BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF009E15

Length=694
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009792514.1|  PREDICTED: aspartic proteinase-like                318   3e-104   Nicotiana sylvestris
ref|XP_009629448.1|  PREDICTED: aspartic proteinase-like                321   2e-103   Nicotiana tomentosiformis
ref|XP_004232695.1|  PREDICTED: aspartic proteinase                     320   3e-103   Solanum lycopersicum
ref|XP_009797823.1|  PREDICTED: aspartic proteinase                     319   1e-102   Nicotiana sylvestris
ref|XP_006348142.1|  PREDICTED: aspartic proteinase-like                318   2e-102   Solanum tuberosum [potatoes]
ref|XP_009587050.1|  PREDICTED: aspartic proteinase-like                318   2e-102   Nicotiana tomentosiformis
ref|XP_004231616.1|  PREDICTED: aspartic proteinase                     317   4e-102   Solanum lycopersicum
emb|CDP04424.1|  unnamed protein product                                314   9e-101   Coffea canephora [robusta coffee]
ref|XP_006350474.1|  PREDICTED: aspartic proteinase-like                313   2e-100   Solanum tuberosum [potatoes]
ref|XP_010099183.1|  Aspartic proteinase                                311   7e-100   Morus notabilis
ref|XP_007026133.1|  Saposin-like aspartyl protease family protein      311   7e-100   
gb|EYU27762.1|  hypothetical protein MIMGU_mgv1a004712mg                310   2e-99    Erythranthe guttata [common monkey flower]
emb|CAC86004.1|  aspartic proteinase                                    310   3e-99    Theobroma cacao [chocolate]
ref|XP_004145121.1|  PREDICTED: aspartic proteinase-like                308   1e-98    
ref|XP_010252464.1|  PREDICTED: aspartic proteinase A1-like             308   1e-98    Nelumbo nucifera [Indian lotus]
ref|XP_011096039.1|  PREDICTED: aspartic proteinase-like                308   2e-98    
emb|CBI23210.3|  unnamed protein product                                304   4e-98    Vitis vinifera
sp|O04057.1|ASPR_CUCPE  RecName: Full=Aspartic proteinase; Flags:...    307   4e-98    Cucurbita pepo
ref|XP_008440898.1|  PREDICTED: aspartic proteinase                     307   5e-98    Cucumis melo [Oriental melon]
ref|XP_002518445.1|  Aspartic proteinase precursor, putative            306   9e-98    Ricinus communis
ref|XP_003632941.1|  PREDICTED: aspartic proteinase A1                  306   1e-97    Vitis vinifera
gb|KJB67248.1|  hypothetical protein B456_010G182400                    302   3e-96    Gossypium raimondii
gb|EYU33885.1|  hypothetical protein MIMGU_mgv1a004716mg                302   3e-96    Erythranthe guttata [common monkey flower]
gb|KDP20718.1|  hypothetical protein JCGZ_21189                         302   3e-96    Jatropha curcas
gb|KHG11144.1|  Aspartic proteinase                                     301   5e-96    Gossypium arboreum [tree cotton]
gb|KJB67244.1|  hypothetical protein B456_010G182400                    301   5e-96    Gossypium raimondii
ref|XP_008224698.1|  PREDICTED: aspartic proteinase-like                301   6e-96    Prunus mume [ume]
ref|XP_010244477.1|  PREDICTED: aspartic proteinase A1-like isofo...    301   1e-95    Nelumbo nucifera [Indian lotus]
ref|XP_010244475.1|  PREDICTED: aspartic proteinase A1-like isofo...    301   1e-95    Nelumbo nucifera [Indian lotus]
emb|CAA54478.1|  aspartic protease                                      293   2e-95    Brassica oleracea
ref|XP_007211538.1|  hypothetical protein PRUPE_ppa003924mg             300   3e-95    Prunus persica
dbj|BAD93734.1|  putative aspartic proteinase                           289   3e-95    Arabidopsis thaliana [mouse-ear cress]
gb|KGN64503.1|  Aspartic proteinase                                     298   8e-95    Cucumis sativus [cucumbers]
ref|XP_008349314.1|  PREDICTED: aspartic proteinase-like                298   8e-95    
ref|XP_002529926.1|  Aspartic proteinase precursor, putative            298   1e-94    Ricinus communis
ref|XP_011086197.1|  PREDICTED: aspartic proteinase A1-like isofo...    298   1e-94    Sesamum indicum [beniseed]
ref|XP_007020768.1|  Aspartic proteinase A1                             298   1e-94    
ref|XP_011086196.1|  PREDICTED: aspartic proteinase A1-like isofo...    299   2e-94    Sesamum indicum [beniseed]
ref|XP_009357472.1|  PREDICTED: aspartic proteinase-like                297   2e-94    Pyrus x bretschneideri [bai li]
ref|XP_010035554.1|  PREDICTED: aspartic proteinase A1-like             298   2e-94    Eucalyptus grandis [rose gum]
emb|CAC86003.1|  aspartic proteinase                                    297   2e-94    Theobroma cacao [chocolate]
ref|XP_002279049.1|  PREDICTED: aspartic proteinase A1                  297   4e-94    Vitis vinifera
ref|XP_009415269.1|  PREDICTED: aspartic proteinase oryzasin-1-like     296   4e-94    Musa acuminata subsp. malaccensis [pisang utan]
gb|ACX55830.1|  aspartic proteinase 2                                   296   4e-94    Castanea mollissima
ref|XP_010096873.1|  Aspartic proteinase                                296   5e-94    Morus notabilis
gb|ACX55829.1|  aspartic proteinase 1                                   296   5e-94    Castanea mollissima
ref|XP_008385865.1|  PREDICTED: aspartic proteinase A1-like             286   8e-94    
ref|XP_011046729.1|  PREDICTED: aspartic proteinase A1-like             296   8e-94    Populus euphratica
gb|KCW66977.1|  hypothetical protein EUGRSUZ_F00741                     292   9e-94    Eucalyptus grandis [rose gum]
gb|KCW77002.1|  hypothetical protein EUGRSUZ_D01351                     296   1e-93    Eucalyptus grandis [rose gum]
ref|XP_008348384.1|  PREDICTED: LOW QUALITY PROTEIN: aspartic pro...    294   1e-93    
ref|XP_007153977.1|  hypothetical protein PHAVU_003G0808001g            291   1e-93    Phaseolus vulgaris [French bean]
ref|XP_010052871.1|  PREDICTED: aspartic proteinase                     296   1e-93    Eucalyptus grandis [rose gum]
gb|KHN33009.1|  Aspartic proteinase                                     295   1e-93    Glycine soja [wild soybean]
dbj|BAB20970.1|  aspartic proteinase 2                                  295   1e-93    Nepenthes alata
ref|XP_003546159.1|  PREDICTED: aspartic proteinase-like                295   2e-93    Glycine max [soybeans]
gb|KJB69259.1|  hypothetical protein B456_011G012800                    295   2e-93    Gossypium raimondii
gb|KHG11143.1|  Aspartic proteinase                                     295   2e-93    Gossypium arboreum [tree cotton]
gb|ABO93618.1|  aspartic proteinase                                     284   2e-93    Vitis vinifera
ref|XP_003534602.1|  PREDICTED: aspartic proteinase                     295   2e-93    Glycine max [soybeans]
gb|KJB69260.1|  hypothetical protein B456_011G012800                    295   3e-93    Gossypium raimondii
ref|XP_009110686.1|  PREDICTED: aspartic proteinase A1-like             294   5e-93    Brassica rapa
ref|XP_011461056.1|  PREDICTED: aspartic proteinase A1-like             294   6e-93    Fragaria vesca subsp. vesca
gb|KDO62068.1|  hypothetical protein CISIN_1g010230mg                   293   6e-93    Citrus sinensis [apfelsine]
ref|XP_006452415.1|  hypothetical protein CICLE_v10008027mg             293   6e-93    Citrus clementina [clementine]
ref|XP_006475035.1|  PREDICTED: aspartic proteinase-like                293   8e-93    Citrus sinensis [apfelsine]
dbj|BAC16370.1|  aspartic proteinase 4                                  281   1e-92    Glycine max [soybeans]
emb|CDY21021.1|  BnaA08g25040D                                          293   1e-92    Brassica napus [oilseed rape]
ref|XP_009361022.1|  PREDICTED: aspartic proteinase A1-like             293   1e-92    Pyrus x bretschneideri [bai li]
dbj|BAH20208.1|  AT1G11910                                              289   2e-92    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010546667.1|  PREDICTED: aspartic proteinase A1-like             292   2e-92    Tarenaya hassleriana [spider flower]
emb|CDY31221.1|  BnaC08g15160D                                          294   3e-92    Brassica napus [oilseed rape]
ref|XP_007049085.1|  Aspartic protease isoform 2                        291   4e-92    
gb|AAB03108.1|  aspartic protease                                       291   5e-92    Brassica napus [oilseed rape]
ref|XP_010060310.1|  PREDICTED: aspartic proteinase A1-like             291   6e-92    Eucalyptus grandis [rose gum]
gb|AFW81161.1|  hypothetical protein ZEAMMB73_941917                    282   7e-92    
ref|XP_002298827.2|  aspartic protease family protein                   291   9e-92    Populus trichocarpa [western balsam poplar]
ref|XP_007049084.1|  Aspartic proteinase A1 isoform 1                   291   1e-91    
ref|XP_008380299.1|  PREDICTED: aspartic proteinase A1-like             290   1e-91    
ref|XP_006449766.1|  hypothetical protein CICLE_v10014941mg             290   1e-91    Citrus clementina [clementine]
ref|XP_003567869.1|  PREDICTED: phytepsin                               290   2e-91    Brachypodium distachyon [annual false brome]
gb|KDP39159.1|  hypothetical protein JCGZ_00916                         290   2e-91    Jatropha curcas
dbj|BAB20969.1|  aspartic proteinase 1                                  290   2e-91    Nepenthes alata
ref|NP_172655.1|  aspartic proteinase A1                                289   2e-91    Arabidopsis thaliana [mouse-ear cress]
gb|AAC49730.1|  aspartic proteinase                                     289   2e-91    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002892661.1|  aspartyl protease family protein                   289   2e-91    
pdb|1QDM|A  Chain A, Crystal Structure Of Prophytepsin, A Zymogen...    288   4e-91    Hordeum vulgare [barley]
ref|XP_008797519.1|  PREDICTED: aspartic proteinase oryzasin-1-like     289   4e-91    Phoenix dactylifera
ref|XP_010476135.1|  PREDICTED: aspartic proteinase A1-like             289   4e-91    Camelina sativa [gold-of-pleasure]
ref|XP_010458606.1|  PREDICTED: aspartic proteinase A1                  289   4e-91    Camelina sativa [gold-of-pleasure]
sp|P42210.1|ASPR_HORVU  RecName: Full=Phytepsin; AltName: Full=As...    288   6e-91    Hordeum vulgare [barley]
gb|AGP76185.1|  aspartic proteinase                                     288   6e-91    Brassica rapa subsp. chinensis [bok-choy]
ref|XP_006467405.1|  PREDICTED: aspartic proteinase-like isoform X2     288   6e-91    Citrus sinensis [apfelsine]
gb|KEH36904.1|  fungal proteinase A, aspartic proteinase superfam...    288   6e-91    Medicago truncatula
ref|XP_006303952.1|  hypothetical protein CARUB_v10008798mg             289   7e-91    
ref|XP_004486175.1|  PREDICTED: aspartic proteinase-like isoform X1     288   8e-91    Cicer arietinum [garbanzo]
ref|XP_006417290.1|  hypothetical protein EUTSA_v10007418mg             288   9e-91    Eutrema salsugineum [saltwater cress]
ref|XP_010493478.1|  PREDICTED: aspartic proteinase A1-like             288   9e-91    Camelina sativa [gold-of-pleasure]
ref|XP_010926197.1|  PREDICTED: aspartic proteinase oryzasin-1-li...    288   9e-91    Elaeis guineensis
ref|XP_008800700.1|  PREDICTED: aspartic proteinase oryzasin-1-li...    288   1e-90    Phoenix dactylifera
ref|XP_009118162.1|  PREDICTED: aspartic proteinase A1                  288   1e-90    Brassica rapa
ref|XP_008664893.1|  PREDICTED: aspartic proteinase oryzasin-1-like     281   1e-90    Zea mays [maize]
gb|KJB67247.1|  hypothetical protein B456_010G182400                    288   1e-90    Gossypium raimondii
gb|AFW85769.1|  hypothetical protein ZEAMMB73_486102                    279   2e-90    
emb|CDY34819.1|  BnaA09g47450D                                          290   2e-90    Brassica napus [oilseed rape]
gb|ACN24614.1|  aspartic acid protease                                  287   2e-90    Phaseolus vulgaris [French bean]
dbj|BAE20413.1|  aspartic proteinase                                    287   2e-90    Triticum aestivum [Canadian hard winter wheat]
ref|XP_008800699.1|  PREDICTED: aspartic proteinase oryzasin-1-li...    288   2e-90    Phoenix dactylifera
ref|XP_006467404.1|  PREDICTED: aspartic proteinase-like isoform X1     289   2e-90    
emb|CAM12780.1|  aspartic proteinase                                    286   3e-90    Fagopyrum esculentum
ref|XP_007211824.1|  hypothetical protein PRUPE_ppa004375mg             287   3e-90    Prunus persica
gb|KJB13720.1|  hypothetical protein B456_002G091100                    282   3e-90    Gossypium raimondii
ref|XP_008226860.1|  PREDICTED: aspartic proteinase A1-like             286   3e-90    Prunus mume [ume]
ref|XP_006654801.1|  PREDICTED: aspartic proteinase oryzasin-1-like     286   3e-90    
gb|AAV84085.2|  aspartic proteinase 9                                   286   4e-90    Fagopyrum esculentum
ref|XP_008366439.1|  PREDICTED: aspartic proteinase A1-like isofo...    286   4e-90    
ref|XP_008366438.1|  PREDICTED: aspartic proteinase A1-like isofo...    286   5e-90    
ref|XP_008357943.1|  PREDICTED: aspartic proteinase A1-like             283   6e-90    
gb|AFW79207.1|  hypothetical protein ZEAMMB73_486493                    282   7e-90    
ref|XP_007147707.1|  hypothetical protein PHAVU_006G147900g             287   7e-90    Phaseolus vulgaris [French bean]
gb|KHN35722.1|  Aspartic proteinase                                     286   9e-90    Glycine soja [wild soybean]
ref|XP_008660718.1|  PREDICTED: aspartic proteinase oryzasin-1-like     278   9e-90    
ref|XP_009358756.1|  PREDICTED: aspartic proteinase-like                285   1e-89    Pyrus x bretschneideri [bai li]
gb|KHG05834.1|  Asparticase                                             285   2e-89    Gossypium arboreum [tree cotton]
ref|NP_001056348.1|  Os05g0567100                                       285   2e-89    
emb|CAA57510.1|  cyprosin                                               285   2e-89    Cynara cardunculus [cardoon]
ref|XP_006447588.1|  hypothetical protein CICLE_v10017754mg             283   2e-89    
ref|XP_006383885.1|  hypothetical protein POPTR_0004s00900g             285   3e-89    
gb|AAB03843.2|  aspartic proteinase                                     284   3e-89    Vigna unguiculata
ref|XP_006600236.1|  PREDICTED: aspartic proteinase 1 isoform X1        284   4e-89    
ref|NP_001237064.1|  aspartic proteinase 1 precursor                    284   4e-89    
gb|KHN03495.1|  Aspartic proteinase                                     284   4e-89    Glycine soja [wild soybean]
ref|XP_010686810.1|  PREDICTED: aspartic proteinase A1-like             284   4e-89    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003529645.1|  PREDICTED: aspartic proteinase-like isoform X1     284   4e-89    Glycine max [soybeans]
gb|KDO54710.1|  hypothetical protein CISIN_1g009634mg                   283   4e-89    Citrus sinensis [apfelsine]
ref|XP_008371074.1|  PREDICTED: aspartic proteinase                     283   6e-89    
ref|XP_004507671.1|  PREDICTED: aspartic proteinase-like isoform X1     283   6e-89    Cicer arietinum [garbanzo]
gb|KJB13722.1|  hypothetical protein B456_002G091100                    283   6e-89    Gossypium raimondii
ref|XP_006469663.1|  PREDICTED: aspartic proteinase-like                283   6e-89    Citrus sinensis [apfelsine]
gb|AFK46704.1|  unknown                                                 283   7e-89    Medicago truncatula
gb|KJB13718.1|  hypothetical protein B456_002G091100                    283   8e-89    Gossypium raimondii
gb|KDO54711.1|  hypothetical protein CISIN_1g009634mg                   283   8e-89    Citrus sinensis [apfelsine]
gb|AAK55849.1|AF266465_1  aspartic protease                             271   1e-88    Manihot esculenta [manioc]
ref|XP_010924299.1|  PREDICTED: LOW QUALITY PROTEIN: aspartic pro...    283   1e-88    
gb|KJB22150.1|  hypothetical protein B456_004G031800                    283   1e-88    Gossypium raimondii
ref|XP_008647844.1|  PREDICTED: aspartic proteinase oryzasin-1 is...    282   1e-88    Zea mays [maize]
dbj|BAA06876.1|  aspartic protease                                      282   2e-88    Oryza sativa [red rice]
ref|XP_006389579.1|  aspartic endopeptidase family protein              282   2e-88    Populus trichocarpa [western balsam poplar]
emb|CAA70340.1|  aspartic proteinase                                    282   2e-88    Centaurea calcitrapa
ref|XP_010046321.1|  PREDICTED: aspartic proteinase A1-like             282   2e-88    Eucalyptus grandis [rose gum]
ref|XP_011008023.1|  PREDICTED: aspartic proteinase-like                281   3e-88    Populus euphratica
ref|XP_004961190.1|  PREDICTED: aspartic proteinase oryzasin-1-like     281   3e-88    Setaria italica
ref|XP_008229973.1|  PREDICTED: aspartic proteinase A1-like             281   5e-88    Prunus mume [ume]
ref|XP_010473444.1|  PREDICTED: LOW QUALITY PROTEIN: aspartic pro...    280   7e-88    
ref|NP_001148782.1|  aspartic proteinase oryzasin-1 precursor           280   8e-88    Zea mays [maize]
ref|XP_011046961.1|  PREDICTED: aspartic proteinase-like                280   9e-88    Populus euphratica
ref|XP_009410967.1|  PREDICTED: aspartic proteinase oryzasin-1-like     280   9e-88    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010430270.1|  PREDICTED: aspartic proteinase A2-like             280   1e-87    Camelina sativa [gold-of-pleasure]
tpg|DAA63137.1|  TPA: hypothetical protein ZEAMMB73_794362              283   1e-87    
ref|XP_008650245.1|  PREDICTED: aspartic proteinase oryzasin-1-like     273   1e-87    
gb|KHG04193.1|  Asparticase                                             280   2e-87    Gossypium arboreum [tree cotton]
ref|XP_010553449.1|  PREDICTED: aspartic proteinase A1                  280   2e-87    Tarenaya hassleriana [spider flower]
ref|XP_009395027.1|  PREDICTED: aspartic proteinase oryzasin-1-like     280   2e-87    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009347130.1|  PREDICTED: aspartic proteinase A1-like             279   2e-87    Pyrus x bretschneideri [bai li]
ref|XP_006391910.1|  hypothetical protein EUTSA_v10023414mg             279   3e-87    Eutrema salsugineum [saltwater cress]
gb|AGE15494.1|  preprosilpepsin 1                                       278   4e-87    Silybum marianum [holy thistle]
ref|NP_176419.2|  aspartic proteinase A2                                279   4e-87    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001150729.1|  aspartic proteinase oryzasin-1 precursor           279   4e-87    Zea mays [maize]
ref|XP_002886481.1|  aspartyl protease family protein                   278   5e-87    
ref|XP_009353298.1|  PREDICTED: aspartic proteinase A1-like             278   7e-87    Pyrus x bretschneideri [bai li]
ref|XP_006301275.1|  hypothetical protein CARUB_v10021675mg             278   1e-86    Capsella rubella
gb|AFB73927.2|  preprocirsin                                            277   1e-86    Cirsium vulgare
ref|XP_007215237.1|  hypothetical protein PRUPE_ppa004349mg             277   2e-86    Prunus persica
ref|XP_010418214.1|  PREDICTED: aspartic proteinase A2 isoform X2       276   2e-86    Camelina sativa [gold-of-pleasure]
dbj|BAB20971.1|  aspartic proteinase 3                                  276   4e-86    Nepenthes alata
ref|XP_006838131.1|  hypothetical protein AMTR_s00106p00075970          276   4e-86    Amborella trichopoda
emb|CAA48939.1|  cyprosin                                               275   4e-86    Cynara cardunculus [cardoon]
ref|XP_010418210.1|  PREDICTED: aspartic proteinase A2 isoform X1       275   7e-86    Camelina sativa [gold-of-pleasure]
gb|KDO62069.1|  hypothetical protein CISIN_1g010230mg                   275   7e-86    Citrus sinensis [apfelsine]
ref|XP_010667516.1|  PREDICTED: aspartic proteinase A1-like             275   1e-85    Beta vulgaris subsp. vulgaris [field beet]
gb|KJB13723.1|  hypothetical protein B456_002G091100                    275   1e-85    Gossypium raimondii
emb|CDY24888.1|  BnaA03g59920D                                          274   2e-85    Brassica napus [oilseed rape]
gb|AFW74920.1|  hypothetical protein ZEAMMB73_522985                    273   2e-85    
ref|XP_003610462.1|  Aspartic proteinase                                274   2e-85    Medicago truncatula
gb|AFH58568.1|  aspartic acid protease                                  274   3e-85    Ananas comosus
dbj|BAA96446.1|  aspartic endopeptidase                                 266   3e-85    Pyrus pyrifolia [sha li]
ref|XP_011100273.1|  PREDICTED: cyprosin-like                           273   8e-85    Sesamum indicum [beniseed]
ref|XP_008342027.1|  PREDICTED: aspartic proteinase A1-like             273   9e-85    Malus domestica [apple tree]
emb|CDY08632.1|  BnaC04g19410D                                          273   9e-85    Brassica napus [oilseed rape]
ref|XP_009394234.1|  PREDICTED: aspartic proteinase oryzasin-1-like     272   1e-84    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009419881.1|  PREDICTED: aspartic proteinase oryzasin-1-like     272   1e-84    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009123370.1|  PREDICTED: aspartic proteinase A2 isoform X2       271   2e-84    Brassica rapa
ref|XP_009123365.1|  PREDICTED: aspartic proteinase A2 isoform X1       271   3e-84    Brassica rapa
ref|XP_009600571.1|  PREDICTED: cyprosin-like                           270   1e-83    Nicotiana tomentosiformis
gb|ABG37021.1|  aspartic protease                                       270   1e-83    Nicotiana tabacum [American tobacco]
ref|XP_006840365.1|  hypothetical protein AMTR_s00045p00122510          269   2e-83    Amborella trichopoda
ref|XP_004243484.1|  PREDICTED: cyprosin-like                           269   2e-83    Solanum lycopersicum
dbj|BAA76870.1|  aspartic proteinase                                    268   3e-83    Helianthus annuus
gb|EYU34027.1|  hypothetical protein MIMGU_mgv1a024943mg                265   3e-83    Erythranthe guttata [common monkey flower]
ref|XP_004293311.1|  PREDICTED: aspartic proteinase A1                  268   3e-83    Fragaria vesca subsp. vesca
ref|XP_004287958.1|  PREDICTED: aspartic proteinase A1-like             268   4e-83    Fragaria vesca subsp. vesca
gb|AHB32105.1|  aspartic proteinase                                     267   8e-83    Camellia sinensis [black tea]
ref|XP_006644474.1|  PREDICTED: aspartic proteinase oryzasin-1-like     268   8e-83    
ref|XP_004969436.1|  PREDICTED: aspartic proteinase oryzasin-1-like     266   4e-82    Setaria italica
gb|AFX73039.1|  preprogaline A                                          265   7e-82    Galium verum
emb|CDP10762.1|  unnamed protein product                                264   1e-81    Coffea canephora [robusta coffee]
ref|XP_007020767.1|  Aspartic proteinase A1                             263   2e-81    
ref|XP_006364164.1|  PREDICTED: aspartic proteinase-like                263   6e-81    Solanum tuberosum [potatoes]
ref|XP_004151126.1|  PREDICTED: aspartic proteinase-like                262   8e-81    Cucumis sativus [cucumbers]
ref|XP_008784384.1|  PREDICTED: aspartic proteinase oryzasin-1-like     262   9e-81    Phoenix dactylifera
ref|XP_004161880.1|  PREDICTED: aspartic proteinase-like                262   9e-81    
ref|XP_011006459.1|  PREDICTED: cyprosin-like isoform X2                262   1e-80    Populus euphratica
gb|KDP24853.1|  hypothetical protein JCGZ_24447                         262   1e-80    Jatropha curcas
ref|NP_001043786.1|  Os01g0663400                                       262   2e-80    
ref|XP_011006458.1|  PREDICTED: cyprosin-like isoform X1                262   2e-80    Populus euphratica
ref|XP_002302872.2|  aspartic endopeptidase family protein              259   1e-79    
ref|XP_009114573.1|  PREDICTED: aspartic proteinase A3 isoform X2       256   1e-78    Brassica rapa
emb|CDY16668.1|  BnaA09g20460D                                          256   1e-78    Brassica napus [oilseed rape]
ref|XP_009114571.1|  PREDICTED: aspartic proteinase A3 isoform X1       256   1e-78    Brassica rapa
emb|CDX94554.1|  BnaC09g22820D                                          256   2e-78    
sp|P40782.2|CYPR1_CYNCA  RecName: Full=Cyprosin; Flags: Precursor       255   2e-78    Cynara cardunculus [cardoon]
gb|KGN56078.1|  hypothetical protein Csa_3G066750                       256   3e-78    Cucumis sativus [cucumbers]
gb|KDO45252.1|  hypothetical protein CISIN_1g010486mg                   248   6e-78    Citrus sinensis [apfelsine]
gb|EPS60672.1|  aspartic proteinase 1                                   242   1e-77    Genlisea aurea
gb|AFX73042.1|  preprofigain C                                          250   2e-77    Ficus carica
gb|EMS54428.1|  Aspartic proteinase oryzasin-1                          253   2e-77    Triticum urartu
ref|XP_010233477.1|  PREDICTED: aspartic proteinase oryzasin-1-like     254   2e-77    
ref|XP_010926196.1|  PREDICTED: aspartic proteinase oryzasin-1-like     253   2e-77    
ref|XP_006428329.1|  hypothetical protein CICLE_v10011525mg             253   3e-77    Citrus clementina [clementine]
gb|AGE15495.1|  preprosilpepsin 2                                       253   3e-77    Silybum marianum [holy thistle]
gb|ABK26865.1|  unknown                                                 245   5e-77    Picea sitchensis
gb|KDO45250.1|  hypothetical protein CISIN_1g010486mg                   249   6e-77    Citrus sinensis [apfelsine]
gb|KDO45249.1|  hypothetical protein CISIN_1g010486mg                   249   8e-77    Citrus sinensis [apfelsine]
ref|XP_006396693.1|  hypothetical protein EUTSA_v10028587mg             251   1e-76    Eutrema salsugineum [saltwater cress]
ref|XP_006396692.1|  hypothetical protein EUTSA_v10028587mg             251   1e-76    Eutrema salsugineum [saltwater cress]
ref|XP_010455726.1|  PREDICTED: aspartic proteinase A3 isoform X1       250   3e-76    Camelina sativa [gold-of-pleasure]
ref|XP_010916100.1|  PREDICTED: aspartic proteinase oryzasin-1-like     250   3e-76    Elaeis guineensis
ref|XP_010496363.1|  PREDICTED: aspartic proteinase A3-like             250   4e-76    
ref|XP_002872693.1|  aspartyl protease family protein                   249   5e-76    
dbj|BAD94980.1|  putative aspartic proteinase                           238   5e-76    Arabidopsis thaliana [mouse-ear cress]
gb|EMT17680.1|  Phytepsin                                               248   6e-76    
ref|XP_010432791.1|  PREDICTED: aspartic proteinase A3-like isofo...    249   9e-76    Camelina sativa [gold-of-pleasure]
gb|KDO45247.1|  hypothetical protein CISIN_1g010486mg                   248   1e-75    Citrus sinensis [apfelsine]
ref|NP_192355.1|  aspartic proteinase A3                                248   2e-75    Arabidopsis thaliana [mouse-ear cress]
gb|KDO45246.1|  hypothetical protein CISIN_1g010486mg                   248   2e-75    Citrus sinensis [apfelsine]
gb|AFX73041.1|  preprofigain B                                          244   4e-75    Ficus carica
ref|XP_009390744.1|  PREDICTED: aspartic proteinase oryzasin-1-like     247   9e-75    
ref|XP_009780973.1|  PREDICTED: aspartic proteinase A1-like             233   4e-74    Nicotiana sylvestris
gb|KDO62072.1|  hypothetical protein CISIN_1g010230mg                   244   6e-74    Citrus sinensis [apfelsine]
ref|XP_009421489.1|  PREDICTED: aspartic proteinase oryzasin-1-like     244   7e-74    Musa acuminata subsp. malaccensis [pisang utan]
gb|ABR16259.1|  unknown                                                 244   1e-73    Picea sitchensis
ref|XP_008440022.1|  PREDICTED: aspartic proteinase-like isoform X2     244   1e-73    Cucumis melo [Oriental melon]
ref|XP_008800325.1|  PREDICTED: aspartic proteinase-like isoform X1     243   3e-73    Phoenix dactylifera
ref|XP_008800328.1|  PREDICTED: aspartic proteinase-like isoform X2     243   3e-73    
ref|XP_010232062.1|  PREDICTED: aspartic proteinase oryzasin-1-li...    244   3e-73    
ref|XP_008440021.1|  PREDICTED: aspartic proteinase-like isoform X1     243   4e-73    Cucumis melo [Oriental melon]
ref|XP_010455729.1|  PREDICTED: aspartic proteinase A3 isoform X2       242   6e-73    Camelina sativa [gold-of-pleasure]
ref|XP_011039044.1|  PREDICTED: aspartic proteinase-like                241   8e-73    Populus euphratica
gb|AAV84086.1|  aspartic proteinase 12                                  238   1e-72    Fagopyrum esculentum
ref|XP_010432806.1|  PREDICTED: aspartic proteinase A3-like isofo...    240   2e-72    Camelina sativa [gold-of-pleasure]
ref|XP_006286432.1|  hypothetical protein CARUB_v10003637mg             240   2e-72    
gb|EEC78484.1|  hypothetical protein OsI_18377                          237   2e-72    Oryza sativa Indica Group [Indian rice]
ref|XP_002307027.2|  hypothetical protein POPTR_0005s00460g             238   2e-72    
gb|AFW57535.1|  hypothetical protein ZEAMMB73_218341                    234   3e-72    
ref|NP_001190671.1|  aspartic proteinase A3                             239   3e-72    Arabidopsis thaliana [mouse-ear cress]
emb|CDX90864.1|  BnaA03g25440D                                          239   4e-72    
ref|XP_009134301.1|  PREDICTED: aspartic proteinase A3-like             239   5e-72    Brassica rapa
ref|XP_010232061.1|  PREDICTED: aspartic proteinase oryzasin-1-li...    240   7e-72    Brachypodium distachyon [annual false brome]
ref|XP_004134774.1|  PREDICTED: aspartic proteinase-like                239   7e-72    Cucumis sativus [cucumbers]
ref|XP_009416572.1|  PREDICTED: aspartic proteinase-like isoform X2     239   7e-72    
ref|XP_009416564.1|  PREDICTED: aspartic proteinase-like isoform X1     239   1e-71    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001054586.1|  Os05g0137400                                       238   2e-71    
dbj|BAA02242.1|  aspartic proteinase                                    238   2e-71    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010529449.1|  PREDICTED: aspartic proteinase A3                  237   3e-71    Tarenaya hassleriana [spider flower]
ref|XP_007031269.1|  Aspartic proteinase                                236   5e-71    
ref|XP_008370344.1|  PREDICTED: aspartic proteinase-like                236   9e-71    
gb|AFX67029.1|  aspartic protease                                       232   1e-70    Solanum tuberosum [potatoes]
ref|NP_001234702.1|  aspartic protease precursor                        236   1e-70    Solanum lycopersicum
gb|KDO78303.1|  hypothetical protein CISIN_1g010233mg                   235   1e-70    Citrus sinensis [apfelsine]
emb|CDP15176.1|  unnamed protein product                                234   3e-70    
ref|XP_003568979.1|  PREDICTED: aspartic proteinase                     234   4e-70    
gb|AFX73040.1|  preprofigain A                                          234   5e-70    
gb|KHG16917.1|  Asparticase                                             235   5e-70    
ref|XP_010042427.1|  PREDICTED: aspartic proteinase-like isoform X2     234   5e-70    
ref|XP_009366025.1|  PREDICTED: aspartic proteinase-like isoform X3     234   5e-70    
ref|XP_011023864.1|  PREDICTED: aspartic proteinase-like                234   7e-70    
ref|NP_001146573.1|  hypothetical protein                               233   7e-70    
ref|XP_009366024.1|  PREDICTED: aspartic proteinase-like isoform X2     234   8e-70    
ref|XP_009366023.1|  PREDICTED: aspartic proteinase-like isoform X1     234   8e-70    
ref|XP_003567538.1|  PREDICTED: aspartic proteinase-like                233   1e-69    
ref|XP_008661830.1|  PREDICTED: hypothetical protein isoform X1         233   1e-69    
emb|CBI39668.3|  unnamed protein product                                231   1e-69    
gb|KJB13719.1|  hypothetical protein B456_002G091100                    233   1e-69    
gb|AAT08741.1|  aspartic proteinase                                     221   1e-69    
ref|XP_010042419.1|  PREDICTED: aspartic proteinase-like isoform X1     234   2e-69    
ref|NP_001275049.1|  Asp precursor                                      233   2e-69    
ref|XP_002512581.1|  Aspartic proteinase precursor, putative            232   2e-69    
ref|XP_008646647.1|  PREDICTED: aspartic proteinase oryzasin-1-like     227   2e-69    
gb|KDP23334.1|  hypothetical protein JCGZ_23167                         232   3e-69    
gb|EMS45962.1|  Aspartic proteinase                                     232   3e-69    
ref|XP_009771336.1|  PREDICTED: aspartic proteinase A1-like isofo...    232   3e-69    
dbj|BAE20414.1|  aspartic proteinase                                    232   3e-69    
ref|XP_009771335.1|  PREDICTED: aspartic proteinase A1-like isofo...    232   4e-69    
ref|XP_009608676.1|  PREDICTED: cyprosin-like                           231   5e-69    
ref|XP_003633616.1|  PREDICTED: cyprosin-like isoform X2                231   7e-69    
ref|XP_010659757.1|  PREDICTED: cyprosin-like isoform X1                231   7e-69    
ref|XP_008246320.1|  PREDICTED: aspartic proteinase-like                231   8e-69    
ref|XP_010324003.1|  PREDICTED: aspartic protease precursor isofo...    231   9e-69    
gb|EEC70447.1|  hypothetical protein OsI_01478                          230   9e-69    
dbj|BAJ85473.1|  predicted protein                                      231   1e-68    
dbj|BAG16519.1|  putative aspartic protease                             231   1e-68    
emb|CAL07969.1|  aspartic proteinase                                    230   2e-68    
ref|XP_010909333.1|  PREDICTED: aspartic proteinase-like                230   2e-68    
gb|AAT77954.1|  Asp                                                     229   2e-68    
ref|XP_006654022.1|  PREDICTED: aspartic proteinase-like                229   2e-68    
ref|XP_010094903.1|  Aspartic proteinase                                229   3e-68    
ref|XP_007207363.1|  hypothetical protein PRUPE_ppa004505mg             229   4e-68    
ref|NP_001042785.1|  Os01g0290000                                       229   5e-68    
ref|XP_004969250.1|  PREDICTED: aspartic proteinase oryzasin-1-like     229   5e-68    
ref|XP_002319454.2|  aspartic proteinase 2                              229   6e-68    
gb|ADE74632.1|  aspartic protease 1                                     228   7e-68    
ref|XP_004960420.1|  PREDICTED: aspartic proteinase-like                228   8e-68    
ref|XP_009801963.1|  PREDICTED: cyprosin-like                           228   1e-67    
gb|ACF87177.1|  unknown                                                 228   2e-67    
ref|NP_001152501.1|  retrotransposon protein SINE subclass precursor    228   2e-67    
gb|ACL54337.1|  unknown                                                 227   2e-67    
ref|XP_001767404.1|  predicted protein                                  227   2e-67    
gb|AGT16815.1|  aspartic proteinase                                     229   2e-67    
ref|XP_004967621.1|  PREDICTED: aspartic proteinase-like isoform X1     227   2e-67    
ref|XP_004302331.1|  PREDICTED: aspartic proteinase-like                226   4e-67    
ref|XP_008655134.1|  PREDICTED: retrotransposon protein SINE subc...    227   5e-67    
gb|ABI78942.1|  aspartic protease                                       226   6e-67    
gb|KJB26285.1|  hypothetical protein B456_004G235200                    227   6e-67    
gb|AGT16793.1|  aspartic protease                                       227   7e-67    
gb|EMT14628.1|  Aspartic proteinase oryzasin-1                          225   2e-66    
emb|CAE52913.1|  putative vacuaolar aspartic proteinase                 224   3e-66    
dbj|BAC16371.1|  aspartic proteinase 5                                  214   3e-66    
emb|CDM83463.1|  unnamed protein product                                225   4e-66    
gb|KHG03187.1|  Asparticase                                             224   7e-66    
gb|EEE62252.1|  hypothetical protein OsJ_17039                          223   8e-66    
gb|EYU19381.1|  hypothetical protein MIMGU_mgv1a004925mg                223   8e-66    
ref|XP_010539208.1|  PREDICTED: aspartic proteinase A3-like isofo...    223   9e-66    
ref|XP_010539213.1|  PREDICTED: aspartic proteinase A3-like isofo...    223   9e-66    
dbj|BAB20972.1|  aspartic proteinase 4                                  223   1e-65    
ref|XP_002456011.1|  hypothetical protein SORBIDRAFT_03g028820          224   1e-65    
ref|XP_011087561.1|  PREDICTED: aspartic proteinase-like isoform X2     223   1e-65    
ref|XP_011087560.1|  PREDICTED: aspartic proteinase-like isoform X1     223   2e-65    
ref|XP_009619375.1|  PREDICTED: cyprosin-like isoform X2                222   2e-65    
ref|XP_009619374.1|  PREDICTED: cyprosin-like isoform X1                222   2e-65    
ref|NP_001169605.1|  uncharacterized protein LOC100383486 precursor     223   2e-65    
ref|XP_002992068.1|  hypothetical protein SELMODRAFT_186535             221   5e-65    
dbj|BAA76427.1|  aspartic proteinase                                    212   7e-65    
ref|XP_008673210.1|  PREDICTED: uncharacterized protein LOC100383...    221   9e-65    
gb|EPS68187.1|  aspartic protease                                       220   1e-64    
emb|CAN65745.1|  hypothetical protein VITISV_037763                     220   1e-64    
sp|Q9XFX4.1|CARDB_CYNCA  RecName: Full=Procardosin-B; Contains: R...    220   1e-64    
ref|XP_002964101.1|  hypothetical protein SELMODRAFT_166719             219   2e-64    
sp|Q9XFX3.1|CARDA_CYNCA  RecName: Full=Procardosin-A; Contains: R...    219   2e-64    
ref|XP_004495808.1|  PREDICTED: aspartic proteinase-like                219   3e-64    
ref|XP_006644404.1|  PREDICTED: aspartic proteinase oryzasin-1-like     220   3e-64    
gb|ABD33216.1|  Peptidase A1, pepsin                                    215   8e-64    
gb|KEH43130.1|  fungal proteinase A, aspartic proteinase superfam...    218   8e-64    
ref|XP_008673209.1|  PREDICTED: uncharacterized protein LOC100383...    219   1e-63    
gb|EMT27697.1|  Aspartic proteinase oryzasin-1                          217   2e-63    
ref|XP_003626143.1|  Aspartic proteinase                                216   3e-63    
ref|XP_008673208.1|  PREDICTED: uncharacterized protein LOC100383...    217   6e-63    
gb|AES82362.2|  fungal proteinase A, aspartic proteinase superfam...    216   6e-63    
ref|XP_003626142.1|  Aspartic proteinase                                215   7e-63    
ref|XP_001769293.1|  predicted protein                                  214   2e-62    
ref|XP_010659762.1|  PREDICTED: aspartic proteinase A1 isoform X2       214   2e-62    
ref|XP_002276363.3|  PREDICTED: aspartic proteinase A1 isoform X1       214   3e-62    
gb|ACU19920.1|  unknown                                                 204   4e-62    
gb|AAK48494.1|AF259982_1  putative aspartic protease                    213   5e-62    
ref|XP_003555776.1|  PREDICTED: aspartic proteinase isoform X1          213   6e-62    
gb|KHN26195.1|  Aspartic proteinase                                     213   7e-62    
emb|CDY21302.1|  BnaC03g29860D                                          214   1e-61    
ref|XP_003521645.1|  PREDICTED: aspartic proteinase oryzasin-1 is...    212   1e-61    
ref|XP_007145043.1|  hypothetical protein PHAVU_007G205100g             211   2e-61    
emb|CDY28542.1|  BnaC02g36180D                                          202   2e-61    
ref|XP_004494508.1|  PREDICTED: aspartic proteinase-like isoform X1     211   3e-61    
ref|XP_003536026.1|  PREDICTED: aspartic proteinase-like isoform X1     211   4e-61    
dbj|BAD95255.1|  putative aspartic protease                             199   5e-61    
ref|XP_002961603.1|  hypothetical protein SELMODRAFT_230037             207   1e-60    
ref|XP_010674482.1|  PREDICTED: aspartic proteinase-like                209   1e-60    
gb|KHN43373.1|  Aspartic proteinase                                     209   2e-60    
ref|XP_006603753.1|  PREDICTED: aspartic proteinase 2 isoform X1        209   2e-60    
ref|NP_001237345.1|  aspartic proteinase 2                              209   2e-60    
ref|XP_007163289.1|  hypothetical protein PHAVU_001G222100g             208   3e-60    
ref|XP_002971198.1|  hypothetical protein SELMODRAFT_147484             206   5e-60    
gb|AFX73038.1|  preprogaline A                                          207   7e-60    
ref|XP_006488712.1|  PREDICTED: aspartic proteinase A2-like             206   2e-59    
ref|XP_006419206.1|  hypothetical protein CICLE_v10004801mg             206   2e-59    
ref|XP_010271040.1|  PREDICTED: aspartic proteinase-like isoform X1     206   3e-59    
ref|XP_004508063.1|  PREDICTED: aspartic proteinase oryzasin-1-like     206   4e-59    
gb|KDO72241.1|  hypothetical protein CISIN_1g010195mg                   205   6e-59    
gb|KDO72240.1|  hypothetical protein CISIN_1g010195mg                   205   7e-59    
gb|KDO72239.1|  hypothetical protein CISIN_1g010195mg                   205   8e-59    
ref|XP_007036025.1|  Aspartic proteinase oryzasin-1, putative iso...    201   1e-58    
ref|XP_002964099.1|  hypothetical protein SELMODRAFT_142401             204   2e-58    
ref|XP_010549203.1|  PREDICTED: aspartic proteinase A1-like isofo...    202   6e-58    
ref|XP_010549201.1|  PREDICTED: aspartic proteinase A1-like isofo...    202   7e-58    
ref|XP_007036023.1|  Aspartic proteinase oryzasin-1 isoform 1           202   8e-58    
ref|XP_010241437.1|  PREDICTED: cyprosin-like                           201   1e-57    
ref|XP_002519342.1|  Aspartic proteinase oryzasin-1 precursor, pu...    201   2e-57    
ref|XP_007036018.1|  Aspartic proteinase, putative isoform 1            201   2e-57    
ref|XP_002964100.1|  hypothetical protein SELMODRAFT_438819             201   2e-57    
ref|XP_002891994.1|  hypothetical protein ARALYDRAFT_314946             201   2e-57    
gb|KHN44864.1|  Cyprosin                                                197   2e-57    
gb|KHG02139.1|  hypothetical protein F383_24995                         200   3e-57    
ref|XP_008390340.1|  PREDICTED: aspartic proteinase-like                200   5e-57    
gb|KJB28875.1|  hypothetical protein B456_005G073800                    200   5e-57    
ref|XP_010511326.1|  PREDICTED: aspartic proteinase A1-like isofo...    200   5e-57    
gb|ABR25873.1|  retrotransposon protein, sine subclass, expressed       188   1e-56    
ref|XP_006302162.1|  hypothetical protein CARUB_v10020172mg             199   1e-56    
gb|KJB28874.1|  hypothetical protein B456_005G073800                    200   2e-56    
gb|KEH32400.1|  fungal proteinase A, aspartic proteinase superfam...    197   4e-56    
ref|XP_009353444.1|  PREDICTED: aspartic proteinase oryzasin-1-like     197   4e-56    
gb|AAC34854.1|  senescence-associated protein 4                         198   4e-56    
ref|XP_010271041.1|  PREDICTED: aspartic proteinase-like isoform X2     197   7e-56    
gb|EPS69682.1|  hypothetical protein M569_05082                         197   8e-56    
gb|KDP28021.1|  hypothetical protein JCGZ_19101                         196   9e-56    
ref|XP_002314336.2|  aspartic proteinase 2                              196   1e-55    
ref|XP_008378421.1|  PREDICTED: aspartic proteinase-like isoform X2     197   1e-55    
ref|XP_008223613.1|  PREDICTED: aspartic proteinase-like                196   1e-55    
ref|XP_010999327.1|  PREDICTED: aspartic proteinase-like                195   4e-55    
ref|XP_010480290.1|  PREDICTED: aspartic proteinase A1-like             194   5e-55    
gb|KCW61404.1|  hypothetical protein EUGRSUZ_H04134                     190   6e-55    
gb|EMS55205.1|  Aspartic proteinase oryzasin-1                          194   1e-54    
gb|AAK82987.1|  aspartic protease                                       181   5e-54    
ref|XP_004297063.1|  PREDICTED: cyprosin-like                           192   5e-54    
gb|KJB28876.1|  hypothetical protein B456_005G073900                    192   5e-54    
ref|XP_001768042.1|  predicted protein                                  191   6e-54    
gb|ACU22832.1|  unknown                                                 181   2e-53    
ref|XP_004488186.1|  PREDICTED: aspartic proteinase-like isoform X3     185   2e-53    
ref|XP_007138575.1|  hypothetical protein PHAVU_009G220600g             187   4e-53    
ref|XP_010024880.1|  PREDICTED: cyprosin-like                           190   4e-53    
gb|KCW46980.1|  hypothetical protein EUGRSUZ_K00787                     188   8e-53    
ref|XP_007036024.1|  Aspartic proteinase oryzasin-1 isoform 2           188   2e-52    
gb|KHN45025.1|  Aspartic proteinase oryzasin-1                          187   2e-52    
ref|XP_003541325.1|  PREDICTED: aspartic proteinase oryzasin-1-li...    187   2e-52    
ref|XP_007154514.1|  hypothetical protein PHAVU_003G125000g             187   2e-52    
ref|XP_010649704.1|  PREDICTED: aspartic proteinase                     187   2e-52    
ref|XP_006586643.1|  PREDICTED: uncharacterized protein LOC100500...    184   3e-52    
ref|XP_007138576.1|  hypothetical protein PHAVU_009G220600g             187   4e-52    
ref|XP_006600421.1|  PREDICTED: aspartic proteinase oryzasin-1-li...    186   6e-52    
gb|KDO62073.1|  hypothetical protein CISIN_1g010230mg                   185   7e-52    
gb|KHN04670.1|  Aspartic proteinase oryzasin-1                          186   8e-52    
ref|XP_008378420.1|  PREDICTED: aspartic proteinase-like isoform X1     186   1e-51    
ref|XP_003546541.1|  PREDICTED: aspartic proteinase A1-like isofo...    186   1e-51    
ref|XP_008378422.1|  PREDICTED: aspartic proteinase-like isoform X3     186   1e-51    
gb|KJB67250.1|  hypothetical protein B456_010G182400                    184   1e-51    
ref|XP_004488185.1|  PREDICTED: aspartic proteinase-like isoform X2     185   1e-51    
ref|XP_004488184.1|  PREDICTED: aspartic proteinase-like isoform X1     185   1e-51    
ref|XP_009113359.1|  PREDICTED: aspartic proteinase oryzasin-1-like     185   2e-51    
gb|KHN19190.1|  Aspartic proteinase oryzasin-1                          184   3e-51    
ref|XP_006586640.1|  PREDICTED: uncharacterized protein LOC100500...    184   3e-51    
ref|XP_010038033.1|  PREDICTED: cyprosin-like                           183   1e-50    
emb|CDO98683.1|  unnamed protein product                                182   3e-50    
gb|ACS68654.1|  aspartic proteinase                                     170   1e-49    
gb|AGT17264.1|  aspartic proteinase                                     179   4e-49    
ref|XP_010694065.1|  PREDICTED: cyprosin-like                           179   4e-49    
gb|KDO78302.1|  hypothetical protein CISIN_1g010233mg                   176   3e-48    
emb|CAA61253.1|  aspartic protease                                      165   3e-48    
ref|XP_004234022.1|  PREDICTED: aspartic proteinase A1                  176   4e-48    
gb|KDO54714.1|  hypothetical protein CISIN_1g009634mg                   176   4e-48    
gb|KEH37701.1|  fungal proteinase A, aspartic proteinase superfam...    174   2e-47    
ref|XP_003595434.1|  Aspartic proteinase                                174   2e-47    
gb|KEH37702.1|  fungal proteinase A, aspartic proteinase superfam...    174   3e-47    
gb|KJB13726.1|  hypothetical protein B456_002G091100                    173   3e-47    
ref|XP_008653243.1|  PREDICTED: aspartic proteinase oryzasin-1-like     167   3e-47    
ref|XP_010098748.1|  Aspartic proteinase                                173   4e-47    
ref|XP_007223268.1|  hypothetical protein PRUPE_ppa004486mg             173   5e-47    
ref|XP_010511323.1|  PREDICTED: aspartic proteinase-like isoform X1     172   8e-47    
ref|XP_010415029.1|  PREDICTED: aspartic proteinase-like                172   1e-46    
ref|XP_010511324.1|  PREDICTED: aspartic proteinase oryzasin-1-li...    172   1e-46    
ref|NP_001235978.1|  uncharacterized protein LOC100500551               162   1e-46    
emb|CAN74997.1|  hypothetical protein VITISV_036759                     162   6e-46    
ref|XP_010926216.1|  PREDICTED: aspartic proteinase oryzasin-1-li...    169   7e-46    
ref|XP_010271044.1|  PREDICTED: aspartic proteinase A1-like             170   1e-45    
gb|EMS45559.1|  Aspartic proteinase                                     167   3e-45    
ref|XP_010480289.1|  PREDICTED: aspartic proteinase A1-like isofo...    167   6e-45    
gb|EMT30433.1|  Aspartic proteinase                                     166   9e-45    
ref|XP_010480288.1|  PREDICTED: aspartic proteinase A1-like isofo...    167   1e-44    
ref|XP_009359818.1|  PREDICTED: aspartic proteinase-like                157   1e-44    
ref|XP_010271043.1|  PREDICTED: aspartic proteinase-like                167   2e-44    
emb|CAL10023.1|  cyprosin B precursor                                   155   2e-44    
ref|XP_009616098.1|  PREDICTED: cyprosin-like                           164   1e-43    
ref|XP_008649580.1|  PREDICTED: aspartic proteinase oryzasin-1-like     152   4e-43    
ref|XP_009778400.1|  PREDICTED: cyprosin-like isoform X1                161   1e-42    
ref|XP_009778402.1|  PREDICTED: cyprosin-like isoform X2                161   1e-42    
ref|XP_009631812.1|  PREDICTED: cyprosin-like                           159   7e-42    
gb|ABQ41931.1|  aspartic proteinase 1                                   149   1e-40    
ref|XP_010241434.1|  PREDICTED: aspartic proteinase-like isoform X4     156   2e-40    
ref|XP_010241432.1|  PREDICTED: aspartic proteinase-like isoform X2     155   3e-40    
gb|ABQ41930.1|  aspartic proteinase 1                                   145   3e-39    
gb|ABQ41932.1|  aspartic proteinase 1                                   145   3e-39    
gb|ABQ41933.1|  aspartic proteinase 1                                   145   3e-39    
ref|XP_002524837.1|  Aspartic proteinase precursor, putative            150   5e-39    
ref|XP_008678986.1|  PREDICTED: aspartic proteinase-like isoform X2     142   5e-39    
ref|XP_010241433.1|  PREDICTED: aspartic proteinase-like isoform X3     152   5e-39    



>ref|XP_009792514.1| PREDICTED: aspartic proteinase-like, partial [Nicotiana sylvestris]
Length=382

 Score =   318 bits (816),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 144/180 (80%), Positives = 163/180 (91%), Gaps = 0/180 (0%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLHDAMCSACEMT  514
            Q ++DLL+ EA PKKICSQ+G+CTF+GNRGVSMGI+SVVDEK G S  L D MCSACEM 
Sbjct  203  QTIMDLLLAEAHPKKICSQVGVCTFDGNRGVSMGIDSVVDEKAGRSTGLQDGMCSACEMA  262

Query  513  VVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDLS  334
            V+WM+NQL +NQTQ+ IL+YVNELC RLPSP+GES VDCGKLS+MP VSF+IGGKVFDLS
Sbjct  263  VIWMENQLRQNQTQDRILNYVNELCERLPSPLGESAVDCGKLSSMPKVSFTIGGKVFDLS  322

Query  333  PNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEAA  154
            PNEYILKVGEG+ AQCISGFT LD+PPPRGPLWILGD+FMGRYHTVFDYGK+RVGFAEAA
Sbjct  323  PNEYILKVGEGAKAQCISGFTGLDIPPPRGPLWILGDIFMGRYHTVFDYGKLRVGFAEAA  382



>ref|XP_009629448.1| PREDICTED: aspartic proteinase-like [Nicotiana tomentosiformis]
Length=512

 Score =   321 bits (822),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 147/180 (82%), Positives = 162/180 (90%), Gaps = 0/180 (0%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLHDAMCSACEMT  514
            Q ++D+L+ EA PKKICSQ+GLCTF+G RG+SMGIESVVDE  G S+ LHDAMCSACEM 
Sbjct  333  QTIMDMLLAEAHPKKICSQVGLCTFDGTRGISMGIESVVDENAGKSSGLHDAMCSACEMA  392

Query  513  VVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDLS  334
            VVWMQNQL +NQTQE IL+YVNELC RLPSPMG+S VDCGKLS MPSVSF+IGG+ FDLS
Sbjct  393  VVWMQNQLRQNQTQERILNYVNELCERLPSPMGQSAVDCGKLSGMPSVSFTIGGRTFDLS  452

Query  333  PNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEAA  154
            P EYILKVGEG AAQCISGF ALDVPPPRGPLWILGDVFMGRYHTVFD+GK+RVGFAEAA
Sbjct  453  PEEYILKVGEGPAAQCISGFIALDVPPPRGPLWILGDVFMGRYHTVFDFGKLRVGFAEAA  512



>ref|XP_004232695.1| PREDICTED: aspartic proteinase [Solanum lycopersicum]
 ref|XP_010316578.1| PREDICTED: aspartic proteinase [Solanum lycopersicum]
Length=511

 Score =   320 bits (821),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 148/180 (82%), Positives = 162/180 (90%), Gaps = 0/180 (0%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLHDAMCSACEMT  514
            Q ++D+L+ EA PKKICSQ+GLCTF+G RGVSMGIESVVDEK G SA LHDAMCSACEM 
Sbjct  332  QTIMDMLLTEANPKKICSQVGLCTFDGTRGVSMGIESVVDEKAGKSAGLHDAMCSACEMA  391

Query  513  VVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDLS  334
            VVWMQNQL +NQTQ+ IL+YVNELC RLPSPMG+S VDCGKLS MPSVSF+IGGK FDL+
Sbjct  392  VVWMQNQLRQNQTQDRILNYVNELCERLPSPMGQSAVDCGKLSGMPSVSFTIGGKKFDLA  451

Query  333  PNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEAA  154
            P EYILKVGEG AAQCISGF ALD+PPPRGPLWILGDVFMGRYHTVFD GK+RVGFAEAA
Sbjct  452  PEEYILKVGEGRAAQCISGFIALDIPPPRGPLWILGDVFMGRYHTVFDSGKLRVGFAEAA  511



>ref|XP_009797823.1| PREDICTED: aspartic proteinase [Nicotiana sylvestris]
 ref|XP_009797831.1| PREDICTED: aspartic proteinase [Nicotiana sylvestris]
Length=512

 Score =   319 bits (817),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 148/180 (82%), Positives = 161/180 (89%), Gaps = 0/180 (0%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLHDAMCSACEMT  514
            Q ++D+L+ EA PKKICSQ+GLCTF+G RGVSMGIESVVDE  G S+ LHDAMCSACEM 
Sbjct  333  QTIMDMLLAEAHPKKICSQVGLCTFDGTRGVSMGIESVVDENAGKSSGLHDAMCSACEMA  392

Query  513  VVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDLS  334
            VVWMQNQL +NQTQE IL+YVNELC RLPSPMG+S VDCGKLS MPSVSF+IGG+ FDLS
Sbjct  393  VVWMQNQLRQNQTQERILNYVNELCERLPSPMGQSAVDCGKLSGMPSVSFTIGGRTFDLS  452

Query  333  PNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEAA  154
            P EYILKVGEG AAQCISGF ALDVPPPRGPLWILGDVFMGRYHTVFD GK+RVGFAEAA
Sbjct  453  PEEYILKVGEGPAAQCISGFIALDVPPPRGPLWILGDVFMGRYHTVFDSGKLRVGFAEAA  512



>ref|XP_006348142.1| PREDICTED: aspartic proteinase-like [Solanum tuberosum]
Length=511

 Score =   318 bits (815),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 147/180 (82%), Positives = 161/180 (89%), Gaps = 0/180 (0%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLHDAMCSACEMT  514
            Q ++D+L+ EA PKKICSQ+GLCTF+G RGVSMGIESVVDEK G SA LHDAMCSACEM 
Sbjct  332  QTIMDMLLTEANPKKICSQVGLCTFDGTRGVSMGIESVVDEKAGKSAGLHDAMCSACEMA  391

Query  513  VVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDLS  334
            VVWMQNQL +NQTQ+ IL+YVNELC RLPSPMG+S VDCGKLS MPSVSF+IG K FDL+
Sbjct  392  VVWMQNQLRQNQTQDRILNYVNELCERLPSPMGQSAVDCGKLSGMPSVSFTIGSKKFDLA  451

Query  333  PNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEAA  154
            P EYILKVGEG AAQCISGF ALD+PPPRGPLWILGDVFMGRYHTVFD GK+RVGFAEAA
Sbjct  452  PEEYILKVGEGRAAQCISGFVALDIPPPRGPLWILGDVFMGRYHTVFDSGKLRVGFAEAA  511



>ref|XP_009587050.1| PREDICTED: aspartic proteinase-like [Nicotiana tomentosiformis]
Length=510

 Score =   318 bits (815),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 144/180 (80%), Positives = 162/180 (90%), Gaps = 0/180 (0%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLHDAMCSACEMT  514
            Q ++DLL+ EA PKKICSQ+G+CTF+GNRGVSMGIESVVDEK G S  L D MCSACEM 
Sbjct  331  QTIMDLLLAEAHPKKICSQVGVCTFDGNRGVSMGIESVVDEKAGRSTGLQDGMCSACEMA  390

Query  513  VVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDLS  334
            V+WM+NQL +NQTQ+ IL+YVNELC RLPSP+GES VDCGKLS+MP+VSF+IGGKVFDL 
Sbjct  391  VIWMENQLRQNQTQDRILNYVNELCERLPSPLGESAVDCGKLSSMPTVSFTIGGKVFDLV  450

Query  333  PNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEAA  154
            P EYILKVGEG+ AQCISGFT LD+PPPRGPLWILGDVFMGRYHTVFDYGK+RVGFAEAA
Sbjct  451  PKEYILKVGEGAKAQCISGFTGLDIPPPRGPLWILGDVFMGRYHTVFDYGKLRVGFAEAA  510



>ref|XP_004231616.1| PREDICTED: aspartic proteinase [Solanum lycopersicum]
Length=510

 Score =   317 bits (813),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 144/180 (80%), Positives = 161/180 (89%), Gaps = 0/180 (0%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLHDAMCSACEMT  514
            Q ++DLL+ EA PKK+CSQ+G+CTF+G  GVSMGIESVV+EK G SA LHD MCSACEM 
Sbjct  331  QTIMDLLLAEAHPKKVCSQVGVCTFDGTHGVSMGIESVVNEKAGRSAGLHDGMCSACEMA  390

Query  513  VVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDLS  334
            VVWM+NQL +NQTQ+ IL Y+NELC RLPSPMGES VDCGKLS+MP+VSF+IGGKVFDLS
Sbjct  391  VVWMENQLRQNQTQDRILDYLNELCERLPSPMGESAVDCGKLSSMPTVSFTIGGKVFDLS  450

Query  333  PNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEAA  154
            PNEYILKVGEG  AQCISGF  LDVPPPRGPLWILGD+FMGRYHTVFDYGK+RVGFAEAA
Sbjct  451  PNEYILKVGEGDQAQCISGFIGLDVPPPRGPLWILGDIFMGRYHTVFDYGKLRVGFAEAA  510



>emb|CDP04424.1| unnamed protein product [Coffea canephora]
Length=513

 Score =   314 bits (804),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 144/180 (80%), Positives = 162/180 (90%), Gaps = 0/180 (0%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLHDAMCSACEMT  514
            Q+++DLL+ EA+PK ICSQIGLCTF+G +GVSMGIESV DE  G S+ L DAMCSACEM 
Sbjct  334  QKIVDLLLGEAQPKTICSQIGLCTFDGTQGVSMGIESVADEHAGRSSGLRDAMCSACEMA  393

Query  513  VVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDLS  334
            VVWMQNQLS+NQTQE IL+Y NELC+RLPSPMGES V+CG +S+MP VSF+IGGKVFDL+
Sbjct  394  VVWMQNQLSQNQTQERILNYANELCDRLPSPMGESSVECGSISSMPKVSFTIGGKVFDLA  453

Query  333  PNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEAA  154
            P EYILKVGEG+AAQCISGFT LD+PPPRGPLWILGDVFMGRYHTV DYGKMRVGFAEAA
Sbjct  454  PEEYILKVGEGAAAQCISGFTGLDMPPPRGPLWILGDVFMGRYHTVLDYGKMRVGFAEAA  513



>ref|XP_006350474.1| PREDICTED: aspartic proteinase-like [Solanum tuberosum]
Length=510

 Score =   313 bits (801),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 160/180 (89%), Gaps = 0/180 (0%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLHDAMCSACEMT  514
            Q ++DLL+ EA PKK+CSQ+G+CTF+G  GVSMGIESVV+EK G SA  HD +CSACEM 
Sbjct  331  QTIMDLLLAEAHPKKVCSQVGVCTFDGTHGVSMGIESVVNEKAGRSAGPHDGVCSACEMA  390

Query  513  VVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDLS  334
            V+WM+NQL +NQTQ+ IL YVNELC RLPSPMGES VDCGKLS+MP+VSF+IGGKVFDLS
Sbjct  391  VIWMENQLRQNQTQDRILDYVNELCERLPSPMGESAVDCGKLSSMPTVSFTIGGKVFDLS  450

Query  333  PNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEAA  154
            PNEYILKVGEG  AQCISGF  LD+PPPRGPLWILGD+FMGRYHTVFDYGK+RVGFAEAA
Sbjct  451  PNEYILKVGEGDKAQCISGFIGLDIPPPRGPLWILGDIFMGRYHTVFDYGKLRVGFAEAA  510



>ref|XP_010099183.1| Aspartic proteinase [Morus notabilis]
 gb|EXB77055.1| Aspartic proteinase [Morus notabilis]
Length=513

 Score =   311 bits (798),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 162/180 (90%), Gaps = 0/180 (0%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLHDAMCSACEMT  514
            Q ++DLL+ +  PKK+CSQIGLCTF+G R VS+GIESVVD+ NG S  LHDAMCSACEMT
Sbjct  334  QNILDLLMAQVHPKKVCSQIGLCTFDGTRVVSIGIESVVDKNNGKSGVLHDAMCSACEMT  393

Query  513  VVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDLS  334
            VVWMQNQL++NQT+E+IL YVNELC+R+P+PMGES VDCG+LS MP V+F+IGGK+F+LS
Sbjct  394  VVWMQNQLTQNQTREHILDYVNELCDRVPNPMGESSVDCGRLSLMPKVAFTIGGKIFELS  453

Query  333  PNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEAA  154
            P EYILKVGEG  AQCISGFT LDVPPPRGPLWILGDVFMGRYHTVFDYGK+RVGFAEAA
Sbjct  454  PQEYILKVGEGPQAQCISGFTGLDVPPPRGPLWILGDVFMGRYHTVFDYGKLRVGFAEAA  513



>ref|XP_007026133.1| Saposin-like aspartyl protease family protein [Theobroma cacao]
 gb|EOY28755.1| Saposin-like aspartyl protease family protein [Theobroma cacao]
Length=514

 Score =   311 bits (798),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 143/181 (79%), Positives = 163/181 (90%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHDAMCSACEM  517
            Q +IDLL+ EA+P+KICSQIGLCTFNG  GVS GIESVVDE NG S+  L DAMC ACEM
Sbjct  334  QTIIDLLIAEAQPQKICSQIGLCTFNGAHGVSTGIESVVDESNGKSSGVLRDAMCPACEM  393

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQNQ+ +NQTQ+ ILSYVNELC+R+P+PMGES VDCG LS+MP++SF+IGGKVFDL
Sbjct  394  AVVWMQNQVRQNQTQDRILSYVNELCDRVPNPMGESAVDCGSLSSMPTISFTIGGKVFDL  453

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P EYILKVGEGS AQCISGFTALD+PPPRGPLWILGD+FMGRYHTVFD+GK+RVGFAEA
Sbjct  454  TPEEYILKVGEGSDAQCISGFTALDIPPPRGPLWILGDIFMGRYHTVFDFGKLRVGFAEA  513

Query  156  A  154
            A
Sbjct  514  A  514



>gb|EYU27762.1| hypothetical protein MIMGU_mgv1a004712mg [Erythranthe guttata]
Length=513

 Score =   310 bits (795),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 142/180 (79%), Positives = 162/180 (90%), Gaps = 0/180 (0%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLHDAMCSACEMT  514
            Q ++DLL+ EA PKKICSQ+GLCTF+G RGVS GIESVVDEK+G S+ L DAMCSACEM 
Sbjct  334  QTIMDLLLTEAHPKKICSQVGLCTFDGTRGVSAGIESVVDEKDGRSSGLGDAMCSACEMA  393

Query  513  VVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDLS  334
            VVWMQNQL  NQTQ+ IL+YVNELC RLPSPMG+S V+CG +S+MPSVSF+IGGK+FDLS
Sbjct  394  VVWMQNQLRRNQTQDRILNYVNELCERLPSPMGQSAVECGSISSMPSVSFTIGGKIFDLS  453

Query  333  PNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEAA  154
            P+EYILKVGEG+AAQCISGF  LD+PPPRGPLWILGD+FMGRYHTVFD GK+RVGFAEAA
Sbjct  454  PHEYILKVGEGAAAQCISGFMGLDIPPPRGPLWILGDMFMGRYHTVFDSGKLRVGFAEAA  513



>emb|CAC86004.1| aspartic proteinase [Theobroma cacao]
Length=514

 Score =   310 bits (794),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 142/181 (78%), Positives = 163/181 (90%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHDAMCSACEM  517
            + +IDLL+ EA+P+KICSQIGLCTFNG  GVS GIESVVDE NG S+  L DAMC ACEM
Sbjct  334  RTIIDLLIAEAQPQKICSQIGLCTFNGAHGVSTGIESVVDESNGKSSGVLRDAMCPACEM  393

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQNQ+ +NQTQ+ ILSYVNELC+R+P+PMGES VDCG LS+MP++SF+IGGKVFDL
Sbjct  394  AVVWMQNQVRQNQTQDRILSYVNELCDRVPNPMGESAVDCGSLSSMPTISFTIGGKVFDL  453

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P EYILKVGEGS AQCISGFTALD+PPPRGPLWILGD+FMGRYHTVFD+GK+RVGFAEA
Sbjct  454  TPEEYILKVGEGSEAQCISGFTALDIPPPRGPLWILGDIFMGRYHTVFDFGKLRVGFAEA  513

Query  156  A  154
            A
Sbjct  514  A  514



>ref|XP_004145121.1| PREDICTED: aspartic proteinase-like [Cucumis sativus]
 ref|XP_004153558.1| PREDICTED: aspartic proteinase-like [Cucumis sativus]
Length=514

 Score =   308 bits (790),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 142/181 (78%), Positives = 162/181 (90%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHDAMCSACEM  517
            Q ++DLL+ EA PKKICSQI LCTF+G RGVSMGIESVVDE  G S+D L D MCS CEM
Sbjct  334  QTIMDLLLSEADPKKICSQIKLCTFDGTRGVSMGIESVVDENAGKSSDGLRDGMCSVCEM  393

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
            TVVWMQNQL +NQT+E I++Y+NELC+R+PSPMG+S VDCG LS+MPSVSF+IG KVFDL
Sbjct  394  TVVWMQNQLRQNQTKERIINYINELCDRMPSPMGQSAVDCGTLSSMPSVSFTIGDKVFDL  453

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P EYILKVGEG+AAQCISGFTA D+PPPRGPLWILGDVFMGRYHTVFD+GK+RVGFAEA
Sbjct  454  APEEYILKVGEGAAAQCISGFTAFDIPPPRGPLWILGDVFMGRYHTVFDFGKLRVGFAEA  513

Query  156  A  154
            A
Sbjct  514  A  514



>ref|XP_010252464.1| PREDICTED: aspartic proteinase A1-like [Nelumbo nucifera]
 ref|XP_010252465.1| PREDICTED: aspartic proteinase A1-like [Nelumbo nucifera]
Length=514

 Score =   308 bits (789),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 144/181 (80%), Positives = 159/181 (88%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHDAMCSACEM  517
            + +++LL+ E +P K+CSQIGLCTF+G RGVS GIESVVDEKNG S+  LHDAMCSACEM
Sbjct  334  ETILELLLAETQPMKVCSQIGLCTFDGTRGVSTGIESVVDEKNGKSSGFLHDAMCSACEM  393

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQNQL +NQTQ+ ILSY NELC+RLPSPMGES VDC KLS+MP VS +IGGKVFDL
Sbjct  394  AVVWMQNQLRQNQTQDRILSYANELCDRLPSPMGESAVDCDKLSSMPVVSITIGGKVFDL  453

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P EYILKVGEG   QCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYG MRVGFAEA
Sbjct  454  TPEEYILKVGEGPVTQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGNMRVGFAEA  513

Query  156  A  154
            A
Sbjct  514  A  514



>ref|XP_011096039.1| PREDICTED: aspartic proteinase-like [Sesamum indicum]
Length=511

 Score =   308 bits (788),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 139/180 (77%), Positives = 161/180 (89%), Gaps = 0/180 (0%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLHDAMCSACEMT  514
            Q ++DLL+ EA+PKKICSQ+GLCTF+G  GVS GI+SVVDEK+G S+ L D MCSACEM 
Sbjct  332  QTIMDLLLAEAQPKKICSQVGLCTFDGTHGVSAGIQSVVDEKDGRSSGLGDGMCSACEMA  391

Query  513  VVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDLS  334
            VVWMQNQL +NQTQE IL+YVNELC RLPSPMGES VDC  +S+MP++SF+IGGK FDLS
Sbjct  392  VVWMQNQLRQNQTQERILNYVNELCERLPSPMGESAVDCASISSMPTISFTIGGKPFDLS  451

Query  333  PNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEAA  154
            P +YILKVGEG+AAQCISGFT LD+PPPRGPLWILGD+FMGRYHTVFD+GK+RVGFAEAA
Sbjct  452  PEQYILKVGEGAAAQCISGFTGLDIPPPRGPLWILGDMFMGRYHTVFDFGKLRVGFAEAA  511



>emb|CBI23210.3| unnamed protein product [Vitis vinifera]
Length=429

 Score =   304 bits (779),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 143/181 (79%), Positives = 162/181 (90%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNG-VSADLHDAMCSACEM  517
            + ++DLL+ EA P+KICSQIGLCTF+G RGV MGIESVVDEKNG  S+ +HDA CSACEM
Sbjct  249  ETIMDLLLSEASPQKICSQIGLCTFDGTRGVGMGIESVVDEKNGDKSSGVHDAGCSACEM  308

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQ+QL +NQT+E IL YVNELC+RLPSPMGES VDC +LS+MP+VS +IGGKVFDL
Sbjct  309  AVVWMQSQLRQNQTKERILEYVNELCDRLPSPMGESAVDCLQLSSMPNVSLTIGGKVFDL  368

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            S NEY+LKVGEG+AAQCISGF A+DVPPPRGPLWILGDVFMGRYHTVFDYG MRVGFAEA
Sbjct  369  SANEYVLKVGEGAAAQCISGFIAMDVPPPRGPLWILGDVFMGRYHTVFDYGNMRVGFAEA  428

Query  156  A  154
            A
Sbjct  429  A  429



>sp|O04057.1|ASPR_CUCPE RecName: Full=Aspartic proteinase; Flags: Precursor [Cucurbita 
pepo]
 dbj|BAA19607.1| aspartic endopeptidase [Cucurbita pepo]
Length=513

 Score =   307 bits (786),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 140/181 (77%), Positives = 162/181 (90%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHDAMCSACEM  517
            Q ++DLL+ EA PKKICSQI LCTF+G RGVSMGIESVVDE  G S+D LHD MCS CEM
Sbjct  333  QTIMDLLLSEADPKKICSQINLCTFDGTRGVSMGIESVVDENAGKSSDSLHDGMCSVCEM  392

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
            TVVWMQNQL +NQT+E I++Y+NELC+R+PSPMG+S VDCG+LS+MP+VSF+IGGK+FDL
Sbjct  393  TVVWMQNQLRQNQTKERIINYINELCDRMPSPMGQSAVDCGQLSSMPTVSFTIGGKIFDL  452

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P EYILKVGEG  AQCISGFTA D+PPPRGPLWILGDVFMGRYHTVFD+GK+RVG AEA
Sbjct  453  APEEYILKVGEGPVAQCISGFTAFDIPPPRGPLWILGDVFMGRYHTVFDFGKLRVGSAEA  512

Query  156  A  154
            A
Sbjct  513  A  513



>ref|XP_008440898.1| PREDICTED: aspartic proteinase [Cucumis melo]
Length=514

 Score =   307 bits (786),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 141/181 (78%), Positives = 162/181 (90%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHDAMCSACEM  517
            Q ++DLL+ EA PKKICSQI LCTF+G +GVSMGIESV+DE  G S+D L D MCS CEM
Sbjct  334  QTIMDLLLSEADPKKICSQIKLCTFDGTQGVSMGIESVLDENAGKSSDGLRDGMCSVCEM  393

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
            TVVWMQNQL +NQT+E I++Y+NELC+R+PSPMG+S VDCGKLS+MPSVSF+IG KVFDL
Sbjct  394  TVVWMQNQLRQNQTKERIINYINELCDRMPSPMGQSAVDCGKLSSMPSVSFTIGDKVFDL  453

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P EYILKVGEG AAQCISGFTA D+PPPRGPLWILGDVFMGRYHTVFD+GK+RVGFAEA
Sbjct  454  APEEYILKVGEGVAAQCISGFTAFDIPPPRGPLWILGDVFMGRYHTVFDFGKLRVGFAEA  513

Query  156  A  154
            A
Sbjct  514  A  514



>ref|XP_002518445.1| Aspartic proteinase precursor, putative [Ricinus communis]
 gb|EEF43832.1| Aspartic proteinase precursor, putative [Ricinus communis]
Length=511

 Score =   306 bits (784),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 141/181 (78%), Positives = 163/181 (90%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADL-HDAMCSACEM  517
            + ++DLL+ EA+PKKICSQIGLCTF+G RGVSMGI+SVVD+ N  S+ +  DAMCSACEM
Sbjct  331  ETIMDLLIAEAQPKKICSQIGLCTFDGTRGVSMGIQSVVDDNNDKSSGIVRDAMCSACEM  390

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
            TVVWMQNQL ENQTQ+ IL+YVNELC+R+P+P+GES VDCG +S+MP VSF+IGGKVFDL
Sbjct  391  TVVWMQNQLRENQTQDRILNYVNELCDRIPNPLGESIVDCGSISSMPVVSFTIGGKVFDL  450

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            SP EYILKVGEG+ AQCISGF ALDVPPPRGPLWILGD+FMGRYHTVFDYG +RVGFAEA
Sbjct  451  SPQEYILKVGEGAQAQCISGFMALDVPPPRGPLWILGDIFMGRYHTVFDYGNLRVGFAEA  510

Query  156  A  154
            A
Sbjct  511  A  511



>ref|XP_003632941.1| PREDICTED: aspartic proteinase A1 [Vitis vinifera]
 ref|XP_002262915.2| PREDICTED: aspartic proteinase A1 [Vitis vinifera]
 ref|XP_010655376.1| PREDICTED: aspartic proteinase A1 [Vitis vinifera]
Length=514

 Score =   306 bits (783),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 143/181 (79%), Positives = 162/181 (90%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNG-VSADLHDAMCSACEM  517
            + ++DLL+ EA P+KICSQIGLCTF+G RGV MGIESVVDEKNG  S+ +HDA CSACEM
Sbjct  334  ETIMDLLLSEASPQKICSQIGLCTFDGTRGVGMGIESVVDEKNGDKSSGVHDAGCSACEM  393

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQ+QL +NQT+E IL YVNELC+RLPSPMGES VDC +LS+MP+VS +IGGKVFDL
Sbjct  394  AVVWMQSQLRQNQTKERILEYVNELCDRLPSPMGESAVDCLQLSSMPNVSLTIGGKVFDL  453

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            S NEY+LKVGEG+AAQCISGF A+DVPPPRGPLWILGDVFMGRYHTVFDYG MRVGFAEA
Sbjct  454  SANEYVLKVGEGAAAQCISGFIAMDVPPPRGPLWILGDVFMGRYHTVFDYGNMRVGFAEA  513

Query  156  A  154
            A
Sbjct  514  A  514



>gb|KJB67248.1| hypothetical protein B456_010G182400 [Gossypium raimondii]
Length=506

 Score =   302 bits (774),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 139/181 (77%), Positives = 159/181 (88%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHDAMCSACEM  517
            Q +IDLLV +A P KICSQIGLC F+G+ GVSMGIE+VVDE NG S+  LH AMC ACEM
Sbjct  326  QTIIDLLVSQAEPMKICSQIGLCAFDGSHGVSMGIENVVDESNGKSSGILHSAMCPACEM  385

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQNQL ENQTQ+ IL Y N+LC+R+P+PMGES VDCG LS+MP++SF+IGGK F+L
Sbjct  386  AVVWMQNQLMENQTQDRILDYANQLCDRVPNPMGESTVDCGSLSSMPTISFTIGGKAFEL  445

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P EYILKVGEG+ AQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFD+GK+RVGFAEA
Sbjct  446  TPEEYILKVGEGAEAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDFGKLRVGFAEA  505

Query  156  A  154
            A
Sbjct  506  A  506



>gb|EYU33885.1| hypothetical protein MIMGU_mgv1a004716mg [Erythranthe guttata]
Length=513

 Score =   302 bits (774),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 136/180 (76%), Positives = 159/180 (88%), Gaps = 0/180 (0%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLHDAMCSACEMT  514
            Q ++DLL+ EA+PKKICSQIGLCTF+G RGVS  IESVVDEK G S+ + +AMC ACEM 
Sbjct  334  QTIMDLLLAEAKPKKICSQIGLCTFDGTRGVSGAIESVVDEKEGRSSGMSEAMCPACEMA  393

Query  513  VVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDLS  334
            VVWMQNQL +N+TQ++IL+YVNELC +LPSPMG+S VDC  +S+MPSVS +IGGK FDL+
Sbjct  394  VVWMQNQLKQNKTQDHILNYVNELCEKLPSPMGQSAVDCASISSMPSVSLTIGGKKFDLA  453

Query  333  PNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEAA  154
            P EYILKVGEG+ AQCISGFT LD+PPPRGPLWILGD+FMGRYHTVFDYGK+RVGFAEAA
Sbjct  454  PKEYILKVGEGAQAQCISGFTGLDIPPPRGPLWILGDIFMGRYHTVFDYGKLRVGFAEAA  513



>gb|KDP20718.1| hypothetical protein JCGZ_21189 [Jatropha curcas]
Length=512

 Score =   302 bits (773),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 162/181 (90%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADL-HDAMCSACEM  517
            Q ++DLL+ME +PKKICSQ+GLCTF+G  GVSMGI+SVVDE+N  S+ +  DAMCSACEM
Sbjct  332  QTIMDLLLMEVQPKKICSQVGLCTFDGTHGVSMGIQSVVDERNDKSSGIARDAMCSACEM  391

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
            TVVWMQNQL +NQTQ+ IL+YVNELC+R+PSP+G+S VDCG LS+MP +SF+I GK+F+L
Sbjct  392  TVVWMQNQLRQNQTQDRILNYVNELCDRIPSPLGQSAVDCGSLSSMPIISFTIAGKLFEL  451

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P EYILKVGEGSAAQCISGFT LDVPPPRGPLWILGD+FMGRYHTVFD+G  RVGFAEA
Sbjct  452  TPEEYILKVGEGSAAQCISGFTGLDVPPPRGPLWILGDIFMGRYHTVFDFGNNRVGFAEA  511

Query  156  A  154
            A
Sbjct  512  A  512



>gb|KHG11144.1| Aspartic proteinase [Gossypium arboreum]
Length=514

 Score =   301 bits (772),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 139/181 (77%), Positives = 159/181 (88%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHDAMCSACEM  517
            Q +IDLLV +A P KICS+IGLC F+G+ GVSMGIE+VVDE NG S+  LH AMC ACEM
Sbjct  334  QTIIDLLVSQAEPMKICSRIGLCAFDGSHGVSMGIENVVDESNGKSSGILHSAMCPACEM  393

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQNQL ENQTQ+ IL Y N+LC+R+P+PMGES VDCG LS+MP++SF+IGGK FDL
Sbjct  394  AVVWMQNQLIENQTQDRILDYANQLCDRVPNPMGESTVDCGSLSSMPTISFTIGGKAFDL  453

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P EYILKVGEG+ AQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFD+GK+RVGFAEA
Sbjct  454  TPEEYILKVGEGAEAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDFGKLRVGFAEA  513

Query  156  A  154
            A
Sbjct  514  A  514



>gb|KJB67244.1| hypothetical protein B456_010G182400 [Gossypium raimondii]
 gb|KJB67245.1| hypothetical protein B456_010G182400 [Gossypium raimondii]
 gb|KJB67246.1| hypothetical protein B456_010G182400 [Gossypium raimondii]
Length=514

 Score =   301 bits (772),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 139/181 (77%), Positives = 159/181 (88%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHDAMCSACEM  517
            Q +IDLLV +A P KICSQIGLC F+G+ GVSMGIE+VVDE NG S+  LH AMC ACEM
Sbjct  334  QTIIDLLVSQAEPMKICSQIGLCAFDGSHGVSMGIENVVDESNGKSSGILHSAMCPACEM  393

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQNQL ENQTQ+ IL Y N+LC+R+P+PMGES VDCG LS+MP++SF+IGGK F+L
Sbjct  394  AVVWMQNQLMENQTQDRILDYANQLCDRVPNPMGESTVDCGSLSSMPTISFTIGGKAFEL  453

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P EYILKVGEG+ AQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFD+GK+RVGFAEA
Sbjct  454  TPEEYILKVGEGAEAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDFGKLRVGFAEA  513

Query  156  A  154
            A
Sbjct  514  A  514



>ref|XP_008224698.1| PREDICTED: aspartic proteinase-like [Prunus mume]
Length=514

 Score =   301 bits (772),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 138/180 (77%), Positives = 161/180 (89%), Gaps = 1/180 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHDAMCSACEM  517
            Q +++LL+ EARP K+CSQIGLCTF+G R VS+GIESVVD+ NG S+  LHDA CSACEM
Sbjct  334  QTIMNLLLAEARPDKVCSQIGLCTFDGTRSVSVGIESVVDKSNGKSSGILHDASCSACEM  393

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWM+NQL +NQTQ+ IL+YVNELC R+PSPMG+S VDCGKLS+MPSVSF+IGGKVF+L
Sbjct  394  AVVWMKNQLGQNQTQDRILNYVNELCERMPSPMGQSAVDCGKLSSMPSVSFTIGGKVFEL  453

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +PNEYILKVGEG  AQCISGFT +D+PPPRGPLWILGD+FMGRYHTVFD G+MRVGFAEA
Sbjct  454  TPNEYILKVGEGPQAQCISGFTNIDIPPPRGPLWILGDIFMGRYHTVFDSGRMRVGFAEA  513



>ref|XP_010244477.1| PREDICTED: aspartic proteinase A1-like isoform X3 [Nelumbo nucifera]
Length=514

 Score =   301 bits (770),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 141/181 (78%), Positives = 159/181 (88%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHDAMCSACEM  517
            Q ++++L+ EA PKKICSQIGLCTF+G RGVS GI+SVVDE N  S+  LHD MCSACEM
Sbjct  334  QVILEMLLAEAPPKKICSQIGLCTFDGTRGVSTGIKSVVDESNDKSSGGLHDTMCSACEM  393

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
            TVVWMQNQL +NQTQ+ IL+YVNELC+RLPSPMG+S VDC KLS+MP VSF+IGGKVFDL
Sbjct  394  TVVWMQNQLRQNQTQDRILNYVNELCDRLPSPMGQSSVDCDKLSSMPIVSFTIGGKVFDL  453

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P EYILKVGEG  AQCISGFTALD+PPPRGPLWILGDVFMG YHTVFDYG +RVGFA A
Sbjct  454  TPQEYILKVGEGPEAQCISGFTALDIPPPRGPLWILGDVFMGSYHTVFDYGNLRVGFAAA  513

Query  156  A  154
            A
Sbjct  514  A  514



>ref|XP_010244475.1| PREDICTED: aspartic proteinase A1-like isoform X1 [Nelumbo nucifera]
 ref|XP_010244476.1| PREDICTED: aspartic proteinase A1-like isoform X2 [Nelumbo nucifera]
Length=517

 Score =   301 bits (770),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 141/181 (78%), Positives = 159/181 (88%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHDAMCSACEM  517
            Q ++++L+ EA PKKICSQIGLCTF+G RGVS GI+SVVDE N  S+  LHD MCSACEM
Sbjct  337  QVILEMLLAEAPPKKICSQIGLCTFDGTRGVSTGIKSVVDESNDKSSGGLHDTMCSACEM  396

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
            TVVWMQNQL +NQTQ+ IL+YVNELC+RLPSPMG+S VDC KLS+MP VSF+IGGKVFDL
Sbjct  397  TVVWMQNQLRQNQTQDRILNYVNELCDRLPSPMGQSSVDCDKLSSMPIVSFTIGGKVFDL  456

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P EYILKVGEG  AQCISGFTALD+PPPRGPLWILGDVFMG YHTVFDYG +RVGFA A
Sbjct  457  TPQEYILKVGEGPEAQCISGFTALDIPPPRGPLWILGDVFMGSYHTVFDYGNLRVGFAAA  516

Query  156  A  154
            A
Sbjct  517  A  517



>emb|CAA54478.1| aspartic protease [Brassica oleracea]
Length=292

 Score =   293 bits (749),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 136/181 (75%), Positives = 159/181 (88%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNG-VSADLHDAMCSACEM  517
            Q ++DLL+ E +PKKICSQIGLCTF+G RGVSMGIESVVD++N  +S  + DA CSACEM
Sbjct  112  QTILDLLLSETQPKKICSQIGLCTFDGKRGVSMGIESVVDKENAKLSNGVGDAACSACEM  171

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVW+Q+QL +N TQE IL YVNELC R+PSPMGES VDC +LSTMP+VS +IGGKVFDL
Sbjct  172  AVVWIQSQLRQNMTQERILDYVNELCRRIPSPMGESAVDCAQLSTMPTVSLTIGGKVFDL  231

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P+EY+LKVGEG+AAQCISGF ALDV PPRGPLWILGDVFMG+YHTVFD+GK +VGFAEA
Sbjct  232  APHEYVLKVGEGAAAQCISGFIALDVAPPRGPLWILGDVFMGKYHTVFDFGKAQVGFAEA  291

Query  156  A  154
            A
Sbjct  292  A  292



>ref|XP_007211538.1| hypothetical protein PRUPE_ppa003924mg [Prunus persica]
 gb|EMJ12737.1| hypothetical protein PRUPE_ppa003924mg [Prunus persica]
Length=539

 Score =   300 bits (769),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 138/181 (76%), Positives = 160/181 (88%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHDAMCSACEM  517
            Q +++LL+ EARP K+CSQIGLCTF+G R VSMGIESVVD+ NG S+  LHDA CSACEM
Sbjct  359  QTIMNLLLAEARPDKVCSQIGLCTFDGTRSVSMGIESVVDKSNGKSSGILHDASCSACEM  418

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWM+NQL +NQTQ+ IL+YVNELC R+PSPMG+S VDCG+LS+MPSVSF+IGGKVF+L
Sbjct  419  AVVWMKNQLGQNQTQDRILNYVNELCERMPSPMGQSAVDCGRLSSMPSVSFTIGGKVFEL  478

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +PNEYILKVGEG  AQCISGF  +D+PPPRGPLWILGD+FMGRYHTVFD G MRVGFAEA
Sbjct  479  TPNEYILKVGEGPQAQCISGFINIDIPPPRGPLWILGDIFMGRYHTVFDSGNMRVGFAEA  538

Query  156  A  154
            A
Sbjct  539  A  539



>dbj|BAD93734.1| putative aspartic proteinase [Arabidopsis thaliana]
Length=205

 Score =   289 bits (740),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 156/181 (86%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNG-VSADLHDAMCSACEM  517
            Q ++DLL+ E +PKKICSQIGLCTF+G RGVSMGIESVVD++N  +S  + DA CSACEM
Sbjct  25   QTILDLLLSETQPKKICSQIGLCTFDGTRGVSMGIESVVDKENAKLSNGVGDAACSACEM  84

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVW+Q+QL +N TQE IL+YVNELC RLPSPMGES VDC +LSTMP+VS +IGGKVFDL
Sbjct  85   AVVWIQSQLRQNMTQERILNYVNELCERLPSPMGESAVDCAQLSTMPTVSLTIGGKVFDL  144

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P EY+LKVGEG  AQCISGF ALDV PPRGPLWILGDVFMG+YHTVFD+G  +VGFAEA
Sbjct  145  APEEYVLKVGEGPVAQCISGFIALDVAPPRGPLWILGDVFMGKYHTVFDFGNEQVGFAEA  204

Query  156  A  154
            A
Sbjct  205  A  205



>gb|KGN64503.1| Aspartic proteinase [Cucumis sativus]
Length=489

 Score =   298 bits (762),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 154/171 (90%), Gaps = 1/171 (1%)
 Frame = -2

Query  663  ARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHDAMCSACEMTVVWMQNQLS  487
            A PKKICSQI LCTF+G RGVSMGIESVVDE  G S+D L D MCS CEMTVVWMQNQL 
Sbjct  319  ADPKKICSQIKLCTFDGTRGVSMGIESVVDENAGKSSDGLRDGMCSVCEMTVVWMQNQLR  378

Query  486  ENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVG  307
            +NQT+E I++Y+NELC+R+PSPMG+S VDCG LS+MPSVSF+IG KVFDL+P EYILKVG
Sbjct  379  QNQTKERIINYINELCDRMPSPMGQSAVDCGTLSSMPSVSFTIGDKVFDLAPEEYILKVG  438

Query  306  EGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEAA  154
            EG+AAQCISGFTA D+PPPRGPLWILGDVFMGRYHTVFD+GK+RVGFAEAA
Sbjct  439  EGAAAQCISGFTAFDIPPPRGPLWILGDVFMGRYHTVFDFGKLRVGFAEAA  489



>ref|XP_008349314.1| PREDICTED: aspartic proteinase-like [Malus domestica]
Length=507

 Score =   298 bits (764),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 136/181 (75%), Positives = 160/181 (88%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADL-HDAMCSACEM  517
            Q ++DLL+ EA+PK++CSQIGLCTF+G R VSMGIESVVDE  G S+ + HDA CSACEM
Sbjct  327  QTILDLLLAEAQPKQVCSQIGLCTFDGTRSVSMGIESVVDENGGKSSGITHDASCSACEM  386

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQ QL +N TQ+ IL+YVNELC ++P+P+G+S VDCGKLS+MPSVSF+IGGKVF+L
Sbjct  387  AVVWMQTQLKQNLTQDRILNYVNELCEKMPNPLGQSAVDCGKLSSMPSVSFTIGGKVFEL  446

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P EYILKVGEGS AQCISGFT +D+PPPRGPLWILGD+FMGRYHTVFD GKMRVGFAEA
Sbjct  447  TPEEYILKVGEGSQAQCISGFTNMDIPPPRGPLWILGDIFMGRYHTVFDAGKMRVGFAEA  506

Query  156  A  154
            A
Sbjct  507  A  507



>ref|XP_002529926.1| Aspartic proteinase precursor, putative [Ricinus communis]
 gb|EEF32480.1| Aspartic proteinase precursor, putative [Ricinus communis]
Length=514

 Score =   298 bits (764),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 138/181 (76%), Positives = 160/181 (88%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEK-NGVSADLHDAMCSACEM  517
            + +I +L+ + +P+KICSQIGLCTF+G+RGVSMGIESVV+EK   V+  LHDAMCS CEM
Sbjct  334  ETIIAMLLAKDQPQKICSQIGLCTFDGSRGVSMGIESVVNEKIQEVAGGLHDAMCSTCEM  393

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQNQL +NQTQE+IL+YVNELC RLPSPMGES VDCG LSTMP+VSF+IGG+VFDL
Sbjct  394  AVVWMQNQLKQNQTQEHILNYVNELCERLPSPMGESAVDCGSLSTMPNVSFTIGGRVFDL  453

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P +Y+LKVG+G AAQCISGFTALDVPPPRGPLWILGDVFMG +HTVFDYG  RVGFAE 
Sbjct  454  APEQYVLKVGDGEAAQCISGFTALDVPPPRGPLWILGDVFMGPFHTVFDYGNKRVGFAEV  513

Query  156  A  154
            A
Sbjct  514  A  514



>ref|XP_011086197.1| PREDICTED: aspartic proteinase A1-like isoform X2 [Sesamum indicum]
Length=510

 Score =   298 bits (763),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 133/180 (74%), Positives = 158/180 (88%), Gaps = 0/180 (0%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLHDAMCSACEMT  514
            Q ++DLL+ EA+P+KICSQ+GLCTF+G RGVS GIESVVDE+ G S+ LHDAMC ACEM 
Sbjct  331  QTILDLLLAEAKPEKICSQVGLCTFDGTRGVSGGIESVVDEQGGRSSSLHDAMCPACEMA  390

Query  513  VVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDLS  334
            +VWM+NQL +N+TQ+ ILSY NELC RLPSP+GES VDCG++ +MPSVSF+IGGK F LS
Sbjct  391  IVWMKNQLEQNKTQDRILSYANELCERLPSPLGESAVDCGRIPSMPSVSFTIGGKEFKLS  450

Query  333  PNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEAA  154
              +YILKVGEG+ AQCISGF+ LD+PPPRGPLWILGD+FMG YHTVFDYGK+RVGFAEAA
Sbjct  451  AEQYILKVGEGAEAQCISGFSGLDIPPPRGPLWILGDIFMGPYHTVFDYGKLRVGFAEAA  510



>ref|XP_007020768.1| Aspartic proteinase A1 [Theobroma cacao]
 gb|EOY12293.1| Aspartic proteinase A1 [Theobroma cacao]
Length=514

 Score =   298 bits (763),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 158/181 (87%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNG-VSADLHDAMCSACEM  517
            + +ID+L+ + +P KICSQIGLCTF+G RGVS GIESVV E  G  + DLHDAMCS CEM
Sbjct  334  ETIIDMLLSKDQPLKICSQIGLCTFDGTRGVSTGIESVVHENAGKATGDLHDAMCSTCEM  393

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
            TV+WMQNQL +NQTQE IL Y+NELC+RLPSPMGES VDC  LSTMP+VSF+IGGK+F+L
Sbjct  394  TVIWMQNQLKQNQTQERILEYINELCDRLPSPMGESAVDCSSLSTMPNVSFTIGGKIFEL  453

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            SP +Y+LKVGEG  AQC+SGFTALDVPPPRGPLWILGDVFMG++HTVFDYG ++VGFAEA
Sbjct  454  SPEQYVLKVGEGDVAQCLSGFTALDVPPPRGPLWILGDVFMGQFHTVFDYGNLQVGFAEA  513

Query  156  A  154
            A
Sbjct  514  A  514



>ref|XP_011086196.1| PREDICTED: aspartic proteinase A1-like isoform X1 [Sesamum indicum]
Length=561

 Score =   299 bits (766),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 133/180 (74%), Positives = 158/180 (88%), Gaps = 0/180 (0%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLHDAMCSACEMT  514
            Q ++DLL+ EA+P+KICSQ+GLCTF+G RGVS GIESVVDE+ G S+ LHDAMC ACEM 
Sbjct  382  QTILDLLLAEAKPEKICSQVGLCTFDGTRGVSGGIESVVDEQGGRSSSLHDAMCPACEMA  441

Query  513  VVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDLS  334
            +VWM+NQL +N+TQ+ ILSY NELC RLPSP+GES VDCG++ +MPSVSF+IGGK F LS
Sbjct  442  IVWMKNQLEQNKTQDRILSYANELCERLPSPLGESAVDCGRIPSMPSVSFTIGGKEFKLS  501

Query  333  PNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEAA  154
              +YILKVGEG+ AQCISGF+ LD+PPPRGPLWILGD+FMG YHTVFDYGK+RVGFAEAA
Sbjct  502  AEQYILKVGEGAEAQCISGFSGLDIPPPRGPLWILGDIFMGPYHTVFDYGKLRVGFAEAA  561



>ref|XP_009357472.1| PREDICTED: aspartic proteinase-like [Pyrus x bretschneideri]
 ref|XP_009357473.1| PREDICTED: aspartic proteinase-like [Pyrus x bretschneideri]
Length=507

 Score =   297 bits (761),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 136/181 (75%), Positives = 159/181 (88%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADL-HDAMCSACEM  517
            Q ++DLL  EA+PKK+CSQIGLCTF+G R VSMGIESVVDE  G S+ + HDA CSACEM
Sbjct  327  QTILDLLFAEAQPKKVCSQIGLCTFDGTRSVSMGIESVVDENGGKSSGITHDASCSACEM  386

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQ QL  N T++ IL+YVNELC ++P+P+G+S VDCGKLS+MPSVSF+IGGKVF+L
Sbjct  387  AVVWMQTQLKHNLTEDRILNYVNELCEKMPNPLGQSAVDCGKLSSMPSVSFTIGGKVFEL  446

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P+EYILKVGEGS AQCISGFT +D+PPPRGPLWILGD+FMGRYHTVFD GKMRVGFAEA
Sbjct  447  TPDEYILKVGEGSQAQCISGFTNMDIPPPRGPLWILGDIFMGRYHTVFDAGKMRVGFAEA  506

Query  156  A  154
            A
Sbjct  507  A  507



>ref|XP_010035554.1| PREDICTED: aspartic proteinase A1-like [Eucalyptus grandis]
 ref|XP_010035555.1| PREDICTED: aspartic proteinase A1-like [Eucalyptus grandis]
 gb|KCW46979.1| hypothetical protein EUGRSUZ_K00787 [Eucalyptus grandis]
Length=514

 Score =   298 bits (762),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 158/181 (87%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHDAMCSACEM  517
            + ++++L+ EA+P+KICSQIG CTF+G  GV MGIESVVDE  G S+  LHDAMCSACEM
Sbjct  334  KTILEMLMTEAKPQKICSQIGFCTFDGTHGVRMGIESVVDETKGKSSGGLHDAMCSACEM  393

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQNQL+ NQT++ IL+YVNELC+R+PSPMGES VDC  LS+MP VSF+IGGKVFDL
Sbjct  394  AVVWMQNQLTRNQTEDQILNYVNELCDRIPSPMGESAVDCNSLSSMPRVSFTIGGKVFDL  453

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P +Y+LKVGEG A+QCISGFTALDV PPRGPLWILGD+FMG+YHTVFDYG  RVGFAEA
Sbjct  454  APEQYVLKVGEGGASQCISGFTALDVAPPRGPLWILGDIFMGKYHTVFDYGNQRVGFAEA  513

Query  156  A  154
            A
Sbjct  514  A  514



>emb|CAC86003.1| aspartic proteinase [Theobroma cacao]
Length=514

 Score =   297 bits (761),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 158/181 (87%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNG-VSADLHDAMCSACEM  517
            + +ID+L+ + +P KICSQIGLCTF+G RGVS GIESVV E  G  + DLHDAMCS CEM
Sbjct  334  ETIIDMLLSKDQPLKICSQIGLCTFDGTRGVSTGIESVVHENVGKATGDLHDAMCSTCEM  393

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
            TV+WMQNQL +NQTQE IL Y+NELC+RLPSPMGES VDC  LSTMP+VSF+IGGK+F+L
Sbjct  394  TVIWMQNQLKQNQTQERILEYINELCDRLPSPMGESAVDCSSLSTMPNVSFTIGGKIFEL  453

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            SP +Y+LKVGEG  AQC+SGFTALDVPPPRGPLWILGDVFMG++HTVFDYG ++VGFAEA
Sbjct  454  SPEQYVLKVGEGDVAQCLSGFTALDVPPPRGPLWILGDVFMGQFHTVFDYGNLQVGFAEA  513

Query  156  A  154
            A
Sbjct  514  A  514



>ref|XP_002279049.1| PREDICTED: aspartic proteinase A1 [Vitis vinifera]
 emb|CBI26663.3| unnamed protein product [Vitis vinifera]
Length=514

 Score =   297 bits (760),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 157/181 (87%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHDAMCSACEM  517
            Q +ID+L+ + +P+KICSQIGLC FNG RGVSMGIESVVDE N  ++D LHD MCSAC M
Sbjct  334  QIIIDMLLTKEQPQKICSQIGLCAFNGIRGVSMGIESVVDENNSKASDGLHDTMCSACSM  393

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVW+QN+L +N+T + IL YVNELC+RLPSPMGES VDCG LS+MP+VS +IGGKVFDL
Sbjct  394  AVVWIQNKLGQNETIDRILKYVNELCDRLPSPMGESAVDCGSLSSMPNVSLTIGGKVFDL  453

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            SP +YILKVGEG  AQCISGFTALDVPPP GPLWILGDVFMG+YHTVFDYG M+VGFAEA
Sbjct  454  SPKQYILKVGEGEIAQCISGFTALDVPPPHGPLWILGDVFMGQYHTVFDYGNMKVGFAEA  513

Query  156  A  154
            A
Sbjct  514  A  514



>ref|XP_009415269.1| PREDICTED: aspartic proteinase oryzasin-1-like [Musa acuminata 
subsp. malaccensis]
Length=514

 Score =   296 bits (759),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 160/181 (88%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLH-DAMCSACEM  517
            Q+++DLL+ E +P KIC+QIGLCTF+G RG+S+G+ESVV++   +SA L  DAMCSACEM
Sbjct  334  QQILDLLLAETQPAKICAQIGLCTFDGTRGISIGLESVVNDNGDISAGLQSDAMCSACEM  393

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQNQL +NQT+E+IL+Y+NELC+RLPSPMGES VDCG L++MP VSF+IGGKVF+L
Sbjct  394  AVVWMQNQLRQNQTKEHILNYINELCDRLPSPMGESAVDCGALASMPGVSFTIGGKVFEL  453

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
             P +YILKVGEGS AQCISGFTA D+PPPRGPLWILGDVFMG YHTVFDYG +R+GFAEA
Sbjct  454  KPEQYILKVGEGSVAQCISGFTAFDIPPPRGPLWILGDVFMGAYHTVFDYGNLRIGFAEA  513

Query  156  A  154
            A
Sbjct  514  A  514



>gb|ACX55830.1| aspartic proteinase 2 [Castanea mollissima]
Length=513

 Score =   296 bits (759),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 136/180 (76%), Positives = 156/180 (87%), Gaps = 0/180 (0%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLHDAMCSACEMT  514
            + +I +L+ + +P KICSQIGLCTF+G +GVSM IESVVD  +  S  L DAMCS CEMT
Sbjct  334  ETIIKMLLEKDQPMKICSQIGLCTFDGTQGVSMDIESVVDNTHKASNGLRDAMCSTCEMT  393

Query  513  VVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDLS  334
            VVWMQNQL +NQTQ+ IL+YVNELC+RLPSPMGES VDCG LS++P+VS +IGG+VFDLS
Sbjct  394  VVWMQNQLKQNQTQDRILTYVNELCDRLPSPMGESAVDCGSLSSLPNVSLTIGGRVFDLS  453

Query  333  PNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEAA  154
            P +Y+LKVGEG AAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYG  RVGFAEAA
Sbjct  454  PEQYVLKVGEGEAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGNQRVGFAEAA  513



>ref|XP_010096873.1| Aspartic proteinase [Morus notabilis]
 gb|EXB66327.1| Aspartic proteinase [Morus notabilis]
Length=514

 Score =   296 bits (759),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 156/181 (86%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNG-VSADLHDAMCSACEM  517
            Q +I+ L+ + +PKKIC+QIGLC+F+G RGVSMGI+SVVDE  G  S DL D MCSACEM
Sbjct  334  QTIIESLLAKDQPKKICAQIGLCSFDGTRGVSMGIKSVVDENVGKASGDLRDGMCSACEM  393

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQNQ+ +NQTQ+ IL+YVN+LC RLPSPMGES VDCG LS++P VSF+IGGK F+L
Sbjct  394  AVVWMQNQIKQNQTQDQILNYVNQLCERLPSPMGESAVDCGSLSSLPDVSFTIGGKKFEL  453

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
             P EYILKVGEG  AQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYG MR+GFAEA
Sbjct  454  KPEEYILKVGEGDVAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGNMRIGFAEA  513

Query  156  A  154
            A
Sbjct  514  A  514



>gb|ACX55829.1| aspartic proteinase 1 [Castanea mollissima]
Length=513

 Score =   296 bits (759),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 137/180 (76%), Positives = 155/180 (86%), Gaps = 0/180 (0%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLHDAMCSACEMT  514
            + +I +L+ + +P KICSQIGLCTF+G RGVSM IESVVD     S  L DAMCS CEMT
Sbjct  334  ETIIKMLLEKDQPMKICSQIGLCTFDGVRGVSMDIESVVDNTRKASNGLRDAMCSTCEMT  393

Query  513  VVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDLS  334
            VVWMQNQL +NQTQ+ IL+YVNELC+RLPSPMGES VDCG LS++P+VS +IGG+VFDLS
Sbjct  394  VVWMQNQLKQNQTQDRILTYVNELCDRLPSPMGESAVDCGSLSSLPNVSLTIGGRVFDLS  453

Query  333  PNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEAA  154
            P +Y+LKVGEG AAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYG  RVGFAEAA
Sbjct  454  PEQYVLKVGEGEAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGNQRVGFAEAA  513



>ref|XP_008385865.1| PREDICTED: aspartic proteinase A1-like [Malus domestica]
Length=228

 Score =   286 bits (733),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 155/181 (86%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEK-NGVSADLHDAMCSACEM  517
            + +I+ ++ + +P KICS IGLC+F+G RGVS+GI+SVV+E  + VS  L DA CSACEM
Sbjct  48   ETIIERILAKDQPAKICSXIGLCSFDGTRGVSIGIKSVVEENAHKVSGGLSDATCSACEM  107

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
            TVVWMQNQL +NQTQE IL YVN+LC RLPSPMGES VDCG LS+MP+VSF+IGG+ FDL
Sbjct  108  TVVWMQNQLKQNQTQERILDYVNQLCERLPSPMGESAVDCGGLSSMPNVSFTIGGRTFDL  167

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P +Y+LKVGEG  AQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYG  R+GFAEA
Sbjct  168  TPEQYVLKVGEGDVAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGNERIGFAEA  227

Query  156  A  154
            A
Sbjct  228  A  228



>ref|XP_011046729.1| PREDICTED: aspartic proteinase A1-like [Populus euphratica]
 ref|XP_011046731.1| PREDICTED: aspartic proteinase A1-like [Populus euphratica]
Length=515

 Score =   296 bits (758),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 136/179 (76%), Positives = 157/179 (88%), Gaps = 1/179 (1%)
 Frame = -2

Query  687  MIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHDAMCSACEMTV  511
            +I++L+ + +P+KICSQIGLCTF+G RGVS+GIESVV+E    ++D  HDAMCS CEM V
Sbjct  337  IIEMLLAKDQPQKICSQIGLCTFDGTRGVSVGIESVVNEHAQKASDGFHDAMCSTCEMAV  396

Query  510  VWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDLSP  331
            VWMQNQL +NQTQE IL YVNELC RLPSPMGES VDC  LS+MP+VSF+IGG+VFDLSP
Sbjct  397  VWMQNQLKQNQTQERILDYVNELCERLPSPMGESAVDCDGLSSMPNVSFTIGGRVFDLSP  456

Query  330  NEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEAA  154
             +Y+LKVGEG  AQCISGFTALDVPPPRGPLWILGDVFMGR+HTVFDYG MRVGFAEA+
Sbjct  457  EQYVLKVGEGDVAQCISGFTALDVPPPRGPLWILGDVFMGRFHTVFDYGNMRVGFAEAS  515



>gb|KCW66977.1| hypothetical protein EUGRSUZ_F00741 [Eucalyptus grandis]
Length=386

 Score =   292 bits (747),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 158/181 (87%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKN-GVSADLHDAMCSACEM  517
            + +I  L+ +  P KICS+IGLCTF+G RGVSMGIE+VVD KN  VS  L+DAMCS CEM
Sbjct  206  ETIIQKLLAKEEPHKICSEIGLCTFDGTRGVSMGIETVVDGKNEKVSGRLNDAMCSTCEM  265

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
            TVVWMQNQL  N+TQ+ ILSYVNELC+RLPSPMGES VDC  LS+MP+VSF+IGG+VFDL
Sbjct  266  TVVWMQNQLRLNETQDRILSYVNELCSRLPSPMGESAVDCAGLSSMPNVSFTIGGRVFDL  325

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            SP +YILKVG+G +AQCISGFTALDVPPPRGPLWILGDVFMG+YHTVFDYG +RVGFA+A
Sbjct  326  SPEQYILKVGDGDSAQCISGFTALDVPPPRGPLWILGDVFMGQYHTVFDYGNLRVGFAKA  385

Query  156  A  154
            A
Sbjct  386  A  386



>gb|KCW77002.1| hypothetical protein EUGRSUZ_D01351 [Eucalyptus grandis]
Length=514

 Score =   296 bits (757),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 159/181 (88%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHDAMCSACEM  517
            Q ++DLL+ EA PKKICSQ+G+CTF+GNRGVSMGIESVVD+  G S+  +HDAMCSACEM
Sbjct  334  QTIMDLLLAEASPKKICSQVGVCTFDGNRGVSMGIESVVDKTKGRSSGFMHDAMCSACEM  393

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQ+QL +NQTQ+ +L+YVNELC+R+PSP GES VDC KLS+MP VSF++GGKVFDL
Sbjct  394  AVVWMQSQLEQNQTQKRVLNYVNELCDRVPSPNGESSVDCEKLSSMPVVSFTLGGKVFDL  453

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            SPNEY+LKVG+    QCISGFT LDVPPPRGPLWILGDVFM RYHTVFDYG +RVGFAEA
Sbjct  454  SPNEYVLKVGQEPNTQCISGFTGLDVPPPRGPLWILGDVFMRRYHTVFDYGNIRVGFAEA  513

Query  156  A  154
            A
Sbjct  514  A  514



>ref|XP_008348384.1| PREDICTED: LOW QUALITY PROTEIN: aspartic proteinase A1-like [Malus 
domestica]
Length=469

 Score =   294 bits (753),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 133/180 (74%), Positives = 156/180 (87%), Gaps = 0/180 (0%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLHDAMCSACEMT  514
            + +I+ ++ + +P KICSQIGLC+F+G  GVS+GI+SVV+  + VS DL DA CSACEMT
Sbjct  290  ETIIERILAKDQPAKICSQIGLCSFDGTHGVSIGIKSVVENTHKVSGDLSDATCSACEMT  349

Query  513  VVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDLS  334
            VVWMQNQL +NQTQE IL YVN+LC+RLPSPMGES VDC  LS+MPSVSF+IGG+ FDL+
Sbjct  350  VVWMQNQLKQNQTQERILDYVNQLCDRLPSPMGESAVDCAGLSSMPSVSFTIGGRTFDLT  409

Query  333  PNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEAA  154
            P +Y+LKVGEG AAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYG  R+GFAEAA
Sbjct  410  PEQYVLKVGEGDAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGNERIGFAEAA  469



>ref|XP_007153977.1| hypothetical protein PHAVU_003G0808001g, partial [Phaseolus vulgaris]
 gb|ESW25971.1| hypothetical protein PHAVU_003G0808001g, partial [Phaseolus vulgaris]
Length=369

 Score =   291 bits (744),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 155/181 (86%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDE-KNGVSADLHDAMCSACEM  517
            Q +++LL+ E +PKKICSQIGLCTF+G RG+ MGI SVVDE     S  LHDA CSACEM
Sbjct  189  QTILNLLLAETQPKKICSQIGLCTFDGTRGIDMGIASVVDEIARKSSGGLHDAACSACEM  248

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQNQLS NQTQ+ ILSY+N+LC+++PSPMGES +DCG +S++P VSF+IGG+ FDL
Sbjct  249  AVVWMQNQLSRNQTQDQILSYINQLCDKMPSPMGESSIDCGNISSLPVVSFTIGGRTFDL  308

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
             P EYILKVGEG  AQCISGFTA+D+PPPRGPLWILGDVFMGRYHTVFD+G +RVGFA+A
Sbjct  309  LPEEYILKVGEGPVAQCISGFTAIDIPPPRGPLWILGDVFMGRYHTVFDFGNLRVGFADA  368

Query  156  A  154
            A
Sbjct  369  A  369



>ref|XP_010052871.1| PREDICTED: aspartic proteinase [Eucalyptus grandis]
Length=522

 Score =   296 bits (757),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 159/181 (88%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHDAMCSACEM  517
            Q ++DLL+ EA PKKICSQ+G+CTF+GNRGVSMGIESVVD+  G S+  +HDAMCSACEM
Sbjct  342  QTIMDLLLAEASPKKICSQVGVCTFDGNRGVSMGIESVVDKTKGRSSGFMHDAMCSACEM  401

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQ+QL +NQTQ+ +L+YVNELC+R+PSP GES VDC KLS+MP VSF++GGKVFDL
Sbjct  402  AVVWMQSQLEQNQTQKRVLNYVNELCDRVPSPNGESSVDCEKLSSMPVVSFTLGGKVFDL  461

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            SPNEY+LKVG+    QCISGFT LDVPPPRGPLWILGDVFM RYHTVFDYG +RVGFAEA
Sbjct  462  SPNEYVLKVGQEPNTQCISGFTGLDVPPPRGPLWILGDVFMRRYHTVFDYGNIRVGFAEA  521

Query  156  A  154
            A
Sbjct  522  A  522



>gb|KHN33009.1| Aspartic proteinase [Glycine soja]
Length=504

 Score =   295 bits (755),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 157/181 (87%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDE-KNGVSADLHDAMCSACEM  517
            Q +++LL+ EA+PKKICSQIGLCTF+G  GVSMGIESVVD+ +   S  + DA CSACEM
Sbjct  324  QTILELLLAEAKPKKICSQIGLCTFDGTHGVSMGIESVVDKNEKKSSGGIRDAGCSACEM  383

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             V+WMQNQL +NQT++ I+ Y NELC +LP+PMG S VDCGKLS+MP VSF+IGGKVFDL
Sbjct  384  AVIWMQNQLRQNQTEDRIIDYANELCEKLPNPMGPSSVDCGKLSSMPIVSFTIGGKVFDL  443

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            SP EYILKVGEG  AQCISGFTALDVPPPRGPLWILGDVFMGRYHT+FDYGK+RVGFAEA
Sbjct  444  SPEEYILKVGEGPEAQCISGFTALDVPPPRGPLWILGDVFMGRYHTIFDYGKLRVGFAEA  503

Query  156  A  154
            A
Sbjct  504  A  504



>dbj|BAB20970.1| aspartic proteinase 2 [Nepenthes alata]
Length=514

 Score =   295 bits (756),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 160/181 (88%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHDAMCSACEM  517
            + ++D LV EA+P+KICSQIGLCTF+G RGVSMGIESVV++  G S+D L DAMC+ACEM
Sbjct  334  KAILDALVAEAQPQKICSQIGLCTFDGKRGVSMGIESVVEKNPGNSSDGLQDAMCTACEM  393

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQNQL +N+T+E IL+YVNELCNRLPSPMGES VDCG LS+MP+VS +IGGKVFDL
Sbjct  394  AVVWMQNQLRQNRTEEQILNYVNELCNRLPSPMGESSVDCGSLSSMPNVSLTIGGKVFDL  453

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            SP +Y+LKVGEG AAQCISGF ALD+ PPRGPLWILGD+FMG+YHTVFDYG + VGFAEA
Sbjct  454  SPEKYVLKVGEGVAAQCISGFIALDIAPPRGPLWILGDIFMGQYHTVFDYGNLSVGFAEA  513

Query  156  A  154
            A
Sbjct  514  A  514



>ref|XP_003546159.1| PREDICTED: aspartic proteinase-like [Glycine max]
Length=507

 Score =   295 bits (755),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 157/181 (87%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDE-KNGVSADLHDAMCSACEM  517
            Q +++LL+ EA+PKKICSQIGLCTF+G  GVSMGIESVVD+ +   S  + DA CSACEM
Sbjct  327  QTILELLLAEAKPKKICSQIGLCTFDGTHGVSMGIESVVDKNEKKSSGGIRDAGCSACEM  386

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             V+WMQNQL +NQT++ I+ Y NELC +LP+PMG S VDCGKLS+MP VSF+IGGKVFDL
Sbjct  387  AVIWMQNQLRQNQTEDRIIDYANELCEKLPNPMGPSSVDCGKLSSMPIVSFTIGGKVFDL  446

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            SP EYILKVGEG  AQCISGFTALDVPPPRGPLWILGDVFMGRYHT+FDYGK+RVGFAEA
Sbjct  447  SPEEYILKVGEGPEAQCISGFTALDVPPPRGPLWILGDVFMGRYHTIFDYGKLRVGFAEA  506

Query  156  A  154
            A
Sbjct  507  A  507



>gb|KJB69259.1| hypothetical protein B456_011G012800 [Gossypium raimondii]
Length=514

 Score =   295 bits (755),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 139/181 (77%), Positives = 159/181 (88%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLH-DAMCSACEM  517
            Q +IDLL+ E +P+KICSQIGLCTF+G  GVSMGIESVV+E NG S+ +  +AMC ACEM
Sbjct  334  QTIIDLLLAETQPQKICSQIGLCTFDGAHGVSMGIESVVEEGNGKSSGVQFNAMCPACEM  393

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQNQL +NQT + IL+YVN+LC+R+PSPMGES V+CG LS+MP+VSF+IG KVFDL
Sbjct  394  AVVWMQNQLKQNQTLDVILNYVNQLCDRMPSPMGESAVECGSLSSMPTVSFTIGDKVFDL  453

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            SP EYILKVGEG  AQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFD+GK RVGFAEA
Sbjct  454  SPEEYILKVGEGPQAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDFGKERVGFAEA  513

Query  156  A  154
            A
Sbjct  514  A  514



>gb|KHG11143.1| Aspartic proteinase [Gossypium arboreum]
Length=520

 Score =   295 bits (755),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 139/187 (74%), Positives = 159/187 (85%), Gaps = 7/187 (4%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHDAMCSACEM  517
            Q +IDLLV +A P KICS+IGLC F+G+ GVSMGIE+VVDE NG S+  LH AMC ACEM
Sbjct  334  QTIIDLLVSQAEPMKICSRIGLCAFDGSHGVSMGIENVVDESNGKSSGILHSAMCPACEM  393

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQNQL ENQTQ+ IL Y N+LC+R+P+PMGES VDCG LS+MP++SF+IGGK FDL
Sbjct  394  AVVWMQNQLIENQTQDRILDYANQLCDRVPNPMGESTVDCGSLSSMPTISFTIGGKAFDL  453

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLW------ILGDVFMGRYHTVFDYGKMR  175
            +P EYILKVGEG+ AQCISGFTALDVPPPRGPLW      ILGDVFMGRYHTVFD+GK+R
Sbjct  454  TPEEYILKVGEGAEAQCISGFTALDVPPPRGPLWYFIFALILGDVFMGRYHTVFDFGKLR  513

Query  174  VGFAEAA  154
            VGFAEAA
Sbjct  514  VGFAEAA  520



>gb|ABO93618.1| aspartic proteinase [Vitis vinifera]
Length=194

 Score =   284 bits (726),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 133/171 (78%), Positives = 152/171 (89%), Gaps = 1/171 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNG-VSADLHDAMCSACEM  517
            + ++DLL+ EA P+KICSQIGLCTF+G RGV MGIESVVDEKNG  S+ +HDA CSACEM
Sbjct  24   ETIMDLLLSEASPQKICSQIGLCTFDGTRGVGMGIESVVDEKNGDKSSGVHDAGCSACEM  83

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQ+QL +NQT+E IL YVNELC+RLPSPMGES VDC +LS+MP+VS +I GKVFDL
Sbjct  84   AVVWMQSQLRQNQTKERILEYVNELCDRLPSPMGESAVDCLQLSSMPNVSLTISGKVFDL  143

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYG  184
            S NEY+LKVGEG+AAQCISGF A+DVPPPRGPLWILGDVFMGRYHTVFDYG
Sbjct  144  SANEYVLKVGEGAAAQCISGFIAMDVPPPRGPLWILGDVFMGRYHTVFDYG  194



>ref|XP_003534602.1| PREDICTED: aspartic proteinase [Glycine max]
 gb|KHN40871.1| Aspartic proteinase [Glycine soja]
Length=507

 Score =   295 bits (754),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 136/181 (75%), Positives = 158/181 (87%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDE-KNGVSADLHDAMCSACEM  517
            Q +++LL+ EA+PKKICSQIGLCTF+G  GVSMGIESVVD+ +   S  + DA CSACEM
Sbjct  327  QTILELLLAEAKPKKICSQIGLCTFDGTHGVSMGIESVVDKNERKSSGSIRDAGCSACEM  386

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             V+WMQNQL +NQT++ I+ Y NELC++LP+PMG+S VDC KLS+MP VSF+IGGKVFDL
Sbjct  387  AVIWMQNQLRQNQTEDRIIDYANELCDKLPNPMGQSSVDCEKLSSMPIVSFTIGGKVFDL  446

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            SP EYILKVGEG  AQCISGFTALDVPPPRGPLWILGDVFMGRYHT+FDYGK+RVGFAEA
Sbjct  447  SPQEYILKVGEGPEAQCISGFTALDVPPPRGPLWILGDVFMGRYHTIFDYGKLRVGFAEA  506

Query  156  A  154
            A
Sbjct  507  A  507



>gb|KJB69260.1| hypothetical protein B456_011G012800 [Gossypium raimondii]
Length=521

 Score =   295 bits (754),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 139/181 (77%), Positives = 159/181 (88%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLH-DAMCSACEM  517
            Q +IDLL+ E +P+KICSQIGLCTF+G  GVSMGIESVV+E NG S+ +  +AMC ACEM
Sbjct  341  QTIIDLLLAETQPQKICSQIGLCTFDGAHGVSMGIESVVEEGNGKSSGVQFNAMCPACEM  400

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQNQL +NQT + IL+YVN+LC+R+PSPMGES V+CG LS+MP+VSF+IG KVFDL
Sbjct  401  AVVWMQNQLKQNQTLDVILNYVNQLCDRMPSPMGESAVECGSLSSMPTVSFTIGDKVFDL  460

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            SP EYILKVGEG  AQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFD+GK RVGFAEA
Sbjct  461  SPEEYILKVGEGPQAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDFGKERVGFAEA  520

Query  156  A  154
            A
Sbjct  521  A  521



>ref|XP_009110686.1| PREDICTED: aspartic proteinase A1-like [Brassica rapa]
Length=507

 Score =   294 bits (752),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 159/181 (88%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNG-VSADLHDAMCSACEM  517
            Q ++DLL+ E +PKKICSQIGLCTF+G RGVSMGIESVVD++N  +S  + DA CSACEM
Sbjct  327  QTILDLLLSETQPKKICSQIGLCTFDGKRGVSMGIESVVDKENAKLSNGVGDAGCSACEM  386

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVW+Q+QL +N TQE IL YVNELC R+PSPMGES VDC +LSTMP+VS +IGGKVFDL
Sbjct  387  AVVWIQSQLRQNMTQERILDYVNELCERIPSPMGESAVDCAQLSTMPTVSLTIGGKVFDL  446

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P+EYILKVGEG+AAQCISGF ALDV PPRGPLWILGDVFMG+YHTVFD+GK +VGFAEA
Sbjct  447  APHEYILKVGEGAAAQCISGFIALDVAPPRGPLWILGDVFMGKYHTVFDFGKAQVGFAEA  506

Query  156  A  154
            A
Sbjct  507  A  507



>ref|XP_011461056.1| PREDICTED: aspartic proteinase A1-like [Fragaria vesca subsp. 
vesca]
Length=514

 Score =   294 bits (752),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 136/179 (76%), Positives = 158/179 (88%), Gaps = 1/179 (1%)
 Frame = -2

Query  687  MIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKN-GVSADLHDAMCSACEMTV  511
            +I +++ + +P+KICSQIGLCTF+G RGVS+GI+SVVDE N   SA L DAMCSACEMTV
Sbjct  336  IIKMILAKDQPQKICSQIGLCTFDGTRGVSVGIKSVVDENNHKSSAGLSDAMCSACEMTV  395

Query  510  VWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDLSP  331
            VWMQNQL +NQTQ+ IL YVN+LC+RLPSPMGES VDC  LS+MPSVSF+IGGK FDL+P
Sbjct  396  VWMQNQLKQNQTQDRILDYVNQLCDRLPSPMGESAVDCAGLSSMPSVSFTIGGKQFDLAP  455

Query  330  NEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEAA  154
             +Y+LKVGEG  AQCISGFTALDVPPPRGPLWILGDVFMG+YHTVFD+GK R+GFAEAA
Sbjct  456  EQYVLKVGEGEVAQCISGFTALDVPPPRGPLWILGDVFMGQYHTVFDFGKERIGFAEAA  514



>gb|KDO62068.1| hypothetical protein CISIN_1g010230mg [Citrus sinensis]
Length=510

 Score =   293 bits (751),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 136/181 (75%), Positives = 157/181 (87%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNG-VSADLHDAMCSACEM  517
            + +I++L+ +  P+KICSQIGLCTF+G+RGVSMGIESVV E N   S   HDAMCS CEM
Sbjct  330  EEIINMLLAKDEPQKICSQIGLCTFDGSRGVSMGIESVVPENNHRASGGFHDAMCSTCEM  389

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQNQL +NQTQE IL+YVNELC+RLPSPMGES VDC +LS++P VSF+IGGK+FDL
Sbjct  390  AVVWMQNQLKQNQTQERILNYVNELCDRLPSPMGESAVDCSRLSSLPIVSFTIGGKIFDL  449

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P++YILKVGEG AAQCISGF+ALDV PPRGPLWILGDVFMG YHTVFDY  MRVGFAEA
Sbjct  450  TPDQYILKVGEGDAAQCISGFSALDVAPPRGPLWILGDVFMGPYHTVFDYSNMRVGFAEA  509

Query  156  A  154
            A
Sbjct  510  A  510



>ref|XP_006452415.1| hypothetical protein CICLE_v10008027mg [Citrus clementina]
 gb|ESR65655.1| hypothetical protein CICLE_v10008027mg [Citrus clementina]
Length=514

 Score =   293 bits (751),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 136/181 (75%), Positives = 157/181 (87%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNG-VSADLHDAMCSACEM  517
            + +I++L+ +  P+KICSQIGLCTF+G+RGVSMGIESVV E N   S   HDAMCS CEM
Sbjct  334  EEIINMLLAKDEPQKICSQIGLCTFDGSRGVSMGIESVVPENNHRASGGFHDAMCSTCEM  393

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQNQL +NQTQE IL+YVNELC+RLPSPMGES VDC +LS++P VSF+IGGK+FDL
Sbjct  394  AVVWMQNQLKQNQTQERILNYVNELCDRLPSPMGESAVDCSRLSSLPIVSFTIGGKIFDL  453

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P++YILKVGEG AAQCISGF+ALDV PPRGPLWILGDVFMG YHTVFDY  MRVGFAEA
Sbjct  454  TPDQYILKVGEGDAAQCISGFSALDVAPPRGPLWILGDVFMGPYHTVFDYSNMRVGFAEA  513

Query  156  A  154
            A
Sbjct  514  A  514



>ref|XP_006475035.1| PREDICTED: aspartic proteinase-like [Citrus sinensis]
 gb|KDO62070.1| hypothetical protein CISIN_1g010230mg [Citrus sinensis]
 gb|KDO62071.1| hypothetical protein CISIN_1g010230mg [Citrus sinensis]
Length=514

 Score =   293 bits (751),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 136/181 (75%), Positives = 157/181 (87%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNG-VSADLHDAMCSACEM  517
            + +I++L+ +  P+KICSQIGLCTF+G+RGVSMGIESVV E N   S   HDAMCS CEM
Sbjct  334  EEIINMLLAKDEPQKICSQIGLCTFDGSRGVSMGIESVVPENNHRASGGFHDAMCSTCEM  393

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQNQL +NQTQE IL+YVNELC+RLPSPMGES VDC +LS++P VSF+IGGK+FDL
Sbjct  394  AVVWMQNQLKQNQTQERILNYVNELCDRLPSPMGESAVDCSRLSSLPIVSFTIGGKIFDL  453

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P++YILKVGEG AAQCISGF+ALDV PPRGPLWILGDVFMG YHTVFDY  MRVGFAEA
Sbjct  454  TPDQYILKVGEGDAAQCISGFSALDVAPPRGPLWILGDVFMGPYHTVFDYSNMRVGFAEA  513

Query  156  A  154
            A
Sbjct  514  A  514



>dbj|BAC16370.1| aspartic proteinase 4 [Glycine max]
Length=169

 Score =   281 bits (720),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 131/169 (78%), Positives = 148/169 (88%), Gaps = 1/169 (1%)
 Frame = -2

Query  657  PKKICSQIGLCTFNGNRGVSMGIESVVDE-KNGVSADLHDAMCSACEMTVVWMQNQLSEN  481
            PKKICSQIGLCTF+G  GVSMGIESVVD+ +   S  + DA CSACEM V+WMQNQL +N
Sbjct  1    PKKICSQIGLCTFDGTHGVSMGIESVVDKNERKSSGSIRDAGCSACEMAVIWMQNQLRQN  60

Query  480  QTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEG  301
            QT++ I+ Y NELC++LP+PMG+S VDC KLS+MP VSF+IGGKVFDLSP EYILKVGEG
Sbjct  61   QTEDRIIDYANELCDKLPNPMGQSSVDCEKLSSMPIVSFTIGGKVFDLSPQEYILKVGEG  120

Query  300  SAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEAA  154
              AQCISGFTALDVPPPRGPLWILGDVFMGRYHT+FDYGK+RVGFAEAA
Sbjct  121  PEAQCISGFTALDVPPPRGPLWILGDVFMGRYHTIFDYGKLRVGFAEAA  169



>emb|CDY21021.1| BnaA08g25040D [Brassica napus]
Length=526

 Score =   293 bits (751),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 159/181 (88%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNG-VSADLHDAMCSACEM  517
            Q ++DLL+ E +PKKICSQIGLCTF+G RGVSMGIESVVD++N  +S  + DA CSACEM
Sbjct  346  QTILDLLLSETQPKKICSQIGLCTFDGKRGVSMGIESVVDKENAKLSNGVGDAGCSACEM  405

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVW+Q+QL +N TQE IL YVNELC R+PSPMGES VDC +LSTMP+VS +IGGKVFDL
Sbjct  406  AVVWIQSQLRQNMTQERILDYVNELCERIPSPMGESAVDCAQLSTMPTVSLTIGGKVFDL  465

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P+EYILKVGEG+AAQCISGF ALDV PPRGPLWILGDVFMG+YHTVFD+GK +VGFAEA
Sbjct  466  APHEYILKVGEGAAAQCISGFIALDVAPPRGPLWILGDVFMGKYHTVFDFGKAQVGFAEA  525

Query  156  A  154
            A
Sbjct  526  A  526



>ref|XP_009361022.1| PREDICTED: aspartic proteinase A1-like [Pyrus x bretschneideri]
Length=513

 Score =   293 bits (750),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 132/180 (73%), Positives = 156/180 (87%), Gaps = 0/180 (0%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLHDAMCSACEMT  514
            + +I+ ++ + +P KICSQIGLC+F+G  GVS+GI+SVV+  + VS DL DA CSACEMT
Sbjct  334  ETIIERILAKDQPAKICSQIGLCSFDGTHGVSIGIKSVVENTHKVSGDLSDATCSACEMT  393

Query  513  VVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDLS  334
            VVWMQNQL +NQTQE IL YVN+LC+RLPSPMGES VDC  LS+MP+VSF+IGG+ FDL+
Sbjct  394  VVWMQNQLKQNQTQERILDYVNQLCDRLPSPMGESAVDCAGLSSMPNVSFTIGGRTFDLT  453

Query  333  PNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEAA  154
            P +Y+LKVGEG AAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYG  R+GFAEAA
Sbjct  454  PEQYVLKVGEGDAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGNERIGFAEAA  513



>dbj|BAH20208.1| AT1G11910 [Arabidopsis thaliana]
Length=389

 Score =   289 bits (739),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 156/181 (86%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNG-VSADLHDAMCSACEM  517
            Q ++DLL+ E +PKKICSQIGLCTF+G RGVSMGIESVVD++N  +S  + DA CSACEM
Sbjct  209  QTILDLLLSETQPKKICSQIGLCTFDGTRGVSMGIESVVDKENAKLSNGVGDAACSACEM  268

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVW+Q+QL +N TQE IL+YVNELC RLPSPMGES VDC +LSTMP+VS +IGGKVFDL
Sbjct  269  AVVWIQSQLRQNMTQERILNYVNELCERLPSPMGESAVDCAQLSTMPTVSLTIGGKVFDL  328

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P EY+LKVGEG  AQCISGF ALDV PPRGPLWILGDVFMG+YHTVFD+G  +VGFAEA
Sbjct  329  APEEYVLKVGEGPVAQCISGFIALDVAPPRGPLWILGDVFMGKYHTVFDFGNEQVGFAEA  388

Query  156  A  154
            A
Sbjct  389  A  389



>ref|XP_010546667.1| PREDICTED: aspartic proteinase A1-like [Tarenaya hassleriana]
 ref|XP_010546675.1| PREDICTED: aspartic proteinase A1-like [Tarenaya hassleriana]
Length=508

 Score =   292 bits (748),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 134/180 (74%), Positives = 157/180 (87%), Gaps = 4/180 (2%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLHDAMCSACEMT  514
            Q ++DLL+ E +PKKICSQIGLCTF+G  GVSMGI+SVV+ +NGV    +D  CSACEM 
Sbjct  333  QTILDLLLAETQPKKICSQIGLCTFDGAHGVSMGIKSVVERENGV----NDGACSACEMA  388

Query  513  VVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDLS  334
            VVW+QNQL +N TQ+ IL+Y+NELC R+PSPMGES VDCG+LS+MP+VSFSIGGKVF+L+
Sbjct  389  VVWIQNQLRQNMTQDRILNYINELCERMPSPMGESAVDCGQLSSMPTVSFSIGGKVFELA  448

Query  333  PNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEAA  154
            P EY+LKVGEG  AQCISGF ALDVPPPRGPLWILGDVFMG+YHTVFD+G MRVGFAEAA
Sbjct  449  PEEYVLKVGEGPVAQCISGFIALDVPPPRGPLWILGDVFMGKYHTVFDFGNMRVGFAEAA  508



>emb|CDY31221.1| BnaC08g15160D [Brassica napus]
Length=595

 Score =   294 bits (753),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 136/181 (75%), Positives = 159/181 (88%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNG-VSADLHDAMCSACEM  517
            Q ++DLL+ E +PKKICSQIGLCTF+G RGVSMGIESVVD++N  +S  + DA CSACEM
Sbjct  415  QTILDLLLSETQPKKICSQIGLCTFDGKRGVSMGIESVVDKENAKLSNGVGDAACSACEM  474

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVW+Q+QL +N TQE IL YVNELC R+PSPMGES VDC +LSTMP+VS +IGGKVFDL
Sbjct  475  AVVWIQSQLRQNMTQERILDYVNELCERIPSPMGESAVDCAQLSTMPTVSLTIGGKVFDL  534

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P+EY+LKVGEG+AAQCISGF ALDV PPRGPLWILGDVFMG+YHTVFD+GK +VGFAEA
Sbjct  535  APHEYVLKVGEGAAAQCISGFIALDVAPPRGPLWILGDVFMGKYHTVFDFGKAQVGFAEA  594

Query  156  A  154
            A
Sbjct  595  A  595



>ref|XP_007049085.1| Aspartic protease isoform 2 [Theobroma cacao]
 gb|EOX93242.1| Aspartic protease isoform 2 [Theobroma cacao]
Length=514

 Score =   291 bits (746),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 136/181 (75%), Positives = 154/181 (85%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHDAMCSACEM  517
            + +++LLV E +P+KICSQIG CTF+G RGVS  IESV DE  G S+D +HDAMC+ACEM
Sbjct  334  KMILELLVSETQPQKICSQIGFCTFDGTRGVSTRIESVADEIVGKSSDGVHDAMCTACEM  393

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQN+L  N+T+E IL YVNELC RLPSP GES VDC  LS+MP VSF+IGGKVFDL
Sbjct  394  AVVWMQNKLRRNETEEQILDYVNELCERLPSPNGESVVDCSSLSSMPGVSFTIGGKVFDL  453

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P EY+LKVGEG+ AQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYG M VGFAEA
Sbjct  454  APEEYVLKVGEGAVAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGNMTVGFAEA  513

Query  156  A  154
            A
Sbjct  514  A  514



>gb|AAB03108.1| aspartic protease [Brassica napus]
 emb|CDY34613.1| BnaC08g41720D [Brassica napus]
Length=506

 Score =   291 bits (745),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 157/181 (87%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHDAMCSACEM  517
            Q ++DLL+ E +PKKICSQIGLCTF+G RGVSMGIESVVD++N  S+  + DA CSACEM
Sbjct  326  QTILDLLLSETQPKKICSQIGLCTFDGKRGVSMGIESVVDKENAKSSSGVGDAACSACEM  385

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVW+Q+QL +N TQE IL Y+N+LC RLPSPMGES VDC +LSTMP+VS +IGGKVFDL
Sbjct  386  AVVWIQSQLRQNMTQERILDYINDLCERLPSPMGESAVDCAQLSTMPTVSLTIGGKVFDL  445

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P EY+LKVGEG AAQCISGF ALDV PPRGPLWILGDVFMG+YHTVFD+GK +VGFAEA
Sbjct  446  APEEYVLKVGEGPAAQCISGFIALDVAPPRGPLWILGDVFMGKYHTVFDFGKEQVGFAEA  505

Query  156  A  154
            A
Sbjct  506  A  506



>ref|XP_010060310.1| PREDICTED: aspartic proteinase A1-like [Eucalyptus grandis]
 ref|XP_010060311.1| PREDICTED: aspartic proteinase A1-like [Eucalyptus grandis]
 gb|KCW66975.1| hypothetical protein EUGRSUZ_F00741 [Eucalyptus grandis]
 gb|KCW66976.1| hypothetical protein EUGRSUZ_F00741 [Eucalyptus grandis]
Length=515

 Score =   291 bits (745),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 158/181 (87%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKN-GVSADLHDAMCSACEM  517
            + +I  L+ +  P KICS+IGLCTF+G RGVSMGIE+VVD KN  VS  L+DAMCS CEM
Sbjct  335  ETIIQKLLAKEEPHKICSEIGLCTFDGTRGVSMGIETVVDGKNEKVSGRLNDAMCSTCEM  394

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
            TVVWMQNQL  N+TQ+ ILSYVNELC+RLPSPMGES VDC  LS+MP+VSF+IGG+VFDL
Sbjct  395  TVVWMQNQLRLNETQDRILSYVNELCSRLPSPMGESAVDCAGLSSMPNVSFTIGGRVFDL  454

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            SP +YILKVG+G +AQCISGFTALDVPPPRGPLWILGDVFMG+YHTVFDYG +RVGFA+A
Sbjct  455  SPEQYILKVGDGDSAQCISGFTALDVPPPRGPLWILGDVFMGQYHTVFDYGNLRVGFAKA  514

Query  156  A  154
            A
Sbjct  515  A  515



>gb|AFW81161.1| hypothetical protein ZEAMMB73_941917 [Zea mays]
Length=243

 Score =   282 bits (721),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 152/182 (84%), Gaps = 2/182 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD--LHDAMCSACE  520
            Q+++DLL+ E +P KICSQ+GLCTF+G  GVS GI SVVD+K G S      D MC+ACE
Sbjct  62   QQILDLLLAETQPAKICSQVGLCTFDGTHGVSTGIRSVVDDKAGKSNGGLKSDPMCNACE  121

Query  519  MTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFD  340
            M VVWMQNQL++N+TQE IL+Y+N+LC RLPSPMGES VDC  L +MP ++F+IGGK F 
Sbjct  122  MAVVWMQNQLAQNKTQELILTYINQLCERLPSPMGESAVDCASLGSMPDIAFTIGGKKFK  181

Query  339  LSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAE  160
            L P +YILKVGEG AAQCISGFTA+D+PPPRGPLWILGDVFMG YHTVFDYGK+RVGFAE
Sbjct  182  LKPEQYILKVGEGQAAQCISGFTAMDIPPPRGPLWILGDVFMGVYHTVFDYGKLRVGFAE  241

Query  159  AA  154
            +A
Sbjct  242  SA  243



>ref|XP_002298827.2| aspartic protease family protein [Populus trichocarpa]
 gb|EEE83632.2| aspartic protease family protein [Populus trichocarpa]
Length=515

 Score =   291 bits (744),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 133/179 (74%), Positives = 155/179 (87%), Gaps = 1/179 (1%)
 Frame = -2

Query  687  MIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHDAMCSACEMTV  511
            ++++L+ + +P+KIC+QIGLCTF+G RGVSMGIESVV+E    ++D  HDAMCS CEM V
Sbjct  337  IMEMLLAKDQPQKICAQIGLCTFDGTRGVSMGIESVVNEHAQKASDGFHDAMCSTCEMAV  396

Query  510  VWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDLSP  331
            VWMQNQL +NQTQE IL YVNELC RLPSPMGES VDC  LS+MP+VSF+IGG+VF+LSP
Sbjct  397  VWMQNQLKQNQTQERILDYVNELCERLPSPMGESAVDCDGLSSMPNVSFTIGGRVFELSP  456

Query  330  NEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEAA  154
             +Y+LKVGEG  AQCISGFTALDVPPPRGPLWILGDVFMG +HTVFDYG MRVGFAEA 
Sbjct  457  EQYVLKVGEGDVAQCISGFTALDVPPPRGPLWILGDVFMGSFHTVFDYGNMRVGFAEAT  515



>ref|XP_007049084.1| Aspartic proteinase A1 isoform 1 [Theobroma cacao]
 gb|EOX93241.1| Aspartic proteinase A1 isoform 1 [Theobroma cacao]
Length=550

 Score =   291 bits (746),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 136/181 (75%), Positives = 154/181 (85%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHDAMCSACEM  517
            + +++LLV E +P+KICSQIG CTF+G RGVS  IESV DE  G S+D +HDAMC+ACEM
Sbjct  370  KMILELLVSETQPQKICSQIGFCTFDGTRGVSTRIESVADEIVGKSSDGVHDAMCTACEM  429

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQN+L  N+T+E IL YVNELC RLPSP GES VDC  LS+MP VSF+IGGKVFDL
Sbjct  430  AVVWMQNKLRRNETEEQILDYVNELCERLPSPNGESVVDCSSLSSMPGVSFTIGGKVFDL  489

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P EY+LKVGEG+ AQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYG M VGFAEA
Sbjct  490  APEEYVLKVGEGAVAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGNMTVGFAEA  549

Query  156  A  154
            A
Sbjct  550  A  550



>ref|XP_008380299.1| PREDICTED: aspartic proteinase A1-like [Malus domestica]
Length=513

 Score =   290 bits (743),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 132/180 (73%), Positives = 154/180 (86%), Gaps = 0/180 (0%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLHDAMCSACEMT  514
            + +I+ ++ + +P KICSQIGLC+F+G  GVS+GI+SVV   + VS DL DA CSACEMT
Sbjct  334  ETIIERILAKDQPAKICSQIGLCSFDGTHGVSIGIKSVVXNTHKVSGDLSDATCSACEMT  393

Query  513  VVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDLS  334
            VVWMQNQL + QTQE IL YVN+LC+RLPSPMGES VDC  LS+MPSVSF+IGG+ FDL+
Sbjct  394  VVWMQNQLKQXQTQERILDYVNQLCDRLPSPMGESAVDCAGLSSMPSVSFTIGGRTFDLT  453

Query  333  PNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEAA  154
            P +Y+LKVGEG AAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYG  R+GFAEAA
Sbjct  454  PEQYVLKVGEGDAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGNERIGFAEAA  513



>ref|XP_006449766.1| hypothetical protein CICLE_v10014941mg [Citrus clementina]
 gb|ESR63006.1| hypothetical protein CICLE_v10014941mg [Citrus clementina]
Length=514

 Score =   290 bits (743),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 148/181 (82%), Positives = 164/181 (91%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHDAMCSACEM  517
            Q ++DLL+ EA PKKICSQ+GLCTF+G RGVS GIESVVDE NG S+  L++AMCSACEM
Sbjct  334  QTILDLLLSEAHPKKICSQMGLCTFDGKRGVSTGIESVVDESNGKSSGVLNNAMCSACEM  393

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQNQL +NQTQENIL YVNELC+R+PSPMGES VDCGKLS+MP VSF+IGGKVFDL
Sbjct  394  AVVWMQNQLQQNQTQENILQYVNELCDRMPSPMGESAVDCGKLSSMPIVSFTIGGKVFDL  453

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            SP EYILKVGEG  AQCISGFTA+DVPPPRGPLWILGDVFMGRYHTVFD+GK+RVGFAEA
Sbjct  454  SPEEYILKVGEGPEAQCISGFTAMDVPPPRGPLWILGDVFMGRYHTVFDFGKLRVGFAEA  513

Query  156  A  154
            A
Sbjct  514  A  514



>ref|XP_003567869.1| PREDICTED: phytepsin [Brachypodium distachyon]
Length=505

 Score =   290 bits (742),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 157/181 (87%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLH-DAMCSACEM  517
            Q+++DLL+ E +PKKICSQ+GLCTF+G RGVS GI SVVD++   S  LH D MC+ACEM
Sbjct  325  QQILDLLLAETQPKKICSQVGLCTFDGTRGVSAGIRSVVDDEAEKSNGLHSDPMCNACEM  384

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQNQLS+N+TQ+ IL+Y+N+LC+RLPSPMGES VDCG L++MP + F+IGGK F L
Sbjct  385  AVVWMQNQLSQNKTQDVILNYINQLCDRLPSPMGESSVDCGSLASMPEIEFTIGGKKFAL  444

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
             P EYILKVGEG AAQCISGFTA+D+PPPRGPLWILGDVFMG YHTVFDYGK+RVGFA+A
Sbjct  445  KPEEYILKVGEGPAAQCISGFTAMDIPPPRGPLWILGDVFMGPYHTVFDYGKLRVGFAKA  504

Query  156  A  154
            A
Sbjct  505  A  505



>gb|KDP39159.1| hypothetical protein JCGZ_00916 [Jatropha curcas]
Length=514

 Score =   290 bits (741),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 161/181 (89%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHDAMCSACEM  517
            + +I++L+ + +P+KICSQIGLCTF+G+RGVSMGIESVV+E +  +A  L D MCSACEM
Sbjct  334  ETIIEMLLAKDQPEKICSQIGLCTFDGSRGVSMGIESVVNENDHEAAGGLRDTMCSACEM  393

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQN+L +N TQE+IL+YVN+LC +LPSPMGES VDCG +ST+P+VSF+IGGKVFDL
Sbjct  394  AVVWMQNKLKQNITQESILNYVNDLCEKLPSPMGESAVDCGSVSTLPNVSFTIGGKVFDL  453

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P +Y+LKVGEG AAQCISGFTA+DVPPPRGPLWILGDVFMG +HTVFDYG MRVGFAEA
Sbjct  454  APEQYVLKVGEGEAAQCISGFTAIDVPPPRGPLWILGDVFMGPFHTVFDYGNMRVGFAEA  513

Query  156  A  154
            A
Sbjct  514  A  514



>dbj|BAB20969.1| aspartic proteinase 1 [Nepenthes alata]
Length=514

 Score =   290 bits (741),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 134/178 (75%), Positives = 155/178 (87%), Gaps = 1/178 (1%)
 Frame = -2

Query  687  MIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEK-NGVSADLHDAMCSACEMTV  511
            ++D+L+ E +PKKICSQIGLCTF+G RGVS+GI+SVVD   +G S+ L DA C+ACEMTV
Sbjct  336  ILDMLISETQPKKICSQIGLCTFDGKRGVSVGIKSVVDMNVDGSSSGLQDATCTACEMTV  395

Query  510  VWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDLSP  331
            VWMQNQL +NQT+E IL+YVNELCNRLPSPMGES VDC  LS+MP VSF++GGKVFDL P
Sbjct  396  VWMQNQLKQNQTEERILNYVNELCNRLPSPMGESAVDCSSLSSMPGVSFTVGGKVFDLLP  455

Query  330  NEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
             +YIL+VGEG A QCISGFTALDV PP GPLWILGD+FMG+YHTVFDYG MRVGFAEA
Sbjct  456  EQYILQVGEGVATQCISGFTALDVAPPLGPLWILGDIFMGQYHTVFDYGNMRVGFAEA  513



>ref|NP_172655.1| aspartic proteinase A1 [Arabidopsis thaliana]
 sp|O65390.1|APA1_ARATH RecName: Full=Aspartic proteinase A1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAC17620.1| Identical to aspartic proteinase cDNA gb|U51036 from A. thaliana. 
ESTs gb|N96313, gb|T21893, gb|R30158, gb|T21482, gb|T43650, 
gb|R64749, gb|R65157, gb|T88269, gb|T44552, gb|T22542, 
gb|T76533, gb|T44350, gb|Z34591, gb|AA728734, gb|T46003, gb|R65157, 
gb|N38290, gb|AA395468, gb|T20815 and gb|Z34173 come 
from this gene [Arabidopsis thaliana]
 gb|AAL08243.1| At1g11910/F12F1_24 [Arabidopsis thaliana]
 gb|AAL08259.1| At1g11910/F12F1_24 [Arabidopsis thaliana]
 gb|AAL36330.1| putative aspartic proteinase [Arabidopsis thaliana]
 gb|AAM66979.1| putative aspartic proteinase [Arabidopsis thaliana]
 gb|AAN71979.1| putative aspartic proteinase [Arabidopsis thaliana]
 gb|AEE28813.1| aspartic proteinase A1 [Arabidopsis thaliana]
Length=506

 Score =   289 bits (740),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 156/181 (86%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNG-VSADLHDAMCSACEM  517
            Q ++DLL+ E +PKKICSQIGLCTF+G RGVSMGIESVVD++N  +S  + DA CSACEM
Sbjct  326  QTILDLLLSETQPKKICSQIGLCTFDGTRGVSMGIESVVDKENAKLSNGVGDAACSACEM  385

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVW+Q+QL +N TQE IL+YVNELC RLPSPMGES VDC +LSTMP+VS +IGGKVFDL
Sbjct  386  AVVWIQSQLRQNMTQERILNYVNELCERLPSPMGESAVDCAQLSTMPTVSLTIGGKVFDL  445

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P EY+LKVGEG  AQCISGF ALDV PPRGPLWILGDVFMG+YHTVFD+G  +VGFAEA
Sbjct  446  APEEYVLKVGEGPVAQCISGFIALDVAPPRGPLWILGDVFMGKYHTVFDFGNEQVGFAEA  505

Query  156  A  154
            A
Sbjct  506  A  506



>gb|AAC49730.1| aspartic proteinase [Arabidopsis thaliana]
Length=486

 Score =   289 bits (739),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 156/181 (86%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNG-VSADLHDAMCSACEM  517
            Q ++DLL+ E +PKKICSQIGLCTF+G RGVSMGIESVVD++N  +S  + DA CSACEM
Sbjct  306  QTILDLLLSETQPKKICSQIGLCTFDGTRGVSMGIESVVDKENAKLSNGVGDAACSACEM  365

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVW+Q+QL +N TQE IL+YVNELC RLPSPMGES VDC +LSTMP+VS +IGGKVFDL
Sbjct  366  AVVWIQSQLRQNMTQERILNYVNELCERLPSPMGESAVDCAQLSTMPTVSLTIGGKVFDL  425

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P EY+LKVGEG  AQCISGF ALDV PPRGPLWILGDVFMG+YHTVFD+G  +VGFAEA
Sbjct  426  APEEYVLKVGEGPVAQCISGFIALDVAPPRGPLWILGDVFMGKYHTVFDFGNEQVGFAEA  485

Query  156  A  154
            A
Sbjct  486  A  486



>ref|XP_002892661.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68920.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
Length=506

 Score =   289 bits (740),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 156/181 (86%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNG-VSADLHDAMCSACEM  517
            Q ++DLL+ E +PKKICSQIGLCTF+G RGVSMGIESVVD++N  +S  + DA CSACEM
Sbjct  326  QTILDLLLSETQPKKICSQIGLCTFDGTRGVSMGIESVVDKENSKLSNGVGDAACSACEM  385

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVW+Q+QL +N TQE IL+YVNELC RLPSPMGES VDC +LSTMP+VS +IGGKVFDL
Sbjct  386  AVVWIQSQLRQNMTQERILNYVNELCERLPSPMGESAVDCAQLSTMPTVSLTIGGKVFDL  445

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P EY+LKVGEG  AQCISGF ALDV PPRGPLWILGDVFMG+YHTVFD+G  +VGFAEA
Sbjct  446  APEEYVLKVGEGPVAQCISGFIALDVAPPRGPLWILGDVFMGKYHTVFDFGNEQVGFAEA  505

Query  156  A  154
            A
Sbjct  506  A  506



>pdb|1QDM|A Chain A, Crystal Structure Of Prophytepsin, A Zymogen Of A Barley 
Vacuolar Aspartic Proteinase.
 pdb|1QDM|B Chain B, Crystal Structure Of Prophytepsin, A Zymogen Of A Barley 
Vacuolar Aspartic Proteinase.
 pdb|1QDM|C Chain C, Crystal Structure Of Prophytepsin, A Zymogen Of A Barley 
Vacuolar Aspartic Proteinase.
Length=478

 Score =   288 bits (737),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 157/184 (85%), Gaps = 7/184 (4%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEK----NGVSADLHDAMCSA  526
            Q+++DLL+ E +PKKICSQ+GLCTF+G RGVS GI SVVD++    NG+ AD    MCSA
Sbjct  298  QQILDLLLAETQPKKICSQVGLCTFDGTRGVSAGIRSVVDDEPVKSNGLRAD---PMCSA  354

Query  525  CEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKV  346
            CEM VVWMQNQL++N+TQ+ IL YVN+LCNRLPSPMGES VDCG L +MP + F+IGGK 
Sbjct  355  CEMAVVWMQNQLAQNKTQDLILDYVNQLCNRLPSPMGESAVDCGSLGSMPDIEFTIGGKK  414

Query  345  FDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGF  166
            F L P EYILKVGEG+AAQCISGFTA+D+PPPRGPLWILGDVFMG YHTVFDYGK+R+GF
Sbjct  415  FALKPEEYILKVGEGAAAQCISGFTAMDIPPPRGPLWILGDVFMGPYHTVFDYGKLRIGF  474

Query  165  AEAA  154
            A+AA
Sbjct  475  AKAA  478



>ref|XP_008797519.1| PREDICTED: aspartic proteinase oryzasin-1-like [Phoenix dactylifera]
 ref|XP_008797520.1| PREDICTED: aspartic proteinase oryzasin-1-like [Phoenix dactylifera]
 ref|XP_008797521.1| PREDICTED: aspartic proteinase oryzasin-1-like [Phoenix dactylifera]
 ref|XP_008797522.1| PREDICTED: aspartic proteinase oryzasin-1-like [Phoenix dactylifera]
 ref|XP_008797523.1| PREDICTED: aspartic proteinase oryzasin-1-like [Phoenix dactylifera]
Length=512

 Score =   289 bits (739),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 155/181 (86%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLH-DAMCSACEM  517
            Q+++DLL+ E  P KICSQIGLC F+G  GV +GIESVV++   +SA L  DAMC++CEM
Sbjct  332  QQILDLLLSETEPAKICSQIGLCAFDGTHGVGIGIESVVNDNGDLSAGLQSDAMCTSCEM  391

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             V+WMQNQL +N+TQ+ IL+Y+NELC RLPSPMGES VDC  L +MPSVSF+IGGK F+L
Sbjct  392  AVIWMQNQLKQNETQDRILNYINELCERLPSPMGESSVDCASLDSMPSVSFTIGGKSFEL  451

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P +YILKVGEG+AAQCISGFTALDVPPPRGPLWILGDVFMG YHTVFDYG MRVGFAEA
Sbjct  452  TPEQYILKVGEGAAAQCISGFTALDVPPPRGPLWILGDVFMGVYHTVFDYGNMRVGFAEA  511

Query  156  A  154
            A
Sbjct  512  A  512



>ref|XP_010476135.1| PREDICTED: aspartic proteinase A1-like [Camelina sativa]
Length=506

 Score =   289 bits (739),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 157/181 (87%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNG-VSADLHDAMCSACEM  517
            Q ++DLL+ E +PKKICSQIGLCTF+G RGVSMGIESVVD++N  +S  + DA CSACEM
Sbjct  326  QTILDLLLSETQPKKICSQIGLCTFDGTRGVSMGIESVVDKENAKLSNGVGDAACSACEM  385

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVW+Q+QL +N TQE IL+Y+NELC RLPSPMGES VDC +LST+P+VS +IGGKVFDL
Sbjct  386  AVVWIQSQLRQNMTQERILNYINELCERLPSPMGESAVDCTQLSTLPTVSLTIGGKVFDL  445

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P EY+LKVGEG AAQCISGF ALDV PPRGPLWILGDVFMG+YHTVFD+G  +VGFAEA
Sbjct  446  APEEYVLKVGEGPAAQCISGFIALDVAPPRGPLWILGDVFMGKYHTVFDFGNEQVGFAEA  505

Query  156  A  154
            A
Sbjct  506  A  506



>ref|XP_010458606.1| PREDICTED: aspartic proteinase A1 [Camelina sativa]
 ref|XP_010458607.1| PREDICTED: aspartic proteinase A1 [Camelina sativa]
Length=506

 Score =   289 bits (739),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 157/181 (87%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNG-VSADLHDAMCSACEM  517
            Q ++DLL+ E +PKKICSQIGLCTF+G RGVSMGIESVVD++N  +S  + DA CSACEM
Sbjct  326  QTILDLLLSETQPKKICSQIGLCTFDGTRGVSMGIESVVDKENAKLSNGVGDAACSACEM  385

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVW+Q+QL +N TQE IL+Y+NELC RLPSPMGES VDC +LST+P+VS +IGGKVFDL
Sbjct  386  AVVWIQSQLRQNMTQERILNYINELCERLPSPMGESAVDCTQLSTLPTVSLTIGGKVFDL  445

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P EY+LKVGEG AAQCISGF ALDV PPRGPLWILGDVFMG+YHTVFD+G  +VGFAEA
Sbjct  446  APEEYVLKVGEGPAAQCISGFIALDVAPPRGPLWILGDVFMGKYHTVFDFGNEQVGFAEA  505

Query  156  A  154
            A
Sbjct  506  A  506



>sp|P42210.1|ASPR_HORVU RecName: Full=Phytepsin; AltName: Full=Aspartic proteinase; Contains: 
RecName: Full=Phytepsin 32 kDa subunit; Contains: RecName: 
Full=Phytepsin 29 kDa subunit; Contains: RecName: Full=Phytepsin 
16 kDa subunit; Contains: RecName: Full=Phytepsin 
11 kDa subunit; Flags: Precursor [Hordeum vulgare]
 emb|CAA39602.1| aspartic proteinase [Hordeum vulgare subsp. vulgare]
Length=508

 Score =   288 bits (738),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 157/184 (85%), Gaps = 7/184 (4%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEK----NGVSADLHDAMCSA  526
            Q+++DLL+ E +PKKICSQ+GLCTF+G RGVS GI SVVD++    NG+ AD    MCSA
Sbjct  328  QQILDLLLAETQPKKICSQVGLCTFDGTRGVSAGIRSVVDDEPVKSNGLRAD---PMCSA  384

Query  525  CEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKV  346
            CEM VVWMQNQL++N+TQ+ IL YVN+LCNRLPSPMGES VDCG L +MP + F+IGGK 
Sbjct  385  CEMAVVWMQNQLAQNKTQDLILDYVNQLCNRLPSPMGESAVDCGSLGSMPDIEFTIGGKK  444

Query  345  FDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGF  166
            F L P EYILKVGEG+AAQCISGFTA+D+PPPRGPLWILGDVFMG YHTVFDYGK+R+GF
Sbjct  445  FALKPEEYILKVGEGAAAQCISGFTAMDIPPPRGPLWILGDVFMGPYHTVFDYGKLRIGF  504

Query  165  AEAA  154
            A+AA
Sbjct  505  AKAA  508



>gb|AGP76185.1| aspartic proteinase [Brassica rapa subsp. chinensis]
Length=506

 Score =   288 bits (738),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 134/180 (74%), Positives = 157/180 (87%), Gaps = 1/180 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHDAMCSACEM  517
            Q ++DLL+ E +PKKICSQIGLCTF+G RGVS+GIESVVD++N  S++ + DA CSACEM
Sbjct  326  QTILDLLLSETQPKKICSQIGLCTFDGKRGVSVGIESVVDQENVKSSNGVGDAACSACEM  385

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVW+Q+QL +N TQE IL Y+N+LC RLPSPMGES VDC +LSTMPSVS +IGGKVFDL
Sbjct  386  AVVWIQSQLRQNMTQERILDYINDLCERLPSPMGESAVDCAQLSTMPSVSLTIGGKVFDL  445

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P EY+LKVGEG AAQCISGF ALDV PPRGPLWILGDVFMG+YHTVFD+GK +VGFAEA
Sbjct  446  APEEYVLKVGEGPAAQCISGFIALDVAPPRGPLWILGDVFMGKYHTVFDFGKEQVGFAEA  505



>ref|XP_006467405.1| PREDICTED: aspartic proteinase-like isoform X2 [Citrus sinensis]
 ref|XP_006467406.1| PREDICTED: aspartic proteinase-like isoform X3 [Citrus sinensis]
 gb|KDO78299.1| hypothetical protein CISIN_1g010233mg [Citrus sinensis]
 gb|KDO78300.1| hypothetical protein CISIN_1g010233mg [Citrus sinensis]
 gb|KDO78301.1| hypothetical protein CISIN_1g010233mg [Citrus sinensis]
Length=514

 Score =   288 bits (738),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 164/181 (91%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHDAMCSACEM  517
            Q ++DLL+ EA PKKICSQ+GLCTF+G RGVSMGIESVVDE N  S+  L++AMCSACEM
Sbjct  334  QTILDLLLFEAHPKKICSQMGLCTFDGKRGVSMGIESVVDESNDKSSGVLNNAMCSACEM  393

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQNQL +NQTQENIL YVNELC+R+PSPMGES VDCGKLS+MP VSF+IGGKVFDL
Sbjct  394  AVVWMQNQLQQNQTQENILQYVNELCDRMPSPMGESAVDCGKLSSMPIVSFTIGGKVFDL  453

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            SP EYILKVGEG  AQCISGFTA+DVPPPRGPLWILGDVFMGRYHTVFD+G++RVGFAEA
Sbjct  454  SPEEYILKVGEGPEAQCISGFTAMDVPPPRGPLWILGDVFMGRYHTVFDFGELRVGFAEA  513

Query  156  A  154
            A
Sbjct  514  A  514



>gb|KEH36904.1| fungal proteinase A, aspartic proteinase superfamily protein 
[Medicago truncatula]
Length=510

 Score =   288 bits (738),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 159/181 (88%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLH-DAMCSACEM  517
              ++ LLV EA+PKK+CSQIGLCTF+G +G+SMGI+SVV++ + +S+  H DA CS CEM
Sbjct  330  HSILQLLVAEAQPKKVCSQIGLCTFDGTQGISMGIQSVVEQTDRISSGGHQDATCSVCEM  389

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQNQL +NQT+E I++Y + LC+++P+P+G+S VDC K+S+MP VSF+IGGK FDL
Sbjct  390  AVVWMQNQLKQNQTEERIINYADSLCDKMPNPLGQSSVDCAKISSMPKVSFTIGGKKFDL  449

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P EYILKVGEG+AAQCISGFTALDVPPPRGPLWILGD+FMGRYHTVFDYGK+RVGFAEA
Sbjct  450  APEEYILKVGEGAAAQCISGFTALDVPPPRGPLWILGDIFMGRYHTVFDYGKLRVGFAEA  509

Query  156  A  154
            A
Sbjct  510  A  510



>ref|XP_006303952.1| hypothetical protein CARUB_v10008798mg, partial [Capsella rubella]
 gb|EOA36850.1| hypothetical protein CARUB_v10008798mg, partial [Capsella rubella]
Length=538

 Score =   289 bits (740),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 134/180 (74%), Positives = 156/180 (87%), Gaps = 1/180 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNG-VSADLHDAMCSACEM  517
            + ++DLL+ E +PKKICSQIGLCTF+G RGVSMGIESVVD++N  +S  + DA CSACEM
Sbjct  358  ETILDLLLSETQPKKICSQIGLCTFDGTRGVSMGIESVVDKENAKLSNGVGDAACSACEM  417

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVW+Q+QL +N TQE IL+Y+NELC RLPSPMGES VDC +LSTMP+VS +IGGKVFDL
Sbjct  418  AVVWIQSQLRQNMTQERILNYINELCERLPSPMGESAVDCAQLSTMPTVSLTIGGKVFDL  477

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            SP EY+LKVGEG AAQCISGF ALDV PPRGPLWILGDVFMG+YHTVFD+G  +VGFAEA
Sbjct  478  SPEEYVLKVGEGPAAQCISGFIALDVAPPRGPLWILGDVFMGKYHTVFDFGNEQVGFAEA  537



>ref|XP_004486175.1| PREDICTED: aspartic proteinase-like isoform X1 [Cicer arietinum]
 ref|XP_004486176.1| PREDICTED: aspartic proteinase-like isoform X2 [Cicer arietinum]
 gb|AIA58652.1| aspartic proteinase [Cicer arietinum]
Length=508

 Score =   288 bits (737),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 158/181 (87%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHDAMCSACEM  517
            Q ++ LL+ E +PKKICSQIGLCTF+G  GVSMGI+SVV++ + +S+  L DA CS CEM
Sbjct  328  QTILQLLLTETQPKKICSQIGLCTFDGTHGVSMGIQSVVEQTDRISSGGLQDASCSVCEM  387

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQNQL +NQT+E IL+YV+ LC+++P+PMG+S VDC K+S+MP VSF+IGGK FDL
Sbjct  388  AVVWMQNQLRQNQTEERILNYVHSLCDKMPNPMGQSSVDCAKISSMPVVSFTIGGKKFDL  447

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            S  EYILKVGEGSAAQCISGFTALDVPPPRGPLWILGD+FMGRYHTVFDYGK+RVGFA+A
Sbjct  448  SSQEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDIFMGRYHTVFDYGKLRVGFAQA  507

Query  156  A  154
            A
Sbjct  508  A  508



>ref|XP_006417290.1| hypothetical protein EUTSA_v10007418mg [Eutrema salsugineum]
 dbj|BAJ34217.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ35643.1| hypothetical protein EUTSA_v10007418mg [Eutrema salsugineum]
Length=506

 Score =   288 bits (737),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 134/180 (74%), Positives = 155/180 (86%), Gaps = 1/180 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNG-VSADLHDAMCSACEM  517
            + +++LL+ E +PKKICSQIGLCTFNG RGVSMGIESVVD++N  +S  + DA CSACEM
Sbjct  326  RTILELLLSETQPKKICSQIGLCTFNGKRGVSMGIESVVDKENAKLSNGVGDAACSACEM  385

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVW+Q+QL +N TQE IL Y NELC RLPSPMGES VDC +LSTMP+VS +IGGKVFDL
Sbjct  386  AVVWIQSQLRQNMTQERILDYANELCERLPSPMGESAVDCAQLSTMPTVSLTIGGKVFDL  445

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P EY+LKVGEG AAQCISGF ALDV PPRGPLWILGDVFMG+YHTVFD+GK +VGFAEA
Sbjct  446  APEEYVLKVGEGPAAQCISGFIALDVAPPRGPLWILGDVFMGKYHTVFDFGKEQVGFAEA  505



>ref|XP_010493478.1| PREDICTED: aspartic proteinase A1-like [Camelina sativa]
 ref|XP_010493486.1| PREDICTED: aspartic proteinase A1-like [Camelina sativa]
Length=506

 Score =   288 bits (736),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 134/180 (74%), Positives = 156/180 (87%), Gaps = 1/180 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNG-VSADLHDAMCSACEM  517
            Q ++DLL+ E +PKKICSQIGLCTF+G RGVSMGIESVVD++N  +S  + DA CSACEM
Sbjct  326  QTILDLLLSETQPKKICSQIGLCTFDGTRGVSMGIESVVDKENAKLSNGVGDAACSACEM  385

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVW+Q+QL +N TQE IL+Y+NELC RLPSPMGES VDC +LST+PSVS +IGGKVFDL
Sbjct  386  AVVWIQSQLRQNMTQERILNYINELCERLPSPMGESAVDCTQLSTLPSVSLTIGGKVFDL  445

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P EY+LKVGEG AAQCISGF ALDV PPRGPLWILGDVFMG+YHTVFD+G  +VGFAEA
Sbjct  446  APEEYVLKVGEGPAAQCISGFIALDVAPPRGPLWILGDVFMGKYHTVFDFGNEQVGFAEA  505



>ref|XP_010926197.1| PREDICTED: aspartic proteinase oryzasin-1-like isoform X1 [Elaeis 
guineensis]
 ref|XP_010926203.1| PREDICTED: aspartic proteinase oryzasin-1-like isoform X1 [Elaeis 
guineensis]
 ref|XP_010926209.1| PREDICTED: aspartic proteinase oryzasin-1-like isoform X1 [Elaeis 
guineensis]
Length=512

 Score =   288 bits (737),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 157/181 (87%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLH-DAMCSACEM  517
            Q+++D+L+ E +P KICS+IGLC F+G  GV +GIESVV++   +SA L  DAMC++CEM
Sbjct  332  QQILDMLLSETQPAKICSRIGLCAFDGTHGVGIGIESVVNDNGDLSAGLQSDAMCTSCEM  391

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQNQL +N+TQ+ IL+Y+N+LC RLPSPMGES VDC  L +MPS+SF+IGGK F+L
Sbjct  392  AVVWMQNQLKQNETQDRILNYINDLCERLPSPMGESSVDCASLDSMPSISFTIGGKSFEL  451

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P +YILKVGEG+AAQCISGFTALDVPPPRGPLWILGDVFMG YHTVFDYGKMRVGFAEA
Sbjct  452  TPEQYILKVGEGAAAQCISGFTALDVPPPRGPLWILGDVFMGVYHTVFDYGKMRVGFAEA  511

Query  156  A  154
            A
Sbjct  512  A  512



>ref|XP_008800700.1| PREDICTED: aspartic proteinase oryzasin-1-like isoform X2 [Phoenix 
dactylifera]
Length=512

 Score =   288 bits (736),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 156/181 (86%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLH-DAMCSACEM  517
            Q ++D+L+ E +P KICS IGLCTF+G  GVS+GIESVV++   +SA L  DAMC+ACEM
Sbjct  332  QEILDMLLSETQPAKICSHIGLCTFDGTHGVSVGIESVVNDNGDLSAGLQSDAMCTACEM  391

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQNQL +N+TQE IL+Y+NELC RLPSPMGES VDC  L++MPSVSF+IGGK F+L
Sbjct  392  AVVWMQNQLKQNETQELILNYINELCERLPSPMGESSVDCASLASMPSVSFTIGGKSFEL  451

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P +YILKVGEG+AAQCISGFTALDVPPPRGPLWILGDVFMG YHTVFDY  +RVGFAEA
Sbjct  452  TPEQYILKVGEGAAAQCISGFTALDVPPPRGPLWILGDVFMGVYHTVFDYENLRVGFAEA  511

Query  156  A  154
            A
Sbjct  512  A  512



>ref|XP_009118162.1| PREDICTED: aspartic proteinase A1 [Brassica rapa]
Length=506

 Score =   288 bits (736),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 133/180 (74%), Positives = 156/180 (87%), Gaps = 1/180 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHDAMCSACEM  517
            Q ++DLL+ E +PKKICSQIGLCTF+G R VSMGIESVVD++N  S++ + DA CSACEM
Sbjct  326  QTILDLLLSETQPKKICSQIGLCTFDGKRDVSMGIESVVDKENAKSSNGVGDAACSACEM  385

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVW+Q+QL +N TQE IL Y+N+LC RLPSPMGES VDC +LSTMP+VS +IGGKVFDL
Sbjct  386  AVVWIQSQLRQNMTQERILDYINDLCERLPSPMGESAVDCAQLSTMPTVSLTIGGKVFDL  445

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P EY+LKVGEG AAQCISGF ALDV PPRGPLWILGDVFMG+YHTVFD+GK +VGFAEA
Sbjct  446  APEEYVLKVGEGPAAQCISGFIALDVAPPRGPLWILGDVFMGKYHTVFDFGKEQVGFAEA  505



>ref|XP_008664893.1| PREDICTED: aspartic proteinase oryzasin-1-like [Zea mays]
 tpg|DAA49681.1| TPA: hypothetical protein ZEAMMB73_239621 [Zea mays]
Length=299

 Score =   281 bits (718),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 154/182 (85%), Gaps = 2/182 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD--LHDAMCSACE  520
            Q+++DLL+ E +P KICSQ+GLCTF+G  GVS GI SVVD++ G S      D MC+ACE
Sbjct  118  QQILDLLLAETQPAKICSQVGLCTFDGTHGVSAGIRSVVDDEAGKSNGGLKSDPMCNACE  177

Query  519  MTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFD  340
            M VVWMQNQL++N+TQE IL+Y+N+LC RLPSPMGES VDCG L++MP ++F+IGGK F 
Sbjct  178  MAVVWMQNQLAQNKTQELILNYINQLCERLPSPMGESAVDCGSLASMPDIAFTIGGKKFK  237

Query  339  LSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAE  160
            L P +YILKVGEG AAQCISGFTA+D+PPPRGPLWILGDVFMG YHTVFDYGK+RVGFAE
Sbjct  238  LKPEQYILKVGEGQAAQCISGFTAMDIPPPRGPLWILGDVFMGVYHTVFDYGKLRVGFAE  297

Query  159  AA  154
            +A
Sbjct  298  SA  299



>gb|KJB67247.1| hypothetical protein B456_010G182400 [Gossypium raimondii]
Length=510

 Score =   288 bits (736),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 155/181 (86%), Gaps = 5/181 (3%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHDAMCSACEM  517
            Q +IDLLV +A P KICSQIGLC F+G+ GVSMGIE+VVDE NG S+  LH AMC ACEM
Sbjct  334  QTIIDLLVSQAEPMKICSQIGLCAFDGSHGVSMGIENVVDESNGKSSGILHSAMCPACEM  393

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQNQL ENQTQ+ IL Y N+LC+R+P+PMGES VDCG LS+MP++SF+IGGK F+L
Sbjct  394  AVVWMQNQLMENQTQDRILDYANQLCDRVPNPMGESTVDCGSLSSMPTISFTIGGKAFEL  453

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P E    VGEG+ AQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFD+GK+RVGFAEA
Sbjct  454  TPEE----VGEGAEAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDFGKLRVGFAEA  509

Query  156  A  154
            A
Sbjct  510  A  510



>gb|AFW85769.1| hypothetical protein ZEAMMB73_486102 [Zea mays]
Length=267

 Score =   279 bits (714),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 127/182 (70%), Positives = 153/182 (84%), Gaps = 2/182 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD--LHDAMCSACE  520
            Q+++DLL+ E +P KICSQ+GLCTF+G  GVS GI SVVD++ G S      D MC+ACE
Sbjct  86   QQILDLLLAETQPAKICSQVGLCTFDGTHGVSAGIRSVVDDEAGKSNGGLKSDPMCNACE  145

Query  519  MTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFD  340
            M VVWMQNQL++N+TQE IL+Y+N+LC RLPSPMGES VDCG L++MP ++F+IGGK F 
Sbjct  146  MAVVWMQNQLAQNKTQELILNYINQLCERLPSPMGESAVDCGSLASMPDIAFTIGGKKFK  205

Query  339  LSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAE  160
            L P +YILKVGEG AAQCISGF A+D+PPPRGPLWILGDVFMG YHTVFDYGK+RVGFAE
Sbjct  206  LKPEQYILKVGEGQAAQCISGFKAMDIPPPRGPLWILGDVFMGVYHTVFDYGKLRVGFAE  265

Query  159  AA  154
            +A
Sbjct  266  SA  267



>emb|CDY34819.1| BnaA09g47450D [Brassica napus]
Length=615

 Score =   290 bits (742),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 134/180 (74%), Positives = 158/180 (88%), Gaps = 1/180 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHDAMCSACEM  517
            Q ++DLL+ EA+PKKICSQIGLCTF+G RGVS+GIESVVD++N  S++ + DA CSACEM
Sbjct  435  QTILDLLLSEAQPKKICSQIGLCTFDGKRGVSVGIESVVDQENVKSSNGVGDAACSACEM  494

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVW+Q+QL +N TQE IL Y+N+LC RLPSPMGES VDC +LSTMP+VS +IGGKVFDL
Sbjct  495  AVVWIQSQLRQNMTQERILDYINDLCERLPSPMGESAVDCAQLSTMPTVSLTIGGKVFDL  554

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P EY+LKVGEG AAQCISGF ALDV PPRGPLWILGDVFMG+YHTVFD+GK +VGFAEA
Sbjct  555  APEEYVLKVGEGPAAQCISGFIALDVAPPRGPLWILGDVFMGKYHTVFDFGKEQVGFAEA  614



>gb|ACN24614.1| aspartic acid protease [Phaseolus vulgaris]
Length=513

 Score =   287 bits (735),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 154/181 (85%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDE-KNGVSADLHDAMCSACEM  517
            Q +++LL+ E +PKKICSQIGLCTF+G RG+ MGI SVVDE     S  LHDA CSACEM
Sbjct  333  QTILNLLLAETQPKKICSQIGLCTFDGTRGIDMGIASVVDEIARKSSGGLHDAACSACEM  392

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQNQLS NQTQ+ ILSY+N+LC+++PSPMGES +D G +S++P VSF+IGG+ FDL
Sbjct  393  AVVWMQNQLSRNQTQDQILSYINQLCDKMPSPMGESSIDRGNISSLPVVSFTIGGRTFDL  452

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
             P EYILKVGEG  AQCISGFTA+D+PPPRGPLWILGDVFMGRYHTVFD+G +RVGFA+A
Sbjct  453  LPEEYILKVGEGPVAQCISGFTAIDIPPPRGPLWILGDVFMGRYHTVFDFGNLRVGFADA  512

Query  156  A  154
            A
Sbjct  513  A  513



>dbj|BAE20413.1| aspartic proteinase [Triticum aestivum]
Length=508

 Score =   287 bits (734),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 154/181 (85%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLH-DAMCSACEM  517
            Q+++DLL+ E +PKK+CSQ+GLCTF+G RGVS GI SVVD++   S  LH D MCSACEM
Sbjct  328  QQILDLLLAETQPKKVCSQVGLCTFDGTRGVSAGIRSVVDDEPVKSNGLHTDPMCSACEM  387

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQNQL++N+TQ+ IL YVN+LCNRLPSPMGES VDC  L +MP + F+I GK F L
Sbjct  388  AVVWMQNQLAQNKTQDLILDYVNQLCNRLPSPMGESAVDCASLGSMPDIEFTISGKKFAL  447

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
             P EYILKVGEG+AAQCISGFTA+D+PPPRGPLWILGDVFMG YHTVFDYGK+RVGFA+A
Sbjct  448  KPEEYILKVGEGAAAQCISGFTAMDIPPPRGPLWILGDVFMGPYHTVFDYGKLRVGFAKA  507

Query  156  A  154
            A
Sbjct  508  A  508



>ref|XP_008800699.1| PREDICTED: aspartic proteinase oryzasin-1-like isoform X1 [Phoenix 
dactylifera]
Length=547

 Score =   288 bits (737),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 156/181 (86%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLH-DAMCSACEM  517
            Q ++D+L+ E +P KICS IGLCTF+G  GVS+GIESVV++   +SA L  DAMC+ACEM
Sbjct  367  QEILDMLLSETQPAKICSHIGLCTFDGTHGVSVGIESVVNDNGDLSAGLQSDAMCTACEM  426

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQNQL +N+TQE IL+Y+NELC RLPSPMGES VDC  L++MPSVSF+IGGK F+L
Sbjct  427  AVVWMQNQLKQNETQELILNYINELCERLPSPMGESSVDCASLASMPSVSFTIGGKSFEL  486

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P +YILKVGEG+AAQCISGFTALDVPPPRGPLWILGDVFMG YHTVFDY  +RVGFAEA
Sbjct  487  TPEQYILKVGEGAAAQCISGFTALDVPPPRGPLWILGDVFMGVYHTVFDYENLRVGFAEA  546

Query  156  A  154
            A
Sbjct  547  A  547



>ref|XP_006467404.1| PREDICTED: aspartic proteinase-like isoform X1 [Citrus sinensis]
Length=598

 Score =   289 bits (740),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 164/181 (91%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHDAMCSACEM  517
            Q ++DLL+ EA PKKICSQ+GLCTF+G RGVSMGIESVVDE N  S+  L++AMCSACEM
Sbjct  418  QTILDLLLFEAHPKKICSQMGLCTFDGKRGVSMGIESVVDESNDKSSGVLNNAMCSACEM  477

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQNQL +NQTQENIL YVNELC+R+PSPMGES VDCGKLS+MP VSF+IGGKVFDL
Sbjct  478  AVVWMQNQLQQNQTQENILQYVNELCDRMPSPMGESAVDCGKLSSMPIVSFTIGGKVFDL  537

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            SP EYILKVGEG  AQCISGFTA+DVPPPRGPLWILGDVFMGRYHTVFD+G++RVGFAEA
Sbjct  538  SPEEYILKVGEGPEAQCISGFTAMDVPPPRGPLWILGDVFMGRYHTVFDFGELRVGFAEA  597

Query  156  A  154
            A
Sbjct  598  A  598



>emb|CAM12780.1| aspartic proteinase [Fagopyrum esculentum]
Length=506

 Score =   286 bits (733),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 156/181 (86%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEK-NGVSADLHDAMCSACEM  517
            ++++DLLV + +P+KICSQIGLCTF+G RGVSMGIESVVD+  +  S +L DA CSACEM
Sbjct  326  KQILDLLVSQTQPRKICSQIGLCTFDGTRGVSMGIESVVDKNVDKSSGNLKDATCSACEM  385

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQNQL +NQT++ IL Y N+LC RLPSPMGES VDCG LST+P+VSF++GGK F L
Sbjct  386  AVVWMQNQLKQNQTEDRILDYANQLCERLPSPMGESAVDCGSLSTLPTVSFTLGGKTFAL  445

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P +YIL+VGEG A QCISGF ALDVPPPRGPLWILGD+FMG+YHTVFD+G M+VGFAEA
Sbjct  446  APEQYILQVGEGPATQCISGFIALDVPPPRGPLWILGDIFMGQYHTVFDHGNMQVGFAEA  505

Query  156  A  154
            A
Sbjct  506  A  506



>ref|XP_007211824.1| hypothetical protein PRUPE_ppa004375mg [Prunus persica]
 gb|EMJ13023.1| hypothetical protein PRUPE_ppa004375mg [Prunus persica]
Length=514

 Score =   287 bits (734),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 154/181 (85%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEK-NGVSADLHDAMCSACEM  517
            + +I+ ++ + +P+KICSQIGLCTF+G  GVS  I+SVV+E  + VS  L DA CSACEM
Sbjct  334  ETIIERILAKDQPQKICSQIGLCTFDGTHGVSTEIKSVVEENTHKVSGGLSDASCSACEM  393

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
            TVVWMQNQL +NQTQE IL YVN+LC RLPSPMGES VDC  LS+MPSVSF+IGG+ FDL
Sbjct  394  TVVWMQNQLKQNQTQERILEYVNQLCERLPSPMGESAVDCSGLSSMPSVSFTIGGRTFDL  453

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P +Y+LKVGEG AAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYG  R+GFAEA
Sbjct  454  TPEQYVLKVGEGDAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGNERIGFAEA  513

Query  156  A  154
            A
Sbjct  514  A  514



>gb|KJB13720.1| hypothetical protein B456_002G091100 [Gossypium raimondii]
Length=375

 Score =   282 bits (722),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 155/181 (86%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNG-VSADLHDAMCSACEM  517
            ++++D+L+ +  PKKICSQIGLC F+G +GVSM IES+V+E  G  S  L DAMCS CEM
Sbjct  195  EKILDMLLAKDEPKKICSQIGLCLFDGTQGVSMEIESIVNENAGKASGSLRDAMCSTCEM  254

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             V+WMQNQL +NQTQ++I+ YVNELC+RLPSPMGES +DC  LS+MPSVSF+I GK+F+L
Sbjct  255  AVIWMQNQLKQNQTQDHIIDYVNELCDRLPSPMGESSIDCKSLSSMPSVSFTIAGKLFEL  314

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
             P +Y++KVGEG  AQCISGFTALDVPPPRGPLWILGDVFMG++HTVFDYG M++GFAEA
Sbjct  315  RPEQYVMKVGEGDGAQCISGFTALDVPPPRGPLWILGDVFMGQFHTVFDYGNMQIGFAEA  374

Query  156  A  154
            A
Sbjct  375  A  375



>ref|XP_008226860.1| PREDICTED: aspartic proteinase A1-like [Prunus mume]
 ref|XP_008226861.1| PREDICTED: aspartic proteinase A1-like [Prunus mume]
Length=514

 Score =   286 bits (733),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 154/181 (85%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEK-NGVSADLHDAMCSACEM  517
            + +I+ ++ + +P+KICSQIGLCTF+G  GVS  I+SVV+E  + VS  L DA CSACEM
Sbjct  334  ETIIERILAKDQPQKICSQIGLCTFDGTHGVSTEIKSVVEENTHKVSGGLSDASCSACEM  393

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
            TVVWMQNQL +NQTQE IL YVN+LC RLPSPMGES VDC  LS+MPSVSF+IGG+ FDL
Sbjct  394  TVVWMQNQLKQNQTQERILEYVNQLCERLPSPMGESAVDCSGLSSMPSVSFTIGGRTFDL  453

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P +Y+LKVGEG AAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYG  R+GFAEA
Sbjct  454  TPEQYVLKVGEGDAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGNERIGFAEA  513

Query  156  A  154
            A
Sbjct  514  A  514



>ref|XP_006654801.1| PREDICTED: aspartic proteinase oryzasin-1-like [Oryza brachyantha]
Length=509

 Score =   286 bits (733),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 158/181 (87%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLH-DAMCSACEM  517
            Q+++DLL+ E +P KICSQ+GLCTF+G  GVS  I+SVVD++ G S  LH DAMC+ACEM
Sbjct  329  QQILDLLLAETQPAKICSQVGLCTFDGTHGVSAEIKSVVDDEAGKSNGLHSDAMCNACEM  388

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQNQL++N+TQ+ IL+Y+N+LC++LPSPMGES VDCG L++MP ++F+IGGK F L
Sbjct  389  AVVWMQNQLAQNKTQDRILNYINQLCDKLPSPMGESSVDCGSLASMPEIAFTIGGKQFAL  448

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
             P +YILKVGEG AAQCISGFTA+D+PPPRGPLWILGDVFMG YHTVFDYGKMRVGFA++
Sbjct  449  KPEQYILKVGEGPAAQCISGFTAMDIPPPRGPLWILGDVFMGAYHTVFDYGKMRVGFAKS  508

Query  156  A  154
            A
Sbjct  509  A  509



>gb|AAV84085.2| aspartic proteinase 9 [Fagopyrum esculentum]
Length=506

 Score =   286 bits (732),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 156/181 (86%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEK-NGVSADLHDAMCSACEM  517
            ++++DLLV + +P+KICSQIGLCTF+G RGVSMGIESVVD+  +  S +L DA CSACEM
Sbjct  326  KQILDLLVSQTQPRKICSQIGLCTFDGTRGVSMGIESVVDKNVDKSSGNLKDATCSACEM  385

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQNQL +NQT++ IL Y N+LC RLPSPMGES VDCG LST+P+VSF++GGK F L
Sbjct  386  AVVWMQNQLKQNQTEDRILDYANQLCERLPSPMGESAVDCGSLSTLPTVSFTLGGKTFAL  445

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P +YIL+VGEG A QCISGF ALDVPPPRGPLWILGD+FMG+YHTVFD+G M+VGFAEA
Sbjct  446  APEQYILQVGEGPATQCISGFIALDVPPPRGPLWILGDIFMGQYHTVFDHGNMQVGFAEA  505

Query  156  A  154
            A
Sbjct  506  A  506



>ref|XP_008366439.1| PREDICTED: aspartic proteinase A1-like isoform X2 [Malus domestica]
Length=514

 Score =   286 bits (732),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 155/181 (86%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEK-NGVSADLHDAMCSACEM  517
            + +I+ ++ + +P KICS IGLC+F+G RGVS+GI+SVV+E  + VS  L DA CSACEM
Sbjct  334  ETIIERILAKDQPAKICSXIGLCSFDGTRGVSIGIKSVVEENAHKVSGGLSDATCSACEM  393

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
            TVVWMQNQL +NQTQE IL YVN+LC RLPSPMGES VDCG LS+MP+VSF+IGG+ FDL
Sbjct  394  TVVWMQNQLKQNQTQERILDYVNQLCERLPSPMGESAVDCGGLSSMPNVSFTIGGRTFDL  453

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P +Y+LKVGEG  AQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYG  R+GFAEA
Sbjct  454  TPEQYVLKVGEGDVAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGNERIGFAEA  513

Query  156  A  154
            A
Sbjct  514  A  514



>ref|XP_008366438.1| PREDICTED: aspartic proteinase A1-like isoform X1 [Malus domestica]
Length=518

 Score =   286 bits (732),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 155/181 (86%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEK-NGVSADLHDAMCSACEM  517
            + +I+ ++ + +P KICS IGLC+F+G RGVS+GI+SVV+E  + VS  L DA CSACEM
Sbjct  338  ETIIERILAKDQPAKICSXIGLCSFDGTRGVSIGIKSVVEENAHKVSGGLSDATCSACEM  397

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
            TVVWMQNQL +NQTQE IL YVN+LC RLPSPMGES VDCG LS+MP+VSF+IGG+ FDL
Sbjct  398  TVVWMQNQLKQNQTQERILDYVNQLCERLPSPMGESAVDCGGLSSMPNVSFTIGGRTFDL  457

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P +Y+LKVGEG  AQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYG  R+GFAEA
Sbjct  458  TPEQYVLKVGEGDVAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGNERIGFAEA  517

Query  156  A  154
            A
Sbjct  518  A  518



>ref|XP_008357943.1| PREDICTED: aspartic proteinase A1-like [Malus domestica]
Length=406

 Score =   283 bits (723),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 154/181 (85%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHDAMCSACEM  517
            + +I++LV +A+P+KICSQIG CTF+G RGVS GIES+VD+K    +D +HDA C ACEM
Sbjct  225  KTIIEMLVAKAQPQKICSQIGFCTFDGTRGVSTGIESMVDQKQEKKSDGVHDATCVACEM  284

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQN+L +NQT+E IL YVN+LC RLPSP GES V+C  LS++PSVSF+IGGKVFDL
Sbjct  285  AVVWMQNKLRKNQTEEQILDYVNQLCERLPSPSGESVVECDALSSLPSVSFTIGGKVFDL  344

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P +Y+LKVGEG AAQCISGF ALDV PPRGPLWILGDVFMGRYHTVFDYG + VGFAEA
Sbjct  345  APEQYVLKVGEGVAAQCISGFIALDVAPPRGPLWILGDVFMGRYHTVFDYGNLSVGFAEA  404

Query  156  A  154
            A
Sbjct  405  A  405



>gb|AFW79207.1| hypothetical protein ZEAMMB73_486493 [Zea mays]
Length=382

 Score =   282 bits (721),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 154/182 (85%), Gaps = 2/182 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD--LHDAMCSACE  520
            Q+++DLL+ E +P KICSQ+GLCTF+G  GVS GI SVVD++ G S      D MC+ACE
Sbjct  201  QQILDLLLAETQPAKICSQVGLCTFDGTHGVSAGIRSVVDDEAGKSNGGLKSDPMCNACE  260

Query  519  MTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFD  340
            M VVWMQNQL++N+TQE IL+Y+N+LC RLPSPMGES VDCG L++MP ++F+IGGK F 
Sbjct  261  MAVVWMQNQLAQNKTQELILNYINQLCERLPSPMGESAVDCGSLASMPDIAFTIGGKKFK  320

Query  339  LSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAE  160
            L P +YILKVGEG AAQCISGFTA+D+PPPRGPLWILGDVFMG YHTVFDYGK+RVGFAE
Sbjct  321  LKPEQYILKVGEGQAAQCISGFTAMDIPPPRGPLWILGDVFMGVYHTVFDYGKLRVGFAE  380

Query  159  AA  154
            +A
Sbjct  381  SA  382



>ref|XP_007147707.1| hypothetical protein PHAVU_006G147900g [Phaseolus vulgaris]
 gb|ESW19701.1| hypothetical protein PHAVU_006G147900g [Phaseolus vulgaris]
Length=554

 Score =   287 bits (734),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 155/181 (86%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKN-GVSADLHDAMCSACEM  517
            Q +++LL+ EA+P KICSQIGLC+F+G RGVS GIESVVD+ N   S  + DA+CS CEM
Sbjct  374  QTIMELLLAEAKPNKICSQIGLCSFDGTRGVSTGIESVVDKNNRNSSGAIRDAVCSTCEM  433

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             V+WMQNQL +NQT++ I+ YVN LC++LPSPMG+S VDCGKLS+MP VSF++GGKVFDL
Sbjct  434  AVIWMQNQLRQNQTEDRIIDYVNGLCDKLPSPMGQSSVDCGKLSSMPIVSFTVGGKVFDL  493

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            SP EYILKVGEG  AQCISGF ALDVPPPRGPLWILGDVFMGRYHT+FDYG+ RVGFA A
Sbjct  494  SPKEYILKVGEGPQAQCISGFIALDVPPPRGPLWILGDVFMGRYHTIFDYGQQRVGFAVA  553

Query  156  A  154
            A
Sbjct  554  A  554



>gb|KHN35722.1| Aspartic proteinase [Glycine soja]
Length=514

 Score =   286 bits (731),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 154/181 (85%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDE-KNGVSADLHDAMCSACEM  517
            Q ++DLL+ E +PKKICS+IGLC F+G RGV +GI+SVVDE +   S   H A C ACEM
Sbjct  334  QTILDLLLSETQPKKICSRIGLCAFDGTRGVDVGIKSVVDENERKSSGGHHGAACPACEM  393

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQNQLS NQTQ+ ILSY+N+LC+++PSPMGES VDCG +S++P VSF+IGG+ FDL
Sbjct  394  AVVWMQNQLSRNQTQDQILSYINQLCDKMPSPMGESAVDCGNISSLPVVSFTIGGRTFDL  453

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            SP EYILKVGEG  AQCISGFTA+D+PPPRGPLWILGDVFMGRYHTVFD+GK RVGFA+A
Sbjct  454  SPEEYILKVGEGPVAQCISGFTAIDIPPPRGPLWILGDVFMGRYHTVFDFGKQRVGFADA  513

Query  156  A  154
            A
Sbjct  514  A  514



>ref|XP_008660718.1| PREDICTED: aspartic proteinase oryzasin-1-like [Zea mays]
Length=299

 Score =   278 bits (712),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 127/182 (70%), Positives = 153/182 (84%), Gaps = 2/182 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD--LHDAMCSACE  520
            Q+++DLL+ E +P KICSQ+GLCTF+G  GVS GI SVVD++ G S      D MC+ACE
Sbjct  118  QQILDLLLAETQPAKICSQVGLCTFDGTHGVSAGIRSVVDDEAGKSNGGLKSDPMCNACE  177

Query  519  MTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFD  340
            M VVWMQNQL++N+TQE IL+Y+N+LC RLPSPMGES VDCG L++MP ++F+IGGK F 
Sbjct  178  MAVVWMQNQLAQNKTQELILNYINQLCERLPSPMGESAVDCGSLASMPDIAFTIGGKKFK  237

Query  339  LSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAE  160
            L P +YILKVGEG AAQCISGF A+D+PPPRGPLWILGDVFMG YHTVFDYGK+RVGFAE
Sbjct  238  LKPEQYILKVGEGQAAQCISGFKAMDIPPPRGPLWILGDVFMGVYHTVFDYGKLRVGFAE  297

Query  159  AA  154
            +A
Sbjct  298  SA  299



>ref|XP_009358756.1| PREDICTED: aspartic proteinase-like [Pyrus x bretschneideri]
Length=507

 Score =   285 bits (729),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 153/181 (85%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHDAMCSACEM  517
            + ++DLLV E  PKK+CSQIG+C F+G R VSMGIESVVDE NG S+  LHDA CSACEM
Sbjct  327  RTILDLLVAEVHPKKVCSQIGVCNFDGTRSVSMGIESVVDENNGKSSGILHDASCSACEM  386

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQN+L +N TQ  IL+YVNELC ++P   G+S VDCGKLS+MP VSF+IGGKVF L
Sbjct  387  AVVWMQNELKQNMTQGRILNYVNELCEKMPDASGQSTVDCGKLSSMPPVSFTIGGKVFRL  446

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            + NEYILKVGEG+ AQCISGFT++D+P PRGPLWILGD+FMGRYHTVFDYG MRVGFAEA
Sbjct  447  TSNEYILKVGEGAQAQCISGFTSMDIPRPRGPLWILGDIFMGRYHTVFDYGNMRVGFAEA  506

Query  156  A  154
            A
Sbjct  507  A  507



>gb|KHG05834.1| Asparticase [Gossypium arboreum]
Length=511

 Score =   285 bits (728),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 156/181 (86%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNG-VSADLHDAMCSACEM  517
            ++++D+L+ +  PKKICSQIGLC F+G +GVSMGIES+V+E  G  S  L DAMCS CEM
Sbjct  331  EKILDMLLAKDEPKKICSQIGLCLFDGTQGVSMGIESIVNENAGKASGSLRDAMCSTCEM  390

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             V+WMQNQL +NQT+++I+ YVNELC+RLPSPMGES +DC  LS+MPSVSF+I GK+F+L
Sbjct  391  AVIWMQNQLKQNQTEDHIIDYVNELCDRLPSPMGESSIDCKSLSSMPSVSFTIAGKLFEL  450

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
             P +Y++KVGEG  AQCISGFTALDVPPPRGPLWILGDVFMG++HTVFDYG M++GFAEA
Sbjct  451  RPEQYVMKVGEGDGAQCISGFTALDVPPPRGPLWILGDVFMGQFHTVFDYGNMQIGFAEA  510

Query  156  A  154
            A
Sbjct  511  A  511



>ref|NP_001056348.1| Os05g0567100 [Oryza sativa Japonica Group]
 sp|Q42456.2|ASPR1_ORYSJ RecName: Full=Aspartic proteinase oryzasin-1; Flags: Precursor 
[Oryza sativa Japonica Group]
 gb|AAU10663.1| aspartic proteinase oryzasin 1 precursor [Oryza sativa Japonica 
Group]
 dbj|BAF18262.1| Os05g0567100 [Oryza sativa Japonica Group]
 gb|EAY99059.1| hypothetical protein OsI_21016 [Oryza sativa Indica Group]
 gb|ACA50495.1| aspartic proteinase oryzasin 1 [Oryza sativa Japonica Group]
 dbj|BAG90572.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96074.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96985.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64719.1| hypothetical protein OsJ_19575 [Oryza sativa Japonica Group]
Length=509

 Score =   285 bits (728),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 157/181 (87%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLHDA-MCSACEM  517
            Q+++DLL+ E +P KICSQ+GLCTF+G  GVS GI+SVVD++ G S  L    MC+ACEM
Sbjct  329  QQILDLLLAETQPSKICSQVGLCTFDGKHGVSAGIKSVVDDEAGESNGLQSGPMCNACEM  388

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQNQL++N+TQ+ IL+Y+N+LC++LPSPMGES VDCG L++MP +SF+IGGK F L
Sbjct  389  AVVWMQNQLAQNKTQDLILNYINQLCDKLPSPMGESSVDCGSLASMPEISFTIGGKKFAL  448

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
             P EYILKVGEG+AAQCISGFTA+D+PPPRGPLWILGDVFMG YHTVFDYGKMRVGFA++
Sbjct  449  KPEEYILKVGEGAAAQCISGFTAMDIPPPRGPLWILGDVFMGAYHTVFDYGKMRVGFAKS  508

Query  156  A  154
            A
Sbjct  509  A  509



>emb|CAA57510.1| cyprosin [Cynara cardunculus]
Length=509

 Score =   285 bits (728),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 156/181 (86%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHDAMCSACEM  517
            + MI++L+ EA+P KICSQ+ LCTF+G R  S  IESVVDE NG S+  +HD MC+ CEM
Sbjct  329  KTMIEMLLSEAQPDKICSQMKLCTFDGARDASSIIESVVDENNGKSSSGVHDEMCTFCEM  388

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQNQ+  N+T++NI++YVNELC+RLPSPMGES VDC  LS+MP+++F+IGGKVF+L
Sbjct  389  AVVWMQNQIKRNETEDNIINYVNELCDRLPSPMGESAVDCNSLSSMPNIAFTIGGKVFEL  448

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
             P +YILK+GEG AAQCISGFTA+DV PPRGPLWILGDVFMGRYHTVFDYGK+RVGFAEA
Sbjct  449  CPEQYILKIGEGEAAQCISGFTAMDVAPPRGPLWILGDVFMGRYHTVFDYGKLRVGFAEA  508

Query  156  A  154
            A
Sbjct  509  A  509



>ref|XP_006447588.1| hypothetical protein CICLE_v10017754mg [Citrus clementina]
 gb|ESR60828.1| hypothetical protein CICLE_v10017754mg [Citrus clementina]
Length=486

 Score =   283 bits (725),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 158/182 (87%), Gaps = 2/182 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHD-AMCSACE  520
            + ++++L+ E +P+KICSQ+GLCTF+G RG SMGIESV+D+ +  S+D +HD AMCSACE
Sbjct  305  KTILEMLIAETQPQKICSQMGLCTFDGTRGFSMGIESVIDKSSDKSSDGVHDSAMCSACE  364

Query  519  MTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFD  340
            M V+WMQN+L  N+T + IL+YVN+LC+RLPSP GES VDC  LS+MP+VSF+IGGKVFD
Sbjct  365  MAVIWMQNKLRRNETADQILNYVNQLCDRLPSPNGESAVDCDNLSSMPNVSFTIGGKVFD  424

Query  339  LSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAE  160
            L+PNEY+L+VGEG AAQCISGFTA DV PPRGPLWILGDVFMGRYHTVFDYG + +GFAE
Sbjct  425  LAPNEYVLEVGEGVAAQCISGFTAFDVAPPRGPLWILGDVFMGRYHTVFDYGNLSIGFAE  484

Query  159  AA  154
            AA
Sbjct  485  AA  486



>ref|XP_006383885.1| hypothetical protein POPTR_0004s00900g [Populus trichocarpa]
 gb|ERP61682.1| hypothetical protein POPTR_0004s00900g [Populus trichocarpa]
Length=552

 Score =   285 bits (730),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 159/181 (88%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHDAMCSACEM  517
            + ++DLL+ +A+PK+ICSQIGLCTF+G RG+S+GI+SVVDE N  S+  L DAMC ACEM
Sbjct  372  EAIMDLLLSQAQPKRICSQIGLCTFDGTRGISIGIQSVVDEGNDKSSGVLGDAMCPACEM  431

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWM++QL +NQTQ+ IL YVN+LC R+P+PMGES VDC  + +MP+V+F+IGGK F+L
Sbjct  432  AVVWMRSQLKQNQTQDRILDYVNQLCERMPNPMGESAVDCESVPSMPTVAFTIGGKEFEL  491

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P EYILKVG+GSAAQCISGFTALD+PPPRGPLWILGD+FMGRYHTVFD GK+RVGFAEA
Sbjct  492  APEEYILKVGQGSAAQCISGFTALDIPPPRGPLWILGDIFMGRYHTVFDSGKLRVGFAEA  551

Query  156  A  154
            A
Sbjct  552  A  552



>gb|AAB03843.2| aspartic proteinase [Vigna unguiculata]
 gb|AAQ14346.1| aspartic proteinase [Vigna unguiculata]
Length=513

 Score =   284 bits (727),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 152/181 (84%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEK-NGVSADLHDAMCSACEM  517
            Q +++LL+ E +PKKICSQIGLCTF+G RGV MGIESVVDE     S  LHDA CSACEM
Sbjct  333  QTILNLLLAETQPKKICSQIGLCTFDGTRGVDMGIESVVDENARKSSGGLHDAGCSACEM  392

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVW+QNQLS NQTQ+ ILSYVN+LC+++PSPMGES V CG +S++P VSF+IGG+ FDL
Sbjct  393  AVVWVQNQLSRNQTQDQILSYVNQLCDKMPSPMGESSVGCGDISSLPVVSFTIGGRTFDL  452

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
             P EYILKVGEG  AQCISGFTA+D+ PPRGPLWILGDVFMG YHTVFD+G  RVGFAEA
Sbjct  453  RPEEYILKVGEGPVAQCISGFTAIDIAPPRGPLWILGDVFMGPYHTVFDFGNQRVGFAEA  512

Query  156  A  154
            A
Sbjct  513  A  513



>ref|XP_006600236.1| PREDICTED: aspartic proteinase 1 isoform X1 [Glycine max]
Length=514

 Score =   284 bits (726),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 153/181 (85%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVS-ADLHDAMCSACEM  517
            Q ++DLL+ E +PKKICS+IGLC F+G  GV +GI+SVVDE    S    H A C ACEM
Sbjct  334  QTILDLLLAETQPKKICSRIGLCAFDGTHGVDVGIKSVVDENERKSLGGHHGAACPACEM  393

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQNQLS NQTQ+ ILSY+N+LC+++PSPMGES VDCG +S++P VSF+IGG+ FDL
Sbjct  394  AVVWMQNQLSRNQTQDQILSYINQLCDKMPSPMGESAVDCGNISSLPVVSFTIGGRTFDL  453

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            SP EY+LKVGEG  AQCISGFTA+D+PPPRGPLWILGDVFMGRYHTVFD+GK+RVGFA+A
Sbjct  454  SPEEYVLKVGEGPVAQCISGFTAIDIPPPRGPLWILGDVFMGRYHTVFDFGKLRVGFADA  513

Query  156  A  154
            A
Sbjct  514  A  514



>ref|NP_001237064.1| aspartic proteinase 1 precursor [Glycine max]
 dbj|BAB62890.1| aspartic proteinase 1 [Glycine max]
Length=514

 Score =   284 bits (726),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 153/181 (85%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVS-ADLHDAMCSACEM  517
            Q ++DLL+ E +PKKICS+IGLC F+G  GV +GI+SVVDE    S    H A C ACEM
Sbjct  334  QTILDLLLAETQPKKICSRIGLCAFDGTHGVDVGIKSVVDENERKSLGGHHGAACPACEM  393

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQNQLS NQTQ+ ILSY+N+LC+++PSPMGES VDCG +S++P VSF+IGG+ FDL
Sbjct  394  AVVWMQNQLSRNQTQDQILSYINQLCDKMPSPMGESAVDCGNISSLPVVSFTIGGRTFDL  453

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            SP EY+LKVGEG  AQCISGFTA+D+PPPRGPLWILGDVFMGRYHTVFD+GK+RVGFA+A
Sbjct  454  SPEEYVLKVGEGPVAQCISGFTAIDIPPPRGPLWILGDVFMGRYHTVFDFGKLRVGFADA  513

Query  156  A  154
            A
Sbjct  514  A  514



>gb|KHN03495.1| Aspartic proteinase [Glycine soja]
Length=510

 Score =   284 bits (726),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 153/181 (85%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVS-ADLHDAMCSACEM  517
            Q ++DLL+ E +PKKICS+IGLC F+G  GV +GI+SVVDE    S    H A C ACEM
Sbjct  330  QTILDLLLAETQPKKICSRIGLCAFDGTHGVDVGIKSVVDENERKSLGGHHGAACPACEM  389

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQNQLS NQTQ+ ILSY+N+LC+++PSPMGES VDCG +S++P VSF+IGG+ FDL
Sbjct  390  AVVWMQNQLSRNQTQDQILSYINQLCDKMPSPMGESAVDCGDISSLPVVSFTIGGRTFDL  449

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            SP EY+LKVGEG  AQCISGFTA+D+PPPRGPLWILGDVFMGRYHTVFD+GK+RVGFA+A
Sbjct  450  SPEEYVLKVGEGPVAQCISGFTAIDIPPPRGPLWILGDVFMGRYHTVFDFGKLRVGFADA  509

Query  156  A  154
            A
Sbjct  510  A  510



>ref|XP_010686810.1| PREDICTED: aspartic proteinase A1-like [Beta vulgaris subsp. 
vulgaris]
Length=516

 Score =   284 bits (726),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 130/182 (71%), Positives = 155/182 (85%), Gaps = 2/182 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD--LHDAMCSACE  520
            + +IDLL  E  PKK+CSQIG+CT++G  GVSMGIESVVD+++  S+   LHD MCSACE
Sbjct  335  ETIIDLLFSEGSPKKVCSQIGVCTYDGTHGVSMGIESVVDKESSDSSSEGLHDGMCSACE  394

Query  519  MTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFD  340
            M VVWMQ+QL +N T++ ++SY NELC+R+P+PMG SGVDC ++S MP VSF+I GK F+
Sbjct  395  MAVVWMQSQLKQNATKDRVISYANELCDRVPNPMGTSGVDCARVSKMPPVSFTIAGKEFE  454

Query  339  LSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAE  160
            LSP EYILKVGEG AAQCISGFTALDVPPPRGP+WILGDVFMGRYHTVFDYG +RVGFAE
Sbjct  455  LSPEEYILKVGEGPAAQCISGFTALDVPPPRGPIWILGDVFMGRYHTVFDYGNLRVGFAE  514

Query  159  AA  154
            AA
Sbjct  515  AA  516



>ref|XP_003529645.1| PREDICTED: aspartic proteinase-like isoform X1 [Glycine max]
 ref|XP_006584085.1| PREDICTED: aspartic proteinase-like isoform X2 [Glycine max]
Length=514

 Score =   284 bits (726),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 154/181 (85%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDE-KNGVSADLHDAMCSACEM  517
            Q ++DLL+ E +PKKICS+IGLC F+G RGV +GI+SVVDE +   S   H A C ACEM
Sbjct  334  QTILDLLLSETQPKKICSRIGLCAFDGTRGVDVGIKSVVDENERKSSGGHHGAACPACEM  393

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQNQLS NQTQ+ ILSY+N+LC+++PSPMGES VDCG +S++P VSF+IGG+ F+L
Sbjct  394  AVVWMQNQLSRNQTQDQILSYINQLCDKMPSPMGESAVDCGNISSLPVVSFTIGGRTFEL  453

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            SP EYILKVGEG  AQCISGFTA+D+PPPRGPLWILGDVFMGRYHTVFD+GK RVGFA+A
Sbjct  454  SPEEYILKVGEGPVAQCISGFTAIDIPPPRGPLWILGDVFMGRYHTVFDFGKQRVGFADA  513

Query  156  A  154
            A
Sbjct  514  A  514



>gb|KDO54710.1| hypothetical protein CISIN_1g009634mg [Citrus sinensis]
Length=490

 Score =   283 bits (724),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 158/182 (87%), Gaps = 2/182 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHD-AMCSACE  520
            + ++++L+ E +P+KICSQ+GLCTF+G RG SMGIESV+D+ +  S+D +HD AMCSACE
Sbjct  309  KTILEMLIAETQPQKICSQMGLCTFDGTRGFSMGIESVIDKSSDKSSDGVHDSAMCSACE  368

Query  519  MTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFD  340
            M V+WMQN+L  N+T + IL+YVN+LC+RLPSP GES VDC  LS+MP+VSF+IGGKVFD
Sbjct  369  MAVIWMQNKLRRNETADQILNYVNQLCDRLPSPNGESAVDCDNLSSMPNVSFTIGGKVFD  428

Query  339  LSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAE  160
            L+PNEY+L+VGEG AAQCISGFTA DV PPRGPLWILGDVFMGRYHTVFDYG + +GFAE
Sbjct  429  LAPNEYVLEVGEGVAAQCISGFTAFDVAPPRGPLWILGDVFMGRYHTVFDYGNLSIGFAE  488

Query  159  AA  154
            AA
Sbjct  489  AA  490



>ref|XP_008371074.1| PREDICTED: aspartic proteinase [Malus domestica]
Length=508

 Score =   283 bits (725),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 132/182 (73%), Positives = 157/182 (86%), Gaps = 2/182 (1%)
 Frame = -2

Query  693  QRMIDLLVM-EARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHDAMCSACE  520
            + ++DLLV  E +PKK+CSQIG+CTF+G R VSMGIESVVDEKNG S+  LHDA CSACE
Sbjct  327  RTILDLLVAHEVQPKKVCSQIGVCTFDGTRSVSMGIESVVDEKNGKSSGILHDASCSACE  386

Query  519  MTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFD  340
            M VVWMQN+L  N TQ+ IL+YVNELC ++P  +G+S VDCGKLS+MP VSF+IGG+ F 
Sbjct  387  MAVVWMQNELKXNITQDRILNYVNELCEKMPDTLGQSTVDCGKLSSMPPVSFTIGGRAFK  446

Query  339  LSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAE  160
            L+ +EYILKVGEG+ AQCISGFT+LD+P PRGPLWILGD+FMGRYHTVFDYGKMRVGFA+
Sbjct  447  LTSDEYILKVGEGAQAQCISGFTSLDIPRPRGPLWILGDIFMGRYHTVFDYGKMRVGFAD  506

Query  159  AA  154
            AA
Sbjct  507  AA  508



>ref|XP_004507671.1| PREDICTED: aspartic proteinase-like isoform X1 [Cicer arietinum]
 ref|XP_004507672.1| PREDICTED: aspartic proteinase-like isoform X2 [Cicer arietinum]
 ref|XP_004507673.1| PREDICTED: aspartic proteinase-like isoform X3 [Cicer arietinum]
Length=498

 Score =   283 bits (724),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 127/181 (70%), Positives = 156/181 (86%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDE-KNGVSADLHDAMCSACEM  517
            Q +++LL+ EA+PKKICS+IGLCTF+G  GV++ IESVVDE +   S  LH A CSACEM
Sbjct  318  QTIMNLLLAEAQPKKICSEIGLCTFDGTHGVNLAIESVVDESERKSSGGLHGASCSACEM  377

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQNQLS+N+TQ+ IL+Y+N LC+++PSPMGES VDC  +S++P VSF+IGG+ FDL
Sbjct  378  AVVWMQNQLSQNKTQDQILTYINNLCDKMPSPMGESSVDCEDISSLPVVSFTIGGRTFDL  437

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P EYILKVGEG AAQCISGFTA+D+ PPRGP+WILGD+FMGRYHTVFD+GK RVGFAEA
Sbjct  438  APEEYILKVGEGPAAQCISGFTAIDIAPPRGPIWILGDIFMGRYHTVFDFGKSRVGFAEA  497

Query  156  A  154
            A
Sbjct  498  A  498



>gb|KJB13722.1| hypothetical protein B456_002G091100 [Gossypium raimondii]
Length=492

 Score =   283 bits (723),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 155/181 (86%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNG-VSADLHDAMCSACEM  517
            ++++D+L+ +  PKKICSQIGLC F+G +GVSM IES+V+E  G  S  L DAMCS CEM
Sbjct  312  EKILDMLLAKDEPKKICSQIGLCLFDGTQGVSMEIESIVNENAGKASGSLRDAMCSTCEM  371

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             V+WMQNQL +NQTQ++I+ YVNELC+RLPSPMGES +DC  LS+MPSVSF+I GK+F+L
Sbjct  372  AVIWMQNQLKQNQTQDHIIDYVNELCDRLPSPMGESSIDCKSLSSMPSVSFTIAGKLFEL  431

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
             P +Y++KVGEG  AQCISGFTALDVPPPRGPLWILGDVFMG++HTVFDYG M++GFAEA
Sbjct  432  RPEQYVMKVGEGDGAQCISGFTALDVPPPRGPLWILGDVFMGQFHTVFDYGNMQIGFAEA  491

Query  156  A  154
            A
Sbjct  492  A  492



>ref|XP_006469663.1| PREDICTED: aspartic proteinase-like [Citrus sinensis]
 gb|KDO54712.1| hypothetical protein CISIN_1g009634mg [Citrus sinensis]
Length=514

 Score =   283 bits (725),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 158/182 (87%), Gaps = 2/182 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHD-AMCSACE  520
            + ++++L+ E +P+KICSQ+GLCTF+G RG SMGIESV+D+ +  S+D +HD AMCSACE
Sbjct  333  KTILEMLIAETQPQKICSQMGLCTFDGTRGFSMGIESVIDKSSDKSSDGVHDSAMCSACE  392

Query  519  MTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFD  340
            M V+WMQN+L  N+T + IL+YVN+LC+RLPSP GES VDC  LS+MP+VSF+IGGKVFD
Sbjct  393  MAVIWMQNKLRRNETADQILNYVNQLCDRLPSPNGESAVDCDNLSSMPNVSFTIGGKVFD  452

Query  339  LSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAE  160
            L+PNEY+L+VGEG AAQCISGFTA DV PPRGPLWILGDVFMGRYHTVFDYG + +GFAE
Sbjct  453  LAPNEYVLEVGEGVAAQCISGFTAFDVAPPRGPLWILGDVFMGRYHTVFDYGNLSIGFAE  512

Query  159  AA  154
            AA
Sbjct  513  AA  514



>gb|AFK46704.1| unknown [Medicago truncatula]
Length=510

 Score =   283 bits (724),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 157/181 (87%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLH-DAMCSACEM  517
              ++ LLV EA+PKK+CSQIGLCTF+G +G+SMGI+SVV++ + +S+  H DA C  CEM
Sbjct  330  HSILQLLVAEAQPKKVCSQIGLCTFDGTQGISMGIQSVVEQTDRISSGGHQDATCFVCEM  389

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQNQL +NQT+E I++Y + LC+++P+P+G+S VDC K+S+MP VSF+IGGK FDL
Sbjct  390  AVVWMQNQLKQNQTEERIINYADSLCDKMPNPLGQSSVDCAKISSMPKVSFTIGGKKFDL  449

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P EYILKVGEG+AAQCISGFTALDVPPPRGPLWI GD+FMGRYHTVFDYGK+RVGFAEA
Sbjct  450  APEEYILKVGEGAAAQCISGFTALDVPPPRGPLWIPGDIFMGRYHTVFDYGKLRVGFAEA  509

Query  156  A  154
            A
Sbjct  510  A  510



>gb|KJB13718.1| hypothetical protein B456_002G091100 [Gossypium raimondii]
 gb|KJB13721.1| hypothetical protein B456_002G091100 [Gossypium raimondii]
 gb|KJB13724.1| hypothetical protein B456_002G091100 [Gossypium raimondii]
Length=512

 Score =   283 bits (724),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 155/181 (86%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNG-VSADLHDAMCSACEM  517
            ++++D+L+ +  PKKICSQIGLC F+G +GVSM IES+V+E  G  S  L DAMCS CEM
Sbjct  332  EKILDMLLAKDEPKKICSQIGLCLFDGTQGVSMEIESIVNENAGKASGSLRDAMCSTCEM  391

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             V+WMQNQL +NQTQ++I+ YVNELC+RLPSPMGES +DC  LS+MPSVSF+I GK+F+L
Sbjct  392  AVIWMQNQLKQNQTQDHIIDYVNELCDRLPSPMGESSIDCKSLSSMPSVSFTIAGKLFEL  451

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
             P +Y++KVGEG  AQCISGFTALDVPPPRGPLWILGDVFMG++HTVFDYG M++GFAEA
Sbjct  452  RPEQYVMKVGEGDGAQCISGFTALDVPPPRGPLWILGDVFMGQFHTVFDYGNMQIGFAEA  511

Query  156  A  154
            A
Sbjct  512  A  512



>gb|KDO54711.1| hypothetical protein CISIN_1g009634mg [Citrus sinensis]
Length=530

 Score =   283 bits (725),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 158/182 (87%), Gaps = 2/182 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHD-AMCSACE  520
            + ++++L+ E +P+KICSQ+GLCTF+G RG SMGIESV+D+ +  S+D +HD AMCSACE
Sbjct  349  KTILEMLIAETQPQKICSQMGLCTFDGTRGFSMGIESVIDKSSDKSSDGVHDSAMCSACE  408

Query  519  MTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFD  340
            M V+WMQN+L  N+T + IL+YVN+LC+RLPSP GES VDC  LS+MP+VSF+IGGKVFD
Sbjct  409  MAVIWMQNKLRRNETADQILNYVNQLCDRLPSPNGESAVDCDNLSSMPNVSFTIGGKVFD  468

Query  339  LSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAE  160
            L+PNEY+L+VGEG AAQCISGFTA DV PPRGPLWILGDVFMGRYHTVFDYG + +GFAE
Sbjct  469  LAPNEYVLEVGEGVAAQCISGFTAFDVAPPRGPLWILGDVFMGRYHTVFDYGNLSIGFAE  528

Query  159  AA  154
            AA
Sbjct  529  AA  530



>gb|AAK55849.1|AF266465_1 aspartic protease [Manihot esculenta]
Length=159

 Score =   271 bits (692),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 140/159 (88%), Gaps = 1/159 (1%)
 Frame = -2

Query  627  CTFNGNRGVSMGIESVVDEKNG-VSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYV  451
            CTF+G+RGVSM IESVV+E +  V+  LHDAMCS CEM V+WMQNQL +N T E IL+Y 
Sbjct  1    CTFDGSRGVSMTIESVVNENSQEVAGSLHDAMCSTCEMAVIWMQNQLKQNATLERILNYA  60

Query  450  NELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFT  271
            NELC RLPSPMGES VDCG LSTMP+VSF+IGGKVFDLSP +Y+LKVGEG AAQCISGFT
Sbjct  61   NELCERLPSPMGESAVDCGSLSTMPNVSFTIGGKVFDLSPEQYVLKVGEGEAAQCISGFT  120

Query  270  ALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEAA  154
            ALDVPPPRGPLWILGDVFMGR+HTVFDYG +RVGFAEAA
Sbjct  121  ALDVPPPRGPLWILGDVFMGRFHTVFDYGNLRVGFAEAA  159



>ref|XP_010924299.1| PREDICTED: LOW QUALITY PROTEIN: aspartic proteinase oryzasin-1-like 
[Elaeis guineensis]
Length=546

 Score =   283 bits (725),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 154/181 (85%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLH-DAMCSACEM  517
            Q ++D+L+ E +P KICS+IGLC F+G  GVS+GIE+VV +   +SA    DAMC+ACEM
Sbjct  366  QEILDMLLSETQPAKICSRIGLCAFDGTHGVSIGIENVVHDNGDLSAGFQSDAMCTACEM  425

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQNQL +N+TQE IL+Y+NELC RLPSPMGES VDC  L++MPS+SF+IGGK F+L
Sbjct  426  AVVWMQNQLRQNETQERILNYINELCERLPSPMGESSVDCASLASMPSISFTIGGKSFEL  485

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P +YILKVGEG AAQCISGFTALDVPPPRGPLWILGDVFMG YHTVFDYG +RVGFA+A
Sbjct  486  TPEQYILKVGEGVAAQCISGFTALDVPPPRGPLWILGDVFMGVYHTVFDYGNLRVGFADA  545

Query  156  A  154
            A
Sbjct  546  A  546



>gb|KJB22150.1| hypothetical protein B456_004G031800 [Gossypium raimondii]
 gb|KJB22151.1| hypothetical protein B456_004G031800 [Gossypium raimondii]
Length=514

 Score =   283 bits (723),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 156/181 (86%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNG-VSADLHDAMCSACEM  517
            + +IDLL+ + +P K+CSQIGLC+F+G R VSMGIESVV+E  G  S ++HDAMCS CEM
Sbjct  334  ETIIDLLLSKDQPLKVCSQIGLCSFDGTRDVSMGIESVVNENAGKASGNVHDAMCSVCEM  393

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             V+W+Q+QL +NQTQE IL YVNELC+RLPSPMGES VDC  LS+MPSV+F+IGGK+ +L
Sbjct  394  AVIWVQSQLKQNQTQERILDYVNELCDRLPSPMGESVVDCNSLSSMPSVAFTIGGKILEL  453

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P +YILKVG+G  AQCISGF ALDVPPPRGPLWILGDVFMG++HTVFDYG M++GFAEA
Sbjct  454  TPEQYILKVGDGELAQCISGFGALDVPPPRGPLWILGDVFMGKFHTVFDYGNMQIGFAEA  513

Query  156  A  154
            A
Sbjct  514  A  514



>ref|XP_008647844.1| PREDICTED: aspartic proteinase oryzasin-1 isoform X1 [Zea mays]
 gb|ACN27572.1| unknown [Zea mays]
 gb|ACR38429.1| unknown [Zea mays]
 gb|AFW79205.1| aspartic proteinase oryzasin-1 isoform 1 [Zea mays]
 gb|AFW79206.1| aspartic proteinase oryzasin-1 isoform 2 [Zea mays]
Length=510

 Score =   282 bits (722),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 154/182 (85%), Gaps = 2/182 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD--LHDAMCSACE  520
            Q+++DLL+ E +P KICSQ+GLCTF+G  GVS GI SVVD++ G S      D MC+ACE
Sbjct  329  QQILDLLLAETQPAKICSQVGLCTFDGTHGVSAGIRSVVDDEAGKSNGGLKSDPMCNACE  388

Query  519  MTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFD  340
            M VVWMQNQL++N+TQE IL+Y+N+LC RLPSPMGES VDCG L++MP ++F+IGGK F 
Sbjct  389  MAVVWMQNQLAQNKTQELILNYINQLCERLPSPMGESAVDCGSLASMPDIAFTIGGKKFK  448

Query  339  LSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAE  160
            L P +YILKVGEG AAQCISGFTA+D+PPPRGPLWILGDVFMG YHTVFDYGK+RVGFAE
Sbjct  449  LKPEQYILKVGEGQAAQCISGFTAMDIPPPRGPLWILGDVFMGVYHTVFDYGKLRVGFAE  508

Query  159  AA  154
            +A
Sbjct  509  SA  510



>dbj|BAA06876.1| aspartic protease [Oryza sativa]
 dbj|BAA06875.1| aspartic protease [Oryza sativa]
Length=509

 Score =   282 bits (722),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 127/181 (70%), Positives = 156/181 (86%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLHDA-MCSACEM  517
            Q+++DLL+ E +P KICSQ+GLCTF+G  GVS GI+SVVD++ G S  L    MC+ACEM
Sbjct  329  QQILDLLLAETQPSKICSQVGLCTFDGKHGVSAGIKSVVDDEAGESNGLQSGPMCNACEM  388

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQNQL++N+TQ+ IL+Y+N+LC++LPSPMGES VDCG L++MP +SF+IG K F L
Sbjct  389  AVVWMQNQLAQNKTQDLILNYINQLCDKLPSPMGESSVDCGSLASMPEISFTIGAKKFAL  448

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
             P EYILKVGEG+AAQCISGFTA+D+PPPRGPLWILGDVFMG YHTVFDYGKMRVGFA++
Sbjct  449  KPEEYILKVGEGAAAQCISGFTAMDIPPPRGPLWILGDVFMGAYHTVFDYGKMRVGFAKS  508

Query  156  A  154
            A
Sbjct  509  A  509



>ref|XP_006389579.1| aspartic endopeptidase family protein [Populus trichocarpa]
 gb|ERP48493.1| aspartic endopeptidase family protein [Populus trichocarpa]
Length=512

 Score =   282 bits (722),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 128/179 (72%), Positives = 155/179 (87%), Gaps = 1/179 (1%)
 Frame = -2

Query  687  MIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHDAMCSACEMTV  511
            ++DLL+ E +PKKICSQIGLCTF+G RG+SMGI+SVVDE N  S+  L DAMCSACEM V
Sbjct  334  IMDLLLSEVQPKKICSQIGLCTFDGTRGISMGIQSVVDEGNDKSSGVLGDAMCSACEMAV  393

Query  510  VWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDLSP  331
             WM++QL +NQTQ+ +L Y N+LC R+P+P G+S VDCG + +MP ++F+IGGK F+L+P
Sbjct  394  FWMRSQLQQNQTQDRVLDYANQLCERVPNPTGQSTVDCGSVLSMPRIAFTIGGKEFELAP  453

Query  330  NEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEAA  154
             EYILKVG+GSAAQCISGFTALD+PPPRGPLWILGDVFMGRYHTVFD GK+RVGFAEAA
Sbjct  454  EEYILKVGQGSAAQCISGFTALDIPPPRGPLWILGDVFMGRYHTVFDSGKLRVGFAEAA  512



>emb|CAA70340.1| aspartic proteinase [Centaurea calcitrapa]
Length=509

 Score =   282 bits (721),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 157/181 (87%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHDAMCSACEM  517
            + +I++L+ EA+P KICSQ+ LCTF+G R VS  IESVVD+ NG S+  +HD MC+ CEM
Sbjct  329  KTIIEMLLSEAQPDKICSQMKLCTFDGARDVSSIIESVVDKNNGKSSGGVHDEMCTFCEM  388

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQNQ+  NQT++NI++YVNELC+RLPSPMGES VDC  LS+MP+++F+IGGKVF+L
Sbjct  389  AVVWMQNQIKRNQTEDNIINYVNELCDRLPSPMGESAVDCNDLSSMPNIAFTIGGKVFEL  448

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
             P +YILK+GEG AAQCISGFTA+DV PPRGPLWILGDVFMG+YHTVFDYGK+RVGFAEA
Sbjct  449  CPEQYILKIGEGEAAQCISGFTAMDVAPPRGPLWILGDVFMGQYHTVFDYGKLRVGFAEA  508

Query  156  A  154
            A
Sbjct  509  A  509



>ref|XP_010046321.1| PREDICTED: aspartic proteinase A1-like [Eucalyptus grandis]
 ref|XP_010046325.1| PREDICTED: aspartic proteinase A1-like [Eucalyptus grandis]
 gb|KCW88765.1| hypothetical protein EUGRSUZ_A01109 [Eucalyptus grandis]
 gb|KCW88766.1| hypothetical protein EUGRSUZ_A01109 [Eucalyptus grandis]
Length=514

 Score =   282 bits (721),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 155/181 (86%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDE-KNGVSADLHDAMCSACEM  517
            + ++++L+ EA+P+KICSQ+G CTF+G  GV MGIESVVD+ ++  S  L D MC+ACEM
Sbjct  334  KTILEMLLAEAQPQKICSQVGFCTFDGTHGVRMGIESVVDKNEHKSSGGLGDGMCTACEM  393

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQNQL +NQT+E IL YVN+LC RLPSPMGES VDC +LS++PSVS +IGGKVFDL
Sbjct  394  AVVWMQNQLRKNQTEEQILDYVNQLCERLPSPMGESVVDCSELSSLPSVSLTIGGKVFDL  453

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P EY+L+VGEG AAQC+SGF ALDV PPRGPLWILGDVFMGRYHTVFDYG M+VGFAEA
Sbjct  454  APEEYVLQVGEGVAAQCVSGFIALDVAPPRGPLWILGDVFMGRYHTVFDYGNMQVGFAEA  513

Query  156  A  154
            A
Sbjct  514  A  514



>ref|XP_011008023.1| PREDICTED: aspartic proteinase-like [Populus euphratica]
 ref|XP_011008024.1| PREDICTED: aspartic proteinase-like [Populus euphratica]
Length=512

 Score =   281 bits (720),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 157/179 (88%), Gaps = 1/179 (1%)
 Frame = -2

Query  687  MIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHDAMCSACEMTV  511
            ++DLL+ E +PKKICSQIGLCTF+G RG+SMGI+SVVDE N  S+  L +AMCSACEM V
Sbjct  334  IMDLLLSEVQPKKICSQIGLCTFDGTRGISMGIQSVVDEGNDKSSGVLGNAMCSACEMAV  393

Query  510  VWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDLSP  331
             WM++QL +NQTQ+++L Y N+LC R+P+P G+S VDCG + +MP+++F+IGGK F+L+P
Sbjct  394  FWMRSQLQQNQTQDHVLDYANQLCERVPNPTGQSAVDCGSVFSMPTIAFTIGGKEFELAP  453

Query  330  NEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEAA  154
             EYILKVG+GSAAQCISGFTA+D+PPPRGPLWILGDVFMGRYHTVFD GK+RVGFAEAA
Sbjct  454  EEYILKVGQGSAAQCISGFTAMDIPPPRGPLWILGDVFMGRYHTVFDSGKLRVGFAEAA  512



>ref|XP_004961190.1| PREDICTED: aspartic proteinase oryzasin-1-like [Setaria italica]
Length=507

 Score =   281 bits (720),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 127/182 (70%), Positives = 155/182 (85%), Gaps = 2/182 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD--LHDAMCSACE  520
            Q+++DLL+ E +P KICSQ+GLCTF+G  GVS GI SVVD++ G S      D MC+ACE
Sbjct  326  QQILDLLLAETQPAKICSQVGLCTFDGTHGVSAGIRSVVDDEAGKSNGGLRSDPMCNACE  385

Query  519  MTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFD  340
            M VVWMQNQL++N+TQE IL+Y+N+LC+RLPSPMGES VDC  L +MP+++F+IGGK F 
Sbjct  386  MAVVWMQNQLAQNKTQELILNYINQLCDRLPSPMGESSVDCASLKSMPNIAFTIGGKKFS  445

Query  339  LSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAE  160
            L P +YILKVGEGSAAQCISGFTA+D+PPPRGPLWILGDVFMG YHTVFDYGK+RVGFA+
Sbjct  446  LKPEQYILKVGEGSAAQCISGFTAIDIPPPRGPLWILGDVFMGAYHTVFDYGKLRVGFAD  505

Query  159  AA  154
            +A
Sbjct  506  SA  507



>ref|XP_008229973.1| PREDICTED: aspartic proteinase A1-like [Prunus mume]
Length=515

 Score =   281 bits (719),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 156/181 (86%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHDAMCSACEM  517
            + +I++L+ +A+PKKICSQIG CTF+G  GVSMGIES+V+EK  +++D +HDA C+ACEM
Sbjct  335  KTIIEMLLAQAQPKKICSQIGFCTFDGTHGVSMGIESMVNEKLEMTSDGVHDAACAACEM  394

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQN+L  N+T++ IL+YVNELC RLPSP GES V CG LS++PSVSF+IGGKVFDL
Sbjct  395  AVVWMQNRLRLNETEDQILNYVNELCERLPSPSGESVVQCGALSSLPSVSFTIGGKVFDL  454

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P +Y+LKVGEG AAQCISGF ALDV PPRGPLWILGD+FMGRYHTVFDYG   VGFAEA
Sbjct  455  APEQYVLKVGEGVAAQCISGFIALDVAPPRGPLWILGDIFMGRYHTVFDYGNSSVGFAEA  514

Query  156  A  154
            A
Sbjct  515  A  515



>ref|XP_010473444.1| PREDICTED: LOW QUALITY PROTEIN: aspartic proteinase A2-like [Camelina 
sativa]
Length=498

 Score =   280 bits (716),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 129/180 (72%), Positives = 152/180 (84%), Gaps = 1/180 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKN-GVSADLHDAMCSACEM  517
            Q ++DLL+ E +PKKICSQIGLC F+G  GVSMGIESVVD++N   S+ L DA C  CEM
Sbjct  318  QIILDLLLAETQPKKICSQIGLCDFDGTEGVSMGIESVVDKENMKSSSSLRDAGCLPCEM  377

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVW+Q+QL +N TQE I++YVNE+C R+P+P GES VDC KLSTMP+VSF+IGGKVFDL
Sbjct  378  AVVWIQSQLRQNMTQERIVNYVNEICERMPNPNGESAVDCSKLSTMPTVSFTIGGKVFDL  437

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P EYILK+GEG  AQCISGFTA D+PPPRGPLWILGDVFMG+YHTVFD+G  RVGFAEA
Sbjct  438  APEEYILKIGEGPVAQCISGFTAFDIPPPRGPLWILGDVFMGKYHTVFDFGNERVGFAEA  497



>ref|NP_001148782.1| aspartic proteinase oryzasin-1 precursor [Zea mays]
 gb|ACG32889.1| aspartic proteinase oryzasin-1 precursor [Zea mays]
Length=510

 Score =   280 bits (717),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 127/181 (70%), Positives = 153/181 (85%), Gaps = 2/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD--LHDAMCSACE  520
            Q+++DLL+ E +P KICSQ+GLCTF+G  GVS GI SVVD++ G S      D MC+ACE
Sbjct  329  QQILDLLLAETQPTKICSQVGLCTFDGTHGVSAGIRSVVDDEAGKSNGGLKSDPMCNACE  388

Query  519  MTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFD  340
            M VVWMQNQL++N+TQE IL+Y+N+LC RLPSPMGES VDCG L++MP ++F+IGGK F 
Sbjct  389  MAVVWMQNQLAQNKTQELILNYINQLCERLPSPMGESAVDCGSLASMPDIAFTIGGKKFK  448

Query  339  LSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAE  160
            L P +YILKVGEG AAQCISGFTA+D+PPPRGPLWILGDVFMG YHTVFDYGK+RVGFAE
Sbjct  449  LKPEQYILKVGEGQAAQCISGFTAMDIPPPRGPLWILGDVFMGVYHTVFDYGKLRVGFAE  508

Query  159  A  157
            +
Sbjct  509  S  509



>ref|XP_011046961.1| PREDICTED: aspartic proteinase-like [Populus euphratica]
 ref|XP_011046962.1| PREDICTED: aspartic proteinase-like [Populus euphratica]
Length=512

 Score =   280 bits (717),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 127/181 (70%), Positives = 157/181 (87%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHDAMCSACEM  517
            + ++DLL+ EA+PK+ICSQIGLC F+G RG+S+ I+SVVDE N  S+  L DAMCSACEM
Sbjct  332  EAIMDLLLSEAQPKRICSQIGLCMFDGTRGISISIQSVVDEGNDKSSGVLGDAMCSACEM  391

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWM++QL +NQTQ+ IL Y ++LC R+P+PMGES VDC  + +MP+V+F+IGGK F+L
Sbjct  392  AVVWMRSQLKQNQTQDRILDYASQLCERMPNPMGESAVDCESVPSMPTVAFTIGGKEFEL  451

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P EYILKVG+GSAAQCISGFTALD+PPPRGPLWILGD+FMGRYHTVFD GK+RVGFAEA
Sbjct  452  APEEYILKVGQGSAAQCISGFTALDIPPPRGPLWILGDIFMGRYHTVFDSGKLRVGFAEA  511

Query  156  A  154
            A
Sbjct  512  A  512



>ref|XP_009410967.1| PREDICTED: aspartic proteinase oryzasin-1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009410968.1| PREDICTED: aspartic proteinase oryzasin-1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009410969.1| PREDICTED: aspartic proteinase oryzasin-1-like [Musa acuminata 
subsp. malaccensis]
Length=509

 Score =   280 bits (717),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 127/181 (70%), Positives = 153/181 (85%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLH-DAMCSACEM  517
            ++++D+L+ E  P K+CS+IGLCTF+G  GVS+GIESVV+E   VS+ L  DA+CS CEM
Sbjct  329  EQILDMLLSETEPSKVCSRIGLCTFDGTHGVSIGIESVVNENADVSSGLQSDAICSVCEM  388

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQNQL +NQTQE +L+Y+NELC RLPSPMGES VDC  +S+MP VSF+IG K F+L
Sbjct  389  AVVWMQNQLRQNQTQERVLNYINELCERLPSPMGESSVDCAAISSMPGVSFTIGNKTFEL  448

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +  +YILKVGEG+AAQCISGF ALDVPPPRGP+WILGDVFMG YHTVFDYG +RVGFAEA
Sbjct  449  TAEQYILKVGEGAAAQCISGFIALDVPPPRGPIWILGDVFMGVYHTVFDYGNLRVGFAEA  508

Query  156  A  154
            A
Sbjct  509  A  509



>ref|XP_010430270.1| PREDICTED: aspartic proteinase A2-like [Camelina sativa]
Length=514

 Score =   280 bits (717),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 130/180 (72%), Positives = 153/180 (85%), Gaps = 1/180 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKN-GVSADLHDAMCSACEM  517
            Q ++DLL+ E +PKKICSQIGLC F+G  GVSMGIESVVD++N   S+ L  A C  CEM
Sbjct  334  QIILDLLLAETQPKKICSQIGLCDFDGTEGVSMGIESVVDKENMKSSSGLRGAGCPPCEM  393

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVW+Q+QL +N TQE I++YVNE+C R+P+P GES VDC KLSTMP+VSF+IGGKVFDL
Sbjct  394  AVVWIQSQLRQNMTQERIVNYVNEICERMPNPNGESAVDCSKLSTMPTVSFTIGGKVFDL  453

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P EYILK+GEG  AQCISGFTALD+PPPRGPLWILGDVFMG+YHTVFD+GK RVGFAEA
Sbjct  454  APEEYILKIGEGPVAQCISGFTALDIPPPRGPLWILGDVFMGKYHTVFDFGKERVGFAEA  513



>tpg|DAA63137.1| TPA: hypothetical protein ZEAMMB73_794362 [Zea mays]
Length=608

 Score =   283 bits (723),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 154/182 (85%), Gaps = 2/182 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD--LHDAMCSACE  520
            Q+++DLL+ E +P KICSQ+GLCTF+G  GVS GI SVVD++ G S      D MC+ACE
Sbjct  427  QQILDLLLAETQPAKICSQVGLCTFDGTHGVSAGIRSVVDDEAGKSNGGLKSDPMCNACE  486

Query  519  MTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFD  340
            M VVWMQNQL++N+TQE IL+Y+N+LC RLPSPMGES VDCG L++MP ++F+IGGK F 
Sbjct  487  MAVVWMQNQLAQNKTQELILNYINQLCERLPSPMGESAVDCGSLASMPDIAFTIGGKKFK  546

Query  339  LSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAE  160
            L P +YILKVGEG AAQCISGFTA+D+PPPRGPLWILGDVFMG YHTVFDYGK+RVGFAE
Sbjct  547  LKPEQYILKVGEGQAAQCISGFTAMDIPPPRGPLWILGDVFMGVYHTVFDYGKLRVGFAE  606

Query  159  AA  154
            +A
Sbjct  607  SA  608



>ref|XP_008650245.1| PREDICTED: aspartic proteinase oryzasin-1-like, partial [Zea 
mays]
Length=304

 Score =   273 bits (698),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 126/182 (69%), Positives = 150/182 (82%), Gaps = 2/182 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD--LHDAMCSACE  520
            Q+++DLL+ E +P KICSQ+GLCTF+G  GVS GI SVVD++   S      D MC+ACE
Sbjct  123  QQILDLLLAETQPAKICSQVGLCTFDGTHGVSAGIRSVVDDEARKSNGGLKSDPMCNACE  182

Query  519  MTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFD  340
            M VVWMQNQL++N+TQE IL+Y+N+LC RLPSPMGES VDCG L +MP + F+IGGK F 
Sbjct  183  MAVVWMQNQLAQNKTQELILNYINQLCERLPSPMGESAVDCGSLVSMPDIVFTIGGKKFK  242

Query  339  LSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAE  160
            L P +YILKVGEG A QCISGFTA+D+PPPRGPLWILGDVFMG YHTVFDYGK+RVGFAE
Sbjct  243  LKPEQYILKVGEGQAVQCISGFTAMDIPPPRGPLWILGDVFMGVYHTVFDYGKLRVGFAE  302

Query  159  AA  154
            +A
Sbjct  303  SA  304



>gb|KHG04193.1| Asparticase [Gossypium arboreum]
Length=514

 Score =   280 bits (715),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 127/181 (70%), Positives = 154/181 (85%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNG-VSADLHDAMCSACEM  517
            + +IDLL+ + +P K+CSQIGLC+F+G R VSMGIESVV+E  G  S ++HDAMCS CEM
Sbjct  334  EMIIDLLLSKDQPLKVCSQIGLCSFDGTRDVSMGIESVVNENAGKASGNVHDAMCSVCEM  393

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             V+W+Q+QL +NQTQE IL YVNELC+RLPSPMGES VDC  LS MPSV+F+IGGK+ +L
Sbjct  394  AVIWVQSQLKQNQTQERILDYVNELCDRLPSPMGESVVDCNSLSAMPSVAFTIGGKILEL  453

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P +YILKVG+G  AQCISGF ALDVPPPRGPLWILGDVFMG++HTVFDYG M++GFAEA
Sbjct  454  TPEQYILKVGDGELAQCISGFGALDVPPPRGPLWILGDVFMGKFHTVFDYGNMQIGFAEA  513

Query  156  A  154
             
Sbjct  514  T  514



>ref|XP_010553449.1| PREDICTED: aspartic proteinase A1 [Tarenaya hassleriana]
Length=518

 Score =   280 bits (715),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 130/177 (73%), Positives = 149/177 (84%), Gaps = 1/177 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGV-SADLHDAMCSACEM  517
            Q ++DLL+ E +PKKICSQIGLCTF+G  GVSM IESVVD +N   S  L DA CSACEM
Sbjct  334  QTILDLLLAETQPKKICSQIGLCTFDGAHGVSMDIESVVDRENAKPSGALGDAACSACEM  393

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVW+QNQL +N TQ+ IL+Y+NELC R+PSPMGES VDC +LSTMP+VS +IGGKVFDL
Sbjct  394  AVVWIQNQLRQNMTQDRILNYINELCERMPSPMGESAVDCAQLSTMPTVSLTIGGKVFDL  453

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGF  166
            +P EYILK+GEG  AQCISGF ALDVPPPRGPLWILGDVFMG+YHTVFD+G  RVGF
Sbjct  454  APEEYILKMGEGPVAQCISGFIALDVPPPRGPLWILGDVFMGKYHTVFDFGNERVGF  510



>ref|XP_009395027.1| PREDICTED: aspartic proteinase oryzasin-1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009395028.1| PREDICTED: aspartic proteinase oryzasin-1-like [Musa acuminata 
subsp. malaccensis]
Length=515

 Score =   280 bits (715),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 128/180 (71%), Positives = 151/180 (84%), Gaps = 1/180 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLH-DAMCSACEM  517
            Q+++  L+ + +P KICSQ+GLCTF+G  GVS+GIESV++E    SA LH D MC ACEM
Sbjct  335  QQILAKLMSQTQPSKICSQVGLCTFDGTHGVSIGIESVINENEDASAGLHSDGMCHACEM  394

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQNQL  NQTQE+IL+Y+NELC RLPSPMGES VDC  +++MPSVSF+IG K F+L
Sbjct  395  AVVWMQNQLRLNQTQESILNYINELCERLPSPMGESSVDCASVASMPSVSFTIGDKTFEL  454

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
             P +YILKVG+G+AAQCISGFTALDVPPPRGPLWILGDVFMG YHTVFDYG +RVGFA A
Sbjct  455  KPEQYILKVGQGTAAQCISGFTALDVPPPRGPLWILGDVFMGVYHTVFDYGNLRVGFAPA  514



>ref|XP_009347130.1| PREDICTED: aspartic proteinase A1-like [Pyrus x bretschneideri]
Length=512

 Score =   279 bits (714),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 127/181 (70%), Positives = 154/181 (85%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHDAMCSACEM  517
            + +I++LV +A+P+KICSQIG CTF+G RGVS GIES+VD+K    +D +HDA C+ACEM
Sbjct  332  KTIIEMLVAKAQPQKICSQIGFCTFDGTRGVSTGIESMVDQKQEKKSDGVHDATCAACEM  391

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQN+L +NQT+E IL YVN+LC RLPSP GES V+C  LS++PSVSF+IG KVFDL
Sbjct  392  AVVWMQNKLMKNQTEEQILDYVNQLCERLPSPSGESVVECDALSSLPSVSFTIGAKVFDL  451

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P +Y+LKVGEG AAQCISGF ALD+ PPRGPLWILGDVFMG+YHTVFDYG + VGFAEA
Sbjct  452  APEQYVLKVGEGVAAQCISGFIALDIAPPRGPLWILGDVFMGKYHTVFDYGNLSVGFAEA  511

Query  156  A  154
            A
Sbjct  512  A  512



>ref|XP_006391910.1| hypothetical protein EUTSA_v10023414mg [Eutrema salsugineum]
 gb|ESQ29196.1| hypothetical protein EUTSA_v10023414mg [Eutrema salsugineum]
Length=511

 Score =   279 bits (713),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 127/181 (70%), Positives = 154/181 (85%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHDAMCSACEM  517
            Q ++ LL+ E +PKKICSQIG+CTF+G  GVSMGIESVVD+++  S   L DA C ACEM
Sbjct  331  QTILSLLLAETQPKKICSQIGVCTFDGTHGVSMGIESVVDKEDTKSPRGLRDAGCVACEM  390

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVW+Q+QL +N TQE I++Y+N++C R+PSP GES VDC +LSTMP+VSF+IGGKVFDL
Sbjct  391  AVVWIQSQLKQNMTQERIVNYINDICERMPSPNGESAVDCSQLSTMPTVSFTIGGKVFDL  450

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P EY+LK+GEG  AQCISGFTALD+PPPRGPLWILGDVFMGRYHTVFD+G  +VGFAEA
Sbjct  451  APEEYVLKIGEGPVAQCISGFTALDIPPPRGPLWILGDVFMGRYHTVFDFGNEQVGFAEA  510

Query  156  A  154
            A
Sbjct  511  A  511



>gb|AGE15494.1| preprosilpepsin 1 [Silybum marianum]
Length=506

 Score =   278 bits (712),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 128/180 (71%), Positives = 155/180 (86%), Gaps = 2/180 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLHDAMCSACEMT  514
            + +I++L+ EA+P KICSQ+ LCTFNG R VS  IESVVD+ NG S+   + MC+ CEM 
Sbjct  329  KSIIEMLLSEAQPDKICSQMKLCTFNGARDVSSIIESVVDKNNGKSSG--NEMCTFCEMA  386

Query  513  VVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDLS  334
            VVWMQNQ+  NQTQ+NI++YV+ELC+RLPSPMGES VDC  LS+MP++SF+IGGKVF+L 
Sbjct  387  VVWMQNQIKRNQTQDNIINYVSELCDRLPSPMGESAVDCNSLSSMPNISFTIGGKVFELC  446

Query  333  PNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEAA  154
            P +YILK+G+G AAQCISGFTA+DV PPRGPLWILGDVFMGRYHTVFDYGK+RVGFAEAA
Sbjct  447  PEQYILKIGDGEAAQCISGFTAMDVAPPRGPLWILGDVFMGRYHTVFDYGKLRVGFAEAA  506



>ref|NP_176419.2| aspartic proteinase A2 [Arabidopsis thaliana]
 ref|NP_001031219.1| aspartic proteinase A2 [Arabidopsis thaliana]
 sp|Q8VYL3.1|APA2_ARATH RecName: Full=Aspartic proteinase A2; AltName: Full=Aspartic 
protease 57; Short=AtASP57; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL49856.1| putative aspartic protease [Arabidopsis thaliana]
 gb|AAN13225.1| putative aspartic protease [Arabidopsis thaliana]
 dbj|BAH19961.1| AT1G62290 [Arabidopsis thaliana]
 gb|AEE33946.1| aspartic proteinase A2 [Arabidopsis thaliana]
 gb|AEE33947.1| aspartic proteinase A2 [Arabidopsis thaliana]
Length=513

 Score =   279 bits (713),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 126/180 (70%), Positives = 153/180 (85%), Gaps = 1/180 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHDAMCSACEM  517
            Q ++DLL+ E +PKKICSQIGLC ++G  GVSMGIESVVD++N  S+  L DA C ACEM
Sbjct  333  QTILDLLLAETQPKKICSQIGLCAYDGTHGVSMGIESVVDKENTRSSSGLRDAGCPACEM  392

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVW+Q+QL +N TQE I++Y+NE+C R+PSP GES VDC +LS MP+VSF+IGGKVFDL
Sbjct  393  AVVWIQSQLRQNMTQERIVNYINEICERMPSPNGESAVDCSQLSKMPTVSFTIGGKVFDL  452

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P EY+LK+GEG  AQCISGFTALD+PPPRGPLWILGDVFMG+YHTVFD+G  +VGFAEA
Sbjct  453  APEEYVLKIGEGPVAQCISGFTALDIPPPRGPLWILGDVFMGKYHTVFDFGNEQVGFAEA  512



>ref|NP_001150729.1| aspartic proteinase oryzasin-1 precursor [Zea mays]
 gb|ACG40142.1| aspartic proteinase oryzasin-1 precursor [Zea mays]
Length=518

 Score =   279 bits (713),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 127/182 (70%), Positives = 151/182 (83%), Gaps = 2/182 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD--LHDAMCSACE  520
            Q+++DLL+ E +P KICSQ+GLCTF+G  GVS GI SVVD+K G S      D MC+ACE
Sbjct  337  QQILDLLLAETQPAKICSQVGLCTFDGTHGVSTGIRSVVDDKAGKSNGGLKSDPMCNACE  396

Query  519  MTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFD  340
            M VVWMQNQL++N+TQE IL+Y+N+LC RLPSPMGES VDC  L +MP ++F+IGGK F 
Sbjct  397  MAVVWMQNQLAQNKTQELILTYINQLCERLPSPMGESAVDCASLGSMPDIAFTIGGKKFK  456

Query  339  LSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAE  160
            L P +YILKVGEG AAQCISGFTA+D+PPPRGPLWILGDVFMG YHTVFDY K+RVGFAE
Sbjct  457  LKPEQYILKVGEGQAAQCISGFTAMDIPPPRGPLWILGDVFMGVYHTVFDYXKLRVGFAE  516

Query  159  AA  154
            +A
Sbjct  517  SA  518



>ref|XP_002886481.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62740.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
Length=513

 Score =   278 bits (712),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 153/180 (85%), Gaps = 1/180 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHDAMCSACEM  517
            Q ++DLL+ E +PKKICSQIGLC F+G  GVSMGIESVVD++N  S+  L DA C ACEM
Sbjct  333  QTILDLLLAETQPKKICSQIGLCAFDGTHGVSMGIESVVDKENTRSSSGLRDAGCPACEM  392

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             V+W+Q+QL +N TQE I++Y+NE+C R+PSP GES VDC +LS MP+VSF+IGGKVFDL
Sbjct  393  AVMWIQSQLRQNMTQERIVNYINEICERMPSPNGESAVDCSQLSKMPTVSFTIGGKVFDL  452

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P EY+LK+GEG  AQCISGFTALDVPPPRGPLWILGDVFMG+YHTVFD+G  +VGFAEA
Sbjct  453  APEEYVLKIGEGPVAQCISGFTALDVPPPRGPLWILGDVFMGKYHTVFDFGNEQVGFAEA  512



>ref|XP_009353298.1| PREDICTED: aspartic proteinase A1-like [Pyrus x bretschneideri]
Length=510

 Score =   278 bits (711),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 127/181 (70%), Positives = 153/181 (85%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHDAMCSACEM  517
            + +I++LV +A+P+KICSQIG CTF+G RGVS GIES+VD+K    +D +HDA C+ACEM
Sbjct  330  KTIIEMLVAKAQPQKICSQIGFCTFDGTRGVSTGIESMVDQKQEKKSDGVHDATCAACEM  389

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQN+L +NQT+E IL YVN+LC RLPSP GES V+C  LS++PSVSF+IG KVFDL
Sbjct  390  AVVWMQNKLMKNQTEEQILDYVNQLCERLPSPSGESVVECDALSSLPSVSFTIGAKVFDL  449

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P +Y+LKVGEG AAQCISGF ALD+ PPRGPLWILGDVFMG+YHTVFDYG   VGFAEA
Sbjct  450  APEQYVLKVGEGVAAQCISGFIALDIAPPRGPLWILGDVFMGKYHTVFDYGNSSVGFAEA  509

Query  156  A  154
            A
Sbjct  510  A  510



>ref|XP_006301275.1| hypothetical protein CARUB_v10021675mg [Capsella rubella]
 gb|EOA34173.1| hypothetical protein CARUB_v10021675mg [Capsella rubella]
Length=514

 Score =   278 bits (710),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 153/180 (85%), Gaps = 1/180 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNG-VSADLHDAMCSACEM  517
            Q +++LL+ + +PKKICSQIGLCTF+G +GVSMGIESVVD++   +S  L  A C ACEM
Sbjct  334  QTILELLLAKTQPKKICSQIGLCTFDGTKGVSMGIESVVDKETAKLSNGLRGAGCPACEM  393

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVW+Q+QL +N TQE I++YVNE+C R+PSP GES VDC +LS MP+VSF+IGGKVFDL
Sbjct  394  AVVWIQSQLRQNMTQERIVNYVNEMCERMPSPNGESAVDCSQLSKMPTVSFTIGGKVFDL  453

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P EYILK+GEG  AQCISGFTALD+PPPRGPLWILGDVFMG+YHTVFD+G  RVGFAEA
Sbjct  454  APEEYILKIGEGPVAQCISGFTALDIPPPRGPLWILGDVFMGKYHTVFDFGNERVGFAEA  513



>gb|AFB73927.2| preprocirsin [Cirsium vulgare]
Length=509

 Score =   277 bits (709),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 127/181 (70%), Positives = 155/181 (86%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHDAMCSACEM  517
            + +I++L+ EA+P KICSQ+ LCTF+G R VS  IESVVD+ NG S+   +D MC+ CEM
Sbjct  329  KSIIEMLLSEAQPDKICSQMKLCTFDGARDVSSIIESVVDKNNGKSSGGANDEMCTFCEM  388

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQNQ+  N+T++NI++YVNELC+RLPSPMGES VDC  LS+MP+++F+IGGKVF+L
Sbjct  389  AVVWMQNQIKRNETEDNIINYVNELCDRLPSPMGESAVDCNSLSSMPNIAFTIGGKVFEL  448

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
             P +YILK+GEG AAQCISGFTA+DV PPRGPLWILGDVFMGRYHTVFDYGK RVGFAEA
Sbjct  449  CPEQYILKIGEGEAAQCISGFTAMDVAPPRGPLWILGDVFMGRYHTVFDYGKSRVGFAEA  508

Query  156  A  154
            A
Sbjct  509  A  509



>ref|XP_007215237.1| hypothetical protein PRUPE_ppa004349mg [Prunus persica]
 gb|EMJ16436.1| hypothetical protein PRUPE_ppa004349mg [Prunus persica]
Length=515

 Score =   277 bits (708),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 127/181 (70%), Positives = 155/181 (86%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHDAMCSACEM  517
            + ++++L+ +A+PKKICSQIG CTF+G  GVSMGIES+V+EK  +++D +HDA C+ACEM
Sbjct  335  KTIMEMLLAQAQPKKICSQIGFCTFDGTHGVSMGIESMVNEKLEMTSDGVHDAACTACEM  394

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQN+L  N+T++ IL+YVNELC RLPSP GES V C  LS++PSVSF+IGGKVFDL
Sbjct  395  AVVWMQNRLRLNETEDQILNYVNELCERLPSPSGESVVQCDALSSLPSVSFTIGGKVFDL  454

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P +Y+LKVGEG AAQCISGF ALDV PPRGPLWILGD+FMGRYHTVFDYG   VGFAEA
Sbjct  455  APEQYVLKVGEGVAAQCISGFIALDVAPPRGPLWILGDIFMGRYHTVFDYGNSTVGFAEA  514

Query  156  A  154
            A
Sbjct  515  A  515



>ref|XP_010418214.1| PREDICTED: aspartic proteinase A2 isoform X2 [Camelina sativa]
Length=479

 Score =   276 bits (705),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 153/180 (85%), Gaps = 1/180 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKN-GVSADLHDAMCSACEM  517
            Q ++DLL+ E +P+KICSQIGLC F+G +GVSMGI+SVVD++N   S+ L  A C  CEM
Sbjct  299  QIILDLLLAETQPQKICSQIGLCGFDGTQGVSMGIDSVVDKENMKSSSGLRGAGCPPCEM  358

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVW+Q+QL +N TQE I++YVNE+C R+P+P GES VDC KLSTMP+VSF+IGGKVFDL
Sbjct  359  AVVWIQSQLRQNMTQERIVNYVNEICERMPNPNGESAVDCSKLSTMPTVSFTIGGKVFDL  418

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P EYILK+GEG  AQCISGFTALD+PPPRGPLWILGDVFMG+YHTVFD+G  RVGFAEA
Sbjct  419  APEEYILKIGEGPVAQCISGFTALDIPPPRGPLWILGDVFMGKYHTVFDFGNERVGFAEA  478



>dbj|BAB20971.1| aspartic proteinase 3 [Nepenthes alata]
Length=507

 Score =   276 bits (706),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 156/182 (86%), Gaps = 2/182 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVD-EKNGVSAD-LHDAMCSACE  520
            Q ++DLL+ E  P+KICSQIGLCTF+G RGVS+GI+SVVD E NG S+  L DA+C ACE
Sbjct  326  QTIMDLLLAEVSPEKICSQIGLCTFDGTRGVSIGIKSVVDKENNGKSSGILRDALCPACE  385

Query  519  MTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFD  340
            M VVWM++QL +NQTQ  IL+YVN+LC++LPSPMGES VDC ++S+M +VS +IGGKVFD
Sbjct  386  MAVVWMKSQLEQNQTQNLILNYVNDLCDQLPSPMGESAVDCARISSMATVSSTIGGKVFD  445

Query  339  LSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAE  160
            L P +YIL+VGEG AAQCISGFTA+D+PPP GPLWILGD+ MGRYHTVFDYG +RVGFAE
Sbjct  446  LRPEQYILRVGEGPAAQCISGFTAMDIPPPGGPLWILGDILMGRYHTVFDYGNLRVGFAE  505

Query  159  AA  154
            AA
Sbjct  506  AA  507



>ref|XP_006838131.1| hypothetical protein AMTR_s00106p00075970 [Amborella trichopoda]
 gb|ERN00700.1| hypothetical protein AMTR_s00106p00075970 [Amborella trichopoda]
Length=513

 Score =   276 bits (706),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 126/180 (70%), Positives = 155/180 (86%), Gaps = 1/180 (1%)
 Frame = -2

Query  690  RMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLH-DAMCSACEMT  514
            +++ LL+ EA+P+KICSQIGLC F+G+  V MGIESVVD KNG  + L  D+MCSACEM 
Sbjct  334  KIMQLLLAEAQPQKICSQIGLCEFDGSHSVGMGIESVVDMKNGGKSSLKTDSMCSACEMA  393

Query  513  VVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDLS  334
            VVW+QNQL +N TQ+ I++Y+NELC RLPSPMG+S VDC KLS+MP+V+F+IGGK F+L+
Sbjct  394  VVWIQNQLKQNMTQDRIMNYINELCERLPSPMGQSAVDCNKLSSMPNVAFTIGGKAFELT  453

Query  333  PNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEAA  154
            P +YILKVGEG+AAQCISGF+ALDV PPRGPLWILGDV +G YHTVFDYG +RVGFA+AA
Sbjct  454  PQQYILKVGEGAAAQCISGFSALDVAPPRGPLWILGDVVLGVYHTVFDYGNLRVGFAKAA  513



>emb|CAA48939.1| cyprosin [Cynara cardunculus]
Length=474

 Score =   275 bits (703),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 119/180 (66%), Positives = 154/180 (86%), Gaps = 0/180 (0%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLHDAMCSACEMT  514
            + MI++L+ E +P+KICSQ+ LC+F+G+   SM IESVVD+  G S+ LHD MC+ C+M 
Sbjct  295  KSMIEMLLSEEQPEKICSQMKLCSFDGSHDTSMIIESVVDKSKGKSSGLHDEMCTMCQMA  354

Query  513  VVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDLS  334
            VVWMQNQ+ +N+T+ENI++YV++LC RLPSPMGES VDC  LS+MP+++F++GGK F+LS
Sbjct  355  VVWMQNQIRQNETEENIINYVDKLCERLPSPMGESAVDCSSLSSMPNIAFTVGGKTFNLS  414

Query  333  PNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEAA  154
            P +Y+LKVGEG+ AQCISGFTA+DV PP GPLWILGDVFMG+YHTVFDYG +RVGFAEAA
Sbjct  415  PEQYVLKVGEGATAQCISGFTAMDVAPPHGPLWILGDVFMGQYHTVFDYGNLRVGFAEAA  474



>ref|XP_010418210.1| PREDICTED: aspartic proteinase A2 isoform X1 [Camelina sativa]
 ref|XP_010418211.1| PREDICTED: aspartic proteinase A2 isoform X1 [Camelina sativa]
 ref|XP_010418212.1| PREDICTED: aspartic proteinase A2 isoform X1 [Camelina sativa]
 ref|XP_010418213.1| PREDICTED: aspartic proteinase A2 isoform X1 [Camelina sativa]
Length=514

 Score =   275 bits (704),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 153/180 (85%), Gaps = 1/180 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKN-GVSADLHDAMCSACEM  517
            Q ++DLL+ E +P+KICSQIGLC F+G +GVSMGI+SVVD++N   S+ L  A C  CEM
Sbjct  334  QIILDLLLAETQPQKICSQIGLCGFDGTQGVSMGIDSVVDKENMKSSSGLRGAGCPPCEM  393

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVW+Q+QL +N TQE I++YVNE+C R+P+P GES VDC KLSTMP+VSF+IGGKVFDL
Sbjct  394  AVVWIQSQLRQNMTQERIVNYVNEICERMPNPNGESAVDCSKLSTMPTVSFTIGGKVFDL  453

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P EYILK+GEG  AQCISGFTALD+PPPRGPLWILGDVFMG+YHTVFD+G  RVGFAEA
Sbjct  454  APEEYILKIGEGPVAQCISGFTALDIPPPRGPLWILGDVFMGKYHTVFDFGNERVGFAEA  513



>gb|KDO62069.1| hypothetical protein CISIN_1g010230mg [Citrus sinensis]
Length=505

 Score =   275 bits (704),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 145/166 (87%), Gaps = 1/166 (1%)
 Frame = -2

Query  648  ICSQIGLCTFNGNRGVSMGIESVVDEKNG-VSADLHDAMCSACEMTVVWMQNQLSENQTQ  472
            + ++IGLCTF+G+RGVSMGIESVV E N   S   HDAMCS CEM VVWMQNQL +NQTQ
Sbjct  340  LLAKIGLCTFDGSRGVSMGIESVVPENNHRASGGFHDAMCSTCEMAVVWMQNQLKQNQTQ  399

Query  471  ENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAA  292
            E IL+YVNELC+RLPSPMGES VDC +LS++P VSF+IGGK+FDL+P++YILKVGEG AA
Sbjct  400  ERILNYVNELCDRLPSPMGESAVDCSRLSSLPIVSFTIGGKIFDLTPDQYILKVGEGDAA  459

Query  291  QCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEAA  154
            QCISGF+ALDV PPRGPLWILGDVFMG YHTVFDY  MRVGFAEAA
Sbjct  460  QCISGFSALDVAPPRGPLWILGDVFMGPYHTVFDYSNMRVGFAEAA  505



>ref|XP_010667516.1| PREDICTED: aspartic proteinase A1-like [Beta vulgaris subsp. 
vulgaris]
Length=513

 Score =   275 bits (702),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 155/181 (86%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVD-EKNGVSADLHDAMCSACEM  517
            +++++LL+ E +PKKICSQIGLCTF+G R VSMGIESVVD   +  S  L D+MC+ACEM
Sbjct  333  KQILELLLSETQPKKICSQIGLCTFDGKRDVSMGIESVVDVNVDKSSGGLRDSMCTACEM  392

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQNQL +NQT+E IL+Y NELC RLPSPMGES VDC  LS+MPS+SF+I G  FDL
Sbjct  393  AVVWMQNQLRQNQTEERILNYANELCERLPSPMGESAVDCSSLSSMPSISFTIAGTTFDL  452

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P +YILKVGEG+AAQCISGF ALDVPPPRGPLWILGD+FMGRYHTVFDYG +RVGFAEA
Sbjct  453  TPEQYILKVGEGAAAQCISGFIALDVPPPRGPLWILGDIFMGRYHTVFDYGNLRVGFAEA  512

Query  156  A  154
            A
Sbjct  513  A  513



>gb|KJB13723.1| hypothetical protein B456_002G091100 [Gossypium raimondii]
Length=508

 Score =   275 bits (702),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 153/181 (85%), Gaps = 5/181 (3%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNG-VSADLHDAMCSACEM  517
            ++++D+L+     KKICSQIGLC F+G +GVSM IES+V+E  G  S  L DAMCS CEM
Sbjct  332  EKILDMLL----AKKICSQIGLCLFDGTQGVSMEIESIVNENAGKASGSLRDAMCSTCEM  387

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             V+WMQNQL +NQTQ++I+ YVNELC+RLPSPMGES +DC  LS+MPSVSF+I GK+F+L
Sbjct  388  AVIWMQNQLKQNQTQDHIIDYVNELCDRLPSPMGESSIDCKSLSSMPSVSFTIAGKLFEL  447

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
             P +Y++KVGEG  AQCISGFTALDVPPPRGPLWILGDVFMG++HTVFDYG M++GFAEA
Sbjct  448  RPEQYVMKVGEGDGAQCISGFTALDVPPPRGPLWILGDVFMGQFHTVFDYGNMQIGFAEA  507

Query  156  A  154
            A
Sbjct  508  A  508



>emb|CDY24888.1| BnaA03g59920D [Brassica napus]
Length=511

 Score =   274 bits (701),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 154/181 (85%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHDAMCSACEM  517
            Q ++DLL+ +A+PK ICS+IGLCTF+G  GVSMGIESVVD++N  S+  L DA C+ CEM
Sbjct  331  QTILDLLLAKAQPKHICSKIGLCTFDGTHGVSMGIESVVDKENTKSSSGLRDAGCAPCEM  390

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVW+Q+QL +N TQ+ I++ +N++C R+PSP GES VDC +LS MP+VSF+IGGKVFDL
Sbjct  391  AVVWIQSQLMQNMTQKRIVNNINDICERMPSPNGESAVDCSQLSKMPTVSFTIGGKVFDL  450

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            SP EY+LK+GEG  AQCISGFTALD+PPPRGPLWILGDVFMGRYHTVFD+G  +VGFAEA
Sbjct  451  SPEEYVLKIGEGPVAQCISGFTALDLPPPRGPLWILGDVFMGRYHTVFDFGNEQVGFAEA  510

Query  156  A  154
            A
Sbjct  511  A  511



>gb|AFW74920.1| hypothetical protein ZEAMMB73_522985 [Zea mays]
Length=468

 Score =   273 bits (698),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 126/182 (69%), Positives = 150/182 (82%), Gaps = 2/182 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD--LHDAMCSACE  520
            Q+++DLL+ E +P KICSQ+GLCTF+G  GVS GI SVVD++   S      D MC+ACE
Sbjct  287  QQILDLLLAETQPAKICSQVGLCTFDGTHGVSAGIRSVVDDEARKSNGGLKSDPMCNACE  346

Query  519  MTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFD  340
            M VVWMQNQL++N+TQE IL+Y+N+LC RLPSPMGES VDCG L +MP + F+IGGK F 
Sbjct  347  MAVVWMQNQLAQNKTQELILNYINQLCERLPSPMGESAVDCGSLVSMPDIVFTIGGKKFK  406

Query  339  LSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAE  160
            L P +YILKVGEG A QCISGFTA+D+PPPRGPLWILGDVFMG YHTVFDYGK+RVGFAE
Sbjct  407  LKPEQYILKVGEGQAVQCISGFTAMDIPPPRGPLWILGDVFMGVYHTVFDYGKLRVGFAE  466

Query  159  AA  154
            +A
Sbjct  467  SA  468



>ref|XP_003610462.1| Aspartic proteinase [Medicago truncatula]
 gb|AES92659.1| fungal proteinase A, aspartic proteinase superfamily protein 
[Medicago truncatula]
Length=519

 Score =   274 bits (701),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 153/181 (85%), Gaps = 2/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVD-EKNGVSADLHDAMCSACEM  517
            Q +++LL+ EA+PKKICS+IGLCTF+G  GV + IESVVD  +   S+ LH A CSACEM
Sbjct  340  QTILNLLLAEAQPKKICSEIGLCTFDGTHGVDLAIESVVDGNERKSSSGLHGASCSACEM  399

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQNQL +N+TQ+ IL+Y+N LC+++PSPMGES VDC  +S++P +SF+IGG+ FDL
Sbjct  400  AVVWMQNQLRQNKTQDQILTYINNLCDKMPSPMGESSVDCENISSLPVISFTIGGRTFDL  459

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P EYI KVGEG AAQCISGF A+DVPPPRGP+WILGD+FMGRYHTVFD+GK RVGFAEA
Sbjct  460  APEEYI-KVGEGPAAQCISGFVAIDVPPPRGPIWILGDIFMGRYHTVFDFGKSRVGFAEA  518

Query  156  A  154
            A
Sbjct  519  A  519



>gb|AFH58568.1| aspartic acid protease [Ananas comosus]
Length=514

 Score =   274 bits (700),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 151/181 (83%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSA-DLHDAMCSACEM  517
            Q+++ +L+ E +P KICS IGLCTF+G +GVS GIESVV++    SA  L DAMC+ CEM
Sbjct  334  QQILQMLLAEVQPGKICSSIGLCTFDGKQGVSAGIESVVNKDTRRSAAGLSDAMCNVCEM  393

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQNQ+S+NQTQE I +Y+N+LC +LPSPMGES VDC  +++MP +SF+IGGK F L
Sbjct  394  AVVWMQNQISQNQTQELIFNYLNQLCEKLPSPMGESSVDCSSVASMPDISFTIGGKKFSL  453

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
             P +YIL+VGEG AAQCISGFTALDVPPPRGPLWILGDVFMG YHTVFDYG MRVGFA+A
Sbjct  454  KPEQYILQVGEGYAAQCISGFTALDVPPPRGPLWILGDVFMGAYHTVFDYGNMRVGFADA  513

Query  156  A  154
            A
Sbjct  514  A  514



>dbj|BAA96446.1| aspartic endopeptidase [Pyrus pyrifolia]
Length=273

 Score =   266 bits (680),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 151/181 (83%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHDAMCSACEM  517
            + +I++L+ +++P+KICSQIG CTF+G RGVS GIES+VD+     +D +HDA C+ACEM
Sbjct  93   KTIIEMLMAKSQPQKICSQIGFCTFDGTRGVSPGIESLVDQNPEKQSDGVHDATCAACEM  152

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VV MQ +L +NQT+E IL YVN+LC RLPSP GES V C  LS++PSVSF+IGGKVFDL
Sbjct  153  PVVLMQIRLRKNQTEEQILDYVNQLCERLPSPSGESVVQCDSLSSLPSVSFTIGGKVFDL  212

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P +Y+LKVGEG AAQCISGF ALDV PPRGPLWILGD+FMGRYHTVFDYG + VGFAEA
Sbjct  213  APEQYVLKVGEGVAAQCISGFIALDVAPPRGPLWILGDIFMGRYHTVFDYGNLSVGFAEA  272

Query  156  A  154
            A
Sbjct  273  A  273



>ref|XP_011100273.1| PREDICTED: cyprosin-like [Sesamum indicum]
Length=504

 Score =   273 bits (697),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 153/181 (85%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGV-SADLHDAMCSACEM  517
            + ++++L+ +  P++ICS+IGLC+ +G R VSM IESVVD+ +   S  LHD MC+AC+M
Sbjct  324  KTILEMLLSKEEPQRICSRIGLCSSDGIRDVSMIIESVVDKDSTKDSYGLHDEMCTACQM  383

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQNQL  N T+E IL Y+NELC+RLPSPMGES VDC  LS+MP+VSF+IGGK FDL
Sbjct  384  AVVWMQNQLRRNVTEEKILDYINELCDRLPSPMGESAVDCSVLSSMPNVSFTIGGKSFDL  443

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P +Y+LKVGEG AAQCISGFTALDVPPPRGPLWILGDVFMG+YHTVFDYG M+VGFAEA
Sbjct  444  TPEQYVLKVGEGDAAQCISGFTALDVPPPRGPLWILGDVFMGQYHTVFDYGNMKVGFAEA  503

Query  156  A  154
            A
Sbjct  504  A  504



>ref|XP_008342027.1| PREDICTED: aspartic proteinase A1-like [Malus domestica]
Length=538

 Score =   273 bits (699),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 154/181 (85%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHDAMCSACEM  517
            + +I++L+ +++P+K+CSQIG CTF+G RGVS GIES+VD+K    +D ++DA C+ACEM
Sbjct  358  KTIIEMLMAKSQPQKVCSQIGFCTFDGTRGVSTGIESMVDQKPEKQSDGVNDATCAACEM  417

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQ++L +NQT+E IL YVN+LC RLPSP GES V C  LS++PSVSF+IGGKVFDL
Sbjct  418  AVVWMQSRLRKNQTEEQILDYVNQLCERLPSPSGESVVQCDALSSLPSVSFTIGGKVFDL  477

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P +YILKVGEG AAQCISGF ALDV PPRGPLWILGD+FMGRYHTVFDYG + VGFAEA
Sbjct  478  APEQYILKVGEGVAAQCISGFIALDVAPPRGPLWILGDIFMGRYHTVFDYGNLSVGFAEA  537

Query  156  A  154
            A
Sbjct  538  A  538



>emb|CDY08632.1| BnaC04g19410D [Brassica napus]
Length=511

 Score =   273 bits (697),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 151/181 (83%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVD-EKNGVSADLHDAMCSACEM  517
            Q ++DLL+ +A+PK ICSQIGLCTF+G  GVSMGIESVVD E    S+ L DA C+ CEM
Sbjct  331  QSILDLLLAKAQPKHICSQIGLCTFDGTHGVSMGIESVVDKESTKSSSGLRDAGCAPCEM  390

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVW+Q+QL +N TQ+ I++Y+N++C R+PSP GES VDC +L  MP+VSF+IGGKVFDL
Sbjct  391  AVVWIQSQLMQNMTQKRIVNYINDICERMPSPNGESAVDCSQLCKMPTVSFTIGGKVFDL  450

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P EY+LK+GEG  AQCISGFTALD+PPPRGPLWILGDVFMGRYHTVF +G  +VGFAEA
Sbjct  451  APEEYVLKIGEGPVAQCISGFTALDLPPPRGPLWILGDVFMGRYHTVFHFGNEQVGFAEA  510

Query  156  A  154
            A
Sbjct  511  A  511



>ref|XP_009394234.1| PREDICTED: aspartic proteinase oryzasin-1-like [Musa acuminata 
subsp. malaccensis]
Length=509

 Score =   272 bits (696),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 150/181 (83%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLH-DAMCSACEM  517
            Q+++ +L+ E  P KICSQIGLCTF+G RGVS+ IESVV+E    S+ +  ++MC  CEM
Sbjct  329  QQILKMLLSETEPAKICSQIGLCTFDGTRGVSIDIESVVNENADASSGVQTNSMCGVCEM  388

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
            +VVWMQNQL +NQTQE +L+Y+N LC RLPSPMGES VDC  +S+MP VSF+IG K F+L
Sbjct  389  SVVWMQNQLRQNQTQERVLNYINGLCERLPSPMGESSVDCAAISSMPGVSFTIGNKTFEL  448

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +  +YILKVGEG+AAQCISGFTALDVPPPRGPLWILGDVFMG YHTVFDY  +RVGFAEA
Sbjct  449  AAEQYILKVGEGAAAQCISGFTALDVPPPRGPLWILGDVFMGVYHTVFDYRNLRVGFAEA  508

Query  156  A  154
            A
Sbjct  509  A  509



>ref|XP_009419881.1| PREDICTED: aspartic proteinase oryzasin-1-like [Musa acuminata 
subsp. malaccensis]
Length=515

 Score =   272 bits (696),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 150/181 (83%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLH-DAMCSACEM  517
            QR+ ++L+ + +P K+CSQIGLC  +G   VS+ IESVV E   VS+ LH DAMC+ACEM
Sbjct  335  QRIFEMLISQTQPTKMCSQIGLCASDGTGAVSIAIESVVSENKDVSSSLHNDAMCNACEM  394

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             +VWMQNQLS+NQTQE +L+++NELC RLPSPMGES VDC  + +MPSVSF+IG ++F+L
Sbjct  395  ALVWMQNQLSQNQTQEEMLNHINELCERLPSPMGESSVDCAAIPSMPSVSFTIGDRIFEL  454

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
             P +YILKVGEG+  QCISGFTALDVPPPRGPLWILGDVFMG YHTVFDYG  RVGFA+A
Sbjct  455  QPEQYILKVGEGAEEQCISGFTALDVPPPRGPLWILGDVFMGVYHTVFDYGNSRVGFAQA  514

Query  156  A  154
            A
Sbjct  515  A  515



>ref|XP_009123370.1| PREDICTED: aspartic proteinase A2 isoform X2 [Brassica rapa]
Length=501

 Score =   271 bits (693),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 154/181 (85%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHDAMCSACEM  517
            Q ++DLL+ +A+PK ICS+IGLCTF+G  GVSMGIESVV+++N  S+  L DA C+ CEM
Sbjct  321  QTILDLLLAKAQPKHICSKIGLCTFDGTHGVSMGIESVVEKENTKSSSGLRDAGCAPCEM  380

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             V+W+Q+QL +N TQ+ I++ +N++C R+PSP GES VDC +LS MP+VSF+IGGKVFDL
Sbjct  381  AVMWIQSQLMQNMTQKRIVNNINDICERMPSPNGESAVDCSQLSKMPTVSFTIGGKVFDL  440

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            SP EY+LK+GEG  AQCISGFTALD+PPPRGPLWILGDVFMGRYHTVFD+G  +VGFAEA
Sbjct  441  SPEEYVLKIGEGPVAQCISGFTALDLPPPRGPLWILGDVFMGRYHTVFDFGNEQVGFAEA  500

Query  156  A  154
            A
Sbjct  501  A  501



>ref|XP_009123365.1| PREDICTED: aspartic proteinase A2 isoform X1 [Brassica rapa]
 ref|XP_009123366.1| PREDICTED: aspartic proteinase A2 isoform X1 [Brassica rapa]
 ref|XP_009123367.1| PREDICTED: aspartic proteinase A2 isoform X1 [Brassica rapa]
 ref|XP_009123369.1| PREDICTED: aspartic proteinase A2 isoform X1 [Brassica rapa]
Length=509

 Score =   271 bits (693),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 154/181 (85%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHDAMCSACEM  517
            Q ++DLL+ +A+PK ICS+IGLCTF+G  GVSMGIESVV+++N  S+  L DA C+ CEM
Sbjct  329  QTILDLLLAKAQPKHICSKIGLCTFDGTHGVSMGIESVVEKENTKSSSGLRDAGCAPCEM  388

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             V+W+Q+QL +N TQ+ I++ +N++C R+PSP GES VDC +LS MP+VSF+IGGKVFDL
Sbjct  389  AVMWIQSQLMQNMTQKRIVNNINDICERMPSPNGESAVDCSQLSKMPTVSFTIGGKVFDL  448

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            SP EY+LK+GEG  AQCISGFTALD+PPPRGPLWILGDVFMGRYHTVFD+G  +VGFAEA
Sbjct  449  SPEEYVLKIGEGPVAQCISGFTALDLPPPRGPLWILGDVFMGRYHTVFDFGNEQVGFAEA  508

Query  156  A  154
            A
Sbjct  509  A  509



>ref|XP_009600571.1| PREDICTED: cyprosin-like [Nicotiana tomentosiformis]
Length=508

 Score =   270 bits (689),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 122/180 (68%), Positives = 148/180 (82%), Gaps = 0/180 (0%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLHDAMCSACEMT  514
            + ++DLL  +A P+KICSQIGLC+ +G+R VSM IESVVD+ NG S  L D MC  CEM 
Sbjct  329  KTILDLLESKAAPQKICSQIGLCSSDGSRDVSMIIESVVDKHNGASNGLGDEMCRVCEMA  388

Query  513  VVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDLS  334
            V+WMQNQ+  N+T ++I  YVN+LC+RLPSPMGES VDC  L++MP+VSF++G + F L+
Sbjct  389  VIWMQNQMRRNETADSIYDYVNQLCDRLPSPMGESAVDCSSLASMPNVSFTVGNQTFGLT  448

Query  333  PNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEAA  154
            P +Y+L+VGEG  AQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYG  RVGFAEAA
Sbjct  449  PQQYVLQVGEGPVAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGNSRVGFAEAA  508



>gb|ABG37021.1| aspartic protease [Nicotiana tabacum]
Length=508

 Score =   270 bits (689),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 122/180 (68%), Positives = 148/180 (82%), Gaps = 0/180 (0%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLHDAMCSACEMT  514
            + ++DLL  +A P+KICSQIGLC+ +G+R VSM IESVVD+ NG S  L D MC  CEM 
Sbjct  329  KTILDLLESKAAPQKICSQIGLCSSDGSRDVSMIIESVVDKHNGASNGLGDEMCRVCEMA  388

Query  513  VVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDLS  334
            V+WMQNQ+  N+T ++I  YVN+LC+RLPSPMGES VDC  L++MP+VSF++G + F L+
Sbjct  389  VIWMQNQMRRNETADSIYDYVNQLCDRLPSPMGESAVDCSSLASMPNVSFTVGNQTFGLT  448

Query  333  PNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEAA  154
            P +Y+L+VGEG  AQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYG  RVGFAEAA
Sbjct  449  PQQYVLQVGEGPVAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGNSRVGFAEAA  508



>ref|XP_006840365.1| hypothetical protein AMTR_s00045p00122510 [Amborella trichopoda]
 gb|ERN02040.1| hypothetical protein AMTR_s00045p00122510 [Amborella trichopoda]
Length=510

 Score =   269 bits (688),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 149/181 (82%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLHD-AMCSACEM  517
            + +++LL+ E +P+KICSQIGLC F+GNR VS GI SVVD+++G  A + D AMC+ACEM
Sbjct  330  EMILELLLSETQPQKICSQIGLCVFDGNRDVSSGIASVVDKEDGSKASVGDSAMCTACEM  389

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVW+QNQ+  N+T+  IL Y N+LC RLPSPMGES VDC  +S MP+VSF IG K FDL
Sbjct  390  AVVWIQNQIKRNETKTQILEYANQLCERLPSPMGESAVDCNNISGMPNVSFIIGNKAFDL  449

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
             P++Y+LKVGEG  AQCISGF+ALD+PPPRGPLWILGDVFMG YHTVFDYG +RVGFAEA
Sbjct  450  RPDQYVLKVGEGVTAQCISGFSALDMPPPRGPLWILGDVFMGAYHTVFDYGNLRVGFAEA  509

Query  156  A  154
            A
Sbjct  510  A  510



>ref|XP_004243484.1| PREDICTED: cyprosin-like [Solanum lycopersicum]
Length=508

 Score =   269 bits (687),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 147/180 (82%), Gaps = 0/180 (0%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLHDAMCSACEMT  514
            + ++DLL  +A P++ICSQIGLC+ +G + VSM IESVVD+ N  S  +HD MC  CEM 
Sbjct  329  KTILDLLESKAAPQQICSQIGLCSRDGGKDVSMIIESVVDKHNEASNGVHDEMCRVCEMA  388

Query  513  VVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDLS  334
            VVWMQNQL  N+T + I  Y+N+LC+R+PSPMGES VDC  L++MP+VSF++G K F+L+
Sbjct  389  VVWMQNQLRRNETADRIFDYMNKLCDRIPSPMGESAVDCNSLASMPNVSFTVGDKTFELT  448

Query  333  PNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEAA  154
            P +Y+LKVGE   AQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDY KMRVGFAEAA
Sbjct  449  PQQYVLKVGEAPVAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYEKMRVGFAEAA  508



>dbj|BAA76870.1| aspartic proteinase [Helianthus annuus]
Length=509

 Score =   268 bits (686),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 153/181 (85%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNG-VSADLHDAMCSACEM  517
            + +I++L+ EA+P KICS++ LCTF+G+R VS  IESVVD+ NG  SA L+D +C+ CEM
Sbjct  329  KTIIEMLLSEAQPDKICSRMNLCTFDGSRDVSSIIESVVDKNNGKSSAGLNDGICAFCEM  388

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQ+QL  NQT+++I++YVNELC+R+PSPMGES VDC  LS MP+++F+IGGK FDL
Sbjct  389  AVVWMQSQLKRNQTEDSIINYVNELCDRIPSPMGESAVDCQTLSNMPNIAFTIGGKTFDL  448

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P +YILKVGEG  AQCISGFTALDV PP GPLWI GDVFMG+YHTVFD+GK RVGFAEA
Sbjct  449  TPEQYILKVGEGEVAQCISGFTALDVAPPHGPLWIHGDVFMGQYHTVFDFGKSRVGFAEA  508

Query  156  A  154
            A
Sbjct  509  A  509



>gb|EYU34027.1| hypothetical protein MIMGU_mgv1a024943mg, partial [Erythranthe 
guttata]
Length=382

 Score =   265 bits (676),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 148/180 (82%), Gaps = 7/180 (4%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLHDAMCSACEMT  514
            + ++++L  E +P+KICSQIGLC  +G R VSM IESVV++ +       D MC+ACEM 
Sbjct  210  KTILEMLTSETQPQKICSQIGLCASDGTRDVSMIIESVVEKGS-------DEMCTACEMA  262

Query  513  VVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDLS  334
            VVWMQNQ+  N+T+E IL Y+N+LC RLPSPMGES VDCG LS+MP++SF+IGGK F+L+
Sbjct  263  VVWMQNQVKRNETEEKILDYINQLCERLPSPMGESAVDCGVLSSMPNISFTIGGKSFELT  322

Query  333  PNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEAA  154
            P +Y+LK+GEG AAQCISGFTALDV PPRGPLWILGDVFMG YHTVFDYG ++VGFAEAA
Sbjct  323  PQQYVLKIGEGEAAQCISGFTALDVAPPRGPLWILGDVFMGPYHTVFDYGNLKVGFAEAA  382



>ref|XP_004293311.1| PREDICTED: aspartic proteinase A1 [Fragaria vesca subsp. vesca]
Length=512

 Score =   268 bits (686),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 156/181 (86%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDE-KNGVSADLHDAMCSACEM  517
            Q +++LL+ EA+P+KICSQIG+CTF+G R VSMGIESVVD+ +   S  LHDA CSACEM
Sbjct  332  QTILELLLAEAQPRKICSQIGVCTFDGTRSVSMGIESVVDKNRKKSSGVLHDASCSACEM  391

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQNQL +NQTQE IL+YVNELC+R+PSP G+S VDC +LSTMP++SF+IGGKVF L
Sbjct  392  AVVWMQNQLQQNQTQEFILNYVNELCDRMPSPNGQSAVDCQRLSTMPTISFTIGGKVFPL  451

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
               EY+LKVGEG+ AQCISGF  +DVPPPRGPLWILGDVFMGRYHTVFDYGK RVGFAEA
Sbjct  452  RAEEYVLKVGEGAQAQCISGFIGMDVPPPRGPLWILGDVFMGRYHTVFDYGKKRVGFAEA  511

Query  156  A  154
            A
Sbjct  512  A  512



>ref|XP_004287958.1| PREDICTED: aspartic proteinase A1-like [Fragaria vesca subsp. 
vesca]
Length=515

 Score =   268 bits (686),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 120/181 (66%), Positives = 152/181 (84%), Gaps = 3/181 (2%)
 Frame = -2

Query  687  MIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHDAMCSACEMTV  511
            ++++L+ + +P++ICSQIGLCTF+G RGVSMGIE+VVD+     +D +HDA C+ACEM V
Sbjct  335  ILEMLLAQVKPQRICSQIGLCTFDGTRGVSMGIETVVDQNTETKSDGVHDAACTACEMAV  394

Query  510  VWMQNQL--SENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
            VW+QNQL  + NQT+E IL+Y NELC RLPSP GES V C  LS++P++SF+IGGKVFDL
Sbjct  395  VWIQNQLRLNLNQTEEQILNYANELCERLPSPNGESAVQCNTLSSLPTISFTIGGKVFDL  454

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P +Y+LK+GEG+AAQC+SGF ALDV PPRGPLWILGD+FMG+YHTVFDYG   VGFA A
Sbjct  455  APEQYVLKMGEGAAAQCLSGFIALDVAPPRGPLWILGDIFMGQYHTVFDYGNANVGFAVA  514

Query  156  A  154
            A
Sbjct  515  A  515



>gb|AHB32105.1| aspartic proteinase [Camellia sinensis]
Length=507

 Score =   267 bits (683),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 122/181 (67%), Positives = 153/181 (85%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLH-DAMCSACEM  517
            + ++++L+ +A P+KICSQIGLC  +G++ VS+GIESVVD+    S+ +H +A C+AC+M
Sbjct  327  KMILEMLLAQAEPQKICSQIGLCYSDGSQDVSIGIESVVDKNRHESSGVHGEASCTACQM  386

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             V+WMQNQL  NQTQ+ IL+Y+NELC+RLPSPMGES VDC  LS+MP VSF+IGGKVFDL
Sbjct  387  MVIWMQNQLKGNQTQDRILNYINELCDRLPSPMGESAVDCSSLSSMPIVSFTIGGKVFDL  446

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P +Y+L+VG+G   QCISGFTALDV PPRGPLWILGDVFMG+YHTVFDYG M VGFAEA
Sbjct  447  TPEQYVLQVGDGPETQCISGFTALDVTPPRGPLWILGDVFMGQYHTVFDYGNMTVGFAEA  506

Query  156  A  154
            A
Sbjct  507  A  507



>ref|XP_006644474.1| PREDICTED: aspartic proteinase oryzasin-1-like [Oryza brachyantha]
Length=517

 Score =   268 bits (684),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 119/181 (66%), Positives = 149/181 (82%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHDAMCSACEM  517
            Q+++D L+ E++P ++CS +GLCTF+G  GVS GI SVVD++NG S+     AMC+ACE 
Sbjct  337  QQILDQLLAESKPAQVCSSVGLCTFDGIHGVSAGIRSVVDDENGKSSSPFSSAMCNACET  396

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWM  QL++NQTQ+ IL Y+N+LC+RLPSPMGES VDC  L++MP ++F+IGGK F L
Sbjct  397  AVVWMHTQLAQNQTQDLILQYINQLCDRLPSPMGESSVDCSSLASMPDIAFTIGGKKFVL  456

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
             P +YILKV EG A QCISGFTA+D+PPPRGPLWILGDVFMG YHTVFDYGK++VGFAEA
Sbjct  457  KPEQYILKVSEGDATQCISGFTAMDIPPPRGPLWILGDVFMGAYHTVFDYGKLKVGFAEA  516

Query  156  A  154
            A
Sbjct  517  A  517



>ref|XP_004969436.1| PREDICTED: aspartic proteinase oryzasin-1-like [Setaria italica]
Length=507

 Score =   266 bits (679),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 117/181 (65%), Positives = 153/181 (85%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADL-HDAMCSACEM  517
            Q++ID L+ E +P KICS +GLCTF+G  GVS GI SVVD++ G S  L ++AMC+ACE 
Sbjct  327  QQIIDQLLAETQPSKICSSVGLCTFDGAHGVSAGIRSVVDDEAGESNGLFNEAMCNACET  386

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVW+++QL++NQTQ+ +L Y+N+LC +LPSPMGES VDC ++++MP ++F+IGG+ F L
Sbjct  387  AVVWIRSQLAQNQTQDLVLQYINQLCEKLPSPMGESSVDCSRVASMPDIAFTIGGRKFAL  446

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
             P +YILKVGEG+AAQCISGFTA+D+PPPRGPLWILGD+FMG YHTVFDYG ++VGFAEA
Sbjct  447  KPEQYILKVGEGTAAQCISGFTAMDIPPPRGPLWILGDIFMGAYHTVFDYGNLKVGFAEA  506

Query  156  A  154
            A
Sbjct  507  A  507



>gb|AFX73039.1| preprogaline A [Galium verum]
Length=506

 Score =   265 bits (677),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 121/181 (67%), Positives = 147/181 (81%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADL-HDAMCSACEM  517
            + ++D+L+ +  PK IC+ IGLC   G+R   M IESVV+E +  S  L +D MCSAC+M
Sbjct  326  KTILDMLLAKTEPKTICASIGLCLPKGSRDDDMIIESVVEETDSASDGLRNDEMCSACQM  385

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQNQ+ +NQT+E IL Y+N+LC+RLPSPMGES VDC  L+++P ++FSIGGK F+L
Sbjct  386  AVVWMQNQVRQNQTEEKILDYINQLCDRLPSPMGESAVDCSSLASLPKIAFSIGGKAFEL  445

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            SP EY+LKVGEG+AAQCISGFTALDV PP GPLWILGDVFMG YHTVFDYG MRVGFAEA
Sbjct  446  SPEEYVLKVGEGAAAQCISGFTALDVAPPLGPLWILGDVFMGSYHTVFDYGNMRVGFAEA  505

Query  156  A  154
            A
Sbjct  506  A  506



>emb|CDP10762.1| unnamed protein product [Coffea canephora]
Length=507

 Score =   264 bits (675),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/180 (68%), Positives = 149/180 (83%), Gaps = 1/180 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLHDAMCSACEMT  514
            + +I++L+ +  P++ICS+IGLC+ +G+  VSM IESVV E +  S    D MC+AC+M 
Sbjct  329  KTIIEMLLAKVEPQQICSKIGLCSSDGSHDVSMLIESVV-ETDMTSDGPRDNMCTACQMA  387

Query  513  VVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDLS  334
            VVWMQNQL  NQT+E IL Y+N+LC+RLPSPMGES VDC  L++MP +SF IG K F+LS
Sbjct  388  VVWMQNQLRRNQTEEKILDYINQLCDRLPSPMGESAVDCSALASMPKISFIIGSKTFELS  447

Query  333  PNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEAA  154
            P +YIL+VGEG+AAQCISGFTALDV PPRGPLWILGDVFMG+YHTVFDYGKMRVGFAEAA
Sbjct  448  PEQYILRVGEGAAAQCISGFTALDVLPPRGPLWILGDVFMGQYHTVFDYGKMRVGFAEAA  507



>ref|XP_007020767.1| Aspartic proteinase A1 [Theobroma cacao]
 gb|EOY12292.1| Aspartic proteinase A1 [Theobroma cacao]
Length=470

 Score =   263 bits (671),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 150/181 (83%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEK-NGVSADLHDAMCSACEM  517
            + +ID+L+ E +P+KICSQIGLC  +G RG SM IESVVD+     S  +H++MCSACEM
Sbjct  290  ETIIDMLLAEDQPQKICSQIGLCALDGTRGASMSIESVVDKNAQKSSGGVHNSMCSACEM  349

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
            T+ W+QNQL +NQT +++L+Y+NELC+RLPSPMG S VDC  LS+MP++SF IGG++FDL
Sbjct  350  TISWIQNQLKQNQTLDHVLNYINELCDRLPSPMGASAVDCNALSSMPNLSFVIGGRIFDL  409

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P +YILKVGEG+ A+CISGFTALD+P P  PLWILGDVFMG+YHTV DYG M+VGFA A
Sbjct  410  NPEQYILKVGEGNTARCISGFTALDLPLPHEPLWILGDVFMGQYHTVLDYGNMKVGFAAA  469

Query  156  A  154
            A
Sbjct  470  A  470



>ref|XP_006364164.1| PREDICTED: aspartic proteinase-like [Solanum tuberosum]
Length=508

 Score =   263 bits (671),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 119/180 (66%), Positives = 144/180 (80%), Gaps = 0/180 (0%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLHDAMCSACEMT  514
            + ++DLL  +A P++ICSQI LC+ +G R VSM IESVVD+ N  S  +HD MC  CEM 
Sbjct  329  KTILDLLESKAAPQQICSQINLCSRDGGRDVSMIIESVVDKHNEASNGVHDEMCRVCEMA  388

Query  513  VVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDLS  334
            VVWMQNQL  N+T + I  Y+N+LC+RLPSPMGES V+C  L++MP+VSF++G K F+L+
Sbjct  389  VVWMQNQLRRNETADRIFDYMNKLCDRLPSPMGESAVNCNSLASMPNVSFTVGNKTFELT  448

Query  333  PNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEAA  154
            P +Y+LKVGE    QCISGFTALDVPPPRGPLWILGDVFMGRYHTVFD  KMRVGFAEAA
Sbjct  449  PQQYVLKVGEAPVTQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDSEKMRVGFAEAA  508



>ref|XP_004151126.1| PREDICTED: aspartic proteinase-like [Cucumis sativus]
Length=513

 Score =   262 bits (670),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 120/181 (66%), Positives = 146/181 (81%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHDAMCSACEM  517
            + +I +L+ + +PKKICS +GLC F+G RGVSMGIESVVD     S++ L D MC+ACEM
Sbjct  333  ETIIKMLLAKDQPKKICSTLGLCAFDGERGVSMGIESVVDNTTQKSSNGLRDVMCNACEM  392

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVW Q+QL E +TQ+ IL+Y++ LC +LPSPMGES +DC  LST+PS+SF+IGGKVF+L
Sbjct  393  AVVWAQSQLKEEKTQDQILNYIDGLCEKLPSPMGESVIDCDSLSTLPSISFTIGGKVFEL  452

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
             P +Y+LKV EG   +CISGF ALDVPPPRGPLWILGDVFMG YHTVFDYG  RVGFAEA
Sbjct  453  KPEQYVLKVTEGPVTECISGFAALDVPPPRGPLWILGDVFMGSYHTVFDYGNSRVGFAEA  512

Query  156  A  154
            A
Sbjct  513  A  513



>ref|XP_008784384.1| PREDICTED: aspartic proteinase oryzasin-1-like [Phoenix dactylifera]
Length=518

 Score =   262 bits (670),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 151/181 (83%), Gaps = 3/181 (2%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVS-ADLHDAMCSACEM  517
            ++++++L+ +  P KICS+IGLC F+G RGVSMGI+S+V+ K   S   L D MCS CEM
Sbjct  338  EKIMEMLMEKEEPAKICSRIGLCAFDGTRGVSMGIKSMVNGKRDRSTGGLGDGMCSYCEM  397

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQ+QL +NQT E +L+Y++ELC RLPSPMGES VDC  LS+MP+VSF+IGGK+FDL
Sbjct  398  AVVWMQSQLVQNQTLEQVLNYISELCERLPSPMGESAVDCNSLSSMPTVSFTIGGKIFDL  457

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
             P +YILKVG+GS+AQCISGFTALDV  P+GPLWILGDVFMG YHTVFDYG+ RVGFAEA
Sbjct  458  KPEQYILKVGDGSSAQCISGFTALDV--PQGPLWILGDVFMGAYHTVFDYGQQRVGFAEA  515

Query  156  A  154
            A
Sbjct  516  A  516



>ref|XP_004161880.1| PREDICTED: aspartic proteinase-like [Cucumis sativus]
Length=516

 Score =   262 bits (670),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 120/181 (66%), Positives = 146/181 (81%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHDAMCSACEM  517
            + +I +L+ + +PKKICS +GLC F+G RGVSMGIESVVD     S++ L D MC+ACEM
Sbjct  336  ETIIKMLLAKDQPKKICSTLGLCAFDGERGVSMGIESVVDNTTQKSSNGLRDVMCNACEM  395

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVW Q+QL E +TQ+ IL+Y++ LC +LPSPMGES +DC  LST+PS+SF+IGGKVF+L
Sbjct  396  AVVWAQSQLKEEKTQDQILNYIDGLCEKLPSPMGESVIDCDSLSTLPSISFTIGGKVFEL  455

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
             P +Y+LKV EG   +CISGF ALDVPPPRGPLWILGDVFMG YHTVFDYG  RVGFAEA
Sbjct  456  KPEQYVLKVTEGPVTECISGFAALDVPPPRGPLWILGDVFMGSYHTVFDYGNSRVGFAEA  515

Query  156  A  154
            A
Sbjct  516  A  516



>ref|XP_011006459.1| PREDICTED: cyprosin-like isoform X2 [Populus euphratica]
Length=514

 Score =   262 bits (670),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 154/179 (86%), Gaps = 1/179 (1%)
 Frame = -2

Query  687  MIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHDAMCSACEMTV  511
            ++++LV +A+P+K+CSQI  CTF+G +GVSM IESVV+E +  S+D LHDAMC+ACEM V
Sbjct  336  ILEMLVAQAQPRKVCSQISFCTFDGTQGVSMNIESVVEESSDKSSDGLHDAMCTACEMIV  395

Query  510  VWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDLSP  331
            VWM+N+L  N T++ IL YVN+LC+RLPSP GES V+C  LS+M SVSF IGGK+F+LSP
Sbjct  396  VWMENRLRLNDTKDQILDYVNDLCDRLPSPNGESAVECSSLSSMSSVSFEIGGKLFELSP  455

Query  330  NEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEAA  154
             +Y+LKVGEG +AQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYG + VGFA+AA
Sbjct  456  EQYVLKVGEGVSAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGNLTVGFADAA  514



>gb|KDP24853.1| hypothetical protein JCGZ_24447 [Jatropha curcas]
Length=512

 Score =   262 bits (669),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 120/176 (68%), Positives = 145/176 (82%), Gaps = 1/176 (1%)
 Frame = -2

Query  678  LLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHDAMCSACEMTVVWM  502
            LL  +A+P+KICSQIG CTF+G +GVS  IESVVD      +D L DA C+ACEM VVW+
Sbjct  337  LLAQQAQPQKICSQIGFCTFDGTQGVSTNIESVVDASMDRQSDGLQDAACTACEMMVVWI  396

Query  501  QNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDLSPNEY  322
            QN+L  NQTQ+ IL+YVN+LC+RLPSP GES VDC  LS+M ++SF+IGGK F+L+P +Y
Sbjct  397  QNRLRLNQTQDQILNYVNQLCDRLPSPNGESAVDCSSLSSMANISFTIGGKAFELTPEQY  456

Query  321  ILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEAA  154
            +LKVGEG +AQCISGFTA D+PPPRGPLWILGDVFMG YHTVFDYG + VGFA+AA
Sbjct  457  VLKVGEGVSAQCISGFTAFDLPPPRGPLWILGDVFMGPYHTVFDYGNLTVGFAKAA  512



>ref|NP_001043786.1| Os01g0663400 [Oryza sativa Japonica Group]
 dbj|BAF05700.1| Os01g0663400 [Oryza sativa Japonica Group]
 dbj|BAG92907.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC71223.1| hypothetical protein OsI_03158 [Oryza sativa Indica Group]
 gb|EEE55128.1| hypothetical protein OsJ_02912 [Oryza sativa Japonica Group]
 gb|AFI71272.1| unnamed protein [Oryza sativa Japonica Group]
Length=522

 Score =   262 bits (669),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 116/181 (64%), Positives = 146/181 (81%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHDAMCSACEM  517
            Q+++D L  E +P K+CS +GLCTF+G  GVS GI SVVD++ G S+     AMC+ACE 
Sbjct  342  QQILDQLRAETKPAKVCSSVGLCTFDGTHGVSAGIRSVVDDEVGKSSGPFSSAMCNACET  401

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWM  QL++NQTQ+ +L Y+++LC+RLPSPMGES VDC  L++MP ++F+IGG  F L
Sbjct  402  AVVWMHTQLAQNQTQDLVLQYIDQLCDRLPSPMGESSVDCSSLASMPDIAFTIGGNKFVL  461

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
             P +YILKVGEG+A QCISGFTA+D+PPPRGPLWILGDVFMG YHTVFDYG ++VGFAEA
Sbjct  462  KPEQYILKVGEGTATQCISGFTAMDIPPPRGPLWILGDVFMGAYHTVFDYGNLKVGFAEA  521

Query  156  A  154
            A
Sbjct  522  A  522



>ref|XP_011006458.1| PREDICTED: cyprosin-like isoform X1 [Populus euphratica]
Length=536

 Score =   262 bits (669),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 154/179 (86%), Gaps = 1/179 (1%)
 Frame = -2

Query  687  MIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHDAMCSACEMTV  511
            ++++LV +A+P+K+CSQI  CTF+G +GVSM IESVV+E +  S+D LHDAMC+ACEM V
Sbjct  358  ILEMLVAQAQPRKVCSQISFCTFDGTQGVSMNIESVVEESSDKSSDGLHDAMCTACEMIV  417

Query  510  VWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDLSP  331
            VWM+N+L  N T++ IL YVN+LC+RLPSP GES V+C  LS+M SVSF IGGK+F+LSP
Sbjct  418  VWMENRLRLNDTKDQILDYVNDLCDRLPSPNGESAVECSSLSSMSSVSFEIGGKLFELSP  477

Query  330  NEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEAA  154
             +Y+LKVGEG +AQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYG + VGFA+AA
Sbjct  478  EQYVLKVGEGVSAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGNLTVGFADAA  536



>ref|XP_002302872.2| aspartic endopeptidase family protein [Populus trichocarpa]
 gb|EEE82145.2| aspartic endopeptidase family protein [Populus trichocarpa]
Length=514

 Score =   259 bits (662),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 124/179 (69%), Positives = 153/179 (85%), Gaps = 1/179 (1%)
 Frame = -2

Query  687  MIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHDAMCSACEMTV  511
            ++++LV +A+P+K+CSQI  CTF+G +GVSM IESVV+E +  S+D LHDAMC+ACEM V
Sbjct  336  ILEMLVAQAQPRKVCSQISFCTFDGTQGVSMNIESVVEENSDKSSDGLHDAMCTACEMMV  395

Query  510  VWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDLSP  331
            VWM+N+L  N T++ IL YVN LC+RLPSP GES V+C  LS+MPS+SF IGGK+F+LSP
Sbjct  396  VWMENRLRLNDTEDQILDYVNNLCDRLPSPNGESAVECSSLSSMPSISFEIGGKLFELSP  455

Query  330  NEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEAA  154
             +Y+LKVGEG +AQCISGFTALDVPPP GPLWILGDVFMGRYHTVFDYG + VGFA+AA
Sbjct  456  EQYVLKVGEGVSAQCISGFTALDVPPPHGPLWILGDVFMGRYHTVFDYGNLTVGFADAA  514



>ref|XP_009114573.1| PREDICTED: aspartic proteinase A3 isoform X2 [Brassica rapa]
Length=499

 Score =   256 bits (655),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 148/180 (82%), Gaps = 2/180 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLHDAMCSACEMT  514
            Q M++ LV +  P+K+CSQIGLC F+G   VSMGI+SVV++  GVS+ L++AMCSACEM 
Sbjct  322  QTMLESLVSQVDPRKVCSQIGLCGFDGTHSVSMGIKSVVED--GVSSLLNEAMCSACEMA  379

Query  513  VVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDLS  334
             VWMQ++LS+NQTQE IL+Y  ELC+ +P+P  +S VDC ++S+MP V+F+IGGK FDLS
Sbjct  380  SVWMQSELSQNQTQERILAYAAELCDHIPNPNQQSAVDCERVSSMPIVTFTIGGKPFDLS  439

Query  333  PNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEAA  154
            P +YI K+G+G  AQC SGFTA+D+PPPRGPLWILGD+FMG YHTVFDYGK RVGFA+A 
Sbjct  440  PQDYIFKIGDGVQAQCTSGFTAMDIPPPRGPLWILGDIFMGPYHTVFDYGKTRVGFAKAT  499



>emb|CDY16668.1| BnaA09g20460D [Brassica napus]
Length=507

 Score =   256 bits (655),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 148/180 (82%), Gaps = 2/180 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLHDAMCSACEMT  514
            Q M++ LV +  P+K+CSQIGLC F+G   VSMGI+SVV++  GVS+ L++AMCSACEM 
Sbjct  330  QTMLESLVSQVDPRKVCSQIGLCGFDGTHSVSMGIKSVVED--GVSSLLNEAMCSACEMA  387

Query  513  VVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDLS  334
             VWMQ++LS+NQTQE IL+Y  ELC+ +P+P  +S VDC ++S+MP V+F+IGGK FDLS
Sbjct  388  SVWMQSELSQNQTQERILAYAAELCDHIPNPNQQSAVDCERVSSMPIVTFTIGGKPFDLS  447

Query  333  PNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEAA  154
            P +YI K+G+G  AQC SGFTA+D+PPPRGPLWILGD+FMG YHTVFDYGK RVGFA+A 
Sbjct  448  PQDYIFKIGDGVQAQCTSGFTAMDIPPPRGPLWILGDIFMGPYHTVFDYGKTRVGFAKAT  507



>ref|XP_009114571.1| PREDICTED: aspartic proteinase A3 isoform X1 [Brassica rapa]
Length=507

 Score =   256 bits (654),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 148/180 (82%), Gaps = 2/180 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLHDAMCSACEMT  514
            Q M++ LV +  P+K+CSQIGLC F+G   VSMGI+SVV++  GVS+ L++AMCSACEM 
Sbjct  330  QTMLESLVSQVDPRKVCSQIGLCGFDGTHSVSMGIKSVVED--GVSSLLNEAMCSACEMA  387

Query  513  VVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDLS  334
             VWMQ++LS+NQTQE IL+Y  ELC+ +P+P  +S VDC ++S+MP V+F+IGGK FDLS
Sbjct  388  SVWMQSELSQNQTQERILAYAAELCDHIPNPNQQSAVDCERVSSMPIVTFTIGGKPFDLS  447

Query  333  PNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEAA  154
            P +YI K+G+G  AQC SGFTA+D+PPPRGPLWILGD+FMG YHTVFDYGK RVGFA+A 
Sbjct  448  PQDYIFKIGDGVQAQCTSGFTAMDIPPPRGPLWILGDIFMGPYHTVFDYGKTRVGFAKAT  507



>emb|CDX94554.1| BnaC09g22820D [Brassica napus]
Length=507

 Score =   256 bits (654),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 146/180 (81%), Gaps = 2/180 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLHDAMCSACEMT  514
            Q M+D LV +  P+K+CS IGLC F+G   VSMGI+SVV++  GVS  L++AMCSACEM 
Sbjct  330  QTMLDSLVSQVDPRKVCSHIGLCGFDGTHSVSMGIKSVVED--GVSGLLNEAMCSACEMA  387

Query  513  VVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDLS  334
             VWMQ++LS+NQTQE IL+Y  ELC+ +P+P  +S VDC ++S+MP V+F+IGGK FDLS
Sbjct  388  SVWMQSELSQNQTQERILAYAAELCDHIPNPNQQSAVDCERVSSMPIVTFTIGGKPFDLS  447

Query  333  PNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEAA  154
            P +YI K+G+G  AQC SGFTA+D+PPPRGPLWILGD+FMG YHTVFDYGK RVGFA+A 
Sbjct  448  PQDYIFKIGDGVQAQCTSGFTAMDIPPPRGPLWILGDIFMGPYHTVFDYGKTRVGFAKAT  507



>sp|P40782.2|CYPR1_CYNCA RecName: Full=Cyprosin; Flags: Precursor, partial [Cynara cardunculus]
 prf||2124255A cyprosin
Length=473

 Score =   255 bits (651),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 115/180 (64%), Positives = 148/180 (82%), Gaps = 1/180 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLHDAMCSACEMT  514
            + MI++L+ E +P+KICSQ+ LC+F+G+   SM IESVVD+  G S+ L    C  C   
Sbjct  295  KSMIEMLLSEEQPEKICSQMKLCSFDGSHDTSMIIESVVDKSKGKSSGL-PMRCVPCARW  353

Query  513  VVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDLS  334
            VVWMQNQ+ +N+T+ENI++YV++LC RLPSPMGES VDC  LS+MP+++F++GGK F+LS
Sbjct  354  VVWMQNQIRQNETEENIINYVDKLCERLPSPMGESAVDCSSLSSMPNIAFTVGGKTFNLS  413

Query  333  PNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEAA  154
            P +Y+LKVGEG+ AQCISGFTA+DV PP GPLWILGDVFMG+YHTVFDYG +RVGFAEAA
Sbjct  414  PEQYVLKVGEGATAQCISGFTAMDVAPPHGPLWILGDVFMGQYHTVFDYGNLRVGFAEAA  473



>gb|KGN56078.1| hypothetical protein Csa_3G066750 [Cucumis sativus]
Length=535

 Score =   256 bits (654),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 118/170 (69%), Positives = 139/170 (82%), Gaps = 1/170 (1%)
 Frame = -2

Query  660  RPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHDAMCSACEMTVVWMQNQLSE  484
            +PKKICS +GLC F+G RGVSMGIESVVD     S++ L D MC+ACEM VVW Q+QL E
Sbjct  366  QPKKICSTLGLCAFDGERGVSMGIESVVDNTTQKSSNGLRDVMCNACEMAVVWAQSQLKE  425

Query  483  NQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGE  304
             +TQ+ IL+Y++ LC +LPSPMGES +DC  LST+PS+SF+IGGKVF+L P +Y+LKV E
Sbjct  426  EKTQDQILNYIDGLCEKLPSPMGESVIDCDSLSTLPSISFTIGGKVFELKPEQYVLKVTE  485

Query  303  GSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEAA  154
            G   +CISGF ALDVPPPRGPLWILGDVFMG YHTVFDYG  RVGFAEAA
Sbjct  486  GPVTECISGFAALDVPPPRGPLWILGDVFMGSYHTVFDYGNSRVGFAEAA  535



>gb|KDO45252.1| hypothetical protein CISIN_1g010486mg [Citrus sinensis]
Length=295

 Score =   248 bits (633),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 115/176 (65%), Positives = 142/176 (81%), Gaps = 2/176 (1%)
 Frame = -2

Query  681  DLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLHDAMCSACEMTVVWM  502
            DLLV    P+K+C QIGLC FNG   VS GI++VV+++N  + D   A+CSACEM VVW+
Sbjct  122  DLLVSGLLPEKVCQQIGLCAFNGAEYVSTGIKTVVEKENVSAGD--SAVCSACEMAVVWV  179

Query  501  QNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDLSPNEY  322
            QNQL + QT+E +LSY+NELC+ LP+PMGES +DC ++ TMP+VSF+IG K+F+LSP +Y
Sbjct  180  QNQLKQKQTKEKVLSYINELCDSLPNPMGESIIDCDRIPTMPNVSFTIGDKIFNLSPEQY  239

Query  321  ILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEAA  154
            ILK GEG A  CISGF A D+PPPRGPLWILGDVFMG YHTVFD GK+R+GFAEAA
Sbjct  240  ILKTGEGIAEVCISGFMAFDLPPPRGPLWILGDVFMGVYHTVFDSGKLRIGFAEAA  295



>gb|EPS60672.1| aspartic proteinase 1, partial [Genlisea aurea]
Length=146

 Score =   242 bits (618),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 112/149 (75%), Positives = 128/149 (86%), Gaps = 3/149 (2%)
 Frame = -2

Query  600  SMGIESVVDEKNGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSP  421
            S GIESVVDE +G    L DAMCS CEM VVWMQNQL  N+TQ+ IL YV+ LC++LPSP
Sbjct  1    SGGIESVVDENSG---GLRDAMCSTCEMAVVWMQNQLRRNRTQDQILEYVDGLCDKLPSP  57

Query  420  MGESGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGP  241
            MGES VDCG +S++P++SF+IGGKVFDLSP+EY+LKVGEG  AQCISGFT LDVPPPRGP
Sbjct  58   MGESAVDCGSISSLPTISFTIGGKVFDLSPDEYVLKVGEGVGAQCISGFTGLDVPPPRGP  117

Query  240  LWILGDVFMGRYHTVFDYGKMRVGFAEAA  154
            LWILGD+FMGRYHTVFDY  +RVGFAEAA
Sbjct  118  LWILGDIFMGRYHTVFDYANLRVGFAEAA  146



>gb|AFX73042.1| preprofigain C, partial [Ficus carica]
Length=386

 Score =   250 bits (638),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 136/160 (85%), Gaps = 1/160 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNG-VSADLHDAMCSACEM  517
            Q +I+ L+ + +PKKICSQIGLC+F+G RGVSMGI+SVVDE  G  S DL D MCSACEM
Sbjct  227  QTIIESLLAKDQPKKICSQIGLCSFDGTRGVSMGIKSVVDENVGKASGDLRDGMCSACEM  286

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQNQ+ +NQTQE IL+YVN+LC RLPSPMGES VDCG LS++P V+F+IG K F+L
Sbjct  287  AVVWMQNQIKQNQTQEQILNYVNQLCERLPSPMGESSVDCGSLSSLPKVTFTIGEKKFEL  346

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVF  217
            +P +YILKVGEG AAQCISGFTALDVPPPRGPLWILGDV 
Sbjct  347  TPEQYILKVGEGDAAQCISGFTALDVPPPRGPLWILGDVL  386



>gb|EMS54428.1| Aspartic proteinase oryzasin-1 [Triticum urartu]
Length=503

 Score =   253 bits (647),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 116/190 (61%), Positives = 147/190 (77%), Gaps = 13/190 (7%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLHDAMCSACEMT  514
            QR++DLL+ E  P KICS +GLCT +G +GV  GI SV+D + G S   +D MC ACEM 
Sbjct  317  QRILDLLLKEMDPSKICSLVGLCTPDGTQGVRAGIRSVLDHEGGRS---NDVMCHACEMA  373

Query  513  VVWMQNQLSENQTQENILSYVNE----------LCNRLPSPMGESGVDCGKLSTMPSVSF  364
            VVWM NQL++NQTQ+ I  Y+N+          LC+R+PSPMGES VDCG+L++MP ++F
Sbjct  374  VVWMTNQLAKNQTQDLIFKYINQACFLVYLVTPLCDRIPSPMGESSVDCGRLASMPDIAF  433

Query  363  SIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYG  184
            SIGGK F L+P +YILK+GEG A QCISGFTA+D+P PRGPLWILGD+FMG YHTV+DYG
Sbjct  434  SIGGKQFVLTPEQYILKIGEGDATQCISGFTAMDIPRPRGPLWILGDIFMGAYHTVYDYG  493

Query  183  KMRVGFAEAA  154
             M++GFA+AA
Sbjct  494  NMKIGFAKAA  503



>ref|XP_010233477.1| PREDICTED: aspartic proteinase oryzasin-1-like [Brachypodium 
distachyon]
Length=516

 Score =   254 bits (648),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/181 (65%), Positives = 147/181 (81%), Gaps = 6/181 (3%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLHDAM-CSACEM  517
            ++++DLL      KKICS +GLCTF+G  GVS GI+SVVD+K   S D+   + C+ CEM
Sbjct  341  KQILDLL-----RKKICSSVGLCTFDGAHGVSAGIQSVVDDKVWGSNDIFSKVTCNMCEM  395

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQ+QL++NQTQE +L Y+N+LC+  PSPMGES VDC +L++MP ++FSIGGK F L
Sbjct  396  AVVWMQHQLAQNQTQEFVLQYINQLCDSFPSPMGESSVDCNRLASMPDIAFSIGGKQFVL  455

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P +YILKVGEG A QCISGFTA+D+PPPRGPLWILGD+FMG YHTVFDYG ++VGFAEA
Sbjct  456  TPEQYILKVGEGVATQCISGFTAVDIPPPRGPLWILGDIFMGAYHTVFDYGNLKVGFAEA  515

Query  156  A  154
            A
Sbjct  516  A  516



>ref|XP_010926196.1| PREDICTED: aspartic proteinase oryzasin-1-like [Elaeis guineensis]
Length=518

 Score =   253 bits (647),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 147/181 (81%), Gaps = 3/181 (2%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVD-EKNGVSADLHDAMCSACEM  517
            ++++++L+ +  P KICS+IGLC F+G  GVSMGI+SVV+  ++  +  L D MCS CEM
Sbjct  338  EKIMEMLMEKEEPTKICSRIGLCAFDGTHGVSMGIKSVVNGRRDRFTGGLGDGMCSYCEM  397

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQNQ  ++QT + +L Y++ELC RLPSPMGES VDC  L++MP VSF+IGGK FDL
Sbjct  398  AVVWMQNQFMQSQTVQQVLDYISELCERLPSPMGESAVDCSSLASMPVVSFTIGGKRFDL  457

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
             P +YILKVG+GS AQCISGFTALDV  P+GPLWILGDVFMG YHTVFDYG++RVGFAEA
Sbjct  458  KPEQYILKVGDGSLAQCISGFTALDV--PQGPLWILGDVFMGVYHTVFDYGQLRVGFAEA  515

Query  156  A  154
            A
Sbjct  516  A  516



>ref|XP_006428329.1| hypothetical protein CICLE_v10011525mg [Citrus clementina]
 ref|XP_006480355.1| PREDICTED: aspartic proteinase-like [Citrus sinensis]
 gb|ESR41569.1| hypothetical protein CICLE_v10011525mg [Citrus clementina]
Length=506

 Score =   253 bits (646),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 117/176 (66%), Positives = 144/176 (82%), Gaps = 2/176 (1%)
 Frame = -2

Query  681  DLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLHDAMCSACEMTVVWM  502
            DLLV    P+K+C QIGLC FNG   VS GI++VV+++N  + D   A+CSACEMTVVW+
Sbjct  333  DLLVSGLLPEKVCQQIGLCAFNGAEYVSTGIKTVVEKENVSAGD--SAVCSACEMTVVWV  390

Query  501  QNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDLSPNEY  322
            QNQL + QT+E +LSY+NELC+ LP+PMGES +DCG++ TMP+VSF+IG K+F+LSP +Y
Sbjct  391  QNQLKQKQTKEKVLSYINELCDSLPNPMGESIIDCGRIPTMPNVSFTIGDKIFNLSPEQY  450

Query  321  ILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEAA  154
            ILK GEG A  CISGF A D+PPPRGPLWILGDVFMG YHTVFD GK+R+GFAEAA
Sbjct  451  ILKTGEGIAEVCISGFMAFDLPPPRGPLWILGDVFMGVYHTVFDSGKLRIGFAEAA  506



>gb|AGE15495.1| preprosilpepsin 2 [Silybum marianum]
Length=509

 Score =   253 bits (646),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 114/181 (63%), Positives = 145/181 (80%), Gaps = 1/181 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHDAMCSACEM  517
            + ++ +L+ EA+P KICS + LCTF+G   VS  IESVVD KN  S+  +HD MC+ CEM
Sbjct  329  KNIMQMLMSEAQPDKICSHMNLCTFDGAHDVSSIIESVVDMKNDKSSGGVHDEMCTFCEM  388

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQ ++  N+ ++NI++YV ELC+ LPS  GES VDC  LS+MP+ +F+IGGK+F+L
Sbjct  389  AVVWMQKEIKRNEIEDNIINYVTELCDHLPSSSGESVVDCNSLSSMPNTAFTIGGKIFEL  448

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P +YI K+GEG AAQCISGFT +DVPPPRGPLWILGD+FMG YHTVFDYGK+RVGFAEA
Sbjct  449  TPEQYIFKLGEGEAAQCISGFTTMDVPPPRGPLWILGDIFMGPYHTVFDYGKLRVGFAEA  508

Query  156  A  154
            A
Sbjct  509  A  509



>gb|ABK26865.1| unknown [Picea sitchensis]
Length=284

 Score =   245 bits (626),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 112/180 (62%), Positives = 147/180 (82%), Gaps = 4/180 (2%)
 Frame = -2

Query  687  MIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVD---EKNGVSADLHDAMCSACEM  517
            +++LL+ +  PKKICSQIGLC+++G R V +GI SV++   EK  +S+ + D  C+ACEM
Sbjct  105  IMELLMAQTNPKKICSQIGLCSYDGARDVGIGIASVLEKTHEKETLSS-ISDGTCTACEM  163

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVW+QNQ++ NQT+E I++Y+N+LC+RLPSP GES VDC ++S+MP+VSFSIG K F L
Sbjct  164  AVVWVQNQIARNQTKEQIMTYLNQLCDRLPSPNGESVVDCDQVSSMPTVSFSIGNKTFSL  223

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
            +P++YIL+VGEGS AQC+SGF  LDV PP GP+WILGD+FMG YHTVFDYG  RVGFAEA
Sbjct  224  TPDQYILQVGEGSVAQCVSGFMGLDVSPPLGPIWILGDIFMGVYHTVFDYGNSRVGFAEA  283



>gb|KDO45250.1| hypothetical protein CISIN_1g010486mg [Citrus sinensis]
 gb|KDO45251.1| hypothetical protein CISIN_1g010486mg [Citrus sinensis]
Length=388

 Score =   249 bits (635),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 115/176 (65%), Positives = 142/176 (81%), Gaps = 2/176 (1%)
 Frame = -2

Query  681  DLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLHDAMCSACEMTVVWM  502
            DLLV    P+K+C QIGLC FNG   VS GI++VV+++N  + D   A+CSACEM VVW+
Sbjct  215  DLLVSGLLPEKVCQQIGLCAFNGAEYVSTGIKTVVEKENVSAGD--SAVCSACEMAVVWV  272

Query  501  QNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDLSPNEY  322
            QNQL + QT+E +LSY+NELC+ LP+PMGES +DC ++ TMP+VSF+IG K+F+LSP +Y
Sbjct  273  QNQLKQKQTKEKVLSYINELCDSLPNPMGESIIDCDRIPTMPNVSFTIGDKIFNLSPEQY  332

Query  321  ILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEAA  154
            ILK GEG A  CISGF A D+PPPRGPLWILGDVFMG YHTVFD GK+R+GFAEAA
Sbjct  333  ILKTGEGIAEVCISGFMAFDLPPPRGPLWILGDVFMGVYHTVFDSGKLRIGFAEAA  388



>gb|KDO45249.1| hypothetical protein CISIN_1g010486mg [Citrus sinensis]
Length=412

 Score =   249 bits (636),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 115/176 (65%), Positives = 142/176 (81%), Gaps = 2/176 (1%)
 Frame = -2

Query  681  DLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLHDAMCSACEMTVVWM  502
            DLLV    P+K+C QIGLC FNG   VS GI++VV+++N  + D   A+CSACEM VVW+
Sbjct  239  DLLVSGLLPEKVCQQIGLCAFNGAEYVSTGIKTVVEKENVSAGD--SAVCSACEMAVVWV  296

Query  501  QNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDLSPNEY  322
            QNQL + QT+E +LSY+NELC+ LP+PMGES +DC ++ TMP+VSF+IG K+F+LSP +Y
Sbjct  297  QNQLKQKQTKEKVLSYINELCDSLPNPMGESIIDCDRIPTMPNVSFTIGDKIFNLSPEQY  356

Query  321  ILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEAA  154
            ILK GEG A  CISGF A D+PPPRGPLWILGDVFMG YHTVFD GK+R+GFAEAA
Sbjct  357  ILKTGEGIAEVCISGFMAFDLPPPRGPLWILGDVFMGVYHTVFDSGKLRIGFAEAA  412



>ref|XP_006396693.1| hypothetical protein EUTSA_v10028587mg [Eutrema salsugineum]
 gb|ESQ38146.1| hypothetical protein EUTSA_v10028587mg [Eutrema salsugineum]
Length=512

 Score =   251 bits (642),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 112/180 (62%), Positives = 146/180 (81%), Gaps = 2/180 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLHDAMCSACEMT  514
            + M++ L+ +  P+K+CSQIGLC ++G   VSMGI SV++  NG S  L++AMC+ACEM 
Sbjct  335  KTMLNSLLSQTDPRKVCSQIGLCGYDGAHSVSMGIRSVIE--NGTSDLLNEAMCNACEMA  392

Query  513  VVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDLS  334
             VWMQ++L++NQTQE ILSY  ELC+ +P+P  +S V+C K+S+MP V+F+IGGK FDLS
Sbjct  393  AVWMQSELTQNQTQERILSYAAELCDHIPNPNQQSAVNCEKVSSMPIVTFTIGGKSFDLS  452

Query  333  PNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEAA  154
            P +YI K+G+G  AQC SGFTA+D+PPPRGPLWILGD+FMG YHTVFDYGK RVGFA+AA
Sbjct  453  PQDYIFKIGDGVQAQCTSGFTAMDIPPPRGPLWILGDIFMGPYHTVFDYGKARVGFAKAA  512



>ref|XP_006396692.1| hypothetical protein EUTSA_v10028587mg [Eutrema salsugineum]
 gb|ESQ38145.1| hypothetical protein EUTSA_v10028587mg [Eutrema salsugineum]
Length=507

 Score =   251 bits (642),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 112/180 (62%), Positives = 146/180 (81%), Gaps = 2/180 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLHDAMCSACEMT  514
            + M++ L+ +  P+K+CSQIGLC ++G   VSMGI SV++  NG S  L++AMC+ACEM 
Sbjct  330  KTMLNSLLSQTDPRKVCSQIGLCGYDGAHSVSMGIRSVIE--NGTSDLLNEAMCNACEMA  387

Query  513  VVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDLS  334
             VWMQ++L++NQTQE ILSY  ELC+ +P+P  +S V+C K+S+MP V+F+IGGK FDLS
Sbjct  388  AVWMQSELTQNQTQERILSYAAELCDHIPNPNQQSAVNCEKVSSMPIVTFTIGGKSFDLS  447

Query  333  PNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEAA  154
            P +YI K+G+G  AQC SGFTA+D+PPPRGPLWILGD+FMG YHTVFDYGK RVGFA+AA
Sbjct  448  PQDYIFKIGDGVQAQCTSGFTAMDIPPPRGPLWILGDIFMGPYHTVFDYGKARVGFAKAA  507



>ref|XP_010455726.1| PREDICTED: aspartic proteinase A3 isoform X1 [Camelina sativa]
 ref|XP_010455728.1| PREDICTED: aspartic proteinase A3 isoform X1 [Camelina sativa]
Length=508

 Score =   250 bits (639),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 112/180 (62%), Positives = 144/180 (80%), Gaps = 2/180 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLHDAMCSACEMT  514
            + M++ L+ +  PKK+CSQIG+C F+G   VSMGI+SVVD+  G S  L+ AMCSAC+M 
Sbjct  331  KTMLNSLLAQEDPKKVCSQIGVCAFDGTDSVSMGIQSVVDD--GASGLLNQAMCSACQMA  388

Query  513  VVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDLS  334
             VWM+++L++NQTQE IL+Y  ELC+ +P+   +S VDC K+S+MP VSF+IGG+ FDLS
Sbjct  389  AVWMESELTQNQTQERILAYAAELCDHIPTQNQQSAVDCEKVSSMPIVSFTIGGRTFDLS  448

Query  333  PNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEAA  154
            P +YI K+GEG   QC SGFTA+D+PPPRGPLWILGD+FMG YHTVFDYGK RVGFA+AA
Sbjct  449  PQDYIFKIGEGVETQCTSGFTAMDIPPPRGPLWILGDIFMGPYHTVFDYGKARVGFAKAA  508



>ref|XP_010916100.1| PREDICTED: aspartic proteinase oryzasin-1-like [Elaeis guineensis]
 ref|XP_010916101.1| PREDICTED: aspartic proteinase oryzasin-1-like [Elaeis guineensis]
 ref|XP_010916102.1| PREDICTED: aspartic proteinase oryzasin-1-like [Elaeis guineensis]
Length=518

 Score =   250 bits (639),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 118/182 (65%), Positives = 149/182 (82%), Gaps = 4/182 (2%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVD-EKNGVSADLHDAMCSACEM  517
            ++++++L+ +  P KICS++GLC F+G  GVSMGI+SVV+ +++G +  L + MC+ CEM
Sbjct  336  EKIMEMLMEKEEPAKICSRVGLCAFDGTHGVSMGIKSVVNGKRDGSTGGLGNGMCTYCEM  395

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQNQL +NQT E +L+Y+N+LC RLPSP GES VDC  L +MP+VSF+IGGK FDL
Sbjct  396  AVVWMQNQLVQNQTLEQVLNYINQLCERLPSPTGESAVDCDSLPSMPTVSFTIGGKRFDL  455

Query  336  SPNEYILKVGEGSAA-QCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAE  160
             P +YILKV  GS+A QCISGFTALDV  P+GPLWILGDVFMG YHTVFDYGK+RVGFAE
Sbjct  456  KPEQYILKVDVGSSATQCISGFTALDV--PQGPLWILGDVFMGAYHTVFDYGKLRVGFAE  513

Query  159  AA  154
            AA
Sbjct  514  AA  515



>ref|XP_010496363.1| PREDICTED: aspartic proteinase A3-like [Camelina sativa]
Length=512

 Score =   250 bits (639),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 112/180 (62%), Positives = 144/180 (80%), Gaps = 2/180 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLHDAMCSACEMT  514
            + M++ L+ +  PKK+CSQIG+C F+G   VSMGI+SVVD+  G S  L+ AMCSAC+M 
Sbjct  335  KTMLNSLLAQEDPKKVCSQIGVCAFDGTDSVSMGIQSVVDD--GASGLLNQAMCSACQMA  392

Query  513  VVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDLS  334
             VWM+++L++NQTQE IL+Y  ELC+ +P+   +S VDC K+S+MP VSF+IGG+ FDLS
Sbjct  393  AVWMESELTQNQTQERILAYAAELCDHIPTQNQQSAVDCEKVSSMPIVSFTIGGRTFDLS  452

Query  333  PNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEAA  154
            P +YI K+GEG   QC SGFTA+D+PPPRGPLWILGD+FMG YHTVFDYGK RVGFA+AA
Sbjct  453  PQDYIFKIGEGVETQCTSGFTAMDIPPPRGPLWILGDIFMGPYHTVFDYGKARVGFAKAA  512



>ref|XP_002872693.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48952.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
Length=507

 Score =   249 bits (637),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 111/180 (62%), Positives = 144/180 (80%), Gaps = 2/180 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLHDAMCSACEMT  514
            + M++ L+ +  PKK+CSQIG+C ++G   VSM I+SVVD+  G S  L+ AMCSACEM 
Sbjct  330  KTMLNSLLAQEDPKKVCSQIGVCAYDGTHSVSMDIQSVVDD--GTSGLLNQAMCSACEMA  387

Query  513  VVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDLS  334
             VWM+++L++NQTQE IL+Y  ELCN +P+   +S VDC ++S+MP VSFSIGG+ FDLS
Sbjct  388  AVWMESELTQNQTQERILAYAAELCNHIPTKNQQSAVDCERVSSMPIVSFSIGGRTFDLS  447

Query  333  PNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEAA  154
            P +YI K+G+G  +QC SGFTA+D+PPPRGPLWILGD+FMG YHTVFDYGK RVGFA+AA
Sbjct  448  PQDYIFKIGDGVESQCTSGFTAMDIPPPRGPLWILGDIFMGPYHTVFDYGKARVGFAKAA  507



>dbj|BAD94980.1| putative aspartic proteinase [Arabidopsis thaliana]
Length=149

 Score =   238 bits (607),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 112/149 (75%), Positives = 128/149 (86%), Gaps = 1/149 (1%)
 Frame = -2

Query  597  MGIESVVDEKNG-VSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSP  421
            MGIESVVD++N  +S  + DA CSACEM VVW+Q+QL +N TQE IL+YVNELC RLPSP
Sbjct  1    MGIESVVDKENAKLSNGVGDAACSACEMAVVWIQSQLRQNMTQERILNYVNELCERLPSP  60

Query  420  MGESGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGP  241
            MGES VDC +LSTMP+VS +IGGKVFDL+P EY+LKVGEG  AQCISGF ALDV PPRGP
Sbjct  61   MGESAVDCAQLSTMPTVSLTIGGKVFDLAPEEYVLKVGEGPVAQCISGFIALDVAPPRGP  120

Query  240  LWILGDVFMGRYHTVFDYGKMRVGFAEAA  154
            LWILGDVFMG+YHTVFD+G  +VGFAEAA
Sbjct  121  LWILGDVFMGKYHTVFDFGNEQVGFAEAA  149



>gb|EMT17680.1| Phytepsin [Aegilops tauschii]
Length=446

 Score =   248 bits (632),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 124/208 (60%), Positives = 148/208 (71%), Gaps = 29/208 (14%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGV---------------------------SM  595
            Q+++DLL+ E +PKK+CSQ+   T+N  +                             S 
Sbjct  240  QQILDLLLAETQPKKVCSQL-TDTWNIPKAFFHYAVIAARIVLLTSMAHFPIVHLCEHSA  298

Query  594  GIESVVDEKNGVSADLH-DAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPM  418
            GI SVVD++   S  L  D MCSACEM VVWMQNQL++N+TQ+ IL YVN+LCNRLPSPM
Sbjct  299  GIRSVVDDEPVKSNGLRTDPMCSACEMAVVWMQNQLAQNKTQDLILDYVNQLCNRLPSPM  358

Query  417  GESGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPL  238
            GES VDC  L +MP + F+IGGK F L P EYILKVGEG+AAQCISGFTA+D+PPPRGPL
Sbjct  359  GESAVDCASLGSMPDIEFTIGGKKFALKPEEYILKVGEGAAAQCISGFTAMDIPPPRGPL  418

Query  237  WILGDVFMGRYHTVFDYGKMRVGFAEAA  154
            WILGDVFMG YHTVFDYGK+RVGFA+AA
Sbjct  419  WILGDVFMGPYHTVFDYGKLRVGFAKAA  446



>ref|XP_010432791.1| PREDICTED: aspartic proteinase A3-like isoform X1 [Camelina sativa]
 ref|XP_010432799.1| PREDICTED: aspartic proteinase A3-like isoform X1 [Camelina sativa]
Length=508

 Score =   249 bits (636),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 111/180 (62%), Positives = 144/180 (80%), Gaps = 2/180 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLHDAMCSACEMT  514
            + M++ L+ +  PKK+CSQIG+C F+G   VSMGI+SVVD+  G S  L+ AMCSAC+M 
Sbjct  331  KTMLNSLLAQEDPKKVCSQIGVCAFDGTDSVSMGIQSVVDD--GASGLLNQAMCSACQMA  388

Query  513  VVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDLS  334
             VWM+++L++N+TQE IL+Y  ELC+ +P+   +S VDC K+S+MP VSF+IGG+ FDLS
Sbjct  389  AVWMESELTQNKTQERILAYAAELCDHIPTQNQQSAVDCEKVSSMPIVSFTIGGRTFDLS  448

Query  333  PNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEAA  154
            P +YI K+GEG   QC SGFTA+D+PPPRGPLWILGD+FMG YHTVFDYGK RVGFA+AA
Sbjct  449  PQDYIFKIGEGVETQCTSGFTAMDIPPPRGPLWILGDIFMGPYHTVFDYGKARVGFAKAA  508



>gb|KDO45247.1| hypothetical protein CISIN_1g010486mg [Citrus sinensis]
Length=506

 Score =   248 bits (634),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/176 (65%), Positives = 142/176 (81%), Gaps = 2/176 (1%)
 Frame = -2

Query  681  DLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLHDAMCSACEMTVVWM  502
            DLLV    P+K+C QIGLC FNG   VS GI++VV+++N  + D   A+CSACEM VVW+
Sbjct  333  DLLVSGLLPEKVCQQIGLCAFNGAEYVSTGIKTVVEKENVSAGD--SAVCSACEMAVVWV  390

Query  501  QNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDLSPNEY  322
            QNQL + QT+E +LSY+NELC+ LP+PMGES +DC ++ TMP+VSF+IG K+F+LSP +Y
Sbjct  391  QNQLKQKQTKEKVLSYINELCDSLPNPMGESIIDCDRIPTMPNVSFTIGDKIFNLSPEQY  450

Query  321  ILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEAA  154
            ILK GEG A  CISGF A D+PPPRGPLWILGDVFMG YHTVFD GK+R+GFAEAA
Sbjct  451  ILKTGEGIAEVCISGFMAFDLPPPRGPLWILGDVFMGVYHTVFDSGKLRIGFAEAA  506



>ref|NP_192355.1| aspartic proteinase A3 [Arabidopsis thaliana]
 sp|Q9XEC4.1|APA3_ARATH RecName: Full=Aspartic proteinase A3; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAD29758.1|AF076243_5 putative aspartic protease [Arabidopsis thaliana]
 gb|AAK50111.1|AF372974_1 AT4g04460/T26N6_7 [Arabidopsis thaliana]
 emb|CAB77914.1| putative aspartic protease [Arabidopsis thaliana]
 gb|AEE82390.1| aspartic proteinase A3 [Arabidopsis thaliana]
Length=508

 Score =   248 bits (634),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 110/180 (61%), Positives = 146/180 (81%), Gaps = 2/180 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLHDAMCSACEMT  514
            + M++ L+ +  PKK+CSQIG+C ++G + VSMGI+SVVD+  G S  L+ AMCSACEM 
Sbjct  331  KTMLNSLLAQEDPKKVCSQIGVCAYDGTQSVSMGIQSVVDD--GTSGLLNQAMCSACEMA  388

Query  513  VVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDLS  334
             VWM+++L++NQTQE IL+Y  ELC+ +P+   +S VDCG++S+MP V+FSIGG+ FDL+
Sbjct  389  AVWMESELTQNQTQERILAYAAELCDHIPTQNQQSAVDCGRVSSMPIVTFSIGGRSFDLT  448

Query  333  PNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEAA  154
            P +YI K+GEG  +QC SGFTA+D+ PPRGPLWILGD+FMG YHTVFDYGK RVGFA+AA
Sbjct  449  PQDYIFKIGEGVESQCTSGFTAMDIAPPRGPLWILGDIFMGPYHTVFDYGKGRVGFAKAA  508



>gb|KDO45246.1| hypothetical protein CISIN_1g010486mg [Citrus sinensis]
Length=509

 Score =   248 bits (634),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/176 (65%), Positives = 142/176 (81%), Gaps = 2/176 (1%)
 Frame = -2

Query  681  DLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLHDAMCSACEMTVVWM  502
            DLLV    P+K+C QIGLC FNG   VS GI++VV+++N  + D   A+CSACEM VVW+
Sbjct  336  DLLVSGLLPEKVCQQIGLCAFNGAEYVSTGIKTVVEKENVSAGD--SAVCSACEMAVVWV  393

Query  501  QNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDLSPNEY  322
            QNQL + QT+E +LSY+NELC+ LP+PMGES +DC ++ TMP+VSF+IG K+F+LSP +Y
Sbjct  394  QNQLKQKQTKEKVLSYINELCDSLPNPMGESIIDCDRIPTMPNVSFTIGDKIFNLSPEQY  453

Query  321  ILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEAA  154
            ILK GEG A  CISGF A D+PPPRGPLWILGDVFMG YHTVFD GK+R+GFAEAA
Sbjct  454  ILKTGEGIAEVCISGFMAFDLPPPRGPLWILGDVFMGVYHTVFDSGKLRIGFAEAA  509



>gb|AFX73041.1| preprofigain B, partial [Ficus carica]
Length=385

 Score =   244 bits (622),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 138/160 (86%), Gaps = 0/160 (0%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLHDAMCSACEMT  514
            Q ++DLL+ +  PKK+CSQIGLCTF+G RGVS+ IES+VDE NG S  L DAMCSACEM 
Sbjct  226  QNILDLLMAQVHPKKVCSQIGLCTFDGTRGVSIRIESMVDENNGKSGILRDAMCSACEMA  285

Query  513  VVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDLS  334
            VVWMQNQL++NQTQE IL Y NELC+R+PSPMGES VDCG+LS+MP V+F+IGGK FDLS
Sbjct  286  VVWMQNQLTQNQTQERILDYANELCDRMPSPMGESSVDCGRLSSMPKVAFTIGGKTFDLS  345

Query  333  PNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFM  214
            P EYILKVGEG+ AQCISGFT LDVPPPRGPLWILGDV M
Sbjct  346  PEEYILKVGEGAQAQCISGFTGLDVPPPRGPLWILGDVLM  385



>ref|XP_009390744.1| PREDICTED: aspartic proteinase oryzasin-1-like [Musa acuminata 
subsp. malaccensis]
Length=524

 Score =   247 bits (630),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 117/182 (64%), Positives = 144/182 (79%), Gaps = 4/182 (2%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEK-NGVSADLHDA-MCSACE  520
            ++++D+L+ E  P KICSQIGLC++N  +G S+GI+SVVD K   ++  L+D  MCS CE
Sbjct  345  EKIMDMLLAEEEPSKICSQIGLCSYNSTQGASLGIKSVVDNKVEKLATGLNDGGMCSYCE  404

Query  519  MTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFD  340
            M V+WMQ+QL  NQT E ILSY+NELC R+PSPMGES +DC  LS MP +SF+IGGK FD
Sbjct  405  MAVIWMQSQLRLNQTLEQILSYLNELCERIPSPMGESAIDCDSLSFMPVISFNIGGKNFD  464

Query  339  LSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAE  160
            L+P +Y LKV  G + QCISGFTA+DV  P+GPLWILGDVFMG YHTVFDYG +RVGFAE
Sbjct  465  LTPEQYTLKVATGGSEQCISGFTAIDV--PQGPLWILGDVFMGVYHTVFDYGNLRVGFAE  522

Query  159  AA  154
            AA
Sbjct  523  AA  524



>ref|XP_009780973.1| PREDICTED: aspartic proteinase A1-like [Nicotiana sylvestris]
Length=148

 Score =   233 bits (595),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 106/148 (72%), Positives = 123/148 (83%), Gaps = 0/148 (0%)
 Frame = -2

Query  597  MGIESVVDEKNGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPM  418
            M IESVVD+ NG S  L D MC  CEM VVWMQNQ+  N+T ++I +YVN+LC++LPSPM
Sbjct  1    MIIESVVDKHNGASNGLGDEMCRVCEMAVVWMQNQMRRNETADSIYNYVNQLCDQLPSPM  60

Query  417  GESGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPL  238
            GES VDC  L++MP+VSF+IG K FDL+P +Y+L+VGEG  AQCISGFTALDVPPPRGPL
Sbjct  61   GESAVDCSSLASMPNVSFTIGNKTFDLTPQQYVLQVGEGPVAQCISGFTALDVPPPRGPL  120

Query  237  WILGDVFMGRYHTVFDYGKMRVGFAEAA  154
            WILGDVFMG YHTVFDYG  RVGFAEAA
Sbjct  121  WILGDVFMGHYHTVFDYGNSRVGFAEAA  148



>gb|KDO62072.1| hypothetical protein CISIN_1g010230mg [Citrus sinensis]
Length=492

 Score =   244 bits (623),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 112/156 (72%), Positives = 134/156 (86%), Gaps = 1/156 (1%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNG-VSADLHDAMCSACEM  517
            + +I++L+ +  P+KICSQIGLCTF+G+RGVSMGIESVV E N   S   HDAMCS CEM
Sbjct  334  EEIINMLLAKDEPQKICSQIGLCTFDGSRGVSMGIESVVPENNHRASGGFHDAMCSTCEM  393

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQNQL +NQTQE IL+YVNELC+RLPSPMGES VDC +LS++P VSF+IGGK+FDL
Sbjct  394  AVVWMQNQLKQNQTQERILNYVNELCDRLPSPMGESAVDCSRLSSLPIVSFTIGGKIFDL  453

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWIL  229
            +P++YILKVGEG AAQCISGF+ALDV PPRGPLW +
Sbjct  454  TPDQYILKVGEGDAAQCISGFSALDVAPPRGPLWYV  489



>ref|XP_009421489.1| PREDICTED: aspartic proteinase oryzasin-1-like [Musa acuminata 
subsp. malaccensis]
Length=520

 Score =   244 bits (624),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 111/181 (61%), Positives = 146/181 (81%), Gaps = 3/181 (2%)
 Frame = -2

Query  693  QRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEK-NGVSADLHDAMCSACEM  517
            + ++++++ +  P KICS+IGLC FNG +GVS+GI+SVVD +   + + L + MCS CEM
Sbjct  342  ETIMNMILAKEEPAKICSKIGLCAFNGTQGVSLGIKSVVDNQVEKLDSGLSNGMCSYCEM  401

Query  516  TVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDL  337
             VVWMQ+QL++N+T E +L+Y++ELC R+PSPMGES VDC  LS+MP ++F+IGG+ FDL
Sbjct  402  AVVWMQSQLTQNKTLEQVLNYLDELCERIPSPMGESAVDCNSLSSMPVITFNIGGRNFDL  461

Query  336  SPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEA  157
             P +YILKV  G + QCISGFTALDV  P+GPLW+LGDVFMG YHTVFDYG +RVGFAEA
Sbjct  462  RPEQYILKVASGGSEQCISGFTALDV--PQGPLWVLGDVFMGAYHTVFDYGNLRVGFAEA  519

Query  156  A  154
            A
Sbjct  520  A  520



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1171852487340