELAPFKNYSSRMAA  453

Query  384  VDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEF  214
            +DY V +HS++F++   GN  + ++GHR Y    + KTIRP+ + L  LF N N+ W  F
Sbjct  454  IDYTVCLHSEVFVTTQGGNFPHFLMGHRRYLYGGHSKTIRPDKRKLALLFDNPNIGWKSF  513

Query  213  QDAV--IEGHANRQGEIRLRKPAKSLYTYPAPDCMC  112
            +  +  I  H++ +G   L++P  S+YT+P PDCMC
Sbjct  514  KRQMLGIRSHSDLKG-FELKRPNDSIYTFPCPDCMC  548



>dbj|BAD81763.1| putative auxin-independent growth promoter [Oryza sativa Japonica 
Group]
 dbj|BAG87369.1| unnamed protein product [Oryza sativa Japonica Group]
Length=334

 Score =   162 bits (409),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 83/219 (38%), Positives = 131/219 (60%), Gaps = 10/219 (5%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNS--QFTDEELRSQGRCPLTPEEVGLL  565
            DM A S C F GG+ EK  L   R+  W+G+            +R  G+CPLTP EVGL+
Sbjct  106  DMVAFSCCVFDGGEKEKKELDAARERGWRGKFTRPGRVIRPGAIRMNGKCPLTPLEVGLM  165

Query  564  LAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAA  385
            L  +GF NNT +YLAS ++Y     ++ L  +FPL++ K++LAS EE    K  +S +AA
Sbjct  166  LRGMGFSNNTAIYLASGRIYKSEKNMAPLLEMFPLLQTKETLASDEELAPFKNFSSRMAA  225

Query  384  VDYYVGMHSDIFISASPGNMHNAMVGHRTY----HNLKTIRPNMQLLGQLFLNKNLTWPE  217
            +DY V +HS++F++   GN  + ++GHR Y    H+ KTI+P+ + L  LF +  + W  
Sbjct  226  IDYTVCVHSEVFVTTQGGNFPHFLLGHRRYIYGGHS-KTIKPDKRRLAILFDSPRIGWKS  284

Query  216  FQDAVI--EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
             +  ++    H++ +G I +++  +S+YT+P PDCMC +
Sbjct  285  LKRQLVNMRTHSDAKG-IEMKRANESIYTFPCPDCMCRS  322



>ref|XP_010931258.1| PREDICTED: uncharacterized protein At1g04910-like isoform X1 
[Elaeis guineensis]
Length=563

 Score =   166 bits (419),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 85/219 (39%), Positives = 131/219 (60%), Gaps = 10/219 (5%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNS--QFTDEELRSQGRCPLTPEEVGLL  565
            DM A S C F GG+ EK  +   R+  W+G+            +R  G+CPLTP EVGL+
Sbjct  335  DMVAFSCCIFDGGEEEKQDMNAARERGWRGKFTKPGRVIRPGVIRMSGKCPLTPLEVGLI  394

Query  564  LAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAA  385
            L  +GF NNT +YLAS K+Y     ++ L  +FPL++ K++LAS+EE    K  +S +AA
Sbjct  395  LRGMGFSNNTAIYLASGKIYKAEKAMAPLLEMFPLLQTKETLASAEELAPFKNYSSRMAA  454

Query  384  VDYYVGMHSDIFISASPGNMHNAMVGHRTY----HNLKTIRPNMQLLGQLFLNKNLTWPE  217
            VDY V +H ++F++   GN  + ++GHR Y    H+ KTI+P+ + L  L  N  ++W  
Sbjct  455  VDYSVCLHGEVFVTTQGGNFPHFLIGHRRYLYGGHS-KTIKPDKRKLALLLDNPKVSWKA  513

Query  216  FQDAVI--EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
             +  ++    H++ +G I +++P  S+YTYP PDCMC +
Sbjct  514  LKRQLLNMRAHSDAKG-IEIKRPNDSIYTYPCPDCMCRS  551



>ref|XP_002284457.1| PREDICTED: uncharacterized protein At1g04910 [Vitis vinifera]
 emb|CBI26895.3| unnamed protein product [Vitis vinifera]
Length=561

 Score =   166 bits (419),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 84/216 (39%), Positives = 129/216 (60%), Gaps = 8/216 (4%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNS--QFTDEELRSQGRCPLTPEEVGLL  565
            DM A S C F GG+ E   +   R+  W+G+            +R  G+CPLTP EVGL+
Sbjct  333  DMVAFSCCVFDGGEEEIQDMNAARERGWRGKFTKPGRVIRPGAIRINGKCPLTPLEVGLM  392

Query  564  LAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAA  385
            L  +GFD +T +YLAS K+Y     ++ L  +FPL++ K+ LAS+EE    K  +S +AA
Sbjct  393  LRGMGFDKSTSIYLASGKIYKSEKTMAPLFEMFPLLQTKEMLASAEELAPFKNYSSRMAA  452

Query  384  VDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEF  214
            +DY V +HS++F++   GN  + ++GHR Y    + KT+RP+ + L  LF N N+ W  F
Sbjct  453  IDYTVCLHSEVFVTTQGGNFPHFLMGHRRYLYGGHSKTVRPDKRKLALLFDNPNIGWKSF  512

Query  213  QDAVI--EGHANRQGEIRLRKPAKSLYTYPAPDCMC  112
            +  ++    H++ +G   L++P  S+YT+P PDCMC
Sbjct  513  KRQMLNMRAHSDAKG-FELKRPNDSIYTFPCPDCMC  547



>ref|NP_001066285.2| Os12g0174100 [Oryza sativa Japonica Group]
 gb|ABA96586.1| Growth regulator protein, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF29304.2| Os12g0174100 [Oryza sativa Japonica Group]
Length=491

 Score =   164 bits (416),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 89/220 (40%), Positives = 131/220 (60%), Gaps = 16/220 (7%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQG------RVLNSQFTDEELRSQGRCPLTPEE  577
            DM A S C + GG  EK  +   R+  W+G      RV+N     E  R  G+CPLTP E
Sbjct  271  DMVAFSCCTYDGGLKEKTEMENARERSWRGKFHRHGRVINP----EANRRDGKCPLTPLE  326

Query  576  VGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKAS  397
            VG++L  +GFDN T LY+AS K+Y     ++ LR++FPL+  K +LA  EE  E +G +S
Sbjct  327  VGMMLRGMGFDNTTSLYVASGKIYNAEKYMAPLRQMFPLLATKDTLALPEELAEFEGHSS  386

Query  396  LLAAVDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLT  226
             LAA+DY V + S++F++   GN  + ++GHR Y    N +TI+P+ + L   F + N+ 
Sbjct  387  RLAALDYSVCLPSEVFVTTQGGNFPHFLMGHRRYLFGGNARTIKPDKRKLVLSFDDPNIR  446

Query  225  WPEFQDAV--IEGHANRQGEIRLRKPAKSLYTYPAPDCMC  112
            W  F+  +  I  H++ +G   LRKP  S+YT+P P+CMC
Sbjct  447  WNRFKRHMQDILHHSDMRGTA-LRKPNDSIYTFPMPECMC  485



>ref|XP_004498294.1| PREDICTED: uncharacterized protein At1g04910-like isoform X2 
[Cicer arietinum]
Length=519

 Score =   165 bits (417),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 83/218 (38%), Positives = 129/218 (59%), Gaps = 8/218 (4%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRVLNS--QFTDEELRSQGRCPLTPEEVGLL  565
            DM A S C F GG  EK  +   R+  W+G+            +R  G+CPLTP EVGL+
Sbjct  291  DMVAFSCCVFDGGSQEKDDMVAARERGWKGKFTKPGRVIRPGAIRINGKCPLTPLEVGLM  350

Query  564  LAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAA  385
            L  +GF  NT +YLAS K+Y     ++ LR +FP +  K++LAS EE    K  +S +AA
Sbjct  351  LRGMGFTKNTSIYLASGKIYNAEKTMAPLREMFPNLHTKETLASEEELAPFKNYSSRMAA  410

Query  384  VDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEF  214
            +DY V +HS++F++   GN  + ++GHR Y    + KTI+P+ + L  LF + N+ W   
Sbjct  411  IDYTVCLHSEVFVTTQGGNFPHFLLGHRRYLYGGHSKTIKPDKRKLALLFDSTNIGWKSL  470

Query  213  QDAVI--EGHANRQGEIRLRKPAKSLYTYPAPDCMCNA  106
            +  ++    H++ +G + L++P  S+Y++P PDCMC+A
Sbjct  471  KRQLLSMRSHSDSKG-VELKRPNDSIYSFPCPDCMCHA  507



>ref|XP_009379852.1| PREDICTED: uncharacterized protein At1g04910-like [Musa acuminata 
subsp. malaccensis]
Length=536

 Score =   165 bits (418),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 87/215 (40%), Positives = 132/215 (61%), Gaps = 7/215 (3%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQGRV--LNSQFTDEELRSQGRCPLTPEEVGLL  565
            DM A S C + GG+ EK  + K R+  W+G+        + E  R  G+CPLTP EVG++
Sbjct  318  DMVAFSCCTYDGGQQEKTEMDKARERGWRGKFNKPGRVISPEANRRNGKCPLTPLEVGMM  377

Query  564  LAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAA  385
            +  +GF   T +Y+AS K+Y     ++ LR+LFPL+E K++LAS++E    KG +S LAA
Sbjct  378  IRGMGFGKTTTIYVASGKIYNAQKYMAPLRQLFPLLETKETLASADELAPFKGHSSRLAA  437

Query  384  VDYYVGMHSDIFISASPGNMHNAMVGHRTYHN--LKTIRPNMQLLGQLFLNKNLTWPEFQ  211
            +DY V  +S++F++   GN  + ++GHR Y N   KTI+P+ + L   F N N+ W  F+
Sbjct  438  LDYTVCANSEVFVTTQGGNFPHFLMGHRRYFNGHSKTIKPDKRKLVLSFDNPNIRWDRFK  497

Query  210  DAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  112
              + E   H++ +G + LRK   SLY++P PDCMC
Sbjct  498  HHMQEIFRHSDLKG-VGLRKRDASLYSFPMPDCMC  531



>gb|EEC68940.1| hypothetical protein OsI_37646 [Oryza sativa Indica Group]
Length=566

 Score =   166 bits (419),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 90/220 (41%), Positives = 131/220 (60%), Gaps = 16/220 (7%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQG------RVLNSQFTDEELRSQGRCPLTPEE  577
            DM A S C + GG  EK  +   R+  W+G      RV+N     E  R  G+CPLTP E
Sbjct  346  DMVAFSCCTYDGGLKEKTEMENARERSWRGKFHRHGRVINP----EANRRDGKCPLTPLE  401

Query  576  VGLLLAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKAS  397
            VG++L  +GFDN T LY+AS K+Y     ++ LR++FPL+  K +LA  EE  E +G +S
Sbjct  402  VGMMLRGMGFDNTTSLYVASGKIYNAEKYMAPLRQMFPLLATKDTLALPEELAEFEGHSS  461

Query  396  LLAAVDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLT  226
             LAA+DY V + S++F++   GN  + ++GHR Y    N KTI+P+ + L   F + N+ 
Sbjct  462  RLAALDYSVCLPSEVFVTTQGGNFPHFLMGHRRYLFGGNAKTIKPDKRKLVLSFDDPNIR  521

Query  225  WPEFQDAV--IEGHANRQGEIRLRKPAKSLYTYPAPDCMC  112
            W  F+  +  I  H++ +G   LRKP  S+YT+P P+CMC
Sbjct  522  WNRFKRHMQDILHHSDMRGTA-LRKPNDSIYTFPMPECMC  560



>ref|XP_002891187.1| hypothetical protein ARALYDRAFT_473680 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67446.1| hypothetical protein ARALYDRAFT_473680 [Arabidopsis lyrata subsp. 
lyrata]
Length=569

 Score =   165 bits (418),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 87/216 (40%), Positives = 133/216 (62%), Gaps = 8/216 (4%)
 Frame = -2

Query  738  DMXAHSACDFGGGKAEKLSLAKYRQIYWQG--RVLNSQFTDEELRSQGRCPLTPEEVGLL  565
            DM A S C++  GKAEKL +   R+  W+G  R           R  G+CPLTP EVG++
Sbjct  343  DMVAFSCCEYDFGKAEKLEMDMARERGWKGKFRRRGRVIRPGANRIDGKCPLTPLEVGMM  402

Query  564  LAALGFDNNTRLYLASHKVYGGAARISALRRLFPLMENKKSLASSEERGEIKGKASLLAA  385
            L  +GF+N+T +Y+A+  +Y     ++ LR++FPL++ K +LA+ EE    KG +S LAA
Sbjct  403  LRGMGFNNSTLVYVAAGNIYKADKYMAPLRQMFPLLQTKDTLATPEELAPFKGHSSRLAA  462

Query  384  VDYYVGMHSDIFISASPGNMHNAMVGHRTY---HNLKTIRPNMQLLGQLFLNKNLTWPEF  214
            +DY V +HS++F+S   GN  + ++GHR Y    + +TI+P+ + L QL    ++ W  F
Sbjct  463  LDYTVCLHSEVFVSTQGGNFPHFLIGHRRYLYKGHAETIKPDKRKLVQLLDKPSIRWDYF  522

Query  213  QDAVIE--GHANRQGEIRLRKPAKSLYTYPAPDCMC  112
            +  + +   H + +G + LRKPA SLYT+P PDCMC
Sbjct  523  KKQMQDMLRHNDAKG-VELRKPAASLYTFPMPDCMC  557



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1354032766515