BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF009E06

Length=800
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AGX93072.1|  7-deoxyloganetic acid UDP-glucosyltransferase-lik...    308   2e-98   Catharanthus longifolius
sp|U3U992.1|UGT8_CATRO  RecName: Full=7-deoxyloganetic acid gluco...    308   2e-98   Catharanthus roseus [chatas]
gb|AGX93065.1|  7-deoxyloganetic acid UDP-glucosyltransferase           308   2e-98   Catharanthus roseus [chatas]
gb|AGX93066.1|  7-deoxyloganetic acid UDP-glucosyltransferase-lik...    307   7e-98   Lonicera japonica [Japanese honeysuckle]
gb|AGX93069.1|  7-deoxyloganetic acid UDP-glucosyltransferase-lik...    302   7e-96   Rauvolfia serpentina [devilpepper]
gb|AGX93070.1|  7-deoxyloganetic acid UDP-glucosyltransferase-lik...    298   2e-94   Tabernaemontana elegans
gb|AGX93068.1|  7-deoxyloganetic acid UDP-glucosyltransferase-lik...    297   4e-94   Amsonia hubrichtii
gb|AGX93071.1|  7-deoxyloganetic acid UDP-glucosyltransferase-lik...    295   2e-93   Vinca minor [common periwinkle]
gb|AGX93067.1|  7-deoxyloganetic acid UDP-glucosyltransferase-lik...    291   6e-92   Cinchona calisaya [quinine]
ref|XP_004235055.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    290   3e-91   Solanum lycopersicum
ref|XP_006361975.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       288   7e-91   
ref|XP_010318075.1|  PREDICTED: LOW QUALITY PROTEIN: 7-deoxylogan...    286   3e-90   
ref|XP_002276555.2|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    288   5e-90   
ref|XP_010277669.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    286   1e-89   Nelumbo nucifera [Indian lotus]
ref|XP_007158356.1|  hypothetical protein PHAVU_002G145900g             285   2e-89   Phaseolus vulgaris [French bean]
ref|XP_011076757.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    285   2e-89   Sesamum indicum [beniseed]
emb|CDP14405.1|  unnamed protein product                                279   1e-88   Coffea canephora [robusta coffee]
ref|XP_006379614.1|  hypothetical protein POPTR_0008s06270g             279   2e-88   
ref|XP_007009133.1|  UDP-glucosyltransferase family 1 protein           280   1e-87   Theobroma cacao [chocolate]
ref|XP_011100060.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    281   1e-87   Sesamum indicum [beniseed]
gb|EYU19962.1|  hypothetical protein MIMGU_mgv1a005720mg                280   2e-87   Erythranthe guttata [common monkey flower]
gb|AIE12477.1|  UGT4                                                    280   2e-87   Panax ginseng [Asiatic ginseng]
ref|XP_007009132.1|  UDP-glucosyltransferase family 1 protein           279   4e-87   
ref|XP_008467017.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       273   5e-87   Cucumis melo [Oriental melon]
emb|CDP19643.1|  unnamed protein product                                278   7e-87   Coffea canephora [robusta coffee]
ref|XP_006379615.1|  hypothetical protein POPTR_0008s06270g             278   9e-87   Populus trichocarpa [western balsam poplar]
ref|XP_002281029.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    277   2e-86   Vitis vinifera
ref|XP_011038346.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    277   2e-86   Populus euphratica
ref|XP_011084978.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    278   3e-86   Sesamum indicum [beniseed]
ref|XP_002280624.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    276   4e-86   Vitis vinifera
ref|XP_011084985.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    277   4e-86   Sesamum indicum [beniseed]
gb|KDO69252.1|  hypothetical protein CISIN_1g011848mg                   275   8e-86   Citrus sinensis [apfelsine]
ref|XP_010262684.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    276   8e-86   Nelumbo nucifera [Indian lotus]
gb|KJB74151.1|  hypothetical protein B456_011G275800                    275   9e-86   Gossypium raimondii
ref|XP_010262685.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    276   9e-86   Nelumbo nucifera [Indian lotus]
ref|XP_006435572.1|  hypothetical protein CICLE_v10031404mg             275   9e-86   Citrus clementina [clementine]
gb|KDO69253.1|  hypothetical protein CISIN_1g011848mg                   275   1e-85   Citrus sinensis [apfelsine]
dbj|BAB86920.1|  glucosyltransferase-2                                  275   2e-85   Vigna angularis [azuki bean]
emb|CDP05611.1|  unnamed protein product                                275   2e-85   Coffea canephora [robusta coffee]
ref|XP_002280528.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    275   2e-85   Vitis vinifera
ref|XP_006435573.1|  hypothetical protein CICLE_v10031368mg             273   7e-85   Citrus clementina [clementine]
ref|XP_010650643.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    273   9e-85   Vitis vinifera
ref|XP_011076758.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    273   1e-84   Sesamum indicum [beniseed]
ref|XP_007158359.1|  hypothetical protein PHAVU_002G146200g             273   1e-84   Phaseolus vulgaris [French bean]
emb|CDP05607.1|  unnamed protein product                                273   1e-84   Coffea canephora [robusta coffee]
ref|XP_002280470.2|  PREDICTED: LOW QUALITY PROTEIN: 7-deoxylogan...    272   2e-84   Vitis vinifera
ref|XP_010658496.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    272   2e-84   
ref|XP_010650608.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    272   2e-84   Vitis vinifera
gb|ACS87994.1|  UDP-glucosyltransferase family 1 protein                272   3e-84   Citrus sinensis [apfelsine]
ref|XP_007009131.1|  UDP-glucosyltransferase family 1 protein           271   3e-84   
ref|XP_003517688.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       271   5e-84   Glycine max [soybeans]
gb|EYU19963.1|  hypothetical protein MIMGU_mgv1a005336mg                271   1e-83   Erythranthe guttata [common monkey flower]
ref|XP_002276823.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    270   1e-83   Vitis vinifera
ref|XP_002276617.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    270   1e-83   
ref|XP_004173134.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    265   1e-83   
ref|XP_009597174.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    270   2e-83   Nicotiana tomentosiformis
ref|XP_008464643.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       270   2e-83   
ref|XP_007158358.1|  hypothetical protein PHAVU_002G146100g             269   3e-83   Phaseolus vulgaris [French bean]
ref|XP_002276771.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    269   4e-83   Vitis vinifera
gb|KDP44850.1|  hypothetical protein JCGZ_01350                         268   6e-83   Jatropha curcas
ref|XP_009800319.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    268   1e-82   Nicotiana sylvestris
dbj|BAB86930.1|  glucosyltransferase-12                                 266   2e-82   Vigna angularis [azuki bean]
dbj|BAB86929.1|  glucosyltransferase-11                                 266   2e-82   Vigna angularis [azuki bean]
ref|XP_011084983.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    268   2e-82   Sesamum indicum [beniseed]
ref|XP_009608691.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    267   2e-82   Nicotiana tomentosiformis
ref|XP_009802463.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    266   4e-82   Nicotiana sylvestris
ref|XP_011085130.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    265   7e-82   
ref|XP_009597175.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    266   7e-82   Nicotiana tomentosiformis
gb|KDO61155.1|  hypothetical protein CISIN_1g037374mg                   265   8e-82   Citrus sinensis [apfelsine]
ref|XP_006355679.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       265   1e-81   Solanum tuberosum [potatoes]
ref|XP_004150246.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       265   2e-81   Cucumis sativus [cucumbers]
ref|XP_009590620.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    264   7e-81   Nicotiana tomentosiformis
gb|KDO58004.1|  hypothetical protein CISIN_1g037999mg                   262   9e-81   Citrus sinensis [apfelsine]
ref|XP_008464906.1|  PREDICTED: UDP-glycosyltransferase 85A3-like...    263   1e-80   Cucumis melo [Oriental melon]
ref|XP_008464907.1|  PREDICTED: UDP-glycosyltransferase 85A3-like...    262   1e-80   Cucumis melo [Oriental melon]
ref|XP_006481394.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       262   1e-80   Citrus sinensis [apfelsine]
ref|XP_004172562.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       262   2e-80   
gb|EYU19961.1|  hypothetical protein MIMGU_mgv1a005050mg                262   2e-80   Erythranthe guttata [common monkey flower]
gb|KDO69249.1|  hypothetical protein CISIN_1g0487532mg                  256   2e-80   Citrus sinensis [apfelsine]
ref|XP_006355680.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       261   3e-80   Solanum tuberosum [potatoes]
ref|XP_006429244.1|  hypothetical protein CICLE_v10013877mg             261   3e-80   Citrus clementina [clementine]
ref|XP_006486448.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       261   3e-80   Citrus sinensis [apfelsine]
ref|XP_006435571.1|  hypothetical protein CICLE_v10031408mg             261   3e-80   Citrus clementina [clementine]
gb|KGN50614.1|  hypothetical protein Csa_5G196570                       261   5e-80   Cucumis sativus [cucumbers]
gb|KDO38335.1|  hypothetical protein CISIN_1g044936mg                   259   7e-80   Citrus sinensis [apfelsine]
gb|AIS39472.1|  flavonoid UDP-glucosyltransferase 3                     259   1e-79   Citrus x paradisi [grapefruit]
ref|XP_008785471.1|  PREDICTED: UDP-glycosyltransferase 85A4-like       259   2e-79   Phoenix dactylifera
ref|XP_010674283.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    259   2e-79   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004150245.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       259   3e-79   
gb|AGZ84549.1|  glycosyltransferase KGT31                               258   4e-79   Pueraria montana var. lobata [kudzu]
ref|XP_004149949.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       258   5e-79   Cucumis sativus [cucumbers]
emb|CDP16024.1|  unnamed protein product                                258   5e-79   Coffea canephora [robusta coffee]
ref|XP_009795416.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    256   2e-78   Nicotiana sylvestris
ref|XP_004162780.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       256   3e-78   
gb|KDO69251.1|  hypothetical protein CISIN_1g011832mg                   256   3e-78   Citrus sinensis [apfelsine]
ref|XP_010923185.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    256   4e-78   Elaeis guineensis
gb|KDO43669.1|  hypothetical protein CISIN_1g011792mg                   255   6e-78   Citrus sinensis [apfelsine]
ref|XP_004171873.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       255   6e-78   
gb|KJB74142.1|  hypothetical protein B456_011G275300                    250   6e-78   Gossypium raimondii
ref|XP_006423294.1|  hypothetical protein CICLE_v10030404mg             255   7e-78   Citrus clementina [clementine]
ref|XP_010688868.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    256   1e-77   Beta vulgaris subsp. vulgaris [field beet]
gb|KGN50615.1|  UDP-glucosyltransferase family 1 protein                255   1e-77   Cucumis sativus [cucumbers]
ref|XP_008811497.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       255   2e-77   Phoenix dactylifera
dbj|BAK55741.1|  UDP-glucose glucosyltransferase                        254   3e-77   Gardenia jasminoides
ref|XP_009613526.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    254   3e-77   Nicotiana tomentosiformis
ref|XP_006367215.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       253   3e-77   Solanum tuberosum [potatoes]
ref|XP_004239922.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    254   3e-77   Solanum lycopersicum
dbj|BAK55740.1|  UDP-glucose glucosyltransferase                        254   3e-77   Gardenia jasminoides
ref|XP_004302685.2|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    253   4e-77   Fragaria vesca subsp. vesca
ref|XP_010923184.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    253   7e-77   Elaeis guineensis
ref|XP_010032069.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    253   8e-77   Eucalyptus grandis [rose gum]
gb|KJB74134.1|  hypothetical protein B456_011G274800                    252   1e-76   Gossypium raimondii
ref|XP_006355163.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       252   1e-76   Solanum tuberosum [potatoes]
ref|XP_010923186.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    252   1e-76   Elaeis guineensis
ref|XP_008359771.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       252   1e-76   
ref|XP_008388093.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       252   2e-76   
ref|XP_008353149.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       251   2e-76   
gb|KJB74150.1|  hypothetical protein B456_011G275700                    251   2e-76   Gossypium raimondii
ref|XP_010318076.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    251   2e-76   Solanum lycopersicum
ref|XP_008388092.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       251   2e-76   
ref|XP_002530397.1|  UDP-glucuronosyltransferase, putative              251   3e-76   
gb|KJB74143.1|  hypothetical protein B456_011G275300                    249   3e-76   Gossypium raimondii
gb|KJB74145.1|  hypothetical protein B456_011G275400                    247   4e-76   Gossypium raimondii
gb|KJB74144.1|  hypothetical protein B456_011G275400                    247   4e-76   Gossypium raimondii
ref|XP_010032067.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    251   4e-76   Eucalyptus grandis [rose gum]
ref|XP_010032068.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    251   4e-76   Eucalyptus grandis [rose gum]
ref|XP_010674287.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    251   6e-76   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010674284.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    250   8e-76   
gb|KJB74149.1|  hypothetical protein B456_011G275600                    250   9e-76   Gossypium raimondii
gb|KJB74146.1|  hypothetical protein B456_011G275400                    249   1e-75   Gossypium raimondii
ref|XP_006367216.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       249   2e-75   Solanum tuberosum [potatoes]
ref|XP_008785470.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       249   2e-75   Phoenix dactylifera
ref|XP_004512576.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       248   3e-75   
ref|XP_003613025.1|  UDP-glucuronosyltransferase 1-1                    248   3e-75   Medicago truncatula
gb|KJB74147.1|  hypothetical protein B456_011G275400                    248   5e-75   Gossypium raimondii
gb|KHG01935.1|  UDP-glycosyltransferase 85A1                            256   6e-75   Gossypium arboreum [tree cotton]
emb|CDP19644.1|  unnamed protein product                                247   1e-74   Coffea canephora [robusta coffee]
ref|XP_010658655.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    239   1e-74   Vitis vinifera
ref|XP_011014019.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    247   1e-74   Populus euphratica
ref|XP_007026847.1|  UDP-glucosyl transferase 85A3, putative isof...    247   2e-74   
ref|XP_007026848.1|  UDP-glucosyl transferase 85A3, putative isof...    246   2e-74   
ref|XP_011014018.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    247   2e-74   Populus euphratica
gb|KHG03787.1|  hypothetical protein F383_26945                         240   4e-74   Gossypium arboreum [tree cotton]
gb|KHN04913.1|  UDP-glycosyltransferase 85A2                            244   5e-74   Glycine soja [wild soybean]
ref|XP_010666054.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    246   5e-74   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004235101.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    245   9e-74   Solanum lycopersicum
ref|XP_010905381.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    243   3e-73   
ref|XP_006362115.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       242   8e-73   Solanum tuberosum [potatoes]
ref|XP_003613028.1|  Cis-zeatin O-glucosyltransferase                   242   8e-73   Medicago truncatula
ref|XP_011000049.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    241   1e-72   Populus euphratica
ref|XP_009346996.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    241   3e-72   
emb|CDP05613.1|  unnamed protein product                                239   3e-72   Coffea canephora [robusta coffee]
dbj|BAP90373.1|  UDP-glycose: glycosyltransferase UGT709H1              240   4e-72   Fagopyrum esculentum
ref|XP_010674285.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    241   5e-72   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO38337.1|  hypothetical protein CISIN_1g011531mg                   240   7e-72   Citrus sinensis [apfelsine]
ref|XP_009589441.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    239   8e-72   Nicotiana tomentosiformis
ref|XP_006373896.1|  hypothetical protein POPTR_0016s10010g             239   9e-72   Populus trichocarpa [western balsam poplar]
ref|XP_003517692.2|  PREDICTED: UDP-glycosyltransferase 85A3-like       240   1e-71   Glycine max [soybeans]
ref|XP_008370121.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       239   1e-71   Malus domestica [apple tree]
ref|XP_009589440.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    239   1e-71   Nicotiana tomentosiformis
gb|KHN04919.1|  UDP-glycosyltransferase 85A3                            239   1e-71   Glycine soja [wild soybean]
ref|XP_003613026.1|  UDP-glucuronosyltransferase 1-6                    238   3e-71   Medicago truncatula
ref|XP_006429243.1|  hypothetical protein CICLE_v10011602mg             238   5e-71   Citrus clementina [clementine]
ref|XP_007026849.1|  UDP-glucosyl transferase 85A3, putative            237   6e-71   
ref|XP_009594030.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    234   8e-71   Nicotiana tomentosiformis
gb|KHG01936.1|  UDP-glycosyltransferase 85A1                            244   9e-71   Gossypium arboreum [tree cotton]
ref|XP_010674282.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    238   1e-70   Beta vulgaris subsp. vulgaris [field beet]
gb|AIE12478.1|  UGT5                                                    236   2e-70   Panax ginseng [Asiatic ginseng]
ref|XP_009804549.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    236   2e-70   Nicotiana sylvestris
ref|XP_010676681.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    236   3e-70   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007026846.1|  UDP-glucosyl transferase 85A3, putative isof...    234   4e-70   
ref|XP_007026845.1|  UDP-glucosyl transferase 85A3, putative isof...    235   5e-70   
emb|CAN67315.1|  hypothetical protein VITISV_036458                     234   6e-70   Vitis vinifera
gb|AFJ53007.1|  UDP-glycosyltransferase 1                               233   2e-69   Linum usitatissimum
gb|AFK79038.1|  glycosyltransferase UGT6                                233   2e-69   Bupleurum chinense
ref|XP_010044032.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    232   5e-69   Eucalyptus grandis [rose gum]
ref|XP_006850414.1|  hypothetical protein AMTR_s00165p00029520          226   1e-68   
ref|XP_011466515.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    231   1e-68   Fragaria vesca subsp. vesca
ref|XP_004305167.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    231   2e-68   Fragaria vesca subsp. vesca
ref|XP_008240016.1|  PREDICTED: UDP-glycosyltransferase 85A4-like       223   3e-68   
emb|CDP04614.1|  unnamed protein product                                230   6e-68   Coffea canephora [robusta coffee]
gb|KJB76813.1|  hypothetical protein B456_012G109200                    229   1e-67   Gossypium raimondii
ref|XP_006357782.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       228   2e-67   Solanum tuberosum [potatoes]
gb|KHG08953.1|  hypothetical protein F383_15475                         228   3e-67   Gossypium arboreum [tree cotton]
ref|XP_006850416.1|  hypothetical protein AMTR_s00165p00031520          222   3e-67   
ref|XP_010316060.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    226   6e-67   Solanum lycopersicum
ref|XP_004231996.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    227   6e-67   Solanum lycopersicum
ref|XP_010316061.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    227   7e-67   Solanum lycopersicum
ref|XP_007208247.1|  hypothetical protein PRUPE_ppa016769mg             223   2e-66   
ref|XP_008370128.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       220   2e-66   
ref|XP_006357780.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       225   3e-66   
ref|XP_007207791.1|  hypothetical protein PRUPE_ppa025605mg             225   3e-66   
gb|ACU22679.1|  unknown                                                 217   8e-66   Glycine max [soybeans]
ref|XP_008242262.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       223   9e-66   Prunus mume [ume]
gb|KJB74139.1|  hypothetical protein B456_011G275100                    223   9e-66   Gossypium raimondii
emb|CBI31575.3|  unnamed protein product                                223   1e-65   Vitis vinifera
ref|XP_008346926.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       223   1e-65   
gb|KJB74138.1|  hypothetical protein B456_011G275100                    223   1e-65   Gossypium raimondii
gb|AFJ53008.1|  UDP-glycosyltransferase 1                               223   2e-65   Linum usitatissimum
ref|XP_007009137.1|  UDP-glucosyltransferase family 1 protein, pu...    221   5e-65   
ref|XP_007026851.1|  UDP-Glycosyltransferase superfamily protein ...    222   6e-65   
ref|XP_007026850.1|  UDP-glucosyl transferase 85A4-like protein i...    221   7e-65   
dbj|BAM63146.1|  uncharacterized glucosyltransferase 2                  221   7e-65   Ipomoea nil [qian niu]
ref|XP_007207618.1|  hypothetical protein PRUPE_ppa019804mg             221   8e-65   Prunus persica
gb|AFJ53010.1|  UDP-glycosyltransferase 1                               220   1e-64   Linum usitatissimum
ref|XP_007207170.1|  hypothetical protein PRUPE_ppa022102mg             220   2e-64   Prunus persica
ref|XP_009759439.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    221   2e-64   Nicotiana sylvestris
gb|KJB74137.1|  hypothetical protein B456_011G275000                    220   2e-64   Gossypium raimondii
ref|XP_008242242.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       219   3e-64   
emb|CDO99846.1|  unnamed protein product                                218   4e-64   Coffea canephora [robusta coffee]
ref|XP_003520949.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       218   1e-63   
gb|AFJ53009.1|  UDP-glycosyltransferase 1                               218   1e-63   Linum usitatissimum
ref|XP_008242286.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       217   3e-63   Prunus mume [ume]
ref|XP_007206751.1|  hypothetical protein PRUPE_ppa025141mg             217   4e-63   
ref|XP_003526577.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       213   2e-61   
gb|EPS60746.1|  hypothetical protein M569_14056                         211   2e-61   Genlisea aurea
emb|CDP16023.1|  unnamed protein product                                206   4e-61   Coffea canephora [robusta coffee]
ref|XP_007141198.1|  hypothetical protein PHAVU_008G175300g             211   4e-61   Phaseolus vulgaris [French bean]
ref|XP_008219317.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       211   6e-61   Prunus mume [ume]
gb|KHN13067.1|  UDP-glycosyltransferase 85A3                            211   7e-61   Glycine soja [wild soybean]
ref|XP_003546715.1|  PREDICTED: UDP-glycosyltransferase 85A3            211   8e-61   Glycine max [soybeans]
emb|CAN77812.1|  hypothetical protein VITISV_010344                     214   8e-61   Vitis vinifera
ref|XP_010666049.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    211   9e-61   Beta vulgaris subsp. vulgaris [field beet]
gb|AAR06913.1|  UDP-glycosyltransferase 85A8                            211   9e-61   Stevia rebaudiana
gb|KCW44219.1|  hypothetical protein EUGRSUZ_L023571                    202   1e-60   Eucalyptus grandis [rose gum]
dbj|BAJ98857.1|  predicted protein                                      210   1e-60   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011008547.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    210   1e-60   Populus euphratica
gb|AAB99950.1|  UDP-glucuronosyltransferase                             206   2e-60   Pisum sativum [garden pea]
ref|XP_002308831.2|  hypothetical protein POPTR_0006s02390g             210   2e-60   Populus trichocarpa [western balsam poplar]
ref|XP_007222804.1|  hypothetical protein PRUPE_ppa005043mg             209   2e-60   Prunus persica
gb|AFK34769.1|  unknown                                                 209   3e-60   Lotus japonicus
ref|XP_011014733.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    209   3e-60   Populus euphratica
ref|XP_004154178.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       203   3e-60   
ref|XP_002513937.1|  UDP-glucuronosyltransferase, putative              209   4e-60   Ricinus communis
ref|XP_008219319.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       209   4e-60   Prunus mume [ume]
ref|XP_007141200.1|  hypothetical protein PHAVU_008G175500g             209   4e-60   Phaseolus vulgaris [French bean]
ref|XP_010066663.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    207   4e-60   
gb|KHN34757.1|  UDP-glycosyltransferase 85A2                            208   4e-60   Glycine soja [wild soybean]
ref|XP_007042920.1|  UDP-glucosyl transferase 85A2                      209   5e-60   
gb|KHN15666.1|  UDP-glycosyltransferase 85A7                            208   5e-60   Glycine soja [wild soybean]
ref|XP_003560194.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    208   5e-60   Brachypodium distachyon [annual false brome]
ref|XP_010094135.1|  UDP-glycosyltransferase 85A2                       205   5e-60   
ref|XP_002322559.2|  hypothetical protein POPTR_0016s02220g             208   6e-60   
ref|XP_011045673.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    208   7e-60   Populus euphratica
ref|XP_008219313.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       208   7e-60   Prunus mume [ume]
ref|XP_008219315.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       208   7e-60   
ref|XP_003542333.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       208   8e-60   Glycine max [soybeans]
ref|XP_010063153.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    208   9e-60   Eucalyptus grandis [rose gum]
ref|XP_002263158.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    207   1e-59   Vitis vinifera
ref|XP_010066661.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    207   1e-59   
ref|XP_008391482.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       203   1e-59   
ref|XP_011045674.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    208   1e-59   Populus euphratica
ref|XP_010066664.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    207   1e-59   Eucalyptus grandis [rose gum]
gb|KCW64634.1|  hypothetical protein EUGRSUZ_G02217                     207   1e-59   Eucalyptus grandis [rose gum]
ref|XP_002298702.2|  hypothetical protein POPTR_0001s32000g             207   1e-59   Populus trichocarpa [western balsam poplar]
ref|XP_004237925.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    207   1e-59   Solanum lycopersicum
ref|XP_010066660.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    207   2e-59   Eucalyptus grandis [rose gum]
gb|KDP41399.1|  hypothetical protein JCGZ_15806                         207   2e-59   Jatropha curcas
ref|XP_007009135.1|  UDP-glucosyltransferase family 1 protein, pu...    202   2e-59   
ref|XP_003563101.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    207   2e-59   Brachypodium distachyon [annual false brome]
ref|XP_002308829.1|  hypothetical protein POPTR_0006s02310g             207   3e-59   
ref|XP_007224069.1|  hypothetical protein PRUPE_ppa015357mg             207   3e-59   Prunus persica
ref|XP_002322561.2|  hypothetical protein POPTR_0016s02260g             206   3e-59   Populus trichocarpa [western balsam poplar]
gb|KCW45338.1|  hypothetical protein EUGRSUZ_L009912                    202   3e-59   Eucalyptus grandis [rose gum]
ref|XP_010063159.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    207   3e-59   Eucalyptus grandis [rose gum]
ref|XP_002322563.2|  hypothetical protein POPTR_0016s02260g             206   3e-59   Populus trichocarpa [western balsam poplar]
ref|XP_010320181.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    207   3e-59   Solanum lycopersicum
ref|XP_006853223.1|  hypothetical protein AMTR_s00038p00220680          202   4e-59   
ref|XP_011008546.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    206   5e-59   Populus euphratica
ref|XP_004237927.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    206   5e-59   Solanum lycopersicum
ref|XP_008219316.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       206   6e-59   Prunus mume [ume]
ref|XP_008219456.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       206   6e-59   Prunus mume [ume]
ref|XP_007222658.1|  hypothetical protein PRUPE_ppa004956mg             206   6e-59   Prunus persica
ref|XP_002462875.1|  hypothetical protein SORBIDRAFT_02g033580          206   7e-59   
ref|XP_008219318.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       206   8e-59   Prunus mume [ume]
gb|KDP41397.1|  hypothetical protein JCGZ_15804                         206   8e-59   Jatropha curcas
gb|KDP43115.1|  hypothetical protein JCGZ_26648                         205   9e-59   Jatropha curcas
ref|XP_004299647.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    205   9e-59   Fragaria vesca subsp. vesca
ref|XP_007141191.1|  hypothetical protein PHAVU_008G174700g             206   9e-59   Phaseolus vulgaris [French bean]
dbj|BAO51842.1|  UDP-glycosyltransferase 85A32                          205   1e-58   
ref|XP_004237928.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    205   1e-58   
gb|ADV36300.1|  glucosyltransferase                                     205   1e-58   
ref|XP_007148402.1|  hypothetical protein PHAVU_006G205500g             205   1e-58   
ref|XP_003615138.1|  Cytokinin-O-glucosyltransferase                    205   1e-58   
gb|AFJ52998.1|  UDP-glycosyltransferase 1                               205   1e-58   
ref|XP_006853232.1|  hypothetical protein AMTR_s00038p00222700          201   1e-58   
ref|XP_002322567.2|  hypothetical protein POPTR_0016s02230g             205   1e-58   
gb|KEH28097.1|  UDP-glucosyltransferase family protein                  205   2e-58   
gb|EMT06489.1|  Cytokinin-O-glucosyltransferase 2                       204   2e-58   
ref|XP_011016634.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    204   2e-58   
gb|AFJ52993.1|  UDP-glycosyltransferase 1                               205   2e-58   
gb|KDP37429.1|  hypothetical protein JCGZ_07956                         204   2e-58   
ref|XP_002307922.1|  hypothetical protein POPTR_0006s02450g             204   2e-58   
ref|XP_004172439.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       199   2e-58   
ref|NP_001059665.1|  Os07g0487100                                       204   3e-58   
emb|CAN60444.1|  hypothetical protein VITISV_032467                     204   3e-58   
ref|XP_007222427.1|  hypothetical protein PRUPE_ppa004909mg             204   3e-58   
ref|XP_010535401.1|  PREDICTED: UDP-glycosyltransferase 85A1-like...    204   3e-58   
ref|XP_004155440.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    204   3e-58   
ref|NP_001277168.1|  UDP-glycosyltransferase 85A2-like                  204   3e-58   
ref|XP_007226586.1|  hypothetical protein PRUPE_ppa023851mg             204   3e-58   
gb|EAZ39840.1|  hypothetical protein OsJ_24281                          204   3e-58   
ref|XP_002307921.2|  hypothetical protein POPTR_0006s02440g             203   3e-58   
ref|XP_009349617.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    204   4e-58   
gb|KCW66550.1|  hypothetical protein EUGRSUZ_F00348                     200   5e-58   
ref|XP_004136284.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       203   5e-58   
ref|XP_011010110.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    201   6e-58   
ref|XP_010039816.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    203   6e-58   
gb|KFK44333.1|  hypothetical protein AALP_AA1G244500                    203   6e-58   
gb|KCW56974.1|  hypothetical protein EUGRSUZ_I02647                     202   7e-58   
ref|XP_010041627.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    203   7e-58   
ref|XP_011008539.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    201   8e-58   
ref|XP_007133898.1|  hypothetical protein PHAVU_010G001300g             203   8e-58   
ref|XP_008229741.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       203   9e-58   
ref|XP_004155500.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       203   9e-58   
gb|KCW45698.1|  hypothetical protein EUGRSUZ_L00502                     202   9e-58   
ref|XP_010030029.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    203   1e-57   
ref|XP_006853264.1|  hypothetical protein AMTR_s00038p00233280          197   1e-57   
ref|NP_001175206.1|  Os07g0489950                                       202   1e-57   
ref|XP_008219404.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       200   1e-57   
ref|XP_008386104.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       202   1e-57   
ref|XP_003522179.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       202   1e-57   
gb|AFK33787.1|  unknown                                                 202   1e-57   
ref|XP_008372493.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       202   1e-57   
ref|XP_002302305.1|  UDP-glucuronosyltransferase family protein         202   1e-57   
ref|XP_010040274.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    202   1e-57   
gb|ACJ84649.1|  unknown                                                 202   1e-57   
gb|KCW45705.1|  hypothetical protein EUGRSUZ_L00511                     202   1e-57   
ref|XP_002268162.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    202   2e-57   
ref|XP_010060020.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    202   2e-57   
ref|XP_002308830.2|  hypothetical protein POPTR_0006s02380g             202   2e-57   
ref|XP_004237929.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    202   2e-57   
ref|XP_010030028.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    202   2e-57   
ref|XP_010273031.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    202   2e-57   
ref|XP_010039829.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    202   2e-57   
gb|KHN17866.1|  UDP-glycosyltransferase 76F1                            201   2e-57   
ref|XP_010676201.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    202   2e-57   
dbj|BAB86928.1|  glucosyltransferase-10                                 202   2e-57   
ref|XP_008245954.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       202   2e-57   
ref|XP_010060023.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    202   2e-57   
ref|XP_008229739.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       202   2e-57   
ref|XP_011004477.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    201   2e-57   
ref|XP_004305885.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    201   2e-57   
gb|EMT06270.1|  Cytokinin-O-glucosyltransferase 2                       201   3e-57   
ref|XP_003538437.1|  PREDICTED: UDP-glycosyltransferase 76F1-like       201   3e-57   
ref|XP_011465456.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    201   3e-57   
ref|XP_007042919.1|  UDP-glycosyltransferase 85A1                       201   3e-57   
ref|XP_002447939.1|  hypothetical protein SORBIDRAFT_06g018460          202   3e-57   
ref|XP_008455194.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       201   3e-57   
emb|CDY21357.1|  BnaA09g30700D                                          196   3e-57   
ref|XP_010676253.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    202   3e-57   
ref|XP_010248035.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    201   3e-57   
ref|XP_006363270.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       201   3e-57   
gb|KEH17174.1|  UDP-glucosyltransferase family protein                  201   3e-57   
gb|EMT31313.1|  Cytokinin-O-glucosyltransferase 2                       201   3e-57   
emb|CDO97427.1|  unnamed protein product                                198   3e-57   
ref|XP_011008544.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    201   3e-57   
gb|KFK44336.1|  hypothetical protein AALP_AA1G244800                    201   3e-57   
gb|KCW45703.1|  hypothetical protein EUGRSUZ_L005082                    196   3e-57   
ref|XP_002271368.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    201   3e-57   
ref|XP_010063161.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    201   3e-57   
ref|XP_004957723.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       201   3e-57   
ref|XP_010056398.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    201   3e-57   
ref|XP_007222664.1|  hypothetical protein PRUPE_ppa004979mg             201   3e-57   
gb|AFJ52995.1|  UDP-glycosyltransferase 1                               201   4e-57   
gb|AFJ53000.1|  UDP-glycosyltransferase 1                               201   4e-57   
gb|EAZ03912.1|  hypothetical protein OsI_26045                          201   4e-57   
ref|XP_009377940.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    201   5e-57   
ref|XP_008466222.1|  PREDICTED: UDP-glycosyltransferase 85A2            201   5e-57   
dbj|BAG80552.1|  UDP-glucose:glucosyltransferase                        201   5e-57   
ref|XP_006351766.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       201   5e-57   
emb|CDP01076.1|  unnamed protein product                                201   5e-57   
ref|XP_008373154.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       201   5e-57   
ref|XP_010064219.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    200   5e-57   
gb|KCW73113.1|  hypothetical protein EUGRSUZ_E01564                     199   5e-57   
dbj|BAG80542.1|  glycosyltransferase                                    201   6e-57   
gb|KCW70354.1|  hypothetical protein EUGRSUZ_F03599                     201   6e-57   
ref|XP_004299648.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    201   6e-57   
gb|KGN43734.1|  hypothetical protein Csa_7G063980                       201   6e-57   
ref|XP_009103242.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       201   7e-57   
ref|XP_008455190.1|  PREDICTED: UDP-glycosyltransferase 85A5-like...    201   7e-57   
ref|XP_010063162.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    201   7e-57   
dbj|BAC57706.1|  putative glucosyltransferase-2                         201   7e-57   
ref|XP_011004479.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    200   7e-57   
gb|KCW45340.1|  hypothetical protein EUGRSUZ_L00994                     200   7e-57   
gb|ABK24277.1|  unknown                                                 201   7e-57   
ref|XP_002308828.2|  hypothetical protein POPTR_0006s02330g             200   7e-57   
ref|XP_009349616.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    200   7e-57   
ref|XP_010056397.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    200   7e-57   
ref|XP_008219459.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       200   7e-57   
ref|XP_010676190.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    200   7e-57   
ref|XP_008455195.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       201   7e-57   
ref|XP_003576916.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    201   8e-57   
ref|XP_010064959.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    199   8e-57   
ref|XP_003598165.1|  Cytokinin-O-glucosyltransferase                    200   9e-57   
emb|CDY46643.1|  BnaA07g10530D                                          200   9e-57   
ref|NP_001059664.1|  Os07g0486700                                       200   9e-57   
ref|XP_002513939.1|  UDP-glucuronosyltransferase, putative              197   9e-57   
ref|XP_003575202.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    200   1e-56   
ref|XP_002530115.1|  UDP-glucuronosyltransferase, putative              200   1e-56   
ref|XP_010030926.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    204   1e-56   
ref|XP_008386105.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       200   1e-56   
ref|XP_004147933.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       197   1e-56   
ref|XP_008229481.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       200   1e-56   
ref|XP_008229740.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       200   1e-56   
ref|XP_008779905.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       199   1e-56   
ref|XP_010040275.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    199   1e-56   
ref|XP_004231354.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    199   1e-56   
ref|XP_002525851.1|  UDP-glucuronosyltransferase, putative              199   1e-56   
ref|XP_008229788.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       199   2e-56   
ref|XP_003575790.1|  PREDICTED: 7-deoxyloganetic acid glucosyltra...    199   2e-56   
ref|XP_002285770.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    199   2e-56   
dbj|BAO51844.1|  UDP-glycosyltransferase 85A28                          199   2e-56   
dbj|BAO51841.1|  UDP-glycosyltransferase 85A35                          199   2e-56   
ref|XP_010035387.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    199   2e-56   
ref|XP_002323757.2|  hypothetical protein POPTR_0017s07890g             195   2e-56   
gb|KCW66114.1|  hypothetical protein EUGRSUZ_G03386                     199   2e-56   
ref|XP_010060017.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    199   2e-56   
gb|EMT19728.1|  Cytokinin-O-glucosyltransferase 2                       196   2e-56   
ref|XP_009377942.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    199   2e-56   
ref|XP_008455233.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       199   2e-56   
ref|XP_008345260.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       194   2e-56   
gb|EAY87581.1|  hypothetical protein OsI_08991                          199   2e-56   
gb|ABK24592.1|  unknown                                                 194   2e-56   
ref|XP_008804762.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       199   3e-56   
ref|XP_010098617.1|  UDP-glycosyltransferase 85A2                       199   3e-56   
ref|XP_009380209.1|  PREDICTED: LOW QUALITY PROTEIN: 7-deoxylogan...    199   3e-56   
gb|AFK37311.1|  unknown                                                 199   3e-56   
ref|XP_008455179.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       199   3e-56   
ref|XP_010937488.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    196   3e-56   
ref|XP_009341757.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    199   3e-56   
gb|KCW70355.1|  hypothetical protein EUGRSUZ_F03601                     200   3e-56   
dbj|BAG80547.1|  glycosyltransferase                                    199   3e-56   
ref|XP_004300654.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    199   3e-56   
ref|XP_008219322.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       199   3e-56   
ref|XP_010056400.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    199   3e-56   
ref|XP_010067875.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    199   3e-56   
sp|F8WKW1.1|UGT2_GARJA  RecName: Full=7-deoxyloganetin glucosyltr...    199   3e-56   
ref|XP_010039907.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    199   3e-56   
dbj|BAO51838.1|  UDP-glycosyltransferase 85A36                          199   3e-56   
emb|CDY38225.1|  BnaC05g17420D                                          198   3e-56   
ref|XP_004975806.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       199   3e-56   
ref|XP_006363269.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       199   4e-56   
gb|EYU39132.1|  hypothetical protein MIMGU_mgv1a025300mg                194   4e-56   
gb|KFK44335.1|  hypothetical protein AALP_AA1G244700                    198   4e-56   
gb|KCW66541.1|  hypothetical protein EUGRSUZ_F00338                     198   4e-56   
ref|XP_004963489.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       199   4e-56   
ref|NP_001149205.1|  cytokinin-O-glucosyltransferase 2                  197   4e-56   
ref|NP_001048165.1|  Os02g0755900                                       198   4e-56   
gb|EEC82058.1|  hypothetical protein OsI_26044                          198   4e-56   
ref|XP_008455196.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       198   4e-56   
ref|NP_001059671.1|  Os07g0490100                                       198   4e-56   
ref|XP_011014886.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    198   4e-56   
ref|XP_006388799.1|  hypothetical protein POPTR_0098s00280g             198   5e-56   
ref|XP_010063157.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    198   5e-56   
gb|AFJ52999.1|  UDP-glycosyltransferase 1                               199   5e-56   
ref|XP_003635298.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    198   5e-56   
gb|ACF88457.1|  unknown                                                 198   5e-56   
gb|KJB74141.1|  hypothetical protein B456_011G2752001                   197   5e-56   
ref|XP_003618640.1|  Cytokinin-O-glucosyltransferase                    198   5e-56   
ref|XP_010910271.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    198   5e-56   
ref|XP_011087902.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    197   5e-56   
ref|XP_004299645.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    198   6e-56   
ref|XP_009145352.1|  PREDICTED: UDP-glycosyltransferase 85A7 isof...    197   6e-56   
ref|XP_010039828.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    198   6e-56   
ref|XP_007042950.1|  UDP-glycosyltransferase 85A1                       198   6e-56   
ref|XP_004953968.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       198   6e-56   
ref|XP_004303933.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    198   6e-56   
gb|EMS50281.1|  UDP-glycosyltransferase 85A2                            197   6e-56   
ref|XP_011009481.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    198   7e-56   
ref|XP_008359320.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       198   7e-56   
gb|KGN54319.1|  hypothetical protein Csa_4G303180                       197   7e-56   
gb|EMS59486.1|  UDP-glycosyltransferase 85A2                            198   7e-56   
gb|ABW96222.1|  glucosyltransferase                                     198   7e-56   
ref|XP_004237926.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    198   7e-56   
gb|AFJ52992.1|  UDP-glycosyltransferase 1                               198   7e-56   
gb|EYU18466.1|  hypothetical protein MIMGU_mgv1a005711mg                197   7e-56   
ref|XP_010063158.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    197   7e-56   
gb|EYU18464.1|  hypothetical protein MIMGU_mgv1a005689mg                197   8e-56   
ref|XP_006388804.1|  hypothetical protein POPTR_0098s00310g             197   8e-56   
ref|XP_004308911.1|  PREDICTED: UDP-glycosyltransferase 76F1-like       197   8e-56   
ref|XP_002530117.1|  UDP-glucuronosyltransferase, putative              196   8e-56   
ref|XP_008789349.1|  PREDICTED: UDP-glycosyltransferase 85A2-like...    197   8e-56   
ref|XP_002323187.1|  hypothetical protein POPTR_0016s02180g             197   8e-56   
ref|XP_009790488.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    197   9e-56   
ref|XP_004143462.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       197   9e-56   
ref|XP_004305884.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    197   9e-56   
ref|XP_009612740.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    197   9e-56   
ref|XP_009103240.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       197   1e-55   
ref|XP_007208223.1|  hypothetical protein PRUPE_ppa018343mg             197   1e-55   
ref|XP_008789350.1|  PREDICTED: UDP-glycosyltransferase 85A2-like...    197   1e-55   
ref|XP_009341754.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    197   1e-55   
ref|XP_004167031.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    197   1e-55   
ref|XP_004952882.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       197   1e-55   
ref|XP_006388792.1|  hypothetical protein POPTR_0098s002202g            193   1e-55   
ref|NP_001047222.2|  Os02g0577700                                       197   1e-55   
ref|XP_008342285.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       193   1e-55   
ref|XP_008789348.1|  PREDICTED: UDP-glycosyltransferase 85A2-like...    197   1e-55   
ref|XP_003618649.1|  Cytokinin-O-glucosyltransferase                    197   1e-55   
ref|XP_010267412.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    197   1e-55   



>gb|AGX93072.1| 7-deoxyloganetic acid UDP-glucosyltransferase-like protein [Catharanthus 
longifolius]
Length=482

 Score =   308 bits (790),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 142/201 (71%), Positives = 172/201 (86%), Gaps = 2/201 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED +C+  LD+Q PRSV+YVSFGSI+V+TR QL+EFWYGLVNSG++FLWVMR D + GKD
Sbjct  280  EDRSCVDWLDAQPPRSVLYVSFGSITVVTRDQLLEFWYGLVNSGQRFLWVMRPDSIMGKD  339

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
             + S IP++L+EGTKA GY+VGWAPQE VL+H A+GGFLTHSGWNSTLESI AGVPMICW
Sbjct  340  GQ-SQIPADLEEGTKARGYMVGWAPQEEVLNHPAIGGFLTHSGWNSTLESIVAGVPMICW  398

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P+FADQ  NSRFV E+WK+GLDMKD CDR ++ +++RELME RK EFL+RA++M KLAKE
Sbjct  399  PYFADQMINSRFVSEIWKIGLDMKDTCDRETIMKMVRELMEIRKDEFLQRADHMAKLAKE  458

Query  259  AISEGGSSYCNFDCLIQDMIK  197
            A+SEGGSSY N D L+ D IK
Sbjct  459  AVSEGGSSYSNLDGLV-DYIK  478



>sp|U3U992.1|UGT8_CATRO RecName: Full=7-deoxyloganetic acid glucosyltransferase; AltName: 
Full=UDP-glucose glucosyltransferase 8; Short=CrUGT8; AltName: 
Full=UDP-glycosyltransferase 709C2 [Catharanthus roseus]
 dbj|BAO01109.1| UDP-glucose iridoid glucosyltransferase [Catharanthus roseus]
Length=482

 Score =   308 bits (790),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 142/201 (71%), Positives = 172/201 (86%), Gaps = 2/201 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED +C+  LD+Q PRSV+YVSFGSI+V+TR QL+EFWYGLVNSG++FLWVMR D + GKD
Sbjct  280  EDRSCVDWLDAQPPRSVLYVSFGSITVVTRDQLLEFWYGLVNSGQRFLWVMRPDSIMGKD  339

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
             + S IP++L+EGTKA GY+VGWAPQE VL+H A+GGFLTHSGWNSTLESI AGVPMICW
Sbjct  340  GQ-SQIPADLEEGTKARGYMVGWAPQEEVLNHPAIGGFLTHSGWNSTLESIVAGVPMICW  398

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P+FADQ  NSRFV E+WK+GLDMKD CDR ++ +++RELME RK EFL+RA++M KLAKE
Sbjct  399  PYFADQMINSRFVSEIWKIGLDMKDTCDRETIVKMVRELMEIRKDEFLQRADHMAKLAKE  458

Query  259  AISEGGSSYCNFDCLIQDMIK  197
            A+SEGGSSY N D L+ D IK
Sbjct  459  AVSEGGSSYSNLDGLV-DYIK  478



>gb|AGX93065.1| 7-deoxyloganetic acid UDP-glucosyltransferase [Catharanthus roseus]
 gb|AGX93073.1| 7-deoxyloganetic acid UDP-glucosyltransferase-like protein [Catharanthus 
ovalis]
 gb|AHK60835.1| 7-deoxyloganetic acid-O-glucosyl transferase [Catharanthus roseus]
Length=482

 Score =   308 bits (789),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 142/201 (71%), Positives = 172/201 (86%), Gaps = 2/201 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED +C+  LD+Q PRSV+YVSFGSI+V+TR QL+EFWYGLVNSG++FLWVMR D + GKD
Sbjct  280  EDRSCVDWLDAQPPRSVLYVSFGSITVVTRDQLLEFWYGLVNSGQRFLWVMRPDSIMGKD  339

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
             + S IP++L+EGTKA GY+VGWAPQE VL+H A+GGFLTHSGWNSTLESI AGVPMICW
Sbjct  340  GQ-SQIPADLEEGTKARGYMVGWAPQEEVLNHPAIGGFLTHSGWNSTLESIVAGVPMICW  398

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P+FADQ  NSRFV E+WK+GLDMKD CDR ++ +++RELME RK EFL+RA++M KLAKE
Sbjct  399  PYFADQMINSRFVSEIWKIGLDMKDTCDRETIVKMVRELMEIRKDEFLQRADHMAKLAKE  458

Query  259  AISEGGSSYCNFDCLIQDMIK  197
            A+SEGGSSY N D L+ D IK
Sbjct  459  AVSEGGSSYSNLDGLV-DYIK  478



>gb|AGX93066.1| 7-deoxyloganetic acid UDP-glucosyltransferase-like protein [Lonicera 
japonica]
Length=489

 Score =   307 bits (786),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 141/197 (72%), Positives = 170/197 (86%), Gaps = 1/197 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED TC+  L+SQ+P+SVIYVSFGSI+V+TR QL+EFWYGLVNSG+KFLWVMR D +AGK+
Sbjct  287  EDRTCVDWLNSQQPKSVIYVSFGSITVVTRGQLLEFWYGLVNSGQKFLWVMRPDSIAGKE  346

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
             E S IP EL+EGTKA G++VGWAPQE VLDH A+GGF THSGWNSTLES+ AGVPMICW
Sbjct  347  GE-SQIPVELEEGTKARGFMVGWAPQEEVLDHPAIGGFFTHSGWNSTLESVYAGVPMICW  405

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P+FADQ  NSRFVGEVWK+GLDMKD CDR ++E+++RELME RK E+LERA  M  LAK+
Sbjct  406  PYFADQMINSRFVGEVWKLGLDMKDSCDRITIEKMVRELMEVRKDEYLERAGQMAALAKK  465

Query  259  AISEGGSSYCNFDCLIQ  209
            ++SEGGSSYCN D +++
Sbjct  466  SVSEGGSSYCNLDRMVE  482



>gb|AGX93069.1| 7-deoxyloganetic acid UDP-glucosyltransferase-like protein [Rauvolfia 
serpentina]
Length=482

 Score =   302 bits (773),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 136/197 (69%), Positives = 165/197 (84%), Gaps = 1/197 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED +C+  LDSQ PRSV+YVSFGSI+V+TR QL+EFW+GLV+SG++FLWVMR D + GKD
Sbjct  280  EDRSCVDWLDSQPPRSVLYVSFGSITVVTRDQLLEFWHGLVDSGQRFLWVMRPDSILGKD  339

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
             E   IP EL+EGT+A GY+VGWAPQE VL H A+GGFLTHSGWNSTLESI  GVPMICW
Sbjct  340  GENQ-IPPELEEGTRARGYMVGWAPQEEVLYHPAIGGFLTHSGWNSTLESIVVGVPMICW  398

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P+FADQ  NSRFV E+WK+GLDMKD CDR ++ +++RELME RK EFL+RA+ M KLA+ 
Sbjct  399  PYFADQMINSRFVSELWKIGLDMKDTCDRDTIVKMVRELMEHRKDEFLQRADQMAKLARM  458

Query  259  AISEGGSSYCNFDCLIQ  209
            A+SEGGSSYCN D L++
Sbjct  459  AVSEGGSSYCNLDGLVE  475



>gb|AGX93070.1| 7-deoxyloganetic acid UDP-glucosyltransferase-like protein [Tabernaemontana 
elegans]
Length=482

 Score =   298 bits (763),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 137/203 (67%), Positives = 169/203 (83%), Gaps = 2/203 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED +C+  LDSQ PRSV+YVSFGSI+V+T  QL+EFW+GLVNSG++FLWVMR D + GKD
Sbjct  280  EDRSCVDWLDSQPPRSVLYVSFGSITVVTSDQLLEFWHGLVNSGQRFLWVMRPDSIMGKD  339

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
             + S IP+EL+EGTKA GY+VGWAPQE VL+H A+GGFLTHSGWNSTLESI AGVPMICW
Sbjct  340  GK-SRIPAELEEGTKARGYMVGWAPQEEVLNHPAIGGFLTHSGWNSTLESIVAGVPMICW  398

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P+FADQ  NSRFV E+WK+GLDMKD CDR ++E++++ELM  RK EFL+RA++M KLA+ 
Sbjct  399  PYFADQMINSRFVSEIWKIGLDMKDTCDRDTIEKIVKELMVVRKDEFLQRADHMAKLARG  458

Query  259  AISEGGSSYCNFDCLIQDMIKVN  191
            A+ EGGSSY N D L+ D I+  
Sbjct  459  AVREGGSSYSNLDGLV-DYIRTT  480



>gb|AGX93068.1| 7-deoxyloganetic acid UDP-glucosyltransferase-like protein [Amsonia 
hubrichtii]
Length=482

 Score =   297 bits (761),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 131/197 (66%), Positives = 169/197 (86%), Gaps = 1/197 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED +C+  LD+Q P+SV+YVSFGSI+V+TR QL+EFW+GLVNSG++FLWVMR D + G+D
Sbjct  280  EDRSCVDWLDAQPPKSVLYVSFGSITVVTRDQLLEFWHGLVNSGQRFLWVMRPDSIMGED  339

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
             + S IP+EL+EGTKA GY+VGWAPQE VL+H A+GGF THSGWNSTLESI +GVPMICW
Sbjct  340  GK-SQIPAELEEGTKARGYMVGWAPQEEVLNHPAIGGFFTHSGWNSTLESIVSGVPMICW  398

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P+FADQ  NSRFV E+WK+GLDMKD CDR ++E+++RELME RK EFL+R++++ KLA++
Sbjct  399  PYFADQMINSRFVSEIWKIGLDMKDTCDRDAIEKMVRELMEVRKDEFLQRSDHIAKLARK  458

Query  259  AISEGGSSYCNFDCLIQ  209
            A+ EGGSSY N D L++
Sbjct  459  AVGEGGSSYANLDGLVE  475



>gb|AGX93071.1| 7-deoxyloganetic acid UDP-glucosyltransferase-like protein [Vinca 
minor]
Length=482

 Score =   295 bits (756),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 133/197 (68%), Positives = 162/197 (82%), Gaps = 1/197 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED +C+  LDSQ PRSV+YVSFGSI+V+TR QL+EFW+GLVNSG +FLWVMR D + GKD
Sbjct  280  EDRSCVDWLDSQPPRSVLYVSFGSITVVTRAQLLEFWHGLVNSGHRFLWVMRPDSIMGKD  339

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
             E   +P EL+EGTK  GY+VGWAPQE VL+H A+GGF TH GWNSTLESI AGVPMICW
Sbjct  340  GENR-VPHELEEGTKERGYMVGWAPQEEVLNHSAIGGFFTHCGWNSTLESIVAGVPMICW  398

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P+FADQ  NSRFV E+WK+GLDMKD CDR  + +++RELME +K EF+ERA+ M KLA++
Sbjct  399  PYFADQMINSRFVSEIWKIGLDMKDSCDREIIVKMVRELMEVKKDEFMERADEMAKLARK  458

Query  259  AISEGGSSYCNFDCLIQ  209
            A+SEGGSSY N D L++
Sbjct  459  AVSEGGSSYSNLDALVE  475



>gb|AGX93067.1| 7-deoxyloganetic acid UDP-glucosyltransferase-like protein [Cinchona 
calisaya]
Length=483

 Score =   291 bits (746),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 132/197 (67%), Positives = 166/197 (84%), Gaps = 1/197 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED +C+  L+SQ P+SVIYVSFGSI+V+TR+QL+EFW GLVNSG++FLWVMR D + GKD
Sbjct  281  EDRSCIEWLNSQPPKSVIYVSFGSITVVTREQLLEFWCGLVNSGQRFLWVMRPDSLMGKD  340

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
             E S IP+EL++GTK  GY+VGWAPQE VL+H A+GGF THSGWNSTLESI  GVPMICW
Sbjct  341  GE-SQIPAELEKGTKERGYMVGWAPQEEVLNHSAIGGFFTHSGWNSTLESIVTGVPMICW  399

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P+FADQ  NSRFV EVWK+GLDMKD CDR  +E+++R+LM+ RK EF +RA++M KLA++
Sbjct  400  PYFADQMINSRFVSEVWKIGLDMKDTCDRIIIEKMVRDLMDVRKDEFSQRADDMAKLARK  459

Query  259  AISEGGSSYCNFDCLIQ  209
            A++EGGSSY N D L++
Sbjct  460  AVNEGGSSYQNLDALVE  476



>ref|XP_004235055.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Solanum 
lycopersicum]
Length=468

 Score =   290 bits (741),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 131/199 (66%), Positives = 164/199 (82%), Gaps = 1/199 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            EDE+CM+ LD+Q P+SVIYVSFGS++ +T+++L+EFWYG+VNS +KFLWVMR DL+ G++
Sbjct  261  EDESCMSWLDTQPPKSVIYVSFGSVAGLTKEELLEFWYGIVNSEQKFLWVMRPDLIIGQE  320

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
             ++  IP EL++GTKA GY+  W PQE VL H A+GGFLTHSGWNSTLESI  GVPMICW
Sbjct  321  RKDE-IPVELEQGTKARGYMADWVPQEKVLAHRAIGGFLTHSGWNSTLESIVEGVPMICW  379

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P FADQQ NSRFVGEVWK+GLD+KD CDR  + + I +LMEKR GEF +R ENM  LAK+
Sbjct  380  PRFADQQVNSRFVGEVWKMGLDIKDTCDRDIIAKSITDLMEKRNGEFSQRTENMASLAKK  439

Query  259  AISEGGSSYCNFDCLIQDM  203
            A++EGGSSY N D L+QD+
Sbjct  440  AVNEGGSSYINLDRLMQDI  458



>ref|XP_006361975.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Solanum tuberosum]
Length=470

 Score =   288 bits (738),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 132/199 (66%), Positives = 164/199 (82%), Gaps = 1/199 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            EDE+ M+ LD+Q P+SVIYVSFGS++ +T+++L+EFWYGLVNS +KFLWVMR DL+ G++
Sbjct  211  EDESWMSWLDTQPPKSVIYVSFGSVAGLTKEELLEFWYGLVNSEQKFLWVMRPDLIIGRE  270

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
             ++  IP EL++GTKA GY+  W PQE VL H A+GGFLTHSGWNSTLESI  GVPMICW
Sbjct  271  KKDE-IPVELEQGTKARGYMADWVPQEKVLAHRAIGGFLTHSGWNSTLESIVEGVPMICW  329

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P FADQQ NSRFVGEVWK+GLD+KD CDR  + + IR+LMEKR GEF +R E+M  LAK+
Sbjct  330  PRFADQQVNSRFVGEVWKMGLDIKDTCDRDIIAKSIRDLMEKRNGEFSQRTEHMASLAKK  389

Query  259  AISEGGSSYCNFDCLIQDM  203
            A++EGGSSY N D LIQD+
Sbjct  390  AVNEGGSSYINLDRLIQDI  408



>ref|XP_010318075.1| PREDICTED: LOW QUALITY PROTEIN: 7-deoxyloganetic acid glucosyltransferase-like 
[Solanum lycopersicum]
Length=469

 Score =   286 bits (733),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 134/202 (66%), Positives = 164/202 (81%), Gaps = 1/202 (0%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            EDE+CM+ LD+Q P+SVIYVSFGSI+ +T+++L+EF YGLVNS +KFLWVMRSDL+ G++
Sbjct  262  EDESCMSWLDTQPPKSVIYVSFGSIAGLTKEELLEFXYGLVNSEQKFLWVMRSDLIIGQE  321

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
             ++  IP EL++GTKA GY+  W PQE VL H A+GGFLTHSGWNSTLESI  GVPMICW
Sbjct  322  RKDE-IPVELEQGTKARGYMADWVPQEKVLAHKAIGGFLTHSGWNSTLESIVEGVPMICW  380

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P FADQQ NSRF+GEVWK+GLD+KD CDR  + + +RELMEKR GEF +R E M  LAK+
Sbjct  381  PRFADQQVNSRFIGEVWKMGLDIKDTCDRDIIAKSVRELMEKRNGEFSQRTEQMASLAKK  440

Query  259  AISEGGSSYCNFDCLIQDMIKV  194
            AI+EGGSS  N D LIQD+  V
Sbjct  441  AINEGGSSCINLDRLIQDIRSV  462



>ref|XP_002276555.2| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Vitis 
vinifera]
Length=509

 Score =   288 bits (736),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 128/199 (64%), Positives = 164/199 (82%), Gaps = 1/199 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED++C+  LD Q P+SVIYVSFGS+++IT+ +L EFW+GLVNSG +FLWV+R D + GKD
Sbjct  304  EDKSCILWLDRQPPKSVIYVSFGSLAIITKDELREFWHGLVNSGSRFLWVIRPDALVGKD  363

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
             EE   P+EL EGTK  GY+VGWAPQE VL H AVGGFLTHSGWNSTLESI AG+PMICW
Sbjct  364  -EERQTPAELLEGTKDRGYVVGWAPQEEVLQHPAVGGFLTHSGWNSTLESIIAGLPMICW  422

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P+FADQQ NSRFV  VWK+G+DMKD CDR +VE+++R+LME+++ EF++ A+ M   AK+
Sbjct  423  PYFADQQINSRFVSHVWKLGMDMKDTCDRVTVEKMVRDLMEEKRAEFMKAADTMATSAKK  482

Query  259  AISEGGSSYCNFDCLIQDM  203
            ++SEGGSSYCN   LI+++
Sbjct  483  SVSEGGSSYCNLGSLIEEI  501



>ref|XP_010277669.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nelumbo 
nucifera]
Length=497

 Score =   286 bits (731),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 135/199 (68%), Positives = 167/199 (84%), Gaps = 1/199 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            E+++C+  LDS+  RSV+YVSFGSI+V+TR+++MEFW+GLVNSGK FLWV+R DL+AGK+
Sbjct  288  ENKSCIRWLDSKPLRSVVYVSFGSITVMTREEIMEFWHGLVNSGKWFLWVIRPDLLAGKE  347

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
             E+  I +EL EGT+  GYIVGWAPQE VL H AVGGFLTHSGWNSTLESI AGVPMICW
Sbjct  348  GEDQ-ILTELVEGTRERGYIVGWAPQEEVLAHPAVGGFLTHSGWNSTLESICAGVPMICW  406

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P+FADQQ NSRFV EVWK+GLDMKD CDR  VE +++ELMEK+  E L+ A+ M KLA+ 
Sbjct  407  PYFADQQVNSRFVSEVWKLGLDMKDTCDRWKVELMVKELMEKKMDEMLKSADKMAKLARM  466

Query  259  AISEGGSSYCNFDCLIQDM  203
            ++SEGGSS CN+D LI+D+
Sbjct  467  SVSEGGSSSCNWDKLIKDI  485



>ref|XP_007158356.1| hypothetical protein PHAVU_002G145900g [Phaseolus vulgaris]
 gb|ESW30350.1| hypothetical protein PHAVU_002G145900g [Phaseolus vulgaris]
Length=484

 Score =   285 bits (730),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 131/196 (67%), Positives = 162/196 (83%), Gaps = 1/196 (1%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D +C+  LDSQ  +SV+YVSFGSI+ ITR++LMEFWYGLVNS K+FLWV+R D+VAG+D+
Sbjct  280  DRSCLTWLDSQPLKSVLYVSFGSITTITRERLMEFWYGLVNSKKRFLWVIRPDMVAGEDN  339

Query  616  EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWP  437
             +  +P+EL+EGTK  G+IVGWAPQE VL+H A+GGFLTHSGWNSTLES+ AGVPMICWP
Sbjct  340  NDR-VPAELEEGTKERGFIVGWAPQEEVLEHKAIGGFLTHSGWNSTLESVVAGVPMICWP  398

Query  436  FFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKEA  257
            +FADQQ NSRFV EVWKVGLDMKDVCDR  VE+++ +LM  R+ EFL  A+ M KLA ++
Sbjct  399  YFADQQINSRFVSEVWKVGLDMKDVCDRDVVEKMVNDLMVHRREEFLNSAKAMAKLAHKS  458

Query  256  ISEGGSSYCNFDCLIQ  209
            +S GGSSY +   LIQ
Sbjct  459  VSPGGSSYSSLLDLIQ  474



>ref|XP_011076757.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Sesamum 
indicum]
Length=489

 Score =   285 bits (729),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/206 (66%), Positives = 158/206 (77%), Gaps = 0/206 (0%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED +C++ LD+Q  +SVIYVS GS++VIT+ QL E W+GLVNSG +FLWV R   V G D
Sbjct  281  EDSSCISWLDTQPSKSVIYVSIGSLAVITKDQLFEIWHGLVNSGSRFLWVRRPGSVTGLD  340

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
             E   IPSEL  GTK  GYIV WAPQ+ VL H A+GGFLTHSGWNSTLESI  G PMICW
Sbjct  341  SETEEIPSELSRGTKERGYIVTWAPQDEVLGHPAIGGFLTHSGWNSTLESIVEGKPMICW  400

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P+F DQQ NSR+VGEVWK+GLDMKD CDR  VE++IRELME RK EFLERA+ M KLAK 
Sbjct  401  PYFVDQQVNSRYVGEVWKLGLDMKDTCDRVVVEKMIRELMESRKNEFLERADEMAKLAKA  460

Query  259  AISEGGSSYCNFDCLIQDMIKVNEAT  182
            ++SEGGSSY + D LI D+  +N  T
Sbjct  461  SVSEGGSSYADLDRLIDDIKFMNIPT  486



>emb|CDP14405.1| unnamed protein product [Coffea canephora]
Length=345

 Score =   279 bits (713),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 131/189 (69%), Positives = 157/189 (83%), Gaps = 1/189 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED +C+  L+SQ  +SVIYVSFGS++++TR +L+EFWYGLVNSG+ FLWVMR D V GKD
Sbjct  155  EDRSCIEWLNSQPDKSVIYVSFGSVTIMTRDELLEFWYGLVNSGQMFLWVMRPDSVIGKD  214

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
               S +P E++EGTKA GYIVGWAPQE VL H A GGFLTH GWNSTLESI AG+PMICW
Sbjct  215  GV-SHLPVEIEEGTKARGYIVGWAPQEEVLAHPATGGFLTHCGWNSTLESINAGIPMICW  273

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P+FADQ  NSRFV EVWK+GLDMKD CDR +VE ++R+LME RK EFL++AE+M  LAK+
Sbjct  274  PYFADQTINSRFVDEVWKLGLDMKDTCDRVTVEIMVRDLMEVRKDEFLKKAEHMANLAKK  333

Query  259  AISEGGSSY  233
            A+SEGGSSY
Sbjct  334  AVSEGGSSY  342



>ref|XP_006379614.1| hypothetical protein POPTR_0008s06270g [Populus trichocarpa]
 gb|ERP57411.1| hypothetical protein POPTR_0008s06270g [Populus trichocarpa]
Length=365

 Score =   279 bits (714),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 158/198 (80%), Gaps = 0/198 (0%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D +CM  LD+Q  +SV+YVSFGS +V+TR QL+EFWYGLV+S K+FLWV+R D +A KD 
Sbjct  158  DRSCMTWLDNQPEKSVLYVSFGSFTVMTRHQLLEFWYGLVSSKKRFLWVIRPDSIATKDG  217

Query  616  EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWP  437
            E   IP E++EGTK  G+I GW PQE VL H A+ GFLTHSGWNSTLESI AGVPMICWP
Sbjct  218  EFEKIPVEVEEGTKERGFIAGWVPQEEVLAHKAIAGFLTHSGWNSTLESIVAGVPMICWP  277

Query  436  FFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKEA  257
            +FADQQ NSRFVGEVWK+GLDMKD CDR  VE+++ +LM +R+ EF+  A  M +L++++
Sbjct  278  YFADQQVNSRFVGEVWKLGLDMKDQCDREIVEKMVNDLMVERREEFVRSATRMAELSRKS  337

Query  256  ISEGGSSYCNFDCLIQDM  203
            + EGGSSYCN + LI+D+
Sbjct  338  VREGGSSYCNLNRLIEDI  355



>ref|XP_007009133.1| UDP-glucosyltransferase family 1 protein [Theobroma cacao]
 gb|EOY17943.1| UDP-glucosyltransferase family 1 protein [Theobroma cacao]
Length=481

 Score =   280 bits (717),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/198 (65%), Positives = 158/198 (80%), Gaps = 0/198 (0%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D  C++ LD Q  +SV+YVSFGSI++ +R+QL E WYGLVNS ++FLWV+R + V GKD 
Sbjct  276  DRNCISWLDKQPKQSVVYVSFGSITIPSREQLTELWYGLVNSKRRFLWVVRPNSVTGKDG  335

Query  616  EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWP  437
            +   +P EL EGTK  G IVGWAPQE VL+H AVGGFLTHSGWNSTLES+ AGVPMICWP
Sbjct  336  QGEDVPVELLEGTKERGCIVGWAPQEEVLNHPAVGGFLTHSGWNSTLESVVAGVPMICWP  395

Query  436  FFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKEA  257
            +FADQQ NSRFV EVWK+GLDMKDVCDR  VE+++ +LM  R+ EF++ A  M KLAKE+
Sbjct  396  YFADQQVNSRFVSEVWKLGLDMKDVCDRKVVEKMVNDLMMDRREEFVKSAAEMAKLAKES  455

Query  256  ISEGGSSYCNFDCLIQDM  203
            ++ GGSSYCN D LI+D+
Sbjct  456  VNVGGSSYCNLDRLIEDI  473



>ref|XP_011100060.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Sesamum 
indicum]
Length=493

 Score =   281 bits (718),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/197 (65%), Positives = 161/197 (82%), Gaps = 1/197 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED + M+ LDSQ P+SV+YVSFGS++++TR +L+EFWYGLVNSG KFLWVMR D + G D
Sbjct  292  EDRSSMSWLDSQPPKSVLYVSFGSVTLLTRDELLEFWYGLVNSGHKFLWVMRPDSIVG-D  350

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
            ++++PIP+EL+E TK  GY+VGW PQ  VL H +VG F THSGWNSTLE IAA +PMICW
Sbjct  351  NKDNPIPAELEEATKERGYLVGWVPQNEVLAHPSVGAFFTHSGWNSTLEGIAAVMPMICW  410

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P+FADQ  NSRFV EVWKVGLDMKD CDR  VE+ +R++ME R+ EFLERA +M +LAK+
Sbjct  411  PYFADQTINSRFVSEVWKVGLDMKDSCDRVIVEKTVRDIMEVRRDEFLERALHMAELAKK  470

Query  259  AISEGGSSYCNFDCLIQ  209
            +ISEGG+SY N + LI+
Sbjct  471  SISEGGTSYTNLNRLIE  487



>gb|EYU19962.1| hypothetical protein MIMGU_mgv1a005720mg [Erythranthe guttata]
Length=473

 Score =   280 bits (716),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 132/199 (66%), Positives = 156/199 (78%), Gaps = 5/199 (3%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED TCM  LDSQ P+SVIYVSFGS++V+T  QLMEFWYGLVNSG+KFLWV+R D ++G +
Sbjct  274  EDRTCMTWLDSQPPKSVIYVSFGSLAVMTNDQLMEFWYGLVNSGQKFLWVIRPDSISGYE  333

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
                 IP EL +GT+  GYIVGWAPQE VL H AVGGFLTHSGWNSTLES+  GVPMICW
Sbjct  334  -----IPVELSQGTRERGYIVGWAPQEEVLAHRAVGGFLTHSGWNSTLESVYEGVPMICW  388

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P+F DQQ NSR V E WK+GLDMKD CDRS +E+ I+ LME RK EFL RA++M K AK 
Sbjct  389  PYFMDQQVNSRLVEEEWKLGLDMKDTCDRSLIEKTIKNLMEVRKDEFLLRADDMAKSAKT  448

Query  259  AISEGGSSYCNFDCLIQDM  203
            +++EGGSS+ N   LI D+
Sbjct  449  SLTEGGSSFSNLKRLIDDI  467



>gb|AIE12477.1| UGT4 [Panax ginseng]
Length=478

 Score =   280 bits (716),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 129/199 (65%), Positives = 161/199 (81%), Gaps = 4/199 (2%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED++C+  LDSQ P+SVIYVSFGS++++TR QLMEFW+GLVNSG KFLWV+R D VAG  
Sbjct  277  EDKSCITWLDSQPPKSVIYVSFGSLAIMTRDQLMEFWHGLVNSGCKFLWVIRPDSVAG--  334

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
              +S IP+E+ EGTK  GYIVGWAPQE VL H +VGGFLTHSGWNSTLES+  G PMICW
Sbjct  335  --DSQIPAEVAEGTKERGYIVGWAPQEEVLAHPSVGGFLTHSGWNSTLESVIEGKPMICW  392

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P+F DQQ NSRFV E WK+GLDMKD CDR   E+++++LM +R+ EF++ A+ M +L K+
Sbjct  393  PYFMDQQVNSRFVEEFWKLGLDMKDTCDRVIFEKMVKDLMVERRDEFMKSADQMARLGKK  452

Query  259  AISEGGSSYCNFDCLIQDM  203
             +SEGGSSYCN D LI+D+
Sbjct  453  CLSEGGSSYCNLDRLIEDI  471



>ref|XP_007009132.1| UDP-glucosyltransferase family 1 protein [Theobroma cacao]
 gb|EOY17942.1| UDP-glucosyltransferase family 1 protein [Theobroma cacao]
Length=482

 Score =   279 bits (714),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 129/202 (64%), Positives = 161/202 (80%), Gaps = 0/202 (0%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D +CM+ LD Q  +SV+YVSFGSI+V++ +Q+MEFW+GLVNS ++FLWV+R D VAGK  
Sbjct  276  DRSCMSWLDRQPNQSVVYVSFGSIAVMSDEQIMEFWHGLVNSKRRFLWVVRPDSVAGKGF  335

Query  616  EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWP  437
            +    P EL EGTK  GYIVGWA QE VL H AVGGFLTHSGWNST+ESI AGVPM+CWP
Sbjct  336  QGEDTPKELVEGTKDRGYIVGWAAQEEVLSHRAVGGFLTHSGWNSTMESIVAGVPMLCWP  395

Query  436  FFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKEA  257
            +FADQQ NSRFVGEVWK+G+DMKDVCDR  VE+++ +LM +RK EF++ A  M  LAK+ 
Sbjct  396  YFADQQLNSRFVGEVWKLGIDMKDVCDRKVVEKMVNDLMVERKDEFVKSAAAMASLAKDC  455

Query  256  ISEGGSSYCNFDCLIQDMIKVN  191
            +S GG SYCNFD LI+D+  ++
Sbjct  456  VSVGGPSYCNFDRLIEDIKTIS  477



>ref|XP_008467017.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Cucumis melo]
Length=304

 Score =   273 bits (698),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 126/198 (64%), Positives = 156/198 (79%), Gaps = 1/198 (1%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D TC+A LD+Q P SVIYVSFGSI+V+  + LMEFW+GLVNSG+ FLWV+R DLV+GK+ 
Sbjct  101  DRTCLAWLDNQPPGSVIYVSFGSITVMGNEGLMEFWHGLVNSGRNFLWVIRPDLVSGKNG  160

Query  616  EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWP  437
            E   IP+EL+EGTK  GY+VGWAPQE VL H AVGGFLTHSGWNSTLESI AG PM+CWP
Sbjct  161  EIE-IPAELEEGTKQRGYVVGWAPQEKVLSHEAVGGFLTHSGWNSTLESIVAGKPMVCWP  219

Query  436  FFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKEA  257
            + ADQQ NSRFV  VWK+G+DMKD+CDR  V +++ E+M  RK EF+  A  M  LA+ +
Sbjct  220  YTADQQVNSRFVSNVWKLGVDMKDLCDRDIVAKMVNEIMVNRKEEFMRTASEMANLARRS  279

Query  256  ISEGGSSYCNFDCLIQDM  203
            +S GGSSY +FD L+ ++
Sbjct  280  VSPGGSSYADFDRLVNEI  297



>emb|CDP19643.1| unnamed protein product [Coffea canephora]
Length=460

 Score =   278 bits (711),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 123/197 (62%), Positives = 160/197 (81%), Gaps = 1/197 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED +C+  LDSQ P+SVIYVSFGSI+++ R+QL+EFWYGLVNSG++FLWV+R D + G+ 
Sbjct  258  EDRSCLDWLDSQPPKSVIYVSFGSITIVRREQLLEFWYGLVNSGQRFLWVVRPDSIMGEA  317

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
                 IP+EL+  TKA GY+VGWAPQ  VL+H +VGGFLTH GWNSTLES+AAGVPM+CW
Sbjct  318  GG-GKIPAELETATKARGYMVGWAPQLEVLNHPSVGGFLTHGGWNSTLESMAAGVPMLCW  376

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P+FADQ  NSRFV E+WK+GLDMKD CDR  +++++ ELM  RK EFL RA+ M KLA++
Sbjct  377  PYFADQTINSRFVSEIWKIGLDMKDTCDRVIIQKMVAELMHARKDEFLRRADAMAKLARK  436

Query  259  AISEGGSSYCNFDCLIQ  209
            A+++GG+SY N D L++
Sbjct  437  AVTQGGTSYNNLDSLVE  453



>ref|XP_006379615.1| hypothetical protein POPTR_0008s06270g [Populus trichocarpa]
 gb|ERP57412.1| hypothetical protein POPTR_0008s06270g [Populus trichocarpa]
Length=481

 Score =   278 bits (711),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 158/198 (80%), Gaps = 0/198 (0%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D +CM  LD+Q  +SV+YVSFGS +V+TR QL+EFWYGLV+S K+FLWV+R D +A KD 
Sbjct  274  DRSCMTWLDNQPEKSVLYVSFGSFTVMTRHQLLEFWYGLVSSKKRFLWVIRPDSIATKDG  333

Query  616  EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWP  437
            E   IP E++EGTK  G+I GW PQE VL H A+ GFLTHSGWNSTLESI AGVPMICWP
Sbjct  334  EFEKIPVEVEEGTKERGFIAGWVPQEEVLAHKAIAGFLTHSGWNSTLESIVAGVPMICWP  393

Query  436  FFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKEA  257
            +FADQQ NSRFVGEVWK+GLDMKD CDR  VE+++ +LM +R+ EF+  A  M +L++++
Sbjct  394  YFADQQVNSRFVGEVWKLGLDMKDQCDREIVEKMVNDLMVERREEFVRSATRMAELSRKS  453

Query  256  ISEGGSSYCNFDCLIQDM  203
            + EGGSSYCN + LI+D+
Sbjct  454  VREGGSSYCNLNRLIEDI  471



>ref|XP_002281029.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase [Vitis vinifera]
Length=475

 Score =   277 bits (709),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 128/199 (64%), Positives = 160/199 (80%), Gaps = 1/199 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED+ C+  LD Q  +SVIYVSFGS++VIT+++LMEFW+GLVNSG +FLWV+R D +  KD
Sbjct  273  EDKRCIPWLDRQPSKSVIYVSFGSLTVITKEELMEFWHGLVNSGSRFLWVIRPDSLTEKD  332

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
             E  P P++L E TK  G IVGW PQE VL H AVGGFLT+SGWNST+ESI AGVPMICW
Sbjct  333  GEFQP-PAQLWEVTKERGQIVGWVPQEEVLAHPAVGGFLTYSGWNSTIESIFAGVPMICW  391

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P+FADQQ NSRFV  VWK+G+DMKD CDR ++E+++R+LMEKR+ EF + AE M KLA+ 
Sbjct  392  PYFADQQVNSRFVSHVWKLGMDMKDTCDRVTIEKMVRDLMEKRRTEFTKSAEAMAKLARS  451

Query  259  AISEGGSSYCNFDCLIQDM  203
            ++SEGGSSYCNF  LI+ +
Sbjct  452  SLSEGGSSYCNFSRLIESI  470



>ref|XP_011038346.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Populus 
euphratica]
Length=481

 Score =   277 bits (709),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 124/198 (63%), Positives = 159/198 (80%), Gaps = 0/198 (0%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D +CM  LD+Q  +SV+YVSFGSI+V+TR QL+EFWYGLV+S K+FLWV+R D +A K+ 
Sbjct  274  DRSCMTWLDNQPEKSVLYVSFGSITVMTRHQLLEFWYGLVSSKKRFLWVIRPDSIATKNG  333

Query  616  EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWP  437
            E   IP E++EGT+  G+I GW PQE VL H A+ GFLTHSGWNSTLESI AGVPMICWP
Sbjct  334  EFEKIPVEVEEGTRDRGFIAGWVPQEEVLAHKAIAGFLTHSGWNSTLESIVAGVPMICWP  393

Query  436  FFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKEA  257
            +FADQQ NSRFVGEVWK+GLDMKD CDR  VE+++ +LM +R+ EF+  A  M +L++++
Sbjct  394  YFADQQVNSRFVGEVWKLGLDMKDQCDREIVEKMVNDLMVERREEFVRSATRMAELSRKS  453

Query  256  ISEGGSSYCNFDCLIQDM  203
            + EGGSSYCN + LI+D+
Sbjct  454  VREGGSSYCNLNRLIEDI  471



>ref|XP_011084978.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Sesamum 
indicum]
Length=499

 Score =   278 bits (710),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 127/198 (64%), Positives = 160/198 (81%), Gaps = 1/198 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED+ C+A LDSQ   SVIYVSFGS++++TR +L+EFWYGLVNSG +FLWV+R D + G D
Sbjct  295  EDQNCIAWLDSQPASSVIYVSFGSVTILTRDELLEFWYGLVNSGHRFLWVIRPDSIIGND  354

Query  619  DEE-SPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMIC  443
            +   + IP EL+EGTK+ GY+VGW PQ+ VL H A+G F THSGWNSTLESI  G+PM+C
Sbjct  355  NGNGNEIPVELEEGTKSRGYMVGWVPQQQVLAHPAIGAFFTHSGWNSTLESITLGLPMLC  414

Query  442  WPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAK  263
            W +FADQ TNSRFV EVWKVGLDMKD CDR  VE++++E+ME R+ EFLERA++M  LA+
Sbjct  415  WAYFADQITNSRFVSEVWKVGLDMKDTCDRIIVEKMVKEVMEVRREEFLERADSMATLAR  474

Query  262  EAISEGGSSYCNFDCLIQ  209
            +AISEGGSSY N + LI+
Sbjct  475  KAISEGGSSYLNLNGLIE  492



>ref|XP_002280624.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase [Vitis vinifera]
Length=479

 Score =   276 bits (707),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 160/199 (80%), Gaps = 1/199 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED++C+  LD Q P+SVIYVSFGS+++IT+ +L EFW+GLVNSG +FLWV+R D + GKD
Sbjct  277  EDKSCIPWLDRQPPKSVIYVSFGSLAIITKDELGEFWHGLVNSGNRFLWVIRPDALVGKD  336

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
             EE   P+EL EGTK  GY+VGWAPQE VL H AVGGFLTH GWNSTLESI  G+PMICW
Sbjct  337  -EERQTPAELLEGTKDRGYVVGWAPQEEVLKHPAVGGFLTHGGWNSTLESIVEGLPMICW  395

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P+FADQQ NSRFV  VWK+G+DMKD CDR +VE+++R+LM +++ EF++ A+ +  LAK+
Sbjct  396  PYFADQQINSRFVSHVWKLGMDMKDSCDRVTVEKMVRDLMVEKRDEFMKAADTLATLAKK  455

Query  259  AISEGGSSYCNFDCLIQDM  203
             + +GGSS CN + LI+D+
Sbjct  456  CVGDGGSSSCNLNSLIEDI  474



>ref|XP_011084985.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Sesamum 
indicum]
Length=495

 Score =   277 bits (708),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 127/197 (64%), Positives = 159/197 (81%), Gaps = 3/197 (2%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED +C+A LDSQ   SVIYVSFGSI+ +TR +L+EFWYGLVNSG KFLWVMR D ++G  
Sbjct  295  EDRSCIAWLDSQPTCSVIYVSFGSITTLTRDELLEFWYGLVNSGHKFLWVMRPDSISGNG  354

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
            +E   IP EL+EGTK+ G++VGW PQ+ VL H A+G F THSGWNST+ESIA G+PM+CW
Sbjct  355  NE---IPVELEEGTKSRGWMVGWVPQQEVLAHPAIGAFFTHSGWNSTIESIAIGLPMLCW  411

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P+FADQ TNSRFV EVWKVGLDMKD CDR +VE++++E M+ R+ EF +RA NM  LA++
Sbjct  412  PYFADQMTNSRFVSEVWKVGLDMKDTCDRITVEKMVKEAMDVRRDEFSKRAHNMAMLARK  471

Query  259  AISEGGSSYCNFDCLIQ  209
            AISEGG+SY N + LI+
Sbjct  472  AISEGGTSYLNLNRLIE  488



>gb|KDO69252.1| hypothetical protein CISIN_1g011848mg [Citrus sinensis]
Length=460

 Score =   275 bits (704),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 129/198 (65%), Positives = 158/198 (80%), Gaps = 1/198 (1%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D +CMA LD Q  +SVIYVSFGSI+V++R QL+EF+YGLV+S K FLWV+R DL++GKD 
Sbjct  254  DRSCMAWLDKQPKQSVIYVSFGSIAVMSRDQLIEFYYGLVHSKKSFLWVIRPDLISGKDG  313

Query  616  EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWP  437
            E   IP EL E TK  G I GW PQE VL H AVGGFLTH GWNSTLESI AG+PMICWP
Sbjct  314  ENQ-IPEELLEATKERGCIAGWVPQEEVLAHSAVGGFLTHCGWNSTLESIVAGMPMICWP  372

Query  436  FFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKEA  257
             FADQQ NSRFVGEVWK+GLD+KD+CDR+ VE+ + +LM +RK EF+E A+ M  LAK++
Sbjct  373  SFADQQINSRFVGEVWKLGLDIKDLCDRNIVEKAVNDLMVERKEEFMESADRMANLAKKS  432

Query  256  ISEGGSSYCNFDCLIQDM  203
            +++GGSSYCN D L+ D+
Sbjct  433  VNKGGSSYCNLDRLVNDI  450



>ref|XP_010262684.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nelumbo 
nucifera]
Length=483

 Score =   276 bits (705),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 127/199 (64%), Positives = 165/199 (83%), Gaps = 1/199 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            E+++C+  LDS+  RSV+YVSFGS++ +TR +++EFW+GLVNSGK FLWV+RSDL++ K+
Sbjct  278  ENKSCITWLDSKALRSVVYVSFGSLATMTRDEVLEFWHGLVNSGKPFLWVIRSDLLSVKE  337

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
             E+  I +EL +GT+  GYIVGWAPQE VL H AVGGFLTHSGWNSTLES+ AGVPMICW
Sbjct  338  GEDE-ILTELVKGTRERGYIVGWAPQEEVLAHPAVGGFLTHSGWNSTLESVYAGVPMICW  396

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P  ADQQ NSRFV E+W++GLDMKD CDR  VE +++E+ME+++ E ++ AENM KLA+ 
Sbjct  397  PKLADQQVNSRFVSEMWRLGLDMKDTCDRLKVELMVKEVMEQKRDEMMKSAENMAKLARM  456

Query  259  AISEGGSSYCNFDCLIQDM  203
            ++SEGGSS CNFD LIQD+
Sbjct  457  SVSEGGSSSCNFDKLIQDI  475



>gb|KJB74151.1| hypothetical protein B456_011G275800, partial [Gossypium raimondii]
Length=463

 Score =   275 bits (703),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 127/203 (63%), Positives = 159/203 (78%), Gaps = 0/203 (0%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D +C++ LD Q   SV+YVSFGSI+V+ R++LMEFW+GLVNSGK+FLWV+R + V   D 
Sbjct  259  DRSCISWLDKQPKGSVVYVSFGSIAVLPREKLMEFWFGLVNSGKRFLWVLRPENVPRNDG  318

Query  616  EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWP  437
            E   +P+EL EGTK  GYIV WAPQE VL H A+GGFLTHSGWNSTLES+ AGVPMICWP
Sbjct  319  ECDGVPTELVEGTKERGYIVDWAPQEDVLSHGAIGGFLTHSGWNSTLESVTAGVPMICWP  378

Query  436  FFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKEA  257
             F DQQ NSRFV EVWK+GLDMKDVCDR  VE+++ +LM +++ E L+ A    KLAK +
Sbjct  379  CFGDQQLNSRFVEEVWKLGLDMKDVCDRRVVEQMVNDLMVEKREEILKSAAEFAKLAKGS  438

Query  256  ISEGGSSYCNFDCLIQDMIKVNE  188
            ++ GGSSYCN DCLI+D+  +N+
Sbjct  439  VNVGGSSYCNLDCLIEDIRMMNK  461



>ref|XP_010262685.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nelumbo 
nucifera]
 ref|XP_010262687.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nelumbo 
nucifera]
 ref|XP_010262688.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nelumbo 
nucifera]
 ref|XP_010262689.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nelumbo 
nucifera]
Length=483

 Score =   276 bits (705),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 128/199 (64%), Positives = 162/199 (81%), Gaps = 1/199 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            E+++C+  LDS+  RSV+YVSFGS++ +TR +++EFW+GLVNSGK FLWV+R DL+A K+
Sbjct  276  ENKSCIRWLDSKPLRSVVYVSFGSLATMTRDEVLEFWHGLVNSGKPFLWVIRPDLLARKE  335

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
             E+  I +EL EGT+   YIV WAPQE VL H AVGGFLTHSGWNSTLESI AGVPMICW
Sbjct  336  GEDQ-ILTELVEGTRERAYIVEWAPQEEVLAHPAVGGFLTHSGWNSTLESIYAGVPMICW  394

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P+FADQQ NSRFV EVWK+GLDMKD CDR  VE +++E+ME+++ E ++ AENM KLA+ 
Sbjct  395  PYFADQQINSRFVSEVWKLGLDMKDTCDRLKVELMVKEVMERKRDEMIKSAENMAKLARM  454

Query  259  AISEGGSSYCNFDCLIQDM  203
            ++ EGGSS CN D LIQD+
Sbjct  455  SVGEGGSSSCNLDKLIQDI  473



>ref|XP_006435572.1| hypothetical protein CICLE_v10031404mg [Citrus clementina]
 ref|XP_006486449.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Citrus sinensis]
 gb|ESR48812.1| hypothetical protein CICLE_v10031404mg [Citrus clementina]
Length=476

 Score =   275 bits (704),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 129/198 (65%), Positives = 158/198 (80%), Gaps = 1/198 (1%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D +CMA LD Q  +SVIYVSFGSI+V++R QL+EF+YGLV+S K FLWV+R DL++GKD 
Sbjct  270  DRSCMAWLDKQPKQSVIYVSFGSIAVMSRDQLIEFYYGLVHSKKNFLWVIRPDLISGKDG  329

Query  616  EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWP  437
            E   IP EL E TK  G I GW PQE VL H AVGGFLTH GWNSTLESI AG+PMICWP
Sbjct  330  ENQ-IPEELLEATKERGCIAGWVPQEEVLAHSAVGGFLTHCGWNSTLESIVAGMPMICWP  388

Query  436  FFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKEA  257
             FADQQ NSRFVGEVWK+GLD+KD+CDR+ VE+ + +LM +RK EF+E A+ M  LAK++
Sbjct  389  SFADQQINSRFVGEVWKLGLDIKDLCDRNIVEKTVNDLMVERKEEFMESADRMANLAKKS  448

Query  256  ISEGGSSYCNFDCLIQDM  203
            +++GGSSYCN D L+ D+
Sbjct  449  VNKGGSSYCNLDRLVNDI  466



>gb|KDO69253.1| hypothetical protein CISIN_1g011848mg [Citrus sinensis]
Length=476

 Score =   275 bits (703),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 129/198 (65%), Positives = 158/198 (80%), Gaps = 1/198 (1%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D +CMA LD Q  +SVIYVSFGSI+V++R QL+EF+YGLV+S K FLWV+R DL++GKD 
Sbjct  270  DRSCMAWLDKQPKQSVIYVSFGSIAVMSRDQLIEFYYGLVHSKKSFLWVIRPDLISGKDG  329

Query  616  EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWP  437
            E   IP EL E TK  G I GW PQE VL H AVGGFLTH GWNSTLESI AG+PMICWP
Sbjct  330  ENQ-IPEELLEATKERGCIAGWVPQEEVLAHSAVGGFLTHCGWNSTLESIVAGMPMICWP  388

Query  436  FFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKEA  257
             FADQQ NSRFVGEVWK+GLD+KD+CDR+ VE+ + +LM +RK EF+E A+ M  LAK++
Sbjct  389  SFADQQINSRFVGEVWKLGLDIKDLCDRNIVEKAVNDLMVERKEEFMESADRMANLAKKS  448

Query  256  ISEGGSSYCNFDCLIQDM  203
            +++GGSSYCN D L+ D+
Sbjct  449  VNKGGSSYCNLDRLVNDI  466



>dbj|BAB86920.1| glucosyltransferase-2 [Vigna angularis]
Length=485

 Score =   275 bits (703),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 126/197 (64%), Positives = 160/197 (81%), Gaps = 1/197 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED +C+  LDSQ  +SV+YVSFGSI+ +TR++LMEFWYGLVNS K+FLWV+R D+VAG D
Sbjct  280  EDRSCLTWLDSQPLKSVLYVSFGSITTVTRERLMEFWYGLVNSKKRFLWVIRPDMVAGAD  339

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
            ++E  + +EL+EGTK  G+IVGWAPQE VL H A+GGFLTHSGWNSTLES+ AGVPMICW
Sbjct  340  NDER-VAAELEEGTKERGFIVGWAPQEEVLAHKAIGGFLTHSGWNSTLESLVAGVPMICW  398

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P FADQQ NSRFV EVWK+GLDMKD+CDR  VE+++ +LM  R+ EFL+ A+ M  LA +
Sbjct  399  PCFADQQINSRFVSEVWKLGLDMKDLCDRDVVEKMVNDLMVHRREEFLKSAQAMATLADK  458

Query  259  AISEGGSSYCNFDCLIQ  209
            ++S GGSSY +   L++
Sbjct  459  SVSPGGSSYSSLHDLVE  475



>emb|CDP05611.1| unnamed protein product [Coffea canephora]
Length=490

 Score =   275 bits (703),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 131/207 (63%), Positives = 164/207 (79%), Gaps = 6/207 (3%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLV---A  629
            ED++C+  LD+Q P+SV+YVSFGSI+VITR++L EFW+G+VNSG KFLWV+R D +   A
Sbjct  283  EDKSCIKWLDNQPPKSVLYVSFGSITVITREKLHEFWHGIVNSGVKFLWVIRPDSIKAEA  342

Query  628  GKD---DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAG  458
            G D     +S    EL+E TK  G +VGWAPQE VL H A+GGFLTHSGWNSTLESIA G
Sbjct  343  GDDVLKTTKSTPEMELEEATKERGCMVGWAPQEEVLAHPAIGGFLTHSGWNSTLESIAEG  402

Query  457  VPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENM  278
            VPMICWP+FADQQ NSRFVGEVWK+GLD+KD CDR  VE+ I++LM +RK EFL RA+ M
Sbjct  403  VPMICWPYFADQQPNSRFVGEVWKIGLDIKDTCDRVIVEKAIKDLMVERKDEFLHRADEM  462

Query  277  GKLAKEAISEGGSSYCNFDCLIQDMIK  197
             K+A++++ EGGSS+CN   LI D++K
Sbjct  463  AKMARKSVEEGGSSFCNLVRLIDDIVK  489



>ref|XP_002280528.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase [Vitis vinifera]
Length=479

 Score =   275 bits (702),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 159/199 (80%), Gaps = 1/199 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED +C+  LD Q  +SVIYVSFGS+++IT+++L EFW+GLVNSG +FLWV+R D + GKD
Sbjct  277  EDRSCIPWLDRQPSKSVIYVSFGSLAIITKEELREFWHGLVNSGSRFLWVIRPDALVGKD  336

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
             EE   P+EL EGTK  GY+VGWAPQE VL H AVGGFLTH GWNSTLESI  G+PMICW
Sbjct  337  -EERQTPAELLEGTKDRGYVVGWAPQEEVLKHPAVGGFLTHGGWNSTLESIVEGLPMICW  395

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P+FADQQ NSRFV  VWK+G+DMKD CDR +VE+++R+LM +++ EF+E A+ +  LAK+
Sbjct  396  PYFADQQINSRFVSHVWKLGMDMKDSCDRVTVEKMVRDLMVEKRDEFMEAADTLATLAKK  455

Query  259  AISEGGSSYCNFDCLIQDM  203
             + +GGSS CN + LI+D+
Sbjct  456  CVGDGGSSSCNLNSLIEDI  474



>ref|XP_006435573.1| hypothetical protein CICLE_v10031368mg [Citrus clementina]
 ref|XP_006486447.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Citrus sinensis]
 gb|ESR48813.1| hypothetical protein CICLE_v10031368mg [Citrus clementina]
Length=484

 Score =   273 bits (699),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 156/198 (79%), Gaps = 1/198 (1%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D +C+A LD+Q  +SVI+VSFGS++V+ R QL+EFWYGLVNS K+FLWV+R DL++GKD 
Sbjct  278  DRSCIAWLDNQPSKSVIFVSFGSVAVMQRDQLIEFWYGLVNSHKRFLWVIRPDLISGKDG  337

Query  616  EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWP  437
            E   IP EL + TK  GYI GW PQE VL H AVGGFLTH GWNSTLESI A +PMICWP
Sbjct  338  ENQ-IPKELDKATKERGYIAGWVPQEEVLGHKAVGGFLTHCGWNSTLESIVARMPMICWP  396

Query  436  FFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKEA  257
             FADQQ NSRFV EVWK+GLDMKD+CDR  VE+++ EL+ +R+  F++ A+ M  LA ++
Sbjct  397  SFADQQINSRFVDEVWKLGLDMKDLCDRKIVEKMVNELLVERRAAFMKSADRMANLAIKS  456

Query  256  ISEGGSSYCNFDCLIQDM  203
            ++EGGSSYCN D LI D+
Sbjct  457  VNEGGSSYCNLDHLINDI  474



>ref|XP_010650643.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase [Vitis vinifera]
Length=476

 Score =   273 bits (698),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 160/199 (80%), Gaps = 1/199 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED +C+A LD Q  +S IYVSFGSI+VIT++Q+MEFW+GLVNSG +FLWV+R D +  KD
Sbjct  273  EDRSCLAWLDRQPSKSFIYVSFGSITVITKEQMMEFWHGLVNSGSRFLWVIRPDSLTEKD  332

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
             E   + ++L+E TK  G IV WAPQE VL H AVGGFLTH GWNSTLESI AGVPMICW
Sbjct  333  GEFQ-LQAQLREVTKERGQIVDWAPQEEVLAHPAVGGFLTHGGWNSTLESIFAGVPMICW  391

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P+F+DQQ NSRFV  VWK+G+DMKD CDR +VE+++R++ME+R+ EF +  + M KLA+ 
Sbjct  392  PYFSDQQLNSRFVSHVWKIGMDMKDTCDRVTVEKMVRDVMEERRAEFTKSVDAMAKLARS  451

Query  259  AISEGGSSYCNFDCLIQDM  203
            ++SEGG+SYCNF+ LI+D+
Sbjct  452  SLSEGGTSYCNFNRLIEDI  470



>ref|XP_011076758.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Sesamum 
indicum]
Length=475

 Score =   273 bits (697),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 128/199 (64%), Positives = 156/199 (78%), Gaps = 1/199 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED +C+A LDSQ P+SVIYVSFGS++V T  QLMEFW+GLVNSG++FLWV+R D +A K 
Sbjct  268  EDRSCIAWLDSQPPKSVIYVSFGSLAVTTSNQLMEFWHGLVNSGQRFLWVIRPDSIAAKS  327

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
              ES +P EL + TK  GYIVGW PQE VL H +VGGFLTHSGWNSTLESI  GVPMICW
Sbjct  328  -WESEVPVELSKATKERGYIVGWTPQEEVLAHPSVGGFLTHSGWNSTLESIYEGVPMICW  386

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P+F DQQ NSR V E WK+GLDMKD CDRS +E+++R LM+  K +FLERA+ M K AK 
Sbjct  387  PYFIDQQVNSRLVEEAWKLGLDMKDTCDRSIIEKMVRSLMDVGKEKFLERADQMAKSAKR  446

Query  259  AISEGGSSYCNFDCLIQDM  203
             +S GGSS+ NF+ L++D+
Sbjct  447  CLSNGGSSHNNFERLVEDI  465



>ref|XP_007158359.1| hypothetical protein PHAVU_002G146200g [Phaseolus vulgaris]
 gb|ESW30353.1| hypothetical protein PHAVU_002G146200g [Phaseolus vulgaris]
Length=482

 Score =   273 bits (697),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 130/208 (63%), Positives = 161/208 (77%), Gaps = 6/208 (3%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D TCM  LD+Q   SV+YVSFGS +++ R+ LME W+GLVNS K+FLWVMR D+VAGK D
Sbjct  278  DGTCMTWLDAQPEGSVMYVSFGSSTIVKREDLMEIWHGLVNSKKRFLWVMRPDIVAGKQD  337

Query  616  EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWP  437
            ++  IP+E++EGTK  G+IV WAPQE VL+H A+GGFLTHSGWNSTLES+ AGVPMICWP
Sbjct  338  DDR-IPAEVEEGTKERGFIVEWAPQEEVLEHKAIGGFLTHSGWNSTLESVVAGVPMICWP  396

Query  436  FFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKEA  257
            +FADQQ NSRFV EVWKVGLDMKDVCDR  VE+++ +LM  R+ EFL  A+ M  LA ++
Sbjct  397  YFADQQINSRFVSEVWKVGLDMKDVCDRDVVEKMVNDLMVHRREEFLNSAKAMATLAHKS  456

Query  256  ISEGGSSYCNFDCLIQDMIK-VNEATRE  176
            +S GGSSY +F    QD I  +   +RE
Sbjct  457  VSPGGSSYSSF----QDFIHYIKSGSRE  480



>emb|CDP05607.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   273 bits (698),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/211 (61%), Positives = 163/211 (77%), Gaps = 10/211 (5%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLV----  632
            ED++C+  LD+Q P+SV+YVSFGSI++ITR+ L+EFW+G+VNSG +FLWV+R + V    
Sbjct  281  EDKSCIKWLDNQPPKSVLYVSFGSIAIITRETLLEFWHGIVNSGVRFLWVIRPNSVNVGL  340

Query  631  ------AGKDDEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLES  470
                  + K   +S    EL+E TK  G +VGWAPQE VL H A+GGFLTHSGWNSTLES
Sbjct  341  GDDVLDSTKSKSKSTPEMELEEATKERGCMVGWAPQEDVLAHPAIGGFLTHSGWNSTLES  400

Query  469  IAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLER  290
            IA GVPMICWP FADQQ NSRFVGE+WK+GLDMKD CDR  VE+++R+LM +RK EFL R
Sbjct  401  IAEGVPMICWPCFADQQPNSRFVGEIWKIGLDMKDTCDRVIVEKMVRDLMVERKDEFLHR  460

Query  289  AENMGKLAKEAISEGGSSYCNFDCLIQDMIK  197
            A+ M KLA+++I EGGSS+CN   LI D++K
Sbjct  461  ADEMAKLARKSIEEGGSSFCNLVRLIDDIVK  491



>ref|XP_002280470.2| PREDICTED: LOW QUALITY PROTEIN: 7-deoxyloganetic acid glucosyltransferase-like 
[Vitis vinifera]
Length=479

 Score =   272 bits (696),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 158/199 (79%), Gaps = 1/199 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED +C+  LD Q  +SVIYVSFGS+++IT+++L EFW+GLVNSG +FLWV+R D + GKD
Sbjct  277  EDRSCIPWLDRQPSKSVIYVSFGSLAIITKEELREFWHGLVNSGSRFLWVIRPDALVGKD  336

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
             EE   P+EL EGTK  GY+VGWAPQE VL H AVGGFLTH GWNSTLESI  G+PMICW
Sbjct  337  -EERQTPAELLEGTKDRGYVVGWAPQEEVLKHPAVGGFLTHGGWNSTLESIVEGLPMICW  395

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P+FADQQ NSRFV  VWK+G+DMKD CDR +VE+++R+LM +++ EF+E A+ +  LAK+
Sbjct  396  PYFADQQINSRFVSHVWKLGMDMKDSCDRVTVEKMVRDLMVEKRDEFMEAADTLATLAKK  455

Query  259  AISEGGSSYCNFDCLIQDM  203
             + + GSS CN + LI+D+
Sbjct  456  CVGDSGSSSCNLNSLIEDI  474



>ref|XP_010658496.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Vitis 
vinifera]
Length=480

 Score =   272 bits (695),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 127/199 (64%), Positives = 158/199 (79%), Gaps = 1/199 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED +C+A L+ Q  +SVIYVSFGS++VITR+QL+EF YGLVNSG +FLWV+R+D +A ++
Sbjct  276  EDRSCIAWLNRQPSKSVIYVSFGSVTVITRKQLIEFCYGLVNSGSRFLWVIRTDSLA-EE  334

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
            D E   P+EL EG K   YIV WAPQE VL H AVGGFLTHSGWNSTLESI AGVPMICW
Sbjct  335  DGERQTPAELLEGAKERSYIVEWAPQEEVLAHPAVGGFLTHSGWNSTLESICAGVPMICW  394

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P+FADQQ NSRFV  VWK+G DMKD CDR  VE+++R+LME+R+ E L+ A+ M   A++
Sbjct  395  PYFADQQINSRFVSHVWKLGSDMKDTCDRLIVEKMVRDLMEERRDELLKTADMMATRARK  454

Query  259  AISEGGSSYCNFDCLIQDM  203
             +SEGGSSYCN   LI+++
Sbjct  455  CVSEGGSSYCNLSSLIEEI  473



>ref|XP_010650608.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase [Vitis vinifera]
Length=487

 Score =   272 bits (696),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 125/199 (63%), Positives = 158/199 (79%), Gaps = 1/199 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED +C+A LD Q  +SVIYVSFGSI+VIT++Q+MEFW+GLVNSG +FLWV+R D +  KD
Sbjct  273  EDRSCLAWLDRQPSKSVIYVSFGSITVITKEQMMEFWHGLVNSGSRFLWVIRPDSLTEKD  332

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
             E   + ++L E TK  G IV WAPQE VL H AVGGFLTH GWNSTLESI AGVPMICW
Sbjct  333  GEFQ-LQAQLWEVTKERGQIVDWAPQEEVLAHPAVGGFLTHGGWNSTLESIFAGVPMICW  391

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P+F DQQ NSRFV  VWK+G+DMKD CDR ++E+++R++ME R+ EF +  + M KLA+ 
Sbjct  392  PYFTDQQLNSRFVSHVWKMGMDMKDTCDRVTIEKMVRDVMEGRRAEFTKSVDAMAKLARR  451

Query  259  AISEGGSSYCNFDCLIQDM  203
            ++SEGG+SYCNFD LI+D+
Sbjct  452  SLSEGGTSYCNFDRLIEDI  470



>gb|ACS87994.1| UDP-glucosyltransferase family 1 protein [Citrus sinensis]
Length=484

 Score =   272 bits (695),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 155/198 (78%), Gaps = 1/198 (1%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D  C+A LD+Q  +SVI+VSFGS++V+ R QL+EFWYGLVNS K+FLWV+R DL++GKD 
Sbjct  278  DRGCIAWLDNQPSKSVIFVSFGSVAVMQRDQLIEFWYGLVNSHKRFLWVIRPDLISGKDG  337

Query  616  EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWP  437
            E   IP EL + TK  GYI GW PQE VL H AVGGFLTH GWNSTLESI A +PMICWP
Sbjct  338  ENQ-IPKELDKATKERGYIAGWVPQEEVLGHKAVGGFLTHCGWNSTLESIVARMPMICWP  396

Query  436  FFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKEA  257
             FADQQ NSRFV EVWK+GLDMKD+CDR  VE+++ EL+ +R+  F++ A+ M  LA ++
Sbjct  397  SFADQQINSRFVDEVWKLGLDMKDLCDRKIVEKMVNELLVERRAAFMKSADRMANLAIKS  456

Query  256  ISEGGSSYCNFDCLIQDM  203
            ++EGGSSYCN D LI D+
Sbjct  457  VNEGGSSYCNLDRLINDI  474



>ref|XP_007009131.1| UDP-glucosyltransferase family 1 protein [Theobroma cacao]
 gb|EOY17941.1| UDP-glucosyltransferase family 1 protein [Theobroma cacao]
Length=479

 Score =   271 bits (694),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 124/203 (61%), Positives = 159/203 (78%), Gaps = 4/203 (2%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D +C++ LD Q   SV+YVSFGSI+V++R+Q+MEFW+GLVNS K+FLWV R D +     
Sbjct  277  DRSCLSWLDEQPKESVVYVSFGSIAVLSREQIMEFWFGLVNSRKRFLWVFRPDFMP----  332

Query  616  EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWP  437
            E+  IP+EL EGTK  GY+VGWAPQE VL H A+GGFLTHSGWNSTLES+ AGVPMICWP
Sbjct  333  EKGSIPAELVEGTKQRGYMVGWAPQEEVLAHCAIGGFLTHSGWNSTLESLVAGVPMICWP  392

Query  436  FFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKEA  257
            +FADQQ NSRFV EVWK+GLDMKDVCDR  VE+++ +L+  ++ EF++ +  + KLAK  
Sbjct  393  YFADQQLNSRFVSEVWKLGLDMKDVCDRRVVEKMVNDLIVDKREEFVKSSAEIAKLAKAC  452

Query  256  ISEGGSSYCNFDCLIQDMIKVNE  188
            ++ GGSSYCN D LI+D+  +N 
Sbjct  453  VNVGGSSYCNLDRLIEDIRSMNR  475



>ref|XP_003517688.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Glycine max]
Length=481

 Score =   271 bits (693),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 125/196 (64%), Positives = 158/196 (81%), Gaps = 1/196 (1%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D +CMA L++Q   SVIYVSFGS +++ R+ LME W+GLVNS K+FLWVMR D+VA KD+
Sbjct  277  DRSCMAWLEAQPQGSVIYVSFGSSTIVKREDLMEIWHGLVNSKKRFLWVMRPDIVAAKDN  336

Query  616  EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWP  437
            ++  IP+E++EGT+  G IVGWAPQE VL H AVGGF TH+GWNSTL+S+ AGVPMICWP
Sbjct  337  DDR-IPAEVEEGTRERGLIVGWAPQEDVLAHKAVGGFFTHNGWNSTLDSVVAGVPMICWP  395

Query  436  FFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKEA  257
            +FADQQ NSRFV EVWK+GLDMKDVCDR  VE+++ +LM  RK EFL+ A+ M  LA ++
Sbjct  396  YFADQQINSRFVSEVWKLGLDMKDVCDRHVVEKMVNDLMVHRKEEFLKSAQEMAMLAHKS  455

Query  256  ISEGGSSYCNFDCLIQ  209
            ++ GGSSY +FD LIQ
Sbjct  456  VTPGGSSYSSFDDLIQ  471



>gb|EYU19963.1| hypothetical protein MIMGU_mgv1a005336mg [Erythranthe guttata]
Length=488

 Score =   271 bits (692),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 129/208 (62%), Positives = 162/208 (78%), Gaps = 2/208 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED++C++ LD+Q  +SVI+VS GS++V+T++QL E WYGLVNSG KFLWV R   V G D
Sbjct  283  EDKSCISWLDAQASKSVIFVSIGSLAVMTKEQLFEIWYGLVNSGSKFLWVRRPGSVIGAD  342

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
             E   IP EL EGTK  G+IV WAPQE VL H A+GGFLTHSGWNSTLESI  G PMICW
Sbjct  343  AELE-IPLELSEGTKERGFIVKWAPQEEVLGHPAIGGFLTHSGWNSTLESIVEGKPMICW  401

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P+F DQQ NSR+VGEVWK+GLDMKD CDR+ VE++IRE+M  +K EFLE A  M +LAK 
Sbjct  402  PYFVDQQVNSRYVGEVWKLGLDMKDTCDRAVVEKMIREVMVLKKDEFLETAAKMAELAKS  461

Query  259  AISEGGSSYCNFDCLIQDMIKVNEATRE  176
            +++EGGSS+ +FD L++D +K  + TR+
Sbjct  462  SVAEGGSSFLDFDRLVED-VKTMKITRK  488



>ref|XP_002276823.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Vitis 
vinifera]
Length=480

 Score =   270 bits (691),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 157/199 (79%), Gaps = 1/199 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED +C+A LD Q  +SVIYVSFGS++VI+R+QL+EF +GLVNSG +FLWV+R+D +A ++
Sbjct  276  EDRSCIAWLDHQPSKSVIYVSFGSLTVISRKQLIEFCHGLVNSGSRFLWVIRTDSLA-EE  334

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
            D E   P+EL EG K   YIV WAPQE VL H AVGGFLTHSGWNSTLESI AGVPMICW
Sbjct  335  DGEHQTPAELMEGAKERSYIVEWAPQEEVLAHPAVGGFLTHSGWNSTLESICAGVPMICW  394

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P+FADQQ NSRFV  VWK+G DMKD CDR  VE+++R+LME+RK E L+ A+ M   A++
Sbjct  395  PYFADQQINSRFVSHVWKLGSDMKDTCDRLIVEKMVRDLMEERKDELLKTADKMATRARK  454

Query  259  AISEGGSSYCNFDCLIQDM  203
             +SEGGSSYCN   L+ ++
Sbjct  455  CVSEGGSSYCNLSSLVDEI  473



>ref|XP_002276617.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Vitis 
vinifera]
 ref|XP_010658495.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Vitis 
vinifera]
Length=478

 Score =   270 bits (691),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 128/199 (64%), Positives = 156/199 (78%), Gaps = 1/199 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED +C+A LD Q  +SVIYVSFGS+ VI+R+QL+EF YGLVNS  +FLWV+R+D +A ++
Sbjct  276  EDRSCIAWLDHQPSKSVIYVSFGSMVVISRKQLIEFCYGLVNSSSRFLWVIRTDSLA-EE  334

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
            D E   P+EL EG K   YIV WAPQE VL H AVGGFLTHSGWNSTLESI AGVPMICW
Sbjct  335  DGEHQTPAELMEGAKERSYIVEWAPQEEVLAHPAVGGFLTHSGWNSTLESICAGVPMICW  394

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P+FADQQ NSRFV  VWK+G DMKD CDR  VE+++R+LME+RK E LE A+ M   A++
Sbjct  395  PYFADQQINSRFVSHVWKLGSDMKDTCDRLIVEKMVRDLMEERKDELLETADMMATRARK  454

Query  259  AISEGGSSYCNFDCLIQDM  203
             +SEGGSSYCN   LI+++
Sbjct  455  CVSEGGSSYCNLSSLIEEI  473



>ref|XP_004173134.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyltransferase 85A1-like, 
partial [Cucumis sativus]
Length=308

 Score =   265 bits (676),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/198 (63%), Positives = 154/198 (78%), Gaps = 1/198 (1%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D TC+A LD+Q P SVIYVSFGSI+V+  + LMEFW+GLVNSG+ FLWV+R DLV+GK+ 
Sbjct  105  DRTCLAWLDNQPPGSVIYVSFGSITVMGNEGLMEFWHGLVNSGRNFLWVIRPDLVSGKNG  164

Query  616  EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWP  437
            E   IP++L+EGTK  GY+VGWAPQE VL H AVGGFLTHSGWNSTLESI AG  M+CWP
Sbjct  165  EIE-IPADLEEGTKQRGYVVGWAPQEKVLSHEAVGGFLTHSGWNSTLESIVAGKAMVCWP  223

Query  436  FFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKEA  257
            + ADQQ NSRFV  VWK+G+DMKD+CDR  V +++ E+M  RK EF   A  M  LA+ +
Sbjct  224  YTADQQVNSRFVSNVWKLGVDMKDMCDREIVAKMVNEVMVNRKEEFKRSAIEMANLARRS  283

Query  256  ISEGGSSYCNFDCLIQDM  203
            +S GGSSY +FD L+ ++
Sbjct  284  VSLGGSSYADFDRLVNEI  301



>ref|XP_009597174.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=484

 Score =   270 bits (689),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/202 (62%), Positives = 155/202 (77%), Gaps = 3/202 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED +C+  LD Q  RSV+YVSFGS+  +T+ +L EFW+GLVNSG++FLWV+R D++  KD
Sbjct  286  EDRSCLKWLDEQPSRSVLYVSFGSVITLTKHELTEFWHGLVNSGQQFLWVIRHDVIKDKD  345

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
            D    +  ELKEG K NGYIV WAPQE VL H ++GGFLTHSGWNSTLES+   VPMICW
Sbjct  346  DV---LEVELKEGRKENGYIVSWAPQEEVLAHPSIGGFLTHSGWNSTLESLYEAVPMICW  402

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P  ADQQ NSRFVGEVWK+GLD+KD CDR  +E+++ ELME R+ EFL+RA  M KLA+ 
Sbjct  403  PQLADQQVNSRFVGEVWKLGLDLKDTCDRVIIEKMVSELMEARRNEFLQRANEMTKLARA  462

Query  259  AISEGGSSYCNFDCLIQDMIKV  194
            ++SEGGSS  N D LIQD+  +
Sbjct  463  SVSEGGSSTRNLDRLIQDIYSI  484



>ref|XP_008464643.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Cucumis melo]
 ref|XP_008464644.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Cucumis melo]
Length=509

 Score =   270 bits (691),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 124/198 (63%), Positives = 156/198 (79%), Gaps = 4/198 (2%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D +C+A LD+Q P+SVIYVSFGS+ VI   QL EFW+GLVNSGK+FLWV+R + VAGKD 
Sbjct  304  DRSCLAWLDAQPPKSVIYVSFGSVVVIDDDQLREFWHGLVNSGKRFLWVLRPNSVAGKDG  363

Query  616  EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWP  437
                +P+EL+E TK  GYIVGWAPQE VL H A+G FLTHSGWNSTLESI AGVPMICWP
Sbjct  364  ----VPAELEEETKERGYIVGWAPQEEVLAHKAIGAFLTHSGWNSTLESIVAGVPMICWP  419

Query  436  FFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKEA  257
             FADQQTNSR+V E+WK+GLDMKDVC+R +V +++ ++ME RK E +     + KLA  +
Sbjct  420  QFADQQTNSRYVSEIWKIGLDMKDVCNRETVAKMVNDVMENRKNELMGSVIEIAKLAITS  479

Query  256  ISEGGSSYCNFDCLIQDM  203
            + EGGSSYC+ + +I+D+
Sbjct  480  VEEGGSSYCDLERMIKDI  497



>ref|XP_007158358.1| hypothetical protein PHAVU_002G146100g [Phaseolus vulgaris]
 gb|ESW30352.1| hypothetical protein PHAVU_002G146100g [Phaseolus vulgaris]
Length=482

 Score =   269 bits (688),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 127/205 (62%), Positives = 158/205 (77%), Gaps = 5/205 (2%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D TCM  LD+Q   SV+YVSFGS +++ R+ L E W+GLVNS  +FLWVMR D+VAGK D
Sbjct  278  DRTCMTWLDAQPEGSVMYVSFGSSTIVKREDLTEIWHGLVNSKNRFLWVMRPDIVAGKQD  337

Query  616  EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWP  437
            ++  IP+E++EGTK  G+IV WAPQE VL+H A+GGFLTHSGWNSTLES+ AGVPMICWP
Sbjct  338  DDR-IPAEVEEGTKERGFIVEWAPQEEVLEHKAIGGFLTHSGWNSTLESVVAGVPMICWP  396

Query  436  FFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKEA  257
            +FADQQ NSRFV EVWKVGLDMKDVCDR  VE+++ +LM  R+ EFL  A+ M  LA ++
Sbjct  397  YFADQQINSRFVSEVWKVGLDMKDVCDRDVVEKMVNDLMVHRREEFLNSAKAMATLAHKS  456

Query  256  ISEGGSSYCNFDCLIQDMIKVNEAT  182
            +S GGSSY +F    QD I   ++T
Sbjct  457  VSPGGSSYSSF----QDFIHYIKST  477



>ref|XP_002276771.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase [Vitis vinifera]
Length=480

 Score =   269 bits (687),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 127/199 (64%), Positives = 156/199 (78%), Gaps = 1/199 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED +C+A LD Q  +SVIYVSFGS+ VI+R+QL+EF YGLVNS  +FLWV+R+D +A ++
Sbjct  276  EDRSCIAWLDHQPSKSVIYVSFGSMVVISRKQLIEFCYGLVNSSSRFLWVIRTDSLA-EE  334

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
            D E   P+EL EG K   YIV WAPQE VL H AVGGFLTHSGWNSTLESI AGVPMICW
Sbjct  335  DGEHQTPAELMEGAKERSYIVEWAPQEEVLAHPAVGGFLTHSGWNSTLESICAGVPMICW  394

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P+FADQQ NSRFV  VWK+G DMKD CDR  VE+++R+LME+RK E L+ A+ M   A++
Sbjct  395  PYFADQQINSRFVSHVWKLGSDMKDTCDRLIVEKMVRDLMEERKDELLKTADMMATRARK  454

Query  259  AISEGGSSYCNFDCLIQDM  203
             +SEGGSSYCN   LI+++
Sbjct  455  CVSEGGSSYCNLSSLIEEI  473



>gb|KDP44850.1| hypothetical protein JCGZ_01350 [Jatropha curcas]
Length=490

 Score =   268 bits (686),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 156/199 (78%), Gaps = 1/199 (1%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D TC+A LD+Q  +SVIYVSFGS + +T  QL+EFW+GL+NS ++FLWV+R   V  K+ 
Sbjct  273  DRTCIAWLDNQPSQSVIYVSFGSFANLTLDQLIEFWHGLINSNRRFLWVIRPSSVTDKEG  332

Query  616  -EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
                  P EL+EG K NGYIV WAPQE VL H A+GGFLTHSGWNSTLESI AGVPMICW
Sbjct  333  IVVEKFPEELQEGCKENGYIVKWAPQEEVLAHKAIGGFLTHSGWNSTLESIVAGVPMICW  392

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P+FADQQTNSRFV EVWK+GLDMKDVC+R  VE+++ +LM  ++ EF+  A  M +LA++
Sbjct  393  PYFADQQTNSRFVSEVWKLGLDMKDVCNRKVVEKMVNDLMVNKREEFVRSAARMAELARK  452

Query  259  AISEGGSSYCNFDCLIQDM  203
            +ISEGGSS+CN + LI+D+
Sbjct  453  SISEGGSSFCNLNRLIEDI  471



>ref|XP_009800319.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nicotiana 
sylvestris]
Length=479

 Score =   268 bits (684),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 155/199 (78%), Gaps = 1/199 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED++C+  L++Q P SVIYVSFGSI+ +T++QLMEFWYGLVNS ++FLWV+R D VAG D
Sbjct  278  EDKSCINWLNNQLPNSVIYVSFGSIATMTKEQLMEFWYGLVNSKQRFLWVIRLDSVAG-D  336

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
            D ++ IP EL EGTK  GYIVGWAPQE VL H +VGGF TH GWNS LE++  G PMICW
Sbjct  337  DWKNKIPVELAEGTKERGYIVGWAPQEEVLAHPSVGGFWTHCGWNSILETVYEGKPMICW  396

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P+F DQQ NSRFV   WK+GLDMKD CDR  VE+++++LM  RK EFLERA  M K AK+
Sbjct  397  PYFMDQQVNSRFVEAAWKLGLDMKDTCDREIVEKMVKDLMMVRKDEFLERANQMSKFAKK  456

Query  259  AISEGGSSYCNFDCLIQDM  203
             + EGGSSY NF+ L+ D+
Sbjct  457  CLVEGGSSYSNFERLVNDI  475



>dbj|BAB86930.1| glucosyltransferase-12 [Vigna angularis]
Length=463

 Score =   266 bits (681),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/203 (61%), Positives = 161/203 (79%), Gaps = 1/203 (0%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D +CMA LD+Q   SV+YVSFG+ +++TR++LMEFW+GLV+S K+FLWVMR DLV G+++
Sbjct  259  DRSCMAWLDAQAQGSVLYVSFGTSTIVTREELMEFWHGLVDSKKRFLWVMRPDLVVGREN  318

Query  616  EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWP  437
            ++  IP E++EGTK  G +V WAPQE VL H A+GGFLTHSGWNSTLES+ AGVPMICWP
Sbjct  319  DDR-IPEEVEEGTKERGLMVEWAPQEEVLAHKAIGGFLTHSGWNSTLESLVAGVPMICWP  377

Query  436  FFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKEA  257
            +FADQQ NSRFV EVWKVGLDMKDVCDR  VE+++ +LM  R+ EFL+ A+ M  LA ++
Sbjct  378  YFADQQVNSRFVSEVWKVGLDMKDVCDRDVVEKMVNDLMVHRRDEFLKSAQAMAMLAHQS  437

Query  256  ISEGGSSYCNFDCLIQDMIKVNE  188
            +S GGSS+ +   LI  +  V++
Sbjct  438  VSPGGSSHSSMQDLIHYIKSVSK  460



>dbj|BAB86929.1| glucosyltransferase-11 [Vigna angularis]
Length=462

 Score =   266 bits (681),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 160/207 (77%), Gaps = 4/207 (2%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D +CM  LD+Q   SV+YVSFGS +++ ++ LME W+GLVNS K+FLWV   D+VAGK +
Sbjct  258  DRSCMTWLDAQPDGSVMYVSFGSSTIMNKEDLMEIWHGLVNSKKRFLWVKLPDIVAGKHN  317

Query  616  EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWP  437
            EE  +P+E+KEGTK  G+IV WAPQE VL H A+GGFLTHSGWNSTLES+ AGVPMICWP
Sbjct  318  EEH-VPTEVKEGTKERGFIVEWAPQEEVLTHKAIGGFLTHSGWNSTLESLVAGVPMICWP  376

Query  436  FFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKEA  257
            +FADQQ NSRFV EVWKVGLDMKDVCDR  VE+++ ++M  R+ EFL+ A+ M  LA ++
Sbjct  377  YFADQQINSRFVSEVWKVGLDMKDVCDRDVVEKMVNDVMVHRREEFLKSAQTMAMLAHQS  436

Query  256  ISEGGSSYCNFDCLIQDMIKVNEATRE  176
            +S GGSSY +   LI+ +I    A+RE
Sbjct  437  VSPGGSSYTSLHDLIEYIIS---ASRE  460



>ref|XP_011084983.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Sesamum 
indicum]
Length=524

 Score =   268 bits (685),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/198 (62%), Positives = 158/198 (80%), Gaps = 1/198 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED +C+A LDSQ   SVIYVSFGSI+++TR +L+EFWYGLVNSG +FLWV+R D + G +
Sbjct  320  EDRSCIAWLDSQPTCSVIYVSFGSITILTRDELLEFWYGLVNSGHRFLWVIRPDSIVGNN  379

Query  619  DEE-SPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMIC  443
             E  + IP EL+EGTK+ G +VGW PQ+ VL H A+G F THSGWNSTLESIA G+PMIC
Sbjct  380  SENWNEIPVELEEGTKSRGCMVGWVPQQEVLAHPAIGAFFTHSGWNSTLESIAIGLPMIC  439

Query  442  WPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAK  263
            W +FADQ TNSRFV +VWK+GLDMKD CDR  VE++++++M+ R+ EFLERA +M  L+ 
Sbjct  440  WAYFADQTTNSRFVSKVWKIGLDMKDTCDRIIVEKMVKDVMDVRRDEFLERAHSMAVLSG  499

Query  262  EAISEGGSSYCNFDCLIQ  209
            +AISEGGSSY N + L++
Sbjct  500  KAISEGGSSYLNLNRLVE  517



>ref|XP_009608691.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=480

 Score =   267 bits (682),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 127/199 (64%), Positives = 152/199 (76%), Gaps = 4/199 (2%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED +C+  LD Q  +SVIYVSFGS++V+TR Q MEF +G VNSGK FLWV+R   VA   
Sbjct  279  EDRSCIDWLDQQPFKSVIYVSFGSMTVLTRDQFMEFLHGFVNSGKPFLWVVRPKSVA---  335

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
             E+  IP EL EGT+  GYIV WAPQE VL H A+GGFLTHSGWNSTLESI  GVPMICW
Sbjct  336  -EDYQIPEELLEGTRQRGYIVEWAPQEEVLAHPAIGGFLTHSGWNSTLESIYEGVPMICW  394

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            PF+ADQQ NSR VGEVWK+GLDMKD CDR  +E ++++L+E RK EF + A  M KLA +
Sbjct  395  PFYADQQVNSRLVGEVWKIGLDMKDTCDRVIIENMVKDLIETRKDEFAKSARLMTKLAMK  454

Query  259  AISEGGSSYCNFDCLIQDM  203
            ++SE GSSYCN D LI+D+
Sbjct  455  SVSENGSSYCNLDRLIKDI  473



>ref|XP_009802463.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nicotiana 
sylvestris]
Length=480

 Score =   266 bits (680),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 152/199 (76%), Gaps = 4/199 (2%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED +C+  LD Q  +SVIYVSFGS++V+TR Q MEF +GLVNSGK FLWV+R   VA   
Sbjct  279  EDRSCIDWLDQQPFKSVIYVSFGSMTVLTRDQFMEFLHGLVNSGKPFLWVVRPKSVA---  335

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
             E+  IP EL EGT+  GYIV WAPQE VL H A+GGFLTHSGWNSTLESI  GVPMICW
Sbjct  336  -EDYQIPEELLEGTRQRGYIVEWAPQEEVLGHPAIGGFLTHSGWNSTLESIYEGVPMICW  394

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            PF+ADQQ NSR  GEVWK+GLDMKD CDR  +E+++++L+E RK EF +    M KLA++
Sbjct  395  PFYADQQVNSRLAGEVWKIGLDMKDTCDRVIIEKMVKDLIETRKDEFAKSTRLMAKLARK  454

Query  259  AISEGGSSYCNFDCLIQDM  203
            + SE GSSYCN D LI+D+
Sbjct  455  SASENGSSYCNLDRLIKDI  473



>ref|XP_011085130.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Sesamum 
indicum]
Length=472

 Score =   265 bits (678),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 122/206 (59%), Positives = 160/206 (78%), Gaps = 5/206 (2%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            +  +C+  LD Q  +SV++VSFG+++V+  QQL+EFWYGLVNSGK FLWV+ ++L AG  
Sbjct  270  QHRSCIEWLDDQPLKSVVFVSFGNMTVLKSQQLVEFWYGLVNSGKPFLWVVPANLTAG--  327

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
                 IP+EL EG+  +G +V WAPQE VL H A GGFLTH GWNSTLESI  GVPMICW
Sbjct  328  ---CRIPTELIEGSGKSGKVVDWAPQEEVLSHPATGGFLTHGGWNSTLESIYEGVPMICW  384

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            PF+ADQQ NSR V EVW+VG+DMKD+CDR +VE+ +RELME R+ EFL+ ++++ +LA++
Sbjct  385  PFYADQQVNSRLVEEVWRVGVDMKDICDRKTVEKAVRELMEVRREEFLKSSKDIARLARK  444

Query  259  AISEGGSSYCNFDCLIQDMIKVNEAT  182
            +ISEGGSSY N DCLI+D+  +N A 
Sbjct  445  SISEGGSSYANLDCLIKDIKHMNYAN  470



>ref|XP_009597175.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=489

 Score =   266 bits (679),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 122/202 (60%), Positives = 155/202 (77%), Gaps = 1/202 (0%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED++C+  LD Q   SVIYVSFGS+  +T+  L EFW+GLVNSG++FLWV+R D +   +
Sbjct  285  EDKSCLKWLDDQPANSVIYVSFGSLVTVTKNVLTEFWHGLVNSGQRFLWVIRHDSIT-DN  343

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
            D+E+ I  ELKEG   NGYIV WAPQE VL H A+GGFLTHSGWNSTLESI  GVPMICW
Sbjct  344  DKEAQIEEELKEGVIENGYIVSWAPQEEVLAHTAIGGFLTHSGWNSTLESIIEGVPMICW  403

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P  ADQQ NSR+V EVWK+GLDMKD CDR  +E+++R+LME R+ EFL+RA +M KLA+ 
Sbjct  404  PQLADQQINSRYVEEVWKLGLDMKDTCDRVIIEKMVRDLMELRRSEFLQRANDMAKLARA  463

Query  259  AISEGGSSYCNFDCLIQDMIKV  194
            +++E GSS  N   L+QD++ +
Sbjct  464  SVAEAGSSDSNLARLVQDIVSM  485



>gb|KDO61155.1| hypothetical protein CISIN_1g037374mg [Citrus sinensis]
Length=463

 Score =   265 bits (677),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 155/198 (78%), Gaps = 1/198 (1%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D +C+A LD Q  +SVIYVSFGS++V++R QL+ F+YGLVNS   FLWV+R DL++GKD 
Sbjct  257  DRSCIAWLDKQPKQSVIYVSFGSVAVMSRDQLIVFYYGLVNSKNGFLWVIRPDLISGKDG  316

Query  616  EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWP  437
            E S IP E+ E TK  GYI GW PQE VL H AVGGFL H GWNSTLESI AG+PMICWP
Sbjct  317  E-SQIPEEVVEATKERGYIAGWVPQEEVLAHKAVGGFLIHCGWNSTLESIMAGMPMICWP  375

Query  436  FFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKEA  257
             FADQQ NSRFV EVWK+GLD+KD+ DR+ VE+ + +LM KRK EF+E A+ M  LAK++
Sbjct  376  SFADQQINSRFVDEVWKLGLDIKDLFDRNIVEKAVNDLMVKRKEEFMESADQMANLAKKS  435

Query  256  ISEGGSSYCNFDCLIQDM  203
            ++EGGS YCN D L++D+
Sbjct  436  VNEGGSLYCNLDRLVKDI  453



>ref|XP_006355679.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Solanum tuberosum]
Length=482

 Score =   265 bits (677),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 127/204 (62%), Positives = 155/204 (76%), Gaps = 1/204 (0%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED TC+  L+ Q P SVIYVSFGSI+ +T  QL+EFWYGLVNSG+KFLWV+R D +AG +
Sbjct  278  EDRTCIDWLNDQLPNSVIYVSFGSIATMTNDQLIEFWYGLVNSGQKFLWVIRPDSIAG-E  336

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
            +  S IP +L  GTK  GYIV WAPQE VL H AVGGF TH GWNS LES+  G PMICW
Sbjct  337  EWRSKIPVDLATGTKERGYIVEWAPQEEVLAHPAVGGFWTHCGWNSILESVYEGKPMICW  396

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P+F DQQ NSRFV +VW +GLDMKD CDR  VE+++++LM  RK EFLERA +M KLAK 
Sbjct  397  PYFYDQQVNSRFVEKVWGIGLDMKDTCDREIVEKMVKDLMVLRKEEFLERANHMSKLAKN  456

Query  259  AISEGGSSYCNFDCLIQDMIKVNE  188
             + EGGSSY NFD L++D+  +++
Sbjct  457  CLMEGGSSYSNFDRLVKDIKSLSD  480



>ref|XP_004150246.1| PREDICTED: UDP-glycosyltransferase 85A1-like [Cucumis sativus]
 gb|KGN50613.1| hypothetical protein Csa_5G196560 [Cucumis sativus]
Length=476

 Score =   265 bits (676),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 124/198 (63%), Positives = 154/198 (78%), Gaps = 1/198 (1%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D TC+A LD+Q P SVIYVSFGSI+V+  + LMEFW+GLVNSG+ FLWV+R DLV+GK+ 
Sbjct  273  DRTCLAWLDNQPPGSVIYVSFGSITVMGNEGLMEFWHGLVNSGRNFLWVIRPDLVSGKNG  332

Query  616  EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWP  437
            E   IP++L+EGTK  GY+VGWAPQE VL H AVGGFLTHSGWNSTLESI AG  M+CWP
Sbjct  333  EIE-IPADLEEGTKQRGYVVGWAPQEKVLSHEAVGGFLTHSGWNSTLESIVAGKAMVCWP  391

Query  436  FFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKEA  257
            + ADQQ NSRFV  VWK+G+DMKD+CDR  V +++ E+M  RK EF   A  M  LA+ +
Sbjct  392  YTADQQVNSRFVSNVWKLGVDMKDMCDREIVAKMVNEVMVNRKEEFKRSAIEMANLARRS  451

Query  256  ISEGGSSYCNFDCLIQDM  203
            +S GGSSY +FD L+ ++
Sbjct  452  VSLGGSSYADFDRLVNEI  469



>ref|XP_009590620.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=524

 Score =   264 bits (675),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 153/199 (77%), Gaps = 1/199 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED++C+  L++Q P SVIYVSFGSI+ +T++QLMEFWYGLVNS + FLWV+R D VAG D
Sbjct  323  EDKSCINWLNNQLPNSVIYVSFGSIATMTKEQLMEFWYGLVNSKQNFLWVIRLDSVAG-D  381

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
            D ++ IP EL EGTK  GYIVGWAPQE VL H +VGGF TH GWNS LE++  G PMICW
Sbjct  382  DWKNKIPLELVEGTKERGYIVGWAPQEEVLAHPSVGGFWTHCGWNSILETVYEGKPMICW  441

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P+F DQQ NSRFV   WK+GLDMKD CDR  VE+++++LM  +K EFLERA  M   AK+
Sbjct  442  PYFMDQQVNSRFVEAAWKLGLDMKDTCDRKIVEKMVKDLMVVKKEEFLERANQMSNFAKK  501

Query  259  AISEGGSSYCNFDCLIQDM  203
             + EGGSSY NF+ L+ D+
Sbjct  502  CLKEGGSSYSNFERLVNDI  520



>gb|KDO58004.1| hypothetical protein CISIN_1g037999mg [Citrus sinensis]
Length=447

 Score =   262 bits (669),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 119/197 (60%), Positives = 153/197 (78%), Gaps = 1/197 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED +CM  LDSQ  RSV+YVSFGS   + R+Q++EFW+G+VNSGK+FLWV+RSDL+ G+ 
Sbjct  251  EDRSCMTWLDSQPSRSVLYVSFGSFIKLGREQILEFWHGMVNSGKRFLWVIRSDLIDGEP  310

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
                P+P EL++GTK  G IV WAPQE VL H A+GGFLTHSGWNSTLES+ AGVPMICW
Sbjct  311  GV-GPVPVELEQGTKERGCIVSWAPQEEVLAHQAIGGFLTHSGWNSTLESLVAGVPMICW  369

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P   DQQ NSR V E+WK+GLDMKD CDRS++E L+R+LM+ ++ + +E    + K+A++
Sbjct  370  PQIGDQQVNSRCVSEIWKIGLDMKDTCDRSTIENLVRDLMDNKRDKIMESTVQIAKMARD  429

Query  259  AISEGGSSYCNFDCLIQ  209
            A+ EGGSSY N D LI+
Sbjct  430  AVKEGGSSYRNLDKLIK  446



>ref|XP_008464906.1| PREDICTED: UDP-glycosyltransferase 85A3-like isoform X1 [Cucumis 
melo]
Length=483

 Score =   263 bits (671),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/198 (62%), Positives = 152/198 (77%), Gaps = 1/198 (1%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D +C+  LD+Q   SVIYVSFGSI+V+  ++LMEFW+GLVNSG+ FLWV+R DLV GK+ 
Sbjct  275  DRSCLTWLDNQPAGSVIYVSFGSITVMGNRELMEFWHGLVNSGRNFLWVIRPDLVKGKNG  334

Query  616  EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWP  437
            E   IP+EL+EGTK  GY+VGW PQE VL H AVGGFLTHSGWNSTLESI AG PMICWP
Sbjct  335  EIE-IPAELEEGTKQRGYMVGWTPQEKVLCHEAVGGFLTHSGWNSTLESIVAGKPMICWP  393

Query  436  FFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKEA  257
            F  DQQ NSRFV  +W +GLDMKD+CDR +V +++ ++M  RK EF+  A  +  LA+ +
Sbjct  394  FGFDQQVNSRFVSNMWNLGLDMKDLCDRETVAKMVNDVMVNRKEEFVRSATEIANLARRS  453

Query  256  ISEGGSSYCNFDCLIQDM  203
            +  GGSSY NFD LI+D+
Sbjct  454  VKPGGSSYANFDRLIEDI  471



>ref|XP_008464907.1| PREDICTED: UDP-glycosyltransferase 85A3-like isoform X2 [Cucumis 
melo]
Length=483

 Score =   262 bits (670),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/198 (62%), Positives = 152/198 (77%), Gaps = 1/198 (1%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D +C+  LD+Q   SVIYVSFGSI+V+  ++LMEFW+GLVNSG+ FLWV+R DLV GK+ 
Sbjct  275  DRSCLTWLDNQPAGSVIYVSFGSITVMGNRELMEFWHGLVNSGRNFLWVIRPDLVKGKNG  334

Query  616  EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWP  437
            E   IP+EL+EGTK  GY+VGW PQE VL H AVGGFLTHSGWNSTLESI AG PMICWP
Sbjct  335  EIE-IPAELEEGTKQRGYMVGWTPQEKVLCHEAVGGFLTHSGWNSTLESIVAGKPMICWP  393

Query  436  FFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKEA  257
            F  DQQ NSRFV  +W +GLDMKD+CDR +V +++ ++M  RK EF+  A  +  LA+ +
Sbjct  394  FGFDQQVNSRFVSNMWNLGLDMKDLCDRETVAKMVNDVMVNRKEEFVRSATEIANLARRS  453

Query  256  ISEGGSSYCNFDCLIQDM  203
            +  GGSSY NFD LI+D+
Sbjct  454  VKPGGSSYANFDRLIEDI  471



>ref|XP_006481394.1| PREDICTED: UDP-glycosyltransferase 85A1-like [Citrus sinensis]
Length=469

 Score =   262 bits (669),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 119/197 (60%), Positives = 153/197 (78%), Gaps = 1/197 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED +CM  LDSQ  RSV+YVSFGS   + R+Q++EFW+G+VNSGK+FLWV+RSDL+ G+ 
Sbjct  273  EDRSCMTWLDSQPSRSVLYVSFGSFIKLGREQILEFWHGMVNSGKRFLWVIRSDLIDGEP  332

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
                P+P EL++GTK  G IV WAPQE VL H A+GGFLTHSGWNSTLES+ AGVPMICW
Sbjct  333  GV-GPVPVELEQGTKERGCIVSWAPQEEVLAHQAIGGFLTHSGWNSTLESLVAGVPMICW  391

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P   DQQ NSR V E+WK+GLDMKD CDRS++E L+R+LM+ ++ + +E    + K+A++
Sbjct  392  PQIGDQQVNSRCVSEIWKIGLDMKDTCDRSTIENLVRDLMDNKRDKIMESTVQIAKMARD  451

Query  259  AISEGGSSYCNFDCLIQ  209
            A+ EGGSSY N D LI+
Sbjct  452  AVKEGGSSYRNLDKLIK  468



>ref|XP_004172562.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Cucumis sativus]
Length=485

 Score =   262 bits (670),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/198 (61%), Positives = 154/198 (78%), Gaps = 1/198 (1%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D +C+  LD+Q   SVIYVSFGSI+V+  ++L+EFW+GLVNSG++FLWV+R DLV GK+ 
Sbjct  275  DRSCLTWLDNQAAGSVIYVSFGSITVMGNRELLEFWHGLVNSGRRFLWVIRPDLVKGKNG  334

Query  616  EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWP  437
            E   IP+EL+EGTK  GY+VGW PQE VL H AVGGFLTHSGWNSTLESI AG PMICWP
Sbjct  335  EIE-IPAELEEGTKQRGYMVGWTPQEKVLCHEAVGGFLTHSGWNSTLESIVAGKPMICWP  393

Query  436  FFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKEA  257
            +  DQQ NSRFV  VW +GLDMKD+CDR +V +++ ++M  RK EF+  A  +  LA+ +
Sbjct  394  YGFDQQVNSRFVSNVWNLGLDMKDLCDRETVAKMVNDVMVNRKEEFVRSATEIANLARRS  453

Query  256  ISEGGSSYCNFDCLIQDM  203
            ++ GGSSY NFD L++D+
Sbjct  454  VNPGGSSYANFDRLVEDI  471



>gb|EYU19961.1| hypothetical protein MIMGU_mgv1a005050mg [Erythranthe guttata]
Length=499

 Score =   262 bits (670),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/201 (61%), Positives = 153/201 (76%), Gaps = 4/201 (2%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED + +  L++Q  +SVIYVSFGSI+++TR ++ EFWYGLVNSG +FLWVMR D + G  
Sbjct  300  EDRSSITWLNNQPTKSVIYVSFGSITLLTRSEVFEFWYGLVNSGHRFLWVMRPDSITG--  357

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
             EE  +P EL  GTK  GY+VGW PQ  VL H +VG F THSGWNST+ES+AAGVPMICW
Sbjct  358  -EEYSVPEELDTGTKERGYLVGWVPQNEVLAHPSVGAFFTHSGWNSTMESVAAGVPMICW  416

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P+FADQ  NSRFV +VWKVGLDMKD CDR  VE+++RE+ME ++ EF ER     +LAK+
Sbjct  417  PYFADQTINSRFVSDVWKVGLDMKDSCDRVIVEKMVREVMEDKRDEFSERGVRFAELAKK  476

Query  259  AISEGGSSYCNFDCLIQDMIK  197
            A+SEGGSSY + + LI D IK
Sbjct  477  AVSEGGSSYSSLNRLI-DFIK  496



>gb|KDO69249.1| hypothetical protein CISIN_1g0487532mg, partial [Citrus sinensis]
Length=286

 Score =   256 bits (653),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 118/187 (63%), Positives = 148/187 (79%), Gaps = 1/187 (1%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D +C+A LD+Q  +SVI+VSFGS++V+ R QL+EFWYGLVNS K+FLWV+R DL++GKD 
Sbjct  101  DRSCIAWLDNQPSKSVIFVSFGSVAVMQRDQLIEFWYGLVNSHKRFLWVIRPDLISGKDG  160

Query  616  EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWP  437
            E   IP EL + TK  GYI GW PQE VL H AVGGFLTH GWNSTLESI A +PMICWP
Sbjct  161  ENQ-IPEELDKATKERGYIAGWVPQEEVLGHKAVGGFLTHCGWNSTLESIVARMPMICWP  219

Query  436  FFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKEA  257
             FADQQ NSRFV EVWK+GLDMKD+CDR  VE+++ EL+ +R+  F++ A+ M  LA ++
Sbjct  220  SFADQQINSRFVDEVWKLGLDMKDLCDRKIVEKMVNELLVERRAAFMKSADRMANLAIKS  279

Query  256  ISEGGSS  236
            ++EGGSS
Sbjct  280  VNEGGSS  286



>ref|XP_006355680.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Solanum tuberosum]
Length=482

 Score =   261 bits (668),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 126/204 (62%), Positives = 154/204 (75%), Gaps = 1/204 (0%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED TC+  L+ Q P SVIYVSFGSI+ +T  QL+EFWYGLVNSG+KFLWV+R D +AG +
Sbjct  278  EDRTCIDWLNDQLPNSVIYVSFGSIATMTNDQLIEFWYGLVNSGQKFLWVIRPDSIAG-E  336

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
            +  S IP +L  GTK  GYIV WAPQE VL H AVGGF TH GWNS LES+  G PMICW
Sbjct  337  EWRSKIPVDLATGTKERGYIVEWAPQEEVLAHPAVGGFWTHCGWNSILESVYEGKPMICW  396

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P+F DQQ NSRFV +VW +GLDMKD CDR  VE+++++LM  RK EFL RA +M KLAK 
Sbjct  397  PYFFDQQVNSRFVEKVWGIGLDMKDTCDREIVEKMVKDLMVLRKEEFLGRANHMSKLAKN  456

Query  259  AISEGGSSYCNFDCLIQDMIKVNE  188
             + EGGSSY NFD L++D+  +++
Sbjct  457  CLMEGGSSYSNFDRLVKDIKSLSD  480



>ref|XP_006429244.1| hypothetical protein CICLE_v10013877mg [Citrus clementina]
 gb|ESR42484.1| hypothetical protein CICLE_v10013877mg [Citrus clementina]
Length=477

 Score =   261 bits (667),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 119/199 (60%), Positives = 153/199 (77%), Gaps = 1/199 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED +CM  LDSQ  RSV+YVSFGS   + R+Q++EFW+G+VNSGK+FLWV+RSDL+ G+ 
Sbjct  273  EDRSCMTWLDSQPSRSVLYVSFGSFIKLGREQILEFWHGMVNSGKRFLWVIRSDLIDGEP  332

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
                P+P EL +GTK  G IV WAPQE VL H A+GGFLTHSGWNSTLES+ AGVPMICW
Sbjct  333  GV-GPVPVELDQGTKERGCIVSWAPQEEVLAHQAIGGFLTHSGWNSTLESLVAGVPMICW  391

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P   DQQ NSR V E+WK+GLDMKD CDRS++E L R+LM+ ++ + +E    + K+A++
Sbjct  392  PQIGDQQVNSRCVSEIWKIGLDMKDTCDRSTIENLARDLMDNKRDKIMESTVQIAKMARD  451

Query  259  AISEGGSSYCNFDCLIQDM  203
            A+ EGGSSY N + LI+D+
Sbjct  452  AVKEGGSSYRNLEKLIEDI  470



>ref|XP_006486448.1| PREDICTED: UDP-glycosyltransferase 85A1-like [Citrus sinensis]
Length=476

 Score =   261 bits (667),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 120/198 (61%), Positives = 151/198 (76%), Gaps = 4/198 (2%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D +C+  L  Q  RSV+YVSFGSI+++ R+QL+EFW+GLV+S ++FLWV+R D V G+ D
Sbjct  276  DRSCIEWLGKQPVRSVLYVSFGSITLLKREQLIEFWHGLVDSKQRFLWVIRPDSVIGEGD  335

Query  616  EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWP  437
                 P+EL EGTK  G++V W PQE VL H AV GFLTHSGWNSTLESI AGVPMICWP
Sbjct  336  A----PAELVEGTKERGHLVSWVPQEEVLAHQAVAGFLTHSGWNSTLESIVAGVPMICWP  391

Query  436  FFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKEA  257
            +FADQQ NSRFV EVW +GLDMKDVCDR+ VE+++ +LM +RK EF+  A+ M  +A+  
Sbjct  392  YFADQQINSRFVSEVWNLGLDMKDVCDRNVVEKMVNDLMVERKEEFMRAADRMATMARTT  451

Query  256  ISEGGSSYCNFDCLIQDM  203
             +EGG SYCN D LI D+
Sbjct  452  ANEGGPSYCNLDRLIDDI  469



>ref|XP_006435571.1| hypothetical protein CICLE_v10031408mg [Citrus clementina]
 gb|ESR48811.1| hypothetical protein CICLE_v10031408mg [Citrus clementina]
Length=476

 Score =   261 bits (667),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 120/198 (61%), Positives = 151/198 (76%), Gaps = 4/198 (2%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D +C+  L  Q  RSV+YVSFGSI+++ R+QL+EFW+GLV+S ++FLWV+R D V G+ D
Sbjct  276  DRSCIEWLGKQPVRSVLYVSFGSITLLKREQLIEFWHGLVDSKQRFLWVIRPDSVIGEGD  335

Query  616  EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWP  437
                 P+EL EGTK  G++V W PQE VL H AV GFLTHSGWNSTLESI AGVPMICWP
Sbjct  336  A----PAELVEGTKERGHLVSWVPQEEVLAHQAVAGFLTHSGWNSTLESIVAGVPMICWP  391

Query  436  FFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKEA  257
            +FADQQ NSRFV EVW +GLDMKDVCDR+ VE+++ +LM +RK EF+  A+ M  +A+  
Sbjct  392  YFADQQINSRFVSEVWNLGLDMKDVCDRNVVEKMVNDLMVERKEEFMRAADRMATMARTT  451

Query  256  ISEGGSSYCNFDCLIQDM  203
             +EGG SYCN D LI D+
Sbjct  452  ANEGGPSYCNLDRLIDDI  469



>gb|KGN50614.1| hypothetical protein Csa_5G196570 [Cucumis sativus]
Length=485

 Score =   261 bits (666),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 119/198 (60%), Positives = 154/198 (78%), Gaps = 1/198 (1%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D +C+  LD+Q   SVIYVSFGSI+V+  ++L+EFW+GL NSG++FLWV+R DLV GK+ 
Sbjct  275  DRSCLTWLDNQAAGSVIYVSFGSITVMGNRELLEFWHGLFNSGRRFLWVIRPDLVKGKNG  334

Query  616  EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWP  437
            E   IP+EL+EGTK  GY+VGW PQE VL H AVGGFLTHSGWNSTLESI AG PMICWP
Sbjct  335  EIE-IPAELEEGTKQRGYMVGWTPQEKVLCHEAVGGFLTHSGWNSTLESIVAGKPMICWP  393

Query  436  FFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKEA  257
            +  DQQ NSRFV  VW +GLDMKD+CDR +V +++ ++M  RK EF+  A  +  LA+++
Sbjct  394  YGFDQQVNSRFVSNVWNLGLDMKDLCDRETVAKMVNDVMVNRKEEFVRSATEIANLARQS  453

Query  256  ISEGGSSYCNFDCLIQDM  203
            ++ GGSSY NFD L++D+
Sbjct  454  VNPGGSSYANFDRLVEDI  471



>gb|KDO38335.1| hypothetical protein CISIN_1g044936mg [Citrus sinensis]
Length=455

 Score =   259 bits (663),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 118/199 (59%), Positives = 153/199 (77%), Gaps = 1/199 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED +CM  LDSQ   +V+YVSFGS   + R+Q++EFW+G+VNSGK+FLWV+RSDL+ G+ 
Sbjct  251  EDRSCMTWLDSQPSGTVLYVSFGSFIKLGREQILEFWHGMVNSGKRFLWVIRSDLIDGEP  310

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
                P+P EL +GTK  G IV WAPQE VL H A+GGFLTHSGWNSTLES+ AGVPMICW
Sbjct  311  GV-GPVPVELDQGTKERGCIVSWAPQEEVLAHQAIGGFLTHSGWNSTLESMVAGVPMICW  369

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P   DQQ NSR V E+WK+GLDMKD CDRS++E L+R+LM+ ++ E +E    + K+A++
Sbjct  370  PQIGDQQVNSRCVSEIWKIGLDMKDTCDRSTIENLVRDLMDNKRDEIMESTVKIAKMARD  429

Query  259  AISEGGSSYCNFDCLIQDM  203
            A+ EGGSSY N + LI+D+
Sbjct  430  AVKEGGSSYRNLEKLIEDI  448



>gb|AIS39472.1| flavonoid UDP-glucosyltransferase 3 [Citrus x paradisi]
Length=476

 Score =   259 bits (663),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 119/198 (60%), Positives = 150/198 (76%), Gaps = 4/198 (2%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D +C+     Q  RSV+YVSFGSI+++ R+QL+EFW+GLV+S ++FLWV+R D V G+ D
Sbjct  276  DRSCIEWFGKQPVRSVLYVSFGSITLLKREQLIEFWHGLVDSKQRFLWVIRPDSVIGEGD  335

Query  616  EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWP  437
                 P+EL EGTK  G++V W PQE VL H AV GFLTHSGWNSTLESI AGVPMICWP
Sbjct  336  A----PAELVEGTKERGHLVSWVPQEEVLAHQAVAGFLTHSGWNSTLESIVAGVPMICWP  391

Query  436  FFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKEA  257
            +FADQQ NSRFV EVW +GLDMKDVCDR+ VE+++ +LM +RK EF+  A+ M  +A+  
Sbjct  392  YFADQQINSRFVSEVWNLGLDMKDVCDRNVVEKMVNDLMVERKEEFMRAADRMATMARTT  451

Query  256  ISEGGSSYCNFDCLIQDM  203
             +EGG SYCN D LI D+
Sbjct  452  ANEGGPSYCNLDRLIDDI  469



>ref|XP_008785471.1| PREDICTED: UDP-glycosyltransferase 85A4-like [Phoenix dactylifera]
Length=481

 Score =   259 bits (663),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/204 (59%), Positives = 160/204 (78%), Gaps = 1/204 (0%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED  CM  LDSQ  RSV+YVSFGS++V+TR++ MEFW+GLV+SG++FLWV+RSDL+  + 
Sbjct  272  EDRDCMTWLDSQPDRSVVYVSFGSLAVVTREEFMEFWHGLVDSGQRFLWVVRSDLINRRG  331

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
                 +P+E++EGT+  G +VGWAPQE VL H AVG FLTHSGWNSTLESIAAG PM+CW
Sbjct  332  GGTEVLPAEVEEGTRERGCMVGWAPQEEVLSHPAVGCFLTHSGWNSTLESIAAGKPMLCW  391

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLER-AENMGKLAK  263
            PFFADQQ NSRFV  VW +GLDMKD+C RS VE+++RE+ME  + E L R A  M ++AK
Sbjct  392  PFFADQQINSRFVSAVWGIGLDMKDLCGRSIVEKMVREVMEGERSEELRRNAREMAEMAK  451

Query  262  EAISEGGSSYCNFDCLIQDMIKVN  191
            ++++EGG+S+  F  LI+ ++ ++
Sbjct  452  KSVAEGGTSFNEFQSLIRLIMSLD  475



>ref|XP_010674283.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=487

 Score =   259 bits (662),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/198 (59%), Positives = 157/198 (79%), Gaps = 1/198 (1%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D++C++ LD +  +SV+YVSFGS++++T+ QL EFW GLV+S K FLWV+R +L+ G + 
Sbjct  282  DQSCISWLDQKPNKSVVYVSFGSLTILTKDQLREFWAGLVHSKKYFLWVIRPNLIIGSE-  340

Query  616  EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWP  437
             ++P P +L EGTK  G +V WAPQ+ VL H A+GGFLTHSGWNSTLESI AGVPM+CWP
Sbjct  341  LDNPTPDDLLEGTKKRGCLVKWAPQQEVLAHRAIGGFLTHSGWNSTLESIVAGVPMLCWP  400

Query  436  FFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKEA  257
            +FADQQ NSRFV EVW++GLDMKDVCDR+ VE++I +LM+ +K E     + + +LAK +
Sbjct  401  YFADQQVNSRFVSEVWRIGLDMKDVCDRTIVEKMINDLMDVKKDELQRSMDKISQLAKTS  460

Query  256  ISEGGSSYCNFDCLIQDM  203
            ISEGGSSY NF+ LI+D+
Sbjct  461  ISEGGSSYSNFNQLIEDI  478



>ref|XP_004150245.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Cucumis sativus]
Length=485

 Score =   259 bits (662),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 119/198 (60%), Positives = 153/198 (77%), Gaps = 1/198 (1%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D +C+  LD+Q   SVIYVSFGSI+V+  ++L+EFW+GLVNSG++FLWV+R DLV GK+ 
Sbjct  275  DRSCLTWLDNQAAGSVIYVSFGSITVMGNRELLEFWHGLVNSGRRFLWVIRPDLVKGKNG  334

Query  616  EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWP  437
            E   IP+EL+EGTK  GY+VGW PQE VL H AVGGFLTHSGWNSTLESI AG PMICWP
Sbjct  335  EIE-IPAELEEGTKQRGYMVGWTPQEKVLCHEAVGGFLTHSGWNSTLESIVAGKPMICWP  393

Query  436  FFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKEA  257
            +  DQ  NSRFV  VW +GLDMKD+CDR +V +++ ++M  RK EF+  A  +  LA+ +
Sbjct  394  YGFDQLVNSRFVSNVWNLGLDMKDLCDRETVAKMVNDVMVNRKEEFVRSATEIANLARRS  453

Query  256  ISEGGSSYCNFDCLIQDM  203
            ++ GGSSY NFD L++D+
Sbjct  454  VNPGGSSYANFDRLVEDI  471



>gb|AGZ84549.1| glycosyltransferase KGT31 [Pueraria montana var. lobata]
Length=479

 Score =   258 bits (660),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 126/203 (62%), Positives = 159/203 (78%), Gaps = 1/203 (0%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D  C+  LDSQ  +SVIYVSFGSI+ +TR++L+EFWYGLV+S K+FLWV+R D+VAGK++
Sbjct  274  DRGCLTWLDSQPLKSVIYVSFGSITTLTRERLLEFWYGLVDSKKRFLWVVRPDMVAGKEN  333

Query  616  EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWP  437
            +   IP EL+EGTK  G +VGWAPQE  L H A+GGFLTHSGWNSTLES+ AGVPMICWP
Sbjct  334  DGR-IPEELEEGTKERGLMVGWAPQEEALAHKAIGGFLTHSGWNSTLESLVAGVPMICWP  392

Query  436  FFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKEA  257
            +FADQQ NSRFV EVWK+GLDMKDVCDR  VE ++ +LM  R+ EFL  A+ M  LA ++
Sbjct  393  YFADQQVNSRFVNEVWKLGLDMKDVCDRHVVENMVNDLMVHRRDEFLRSAQAMAMLAHKS  452

Query  256  ISEGGSSYCNFDCLIQDMIKVNE  188
            +S  GSSY + D LIQ +  +++
Sbjct  453  VSPSGSSYSSLDQLIQYIKSISQ  475



>ref|XP_004149949.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Cucumis sativus]
 gb|KGN50608.1| hypothetical protein Csa_5G190520 [Cucumis sativus]
Length=478

 Score =   258 bits (659),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 119/198 (60%), Positives = 149/198 (75%), Gaps = 4/198 (2%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D +C+A LD   P+SVIYVSFGS+ VI   Q  EFW+GLVNSGK+FLWVMR + +AGKD 
Sbjct  273  DRSCLAWLDDHPPKSVIYVSFGSVVVIGDDQFREFWHGLVNSGKRFLWVMRPNSLAGKDG  332

Query  616  EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWP  437
                +P++LKE T   GYIV WAPQE VL H A+G FLTHSGWNSTLESI AGVPMICWP
Sbjct  333  ----VPADLKEKTNERGYIVDWAPQEEVLAHKAIGAFLTHSGWNSTLESIVAGVPMICWP  388

Query  436  FFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKEA  257
             FADQQTNSR+V +VWK+GLDMKDVC+R +V +++ ++ME RK E +     M + A  +
Sbjct  389  QFADQQTNSRYVSDVWKIGLDMKDVCNRETVTKMVNDVMENRKNELMGSVIEMAESAITS  448

Query  256  ISEGGSSYCNFDCLIQDM  203
            + EGGSSYC+ + +I D+
Sbjct  449  VEEGGSSYCDLERMINDI  466



>emb|CDP16024.1| unnamed protein product [Coffea canephora]
Length=483

 Score =   258 bits (660),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 119/199 (60%), Positives = 151/199 (76%), Gaps = 0/199 (0%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED++C+A L+ Q  +SVIYVS GS++ +T+ QLME WYGLVNSG +FLWV R   +AG  
Sbjct  278  EDKSCIAWLNDQPVKSVIYVSIGSLATMTKDQLMEIWYGLVNSGVRFLWVQRPGSIAGSA  337

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
             +   IP EL + T+  GYIV WAPQE VL H  +GGFLTHSGWNSTLESIA GVPMI W
Sbjct  338  AKGDQIPEELAKATQERGYIVDWAPQEEVLGHPGIGGFLTHSGWNSTLESIAEGVPMIGW  397

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P+F DQQ NSR++ EVWK+GLDMKD CDR  VE++++++M+ R+ EFL RA  M KLA  
Sbjct  398  PYFVDQQVNSRYLLEVWKLGLDMKDTCDRVIVEKMVKDVMQLRRDEFLPRANEMAKLANS  457

Query  259  AISEGGSSYCNFDCLIQDM  203
            ++SEGGSSY + D LI+D+
Sbjct  458  SVSEGGSSYNDLDNLIEDI  476



>ref|XP_009795416.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nicotiana 
sylvestris]
Length=478

 Score =   256 bits (655),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 152/199 (76%), Gaps = 1/199 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED +CM  LD Q  +SV++VS GS++ +++ QL+E WYGLVNS  +FLWV R   V G +
Sbjct  276  EDMSCMDWLDEQPNKSVLFVSIGSVATMSKAQLLEIWYGLVNSKTRFLWVQRPGSVIGLE  335

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
             E + IP EL + TK  G IV WAPQE VL H ++GGFLTH GWNSTLESI  GVPMICW
Sbjct  336  -ENNDIPMELSKYTKERGCIVSWAPQEEVLAHPSIGGFLTHCGWNSTLESIVEGVPMICW  394

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P+F DQQ NSR+VGEVWK+GLDMKDVCDR+ VE+++RE+ME RK EFLER   M KLA E
Sbjct  395  PYFVDQQVNSRYVGEVWKLGLDMKDVCDRAIVEKMVREIMEVRKIEFLERGREMRKLAIE  454

Query  259  AISEGGSSYCNFDCLIQDM  203
            +++EGGSSY + D L++D+
Sbjct  455  SVNEGGSSYKDLDSLVEDI  473



>ref|XP_004162780.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Cucumis sativus]
Length=485

 Score =   256 bits (655),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 118/198 (60%), Positives = 153/198 (77%), Gaps = 1/198 (1%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D +C+  LD+Q   SVIYVSFGSI+V+  ++LMEFW+GLVNSG+ FLWV+R DL+ G++ 
Sbjct  275  DRSCLTWLDNQAAGSVIYVSFGSITVMGNRELMEFWHGLVNSGRSFLWVIRPDLLKGENG  334

Query  616  EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWP  437
            E   IP+EL+EGTK  GY+VGW PQE VL H AVGGFLTHSGWNSTLES+ AG PMICWP
Sbjct  335  EIE-IPAELEEGTKQRGYMVGWTPQEKVLCHEAVGGFLTHSGWNSTLESMVAGKPMICWP  393

Query  436  FFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKEA  257
            +  DQ  NSRFV  VW +GLDMKD+CDR +V +++ ++M  RK EF+  A  +  LA+++
Sbjct  394  YGFDQLVNSRFVSNVWNLGLDMKDLCDRETVAKMVNDVMVNRKEEFVRSATEIANLARQS  453

Query  256  ISEGGSSYCNFDCLIQDM  203
            ++ GGSSY NFD LI+D+
Sbjct  454  VNPGGSSYANFDRLIEDI  471



>gb|KDO69251.1| hypothetical protein CISIN_1g011832mg [Citrus sinensis]
Length=476

 Score =   256 bits (654),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 119/198 (60%), Positives = 149/198 (75%), Gaps = 4/198 (2%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D +C+  L  Q  RSV+YVSFGSI+++ R+QL+EFW+GLV+S ++FLWV+R D V G+ D
Sbjct  276  DRSCIEWLGKQPVRSVLYVSFGSITLLKREQLIEFWHGLVDSKQRFLWVIRPDSVIGEGD  335

Query  616  EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWP  437
              +    EL EGTK  G +V W PQE VL H AV GFLTHSGWNSTLESI AGVPMICWP
Sbjct  336  ALA----ELVEGTKERGLLVSWVPQEEVLAHQAVAGFLTHSGWNSTLESIVAGVPMICWP  391

Query  436  FFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKEA  257
            +FADQQ NSRFV EVW +GLDMKDVCDR+ VE+++ +LM +RK EF+  A+ M  +A+  
Sbjct  392  YFADQQINSRFVSEVWNLGLDMKDVCDRNVVEKMVNDLMVERKEEFMRAADRMATMARTT  451

Query  256  ISEGGSSYCNFDCLIQDM  203
             +EGG SYCN D LI D+
Sbjct  452  ANEGGPSYCNLDRLIDDI  469



>ref|XP_010923185.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Elaeis 
guineensis]
Length=484

 Score =   256 bits (653),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 120/204 (59%), Positives = 162/204 (79%), Gaps = 4/204 (2%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED +CM  LDSQ PRSV+YVSFGS++V++R++LMEFW+GLV+SG++FLWV+RSDLV GK 
Sbjct  278  EDRSCMTWLDSQPPRSVVYVSFGSVAVMSREELMEFWHGLVDSGERFLWVLRSDLVEGKT  337

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
             E   +P+E  EGT+  G IVGWAPQE VL H AVG FLTHSGWNSTLES++AGVPMICW
Sbjct  338  GEA--VPAE-AEGTRERGCIVGWAPQEEVLSHPAVGCFLTHSGWNSTLESVSAGVPMICW  394

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLE-RAENMGKLAK  263
            P FADQQ NSRFV +VW++G DMKD C+RS VE+++R++M + + E L   A  M +LA+
Sbjct  395  PCFADQQINSRFVSDVWRIGADMKDKCERSIVEKMVRDVMVRERAERLRTSAMEMAELAR  454

Query  262  EAISEGGSSYCNFDCLIQDMIKVN  191
             ++++GGSSY ++  L++ +  ++
Sbjct  455  RSVAKGGSSYRDYWSLVEHIRAIS  478



>gb|KDO43669.1| hypothetical protein CISIN_1g011792mg [Citrus sinensis]
Length=477

 Score =   255 bits (652),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 116/199 (58%), Positives = 152/199 (76%), Gaps = 1/199 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED +CM  L SQ  RSV+YVSFGS   ++  Q++EFW+G+VNSGK FLWV+RSDL+ G+ 
Sbjct  273  EDRSCMTWLGSQPSRSVLYVSFGSFIKLSGDQILEFWHGIVNSGKGFLWVIRSDLIDGES  332

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
                P+P+EL +GTK  G IV WAPQE VL H A+GGFLTHSGWNSTLES+ AGVPMICW
Sbjct  333  GV-GPVPAELDQGTKERGCIVSWAPQEEVLAHQAIGGFLTHSGWNSTLESMVAGVPMICW  391

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P   DQQ NSR V E+WK+G DMKD CDRS++E+L+R+LM+ ++ + +E    + K+A++
Sbjct  392  PQVGDQQVNSRCVSEIWKIGFDMKDTCDRSTIEKLVRDLMDNKRDKIMESTVQIAKMARD  451

Query  259  AISEGGSSYCNFDCLIQDM  203
            A+ EGGSSY N + LI+D+
Sbjct  452  AVKEGGSSYRNLEKLIEDI  470



>ref|XP_004171873.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Cucumis sativus]
Length=478

 Score =   255 bits (652),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 119/207 (57%), Positives = 153/207 (74%), Gaps = 4/207 (2%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            + +C+A LD   P+SVIYVSFGS+ VI   Q  EFW+GLVNSGK+FLWV+R + +AGKD 
Sbjct  273  NRSCLAWLDDHPPKSVIYVSFGSVVVIGDDQFREFWHGLVNSGKRFLWVVRPNSLAGKDG  332

Query  616  EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWP  437
                +P++LKE T   GYIV WAPQE VL H A+G FLTHSGWNSTLESI AGVPMICWP
Sbjct  333  ----VPADLKEKTNERGYIVDWAPQEEVLAHKAIGAFLTHSGWNSTLESIVAGVPMICWP  388

Query  436  FFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKEA  257
             FADQQTNSR+V +VWK+GLDMKDVC+R +V +++ ++ME RK E +     M + A  +
Sbjct  389  QFADQQTNSRYVSDVWKIGLDMKDVCNRETVTKMVNDVMENRKNELMGSVIEMAESAITS  448

Query  256  ISEGGSSYCNFDCLIQDMIKVNEATRE  176
            + EGGSSYC+ + +I D+  + +  RE
Sbjct  449  VEEGGSSYCDLERMINDIRLLCKRQRE  475



>gb|KJB74142.1| hypothetical protein B456_011G275300 [Gossypium raimondii]
Length=313

 Score =   250 bits (639),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 114/198 (58%), Positives = 147/198 (74%), Gaps = 0/198 (0%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D++C+  L+ Q  RSVIYVSFGSI+ ++R+QL+E WYGL+N   KFL V+R + V GKD 
Sbjct  106  DKSCIFWLNKQPNRSVIYVSFGSITSMSREQLVELWYGLLNCTTKFLLVVRPNSVIGKDG  165

Query  616  EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWP  437
            E   +  EL E +K  GYIV WAPQEAV +H A+GGF TH+GWNSTLES+ AGVPMICWP
Sbjct  166  EGEDVVMELMEKSKDRGYIVNWAPQEAVFNHPAIGGFFTHNGWNSTLESVVAGVPMICWP  225

Query  436  FFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKEA  257
             FADQ  NSR V  VWK+GLDMKDVCDR  VE+++ ++M  RK EF + A  M K+  ++
Sbjct  226  QFADQHVNSRVVSVVWKIGLDMKDVCDRKIVEKMVNDVMVDRKEEFAKSASEMAKVTNQS  285

Query  256  ISEGGSSYCNFDCLIQDM  203
            ++ GGSSY N DCL++D+
Sbjct  286  VNVGGSSYSNLDCLVEDI  303



>ref|XP_006423294.1| hypothetical protein CICLE_v10030404mg [Citrus clementina]
 ref|XP_006469143.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Citrus sinensis]
 gb|ESR36534.1| hypothetical protein CICLE_v10030404mg [Citrus clementina]
Length=477

 Score =   255 bits (652),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 116/199 (58%), Positives = 152/199 (76%), Gaps = 1/199 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED +CM  L SQ  RSV+YVSFGS   ++  Q++EFW+G+VNSGK FLWV+RSDL+ G+ 
Sbjct  273  EDRSCMTWLGSQPSRSVLYVSFGSFIKLSGDQILEFWHGIVNSGKGFLWVIRSDLIDGES  332

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
                P+P+EL +GTK  G IV WAPQE VL H A+GGFLTHSGWNSTLES+ AGVPMICW
Sbjct  333  GV-GPVPAELDQGTKERGCIVSWAPQEEVLAHQAIGGFLTHSGWNSTLESMVAGVPMICW  391

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P   DQQ NSR V E+WK+G DMKD CDRS++E+L+R+LM+ ++ + +E    + K+A++
Sbjct  392  PQVGDQQVNSRCVSEIWKIGFDMKDTCDRSTIEKLVRDLMDNKRDKIMESTVQIAKMARD  451

Query  259  AISEGGSSYCNFDCLIQDM  203
            A+ EGGSSY N + LI+D+
Sbjct  452  AVKEGGSSYRNLEKLIEDI  470



>ref|XP_010688868.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Beta 
vulgaris subsp. vulgaris]
Length=509

 Score =   256 bits (653),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 121/206 (59%), Positives = 154/206 (75%), Gaps = 6/206 (3%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED +C+  LD+Q  +SV++VS GS++V+T+ QLME W GL+NS  +FLWV R+D +   +
Sbjct  291  EDRSCLGWLDAQPQKSVLFVSIGSLAVMTKDQLMEIWCGLINSKTRFLWVRRADSIIKSN  350

Query  619  DEE------SPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAG  458
            +EE      S +PSE+ EG K  G IV WAPQE VL H A+GGFLTHSGWNSTLESI AG
Sbjct  351  NEEADQSQYSEVPSEVIEGIKDRGCIVRWAPQEEVLAHKAIGGFLTHSGWNSTLESIVAG  410

Query  457  VPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENM  278
            VPMICWPFF DQQ NSR V EVWK+GLDMKD C+R  +E++I++LM  RK EFL RA+ M
Sbjct  411  VPMICWPFFVDQQVNSRVVSEVWKIGLDMKDNCNRVVIEKMIKDLMGTRKDEFLARADEM  470

Query  277  GKLAKEAISEGGSSYCNFDCLIQDMI  200
            GKLA +A+ E GSSY + + LI D++
Sbjct  471  GKLAAQAVVEDGSSYNSLNRLIDDIM  496



>gb|KGN50615.1| UDP-glucosyltransferase family 1 protein [Cucumis sativus]
Length=485

 Score =   255 bits (651),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/198 (60%), Positives = 152/198 (77%), Gaps = 1/198 (1%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D +C+  L +Q   SVIYVSFGSI+V+  ++LMEFW+GLVNSG+ FLWV+R DL+ G++ 
Sbjct  275  DRSCLTWLGNQAAGSVIYVSFGSITVMGNRELMEFWHGLVNSGRSFLWVIRPDLLKGENG  334

Query  616  EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWP  437
            E   IP+EL+EGTK  GY+VGW PQE VL H AVGGFLTHSGWNSTLESI AG PMICWP
Sbjct  335  EIE-IPAELEEGTKQRGYMVGWTPQEKVLCHEAVGGFLTHSGWNSTLESIVAGKPMICWP  393

Query  436  FFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKEA  257
            +  DQ  NSRFV  VW +GLDMKD+CDR +V +++ ++M  RK EF+  A  +  LA+++
Sbjct  394  YGFDQLVNSRFVSNVWNLGLDMKDLCDRETVAKMVNDVMVNRKEEFVRSATEIANLARQS  453

Query  256  ISEGGSSYCNFDCLIQDM  203
            ++ GGSSY NFD LI+D+
Sbjct  454  VNPGGSSYANFDRLIEDI  471



>ref|XP_008811497.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Phoenix dactylifera]
Length=499

 Score =   255 bits (651),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 124/200 (62%), Positives = 155/200 (78%), Gaps = 4/200 (2%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVA--G  626
            ED TCM  LDSQ  +SV+YVSFGS+++++++  +EFW GLVNSG++FLWV+R DLV   G
Sbjct  293  EDRTCMTWLDSQPHKSVVYVSFGSLTLVSQEAFLEFWVGLVNSGQRFLWVVRPDLVGEEG  352

Query  625  KDDEES-PIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPM  449
            +  EE  P+  E+K GTK  G +V W PQE VL H AVG FLTHSGWNSTLESI AGVPM
Sbjct  353  RRWEEMLPVTEEVKVGTKERGCLVKWVPQEEVLAHPAVGCFLTHSGWNSTLESIVAGVPM  412

Query  448  ICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELME-KRKGEFLERAENMGK  272
            +CWPFFADQQ NSRFV EVWKVGLDMKD+C RS VE+++RE+ME  R  E+   A+ M K
Sbjct  413  LCWPFFADQQINSRFVSEVWKVGLDMKDLCSRSIVEKMVREMMEGPRAEEWRRSAKEMAK  472

Query  271  LAKEAISEGGSSYCNFDCLI  212
            +A+E+++EGGSSY +F  LI
Sbjct  473  MARESVAEGGSSYTDFRRLI  492



>dbj|BAK55741.1| UDP-glucose glucosyltransferase [Gardenia jasminoides]
Length=493

 Score =   254 bits (649),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 119/200 (60%), Positives = 155/200 (78%), Gaps = 1/200 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            E+++C++ LD+Q  +SVIYVS GS++++ ++QL+E W+GL NS  +FLWV R   + G D
Sbjct  284  ENKSCISWLDNQPAKSVIYVSIGSLALMGKEQLLEIWHGLANSEVRFLWVQRPGSITGLD  343

Query  619  DE-ESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMIC  443
            +E +  +P  L   T   G IV WAPQE VL H AVGGFLTHSGWNSTLESI  GVPMIC
Sbjct  344  EENDGGVPLNLCRATIERGCIVSWAPQEEVLAHPAVGGFLTHSGWNSTLESIVEGVPMIC  403

Query  442  WPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAK  263
             P+FADQQ NSR+VGEVWKVGLDMKD CDR  VE ++R+LMEKRK EFLE+A+++ KLAK
Sbjct  404  LPYFADQQINSRYVGEVWKVGLDMKDTCDRDIVEMMVRDLMEKRKDEFLEKADHVAKLAK  463

Query  262  EAISEGGSSYCNFDCLIQDM  203
             ++S+GG+SY   +CLI+D+
Sbjct  464  ASVSKGGASYNALNCLIEDI  483



>ref|XP_009613526.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=498

 Score =   254 bits (649),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 119/199 (60%), Positives = 150/199 (75%), Gaps = 1/199 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED +CM  LD    +SV++VS GS++ I++ Q +E WYGLVNS  +FLWV R   V G +
Sbjct  296  EDMSCMHWLDEHPKKSVLFVSIGSLATISKAQFLEIWYGLVNSKTRFLWVQRPGSVIGLE  355

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
             E + +P EL + TK  G IV WAPQE VL H +VGGFLTHSGWNSTLESI  GVPMICW
Sbjct  356  -ENNDVPVELSKSTKERGCIVSWAPQEEVLAHPSVGGFLTHSGWNSTLESIVEGVPMICW  414

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P+F DQQ NSR+VGEVWK+GLDMKD+CDR+ VE+++RE+ME RK EFLER   M  LA E
Sbjct  415  PYFVDQQVNSRYVGEVWKLGLDMKDICDRAIVEKMVREMMEVRKIEFLERVREMRNLAIE  474

Query  259  AISEGGSSYCNFDCLIQDM  203
            +++EGGSSY + D L++D+
Sbjct  475  SVNEGGSSYKDLDRLVEDI  493



>ref|XP_006367215.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Solanum tuberosum]
Length=472

 Score =   253 bits (647),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 153/199 (77%), Gaps = 0/199 (0%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED +C+  LD Q  +SVI+VS GS++ +++ Q +EFWYGLVNS  +FLWV R   + G +
Sbjct  269  EDMSCIDWLDKQPNKSVIFVSIGSLATMSKAQFLEFWYGLVNSKTRFLWVQRPGSIIGLE  328

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
            D+ + +P EL + TK  G I+ WAPQE VL H ++GGFLTHSGWNSTLESI  GVPMIC 
Sbjct  329  DDNNNVPMELVKSTKERGCIISWAPQEEVLAHPSIGGFLTHSGWNSTLESIVEGVPMICV  388

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P+F DQQ NSR+VGEVWK+GLDMKDVCDR+++E ++R++M+ +K EFLERA++M  LA  
Sbjct  389  PYFVDQQVNSRYVGEVWKLGLDMKDVCDRATIERMVRDVMDVKKIEFLERAKHMSDLAIA  448

Query  259  AISEGGSSYCNFDCLIQDM  203
            ++ EGGSSY + D LI+D+
Sbjct  449  SVGEGGSSYQDLDRLIEDI  467



>ref|XP_004239922.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Solanum 
lycopersicum]
Length=487

 Score =   254 bits (648),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 149/199 (75%), Gaps = 1/199 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED TC+  LD Q P SVIYVSFGSI+ +T  QL+EFWYGLVNS + FLWV+R + + G +
Sbjct  278  EDRTCIDWLDDQLPNSVIYVSFGSIATMTNDQLIEFWYGLVNSKQNFLWVIRPNSI-GDE  336

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
            +  S +P +L +GTK  GYIV WAPQE VL H AVGGF TH GWNS LES+  G PMICW
Sbjct  337  EWRSKMPVDLVKGTKERGYIVEWAPQEEVLAHPAVGGFWTHCGWNSILESVYEGKPMICW  396

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P+F DQQ NSRFV +VW +GLDMKD CDR  VE+++++LM  RK EFL RA +M KLAK 
Sbjct  397  PYFFDQQVNSRFVEKVWGLGLDMKDTCDREIVEKMVKDLMVLRKQEFLGRANHMSKLAKN  456

Query  259  AISEGGSSYCNFDCLIQDM  203
             + EGGSSY NFD L++D+
Sbjct  457  CLMEGGSSYSNFDRLVKDI  475



>dbj|BAK55740.1| UDP-glucose glucosyltransferase [Gardenia jasminoides]
Length=496

 Score =   254 bits (648),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 119/200 (60%), Positives = 155/200 (78%), Gaps = 1/200 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            E+++C++ LD+Q  +SVIYVS GS++++ ++QL+E W+GL NS  +FLWV R   + G D
Sbjct  287  ENKSCISWLDNQPAKSVIYVSIGSLALMGKEQLLEIWHGLANSEVRFLWVQRPGSITGLD  346

Query  619  DE-ESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMIC  443
            +E +  +P  L   T   G IV WAPQE VL H AVGGFLTHSGWNSTLESI  GVPMIC
Sbjct  347  EENDGGVPLNLCRATIERGCIVSWAPQEEVLAHPAVGGFLTHSGWNSTLESIVEGVPMIC  406

Query  442  WPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAK  263
             P+FADQQ NSR+VGEVWKVGLDMKD CDR  VE ++R+LMEKRK EFLE+A+++ KLAK
Sbjct  407  LPYFADQQINSRYVGEVWKVGLDMKDTCDRDIVEMMVRDLMEKRKDEFLEKADHVAKLAK  466

Query  262  EAISEGGSSYCNFDCLIQDM  203
             ++S+GG+SY   +CLI+D+
Sbjct  467  ASVSKGGASYNALNCLIEDI  486



>ref|XP_004302685.2| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=489

 Score =   253 bits (647),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 121/201 (60%), Positives = 156/201 (78%), Gaps = 2/201 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED +CM  LDSQ P SVI+VS+GS+  +TR QL+EFW+GLVNSG  FLWVMRSD+++ + 
Sbjct  286  EDRSCMTWLDSQRPGSVIFVSYGSLVKLTRVQLLEFWHGLVNSGSHFLWVMRSDVLSDEG  345

Query  619  DEESPI-PSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMIC  443
            +    + P+EL+ GTK  G+IV WAPQE VL H AVGGFLTHSGWNSTLE+I AGVPM+C
Sbjct  346  EHMRHVTPTELEMGTKERGFIVDWAPQEEVLAHDAVGGFLTHSGWNSTLEAIWAGVPMLC  405

Query  442  WPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERA-ENMGKLA  266
            WP  ADQQ NSR+VGEVWK+G+DMKD+CDR++VE++I+ LM   + E   R+ +   KLA
Sbjct  406  WPQVADQQVNSRWVGEVWKIGIDMKDMCDRTTVEKMIKALMGGEEREVFTRSVDRFSKLA  465

Query  265  KEAISEGGSSYCNFDCLIQDM  203
            + ++SE GSSY N + LIQD+
Sbjct  466  RASVSESGSSYHNLEKLIQDL  486



>ref|XP_010923184.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Elaeis 
guineensis]
Length=484

 Score =   253 bits (645),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 122/204 (60%), Positives = 157/204 (77%), Gaps = 4/204 (2%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED +C+  LDSQ  RSV+Y+SFGS++V++R +LMEFW+GLV+SGK+FLWV+R DLV GK 
Sbjct  281  EDRSCLKWLDSQPQRSVVYISFGSVTVMSRDELMEFWHGLVDSGKRFLWVVRPDLVEGKI  340

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
            +E      EL++ T+  G +VGWAPQE VL H AVG FLTHSGWNSTLES+AAGVPMICW
Sbjct  341  EEAM---QELEKETRERGCVVGWAPQEEVLAHPAVGCFLTHSGWNSTLESVAAGVPMICW  397

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLER-AENMGKLAK  263
            PFFADQQ NSR VGEVW++GLDMKD  +RS VE ++RE+ME  + E L R A  M + A+
Sbjct  398  PFFADQQVNSRLVGEVWRIGLDMKDKHERSVVERMVREVMEGDRAEELRRSAGEMAEHAR  457

Query  262  EAISEGGSSYCNFDCLIQDMIKVN  191
             +I EGGSSY  F+ L++ +  ++
Sbjct  458  RSIEEGGSSYRGFENLVEHIKAIS  481



>ref|XP_010032069.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Eucalyptus 
grandis]
 gb|KCW51454.1| hypothetical protein EUGRSUZ_J00979 [Eucalyptus grandis]
Length=479

 Score =   253 bits (645),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 118/198 (60%), Positives = 146/198 (74%), Gaps = 2/198 (1%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D +C++ LD Q P+SVIYVSFGSI+ +TR    EFWYGLVNSG++FLWV+R D +A  D 
Sbjct  277  DRSCISWLDKQPPKSVIYVSFGSITTLTRHDFTEFWYGLVNSGRRFLWVIRPDSLA--DG  334

Query  616  EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWP  437
                +P EL+E     G IVGWAPQE VLDH AV  FLTHSGWNSTLES+ AG PM+CWP
Sbjct  335  GNGAVPEELREAAAERGCIVGWAPQEEVLDHGAVAAFLTHSGWNSTLESVVAGKPMVCWP  394

Query  436  FFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKEA  257
            F ADQQ NSR V  +WKVGLDMKDVCDR  +E ++ E+M +RK EF   A ++ + A++A
Sbjct  395  FSADQQLNSRLVSHLWKVGLDMKDVCDREVMERMVNEVMGERKEEFAAAAGDLARRARDA  454

Query  256  ISEGGSSYCNFDCLIQDM  203
             SEGGSS+ N D LI+D+
Sbjct  455  ASEGGSSWDNLDRLIEDV  472



>gb|KJB74134.1| hypothetical protein B456_011G274800 [Gossypium raimondii]
Length=486

 Score =   252 bits (644),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 147/199 (74%), Gaps = 1/199 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED++C+  LD Q  RSVIYVSFGSI+  +R QL+E WYGL+NS  KFL+V+R D V GKD
Sbjct  278  EDKSCIPWLDKQPYRSVIYVSFGSITSTSRDQLVELWYGLLNSKTKFLFVVRPDSVIGKD  337

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
             E   +  EL E +K  GYIV WAPQE VL+H AVGGFLTHSGWNSTLESI AGVPM+CW
Sbjct  338  GEGEDVVKELMEKSKDRGYIVDWAPQEVVLNHQAVGGFLTHSGWNSTLESIVAGVPMVCW  397

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P+FADQQ  SR V  VWK+GLDMKDVCDR  VE ++ ++M  RK EF+  A +M K+  +
Sbjct  398  PYFADQQVTSRVVSRVWKIGLDMKDVCDRKIVENMVNDVMVDRK-EFVNSATDMAKVINQ  456

Query  259  AISEGGSSYCNFDCLIQDM  203
             +S GGSS  N D LI+D+
Sbjct  457  CVSIGGSSSNNLDRLIEDI  475



>ref|XP_006355163.1| PREDICTED: UDP-glycosyltransferase 85A7-like [Solanum tuberosum]
Length=471

 Score =   252 bits (643),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 152/199 (76%), Gaps = 0/199 (0%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED +C+  L+ Q  +SV++VS GS++ +++ Q +EFWYGLVNS  +FLWV R   + G +
Sbjct  268  EDMSCIDWLNKQPNKSVLFVSIGSLATMSKAQFLEFWYGLVNSKTRFLWVQRPGSIIGLE  327

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
            D++  +P EL E TK  G IV WAPQE VL H ++GGFLTH GWNSTLESIA GVPMICW
Sbjct  328  DDDINVPMELVESTKERGCIVSWAPQEEVLAHPSIGGFLTHCGWNSTLESIAEGVPMICW  387

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P+F DQQ NSR+VGEVWK+GLDMKDVCDR+++E ++ E+M+ +K EFLERA+ M  LA  
Sbjct  388  PYFVDQQVNSRYVGEVWKLGLDMKDVCDRATIERMVIEVMDVKKIEFLERAKQMSNLAIA  447

Query  259  AISEGGSSYCNFDCLIQDM  203
            ++ EGG+SY + + LI+D+
Sbjct  448  SVGEGGASYQDLERLIEDI  466



>ref|XP_010923186.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Elaeis 
guineensis]
Length=484

 Score =   252 bits (643),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/204 (58%), Positives = 159/204 (78%), Gaps = 4/204 (2%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLV---A  629
            ED  CM  L +Q  RSV+YVSFGS++V+TR++ MEFW+GLV+SG++FLWV+RSDL+    
Sbjct  272  EDRDCMTWLHAQPDRSVVYVSFGSLTVVTREEYMEFWHGLVDSGQRFLWVVRSDLINMRG  331

Query  628  GKDDEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPM  449
            G  +E+  +P+E++E T+  G IVGWAPQE VL H +VG F+THSGWNSTLE IAAG PM
Sbjct  332  GGTEEKPAVPAEVEEWTRDRGCIVGWAPQEEVLAHPSVGCFVTHSGWNSTLECIAAGKPM  391

Query  448  ICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLER-AENMGK  272
            +CWPFFADQQ NSRFV  VW++GLDMKD+C RS VE+++RE+ME  + E L R A  M +
Sbjct  392  LCWPFFADQQINSRFVSAVWEIGLDMKDLCGRSIVEKMVREVMEGERSEELRRNAREMAE  451

Query  271  LAKEAISEGGSSYCNFDCLIQDMI  200
            +AK++++EGG+SY +   LIQ ++
Sbjct  452  MAKKSVAEGGTSYNDLQRLIQHIM  475



>ref|XP_008359771.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Malus domestica]
 ref|XP_008368325.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Malus domestica]
Length=487

 Score =   252 bits (643),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/201 (59%), Positives = 155/201 (77%), Gaps = 3/201 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED  CMA LDSQ+  SVI+VSFGS++ ++R QL+EFW+GL+NSGK FLWV+RSD+++   
Sbjct  282  EDRRCMAWLDSQQSGSVIFVSFGSLAKLSRVQLLEFWHGLINSGKPFLWVVRSDMLSSGQ  341

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
            +E +  P EL++GTK  GYI  W PQE VL H AVGGF THSGWNST+E I AGVPM+CW
Sbjct  342  EERA-TPVELEDGTKERGYIAEWVPQEEVLAHKAVGGFWTHSGWNSTIEGIWAGVPMLCW  400

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEK--RKGEFLERAENMGKLA  266
            P  ADQQ NSR+VGE WK+GLDMKD CDRS+VE+++R LME+  ++ +  +  +N  KLA
Sbjct  401  PQLADQQVNSRWVGEGWKIGLDMKDTCDRSTVEKMVRALMEEGDQREQIFKSVDNFAKLA  460

Query  265  KEAISEGGSSYCNFDCLIQDM  203
            + A+SE GSSY N + LI+D+
Sbjct  461  RHAVSEDGSSYKNLEKLIEDL  481



>ref|XP_008388093.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Malus domestica]
Length=487

 Score =   252 bits (643),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/201 (59%), Positives = 155/201 (77%), Gaps = 3/201 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED  CMA LDSQ+  SVI+VSFGS++ ++R QL+EFW+GL+NSGK FLWV+RSD+++   
Sbjct  282  EDRRCMAWLDSQQSGSVIFVSFGSLAKLSRVQLLEFWHGLINSGKPFLWVVRSDMLSSGQ  341

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
            +E +  P EL++GTK  GYI  W PQE VL H AVGGF THSGWNST+E I AGVPM+CW
Sbjct  342  EERA-TPVELEDGTKERGYIAEWVPQEEVLAHKAVGGFWTHSGWNSTIEGIWAGVPMLCW  400

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEK--RKGEFLERAENMGKLA  266
            P  ADQQ NSR+VGE WK+GLDMKD CDRS+VE+++R LME+  ++ +  +  +N  KLA
Sbjct  401  PQLADQQVNSRWVGEGWKIGLDMKDTCDRSTVEKMVRALMEEGDQREQIFKSVDNFAKLA  460

Query  265  KEAISEGGSSYCNFDCLIQDM  203
            + A+SE GSSY N + LI+D+
Sbjct  461  RHAVSEDGSSYKNLEKLIEDL  481



>ref|XP_008353149.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Malus domestica]
Length=487

 Score =   251 bits (642),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/201 (60%), Positives = 153/201 (76%), Gaps = 3/201 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED  CMA LDSQ+  SVI+VSFGS++ ++R QL+EFW+GL+NSGK FLWV+RSD++    
Sbjct  282  EDRRCMAWLDSQQSGSVIFVSFGSLAKLSRVQLLEFWHGLINSGKPFLWVVRSDMLXSGQ  341

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
             EE   P EL++GTK  GYI  W PQE VL H AVGGF THSGWNST+E I AGVPM+CW
Sbjct  342  -EEXATPVELEDGTKERGYIAEWVPQEEVLAHKAVGGFWTHSGWNSTIEGIWAGVPMLCW  400

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEK--RKGEFLERAENMGKLA  266
            P  ADQQ NSR+VGE WK+GLDMKD CDRS+VE+++R LME+  ++ +  +  +N  KLA
Sbjct  401  PQLADQQVNSRWVGEGWKIGLDMKDTCDRSTVEKMVRALMEEGDQREQIFKSVDNFAKLA  460

Query  265  KEAISEGGSSYCNFDCLIQDM  203
            + A+SE GSSY N + LI+D+
Sbjct  461  RHAVSEDGSSYKNLEKLIEDL  481



>gb|KJB74150.1| hypothetical protein B456_011G275700 [Gossypium raimondii]
Length=486

 Score =   251 bits (642),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 114/198 (58%), Positives = 148/198 (75%), Gaps = 0/198 (0%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D++C+  L+ Q  RSVIYVSFGSI+  +R+QL+E  YGL+NS   FL+++R + V GKD 
Sbjct  279  DKSCIFWLNKQPNRSVIYVSFGSITSTSREQLLELCYGLLNSKTNFLFIVRPNSVIGKDG  338

Query  616  EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWP  437
            E   +  EL E +K  GYIV WAPQEAVL+H A+GGF TH+GWNSTLESI AGVPMICWP
Sbjct  339  EGEDVVMELMEKSKDRGYIVNWAPQEAVLNHPAIGGFFTHNGWNSTLESIVAGVPMICWP  398

Query  436  FFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKEA  257
            +FADQ  NSR V EVWK+G DMKDVCDR  VE+++ ++M  RK EF + A  M K+  ++
Sbjct  399  YFADQHVNSRVVSEVWKIGFDMKDVCDRKIVEKMVNDVMVDRKEEFAKSASGMAKVTNQS  458

Query  256  ISEGGSSYCNFDCLIQDM  203
            ++ GGSSY N DCL++D+
Sbjct  459  VNVGGSSYSNLDCLVEDI  476



>ref|XP_010318076.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Solanum 
lycopersicum]
Length=471

 Score =   251 bits (641),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 149/199 (75%), Gaps = 0/199 (0%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED +C+  LD Q  +SV++VS GS++ +++ Q  EFWYGLVNS  +FLWV R   + G +
Sbjct  268  EDVSCIDWLDKQPNKSVLFVSIGSLATMSKAQFFEFWYGLVNSDTRFLWVQRPGSIIGLE  327

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
            D+ + +P EL E TK  G I+ WAPQE VL   ++G FLTHSGWNSTLESI  GVPMICW
Sbjct  328  DDNNNVPMELVESTKERGCIISWAPQEEVLARPSIGAFLTHSGWNSTLESIVEGVPMICW  387

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P+F DQQ NSR+VGEVWK+GLDMKDVCDR ++E ++RE+M+ +K EFLERA+ M  LA  
Sbjct  388  PYFVDQQVNSRYVGEVWKLGLDMKDVCDRITIERMVREVMDVKKIEFLERAKYMSDLAIA  447

Query  259  AISEGGSSYCNFDCLIQDM  203
            ++ EGGSSY + D LI+D+
Sbjct  448  SVGEGGSSYQDLDRLIEDI  466



>ref|XP_008388092.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Malus domestica]
Length=487

 Score =   251 bits (642),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/201 (60%), Positives = 153/201 (76%), Gaps = 3/201 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED  CMA LDSQ+  SVI+VSFGS++ ++R QL+EFW+GL+NSGK FLWV+RSD++    
Sbjct  282  EDRRCMAWLDSQQSGSVIFVSFGSLAKLSRVQLLEFWHGLINSGKPFLWVVRSDMLXSGQ  341

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
             EE   P EL++GTK  GYI  W PQE VL H AVGGF THSGWNST+E I AGVPM+CW
Sbjct  342  -EEXATPVELEDGTKERGYIAEWVPQEEVLAHKAVGGFWTHSGWNSTIEGIWAGVPMLCW  400

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEK--RKGEFLERAENMGKLA  266
            P  ADQQ NSR+VGE WK+GLDMKD CDRS+VE+++R LME+  ++ +  +  +N  KLA
Sbjct  401  PQLADQQVNSRWVGEGWKIGLDMKDTCDRSTVEKMVRALMEEGDQREQIFKSVDNFAKLA  460

Query  265  KEAISEGGSSYCNFDCLIQDM  203
            + A+SE GSSY N + LI+D+
Sbjct  461  RHAVSEDGSSYKNLEKLIEDL  481



>ref|XP_002530397.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
 gb|EEF31967.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
Length=479

 Score =   251 bits (640),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 116/199 (58%), Positives = 148/199 (74%), Gaps = 1/199 (1%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD-  620
            D +C+  LD Q  RSV++VSFGS +++TR Q+MEFW+G+VNS  +FLWV+R   +  KD 
Sbjct  276  DRSCINWLDKQPKRSVLFVSFGSTTLMTRDQMMEFWHGIVNSKIRFLWVLRPQSITAKDG  335

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
            D+      E + G K +GYIV WAPQE VL H A GGFLTHSGWNSTLESIAAGVPMICW
Sbjct  336  DDLERFLDEFEVGPKESGYIVRWAPQEEVLGHKATGGFLTHSGWNSTLESIAAGVPMICW  395

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P++ DQQ NSRFV  VWKVGLDMKDVCDR  VE+++ +LM  RK EF+  +  M + AK 
Sbjct  396  PYYGDQQVNSRFVSAVWKVGLDMKDVCDREIVEKMVIDLMVNRKEEFVGSSTRMAEAAKN  455

Query  259  AISEGGSSYCNFDCLIQDM  203
            ++ +GGSS+CN + LI+D+
Sbjct  456  SVKDGGSSFCNLESLIKDI  474



>gb|KJB74143.1| hypothetical protein B456_011G275300 [Gossypium raimondii]
Length=437

 Score =   249 bits (637),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 114/198 (58%), Positives = 147/198 (74%), Gaps = 0/198 (0%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D++C+  L+ Q  RSVIYVSFGSI+ ++R+QL+E WYGL+N   KFL V+R + V GKD 
Sbjct  230  DKSCIFWLNKQPNRSVIYVSFGSITSMSREQLVELWYGLLNCTTKFLLVVRPNSVIGKDG  289

Query  616  EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWP  437
            E   +  EL E +K  GYIV WAPQEAV +H A+GGF TH+GWNSTLES+ AGVPMICWP
Sbjct  290  EGEDVVMELMEKSKDRGYIVNWAPQEAVFNHPAIGGFFTHNGWNSTLESVVAGVPMICWP  349

Query  436  FFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKEA  257
             FADQ  NSR V  VWK+GLDMKDVCDR  VE+++ ++M  RK EF + A  M K+  ++
Sbjct  350  QFADQHVNSRVVSVVWKIGLDMKDVCDRKIVEKMVNDVMVDRKEEFAKSASEMAKVTNQS  409

Query  256  ISEGGSSYCNFDCLIQDM  203
            ++ GGSSY N DCL++D+
Sbjct  410  VNVGGSSYSNLDCLVEDI  427



>gb|KJB74145.1| hypothetical protein B456_011G275400 [Gossypium raimondii]
Length=357

 Score =   247 bits (631),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 114/198 (58%), Positives = 146/198 (74%), Gaps = 0/198 (0%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D++C+  L+ Q  RSVIYVSFGSI  ++R+Q +E WYGL+NS  KFL V+R + V GKD 
Sbjct  150  DKSCIFWLNKQPNRSVIYVSFGSIMSMSREQPVELWYGLLNSKTKFLLVVRPNSVIGKDG  209

Query  616  EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWP  437
            E   +  EL E +K  GYIV WAPQEAVL+H A+GGF TH+GWNSTLES+  GVPMICWP
Sbjct  210  EGEDVVMELMEKSKDRGYIVNWAPQEAVLNHPAIGGFFTHNGWNSTLESVVPGVPMICWP  269

Query  436  FFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKEA  257
             FADQ  NSR V EVWK+GLDMKDVCD   VE+++ ++M  RK EF + A  M K+  ++
Sbjct  270  QFADQHVNSRVVSEVWKIGLDMKDVCDSKIVEKMVNDVMVDRKEEFAKSASEMAKVTNQS  329

Query  256  ISEGGSSYCNFDCLIQDM  203
            ++ GGSSY N DCL++D+
Sbjct  330  VNVGGSSYSNLDCLVEDI  347



>gb|KJB74144.1| hypothetical protein B456_011G275400 [Gossypium raimondii]
Length=357

 Score =   247 bits (630),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 114/198 (58%), Positives = 146/198 (74%), Gaps = 0/198 (0%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D++C+  L+ Q  RSVIYVSFGSI  ++R+Q +E WYGL+NS  KFL V+R + V GKD 
Sbjct  150  DKSCIFWLNKQPNRSVIYVSFGSIMSMSREQPVELWYGLLNSKTKFLLVVRPNSVIGKDG  209

Query  616  EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWP  437
            E   +  EL E +K  GYIV WAPQEAVL+H A+GGF TH+GWNSTLES+  GVPMICWP
Sbjct  210  EGEDVVMELMEKSKDRGYIVNWAPQEAVLNHPAIGGFFTHNGWNSTLESVVPGVPMICWP  269

Query  436  FFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKEA  257
             FADQ  NSR V EVWK+GLDMKDVCD   VE+++ ++M  RK EF + A  M K+  ++
Sbjct  270  QFADQHVNSRVVSEVWKIGLDMKDVCDSKIVEKMVNDVMVDRKEEFAKSASEMAKVTNQS  329

Query  256  ISEGGSSYCNFDCLIQDM  203
            ++ GGSSY N DCL++D+
Sbjct  330  VNVGGSSYSNLDCLVEDI  347



>ref|XP_010032067.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Eucalyptus 
grandis]
 gb|KCW51452.1| hypothetical protein EUGRSUZ_J00976 [Eucalyptus grandis]
Length=513

 Score =   251 bits (642),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 117/198 (59%), Positives = 143/198 (72%), Gaps = 2/198 (1%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D +C+A LD Q P+SVIYVSFGSI+ + R    EFWYGLVNSG++FLWV+R D +A  + 
Sbjct  311  DRSCIAWLDKQPPKSVIYVSFGSIATLNRHDFTEFWYGLVNSGRRFLWVVRPDSLA--EG  368

Query  616  EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWP  437
                +P EL+E     G IVGWAPQE VL H AV  FLTHSGWNSTLES+ AG PM+CWP
Sbjct  369  SSGAVPEELREAAAERGCIVGWAPQEEVLHHGAVAAFLTHSGWNSTLESVVAGKPMVCWP  428

Query  436  FFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKEA  257
            FFADQQ NSR V   WKVGLDMKDVCDR  VE ++ E+M +R+ EF   A ++ + A+ A
Sbjct  429  FFADQQVNSRLVSHAWKVGLDMKDVCDREVVERMVNEVMGERQEEFAAAAGDLARRARNA  488

Query  256  ISEGGSSYCNFDCLIQDM  203
             SEGGSS+ N D LI+D+
Sbjct  489  ASEGGSSWDNLDRLIEDI  506



>ref|XP_010032068.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Eucalyptus 
grandis]
 gb|KCW51453.1| hypothetical protein EUGRSUZ_J00977 [Eucalyptus grandis]
Length=479

 Score =   251 bits (640),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 115/198 (58%), Positives = 143/198 (72%), Gaps = 2/198 (1%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D +C+A LD Q P+SV+YVSFGSI+ + R    EFWYGLVNSG++FLWV+RSD +   + 
Sbjct  277  DRSCIAWLDKQPPKSVVYVSFGSITTLNRHDFTEFWYGLVNSGRRFLWVLRSDSL--PEG  334

Query  616  EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWP  437
                +P EL+E     G IVGWAPQE VL H A+  FLTHSGWNSTLES+ AG PM+CWP
Sbjct  335  SSGAVPEELREAAAERGCIVGWAPQEEVLHHGAIAAFLTHSGWNSTLESVVAGKPMVCWP  394

Query  436  FFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKEA  257
            FFADQQ NSR V   WK GLDMKDVCDR  VE ++ E+M +RK EF   A ++ + A++A
Sbjct  395  FFADQQLNSRLVSHAWKAGLDMKDVCDREVVERMVNEVMGERKEEFAAAAGDLARRARDA  454

Query  256  ISEGGSSYCNFDCLIQDM  203
             SEGGSS+ N D LI+D+
Sbjct  455  ASEGGSSWDNLDRLIEDI  472



>ref|XP_010674287.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Beta 
vulgaris subsp. vulgaris]
Length=492

 Score =   251 bits (640),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 115/198 (58%), Positives = 151/198 (76%), Gaps = 1/198 (1%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D +C++ LD +  +SV+YVSFGS++V+T+ QL EFW GLV S K FLWV+R +L+ G + 
Sbjct  287  DRSCISWLDRKPNKSVVYVSFGSLTVLTKDQLREFWAGLVQSNKYFLWVIRPNLIIGSE-  345

Query  616  EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWP  437
             ++  P +L EGTK  G +V WAPQ+ VL H A+GGFLTHSGWNSTLESI AGVPM+CWP
Sbjct  346  LDNQTPDDLLEGTKKRGCLVKWAPQKEVLAHRAIGGFLTHSGWNSTLESIVAGVPMLCWP  405

Query  436  FFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKEA  257
            +F+DQQ NSRFV EVW++GLDMKD CDR+ VE++I +LM+  K E     + M  LAK++
Sbjct  406  YFSDQQVNSRFVSEVWRIGLDMKDTCDRTIVEKMINDLMDGNKDELQRSMDRMSYLAKKS  465

Query  256  ISEGGSSYCNFDCLIQDM  203
            ISEGGSSY N + LI+D+
Sbjct  466  ISEGGSSYSNLNQLIEDI  483



>ref|XP_010674284.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=487

 Score =   250 bits (638),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 115/198 (58%), Positives = 151/198 (76%), Gaps = 1/198 (1%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D +C++ LD +  +SV+YVSFGS++V+T+ QL EFW GLV S K FLWV+R +L+ G + 
Sbjct  282  DRSCISWLDQKPNKSVVYVSFGSLTVLTKDQLREFWAGLVQSNKYFLWVIRPNLIIGSEL  341

Query  616  EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWP  437
            + S  P +L EGT+  G +V WAPQ+ VL H A+GGFLTHSGWNSTLESI AGVPM+CWP
Sbjct  342  DNS-TPDDLLEGTEKRGCLVKWAPQKEVLAHRAIGGFLTHSGWNSTLESIVAGVPMLCWP  400

Query  436  FFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKEA  257
            +FADQQ NSRFV EVW++GLDMKD CDR+ VE++I +LM+ +  E     + M  LAK++
Sbjct  401  YFADQQVNSRFVSEVWRIGLDMKDTCDRTIVEKMINDLMDGKNDELQRSMDRMSYLAKKS  460

Query  256  ISEGGSSYCNFDCLIQDM  203
            ISEGGSSY N + LI+D+
Sbjct  461  ISEGGSSYSNLNQLIEDI  478



>gb|KJB74149.1| hypothetical protein B456_011G275600 [Gossypium raimondii]
Length=487

 Score =   250 bits (638),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 115/198 (58%), Positives = 148/198 (75%), Gaps = 0/198 (0%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D++C+  L+ Q  RSVIYVSFGSI+  +R+QL+E  YGL+NS  KFL V+R + V GKD 
Sbjct  280  DKSCICWLNKQPNRSVIYVSFGSITSTSREQLVELCYGLLNSKTKFLLVVRPNSVIGKDG  339

Query  616  EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWP  437
            E   +  EL E +K  GYIV WAPQEAVL+H AVGGF TH+GWNSTLESI AGVPMICWP
Sbjct  340  EGEDVVMELMEKSKDRGYIVNWAPQEAVLNHPAVGGFFTHNGWNSTLESIVAGVPMICWP  399

Query  436  FFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKEA  257
            +FADQ  NSR V EVWK+GLDMKDVCDR  +E+++ ++M  RK EF + A  +  +  ++
Sbjct  400  YFADQHVNSRVVSEVWKIGLDMKDVCDRKILEKMVNDVMVDRKEEFAKSASEIATVTNQS  459

Query  256  ISEGGSSYCNFDCLIQDM  203
            ++ GGSSY N DCL++D+
Sbjct  460  VNVGGSSYSNLDCLVEDI  477



>gb|KJB74146.1| hypothetical protein B456_011G275400 [Gossypium raimondii]
Length=458

 Score =   249 bits (635),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 114/198 (58%), Positives = 147/198 (74%), Gaps = 0/198 (0%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D++C+  L+ Q  RSVIYVSFGSI+ ++R+QL+E WYGL+NS  KFL V+R + V GKD 
Sbjct  251  DKSCIFWLNKQPGRSVIYVSFGSITSMSREQLVELWYGLLNSKTKFLLVVRPNSVIGKDG  310

Query  616  EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWP  437
            E   +  EL E +K  GYIV WAPQEAVL+H A+GGF TH+GWNSTLES+  GVPMICWP
Sbjct  311  EGEDVVMELMEKSKDRGYIVNWAPQEAVLNHPAIGGFFTHNGWNSTLESVVPGVPMICWP  370

Query  436  FFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKEA  257
             FADQ  NSR V  VWK+GLDMKDVCD   VE+++ ++M  RK EF + A  M K+  ++
Sbjct  371  QFADQHVNSRVVSVVWKIGLDMKDVCDSKIVEKMVNDVMVDRKEEFAKSASEMAKVTNQS  430

Query  256  ISEGGSSYCNFDCLIQDM  203
            ++ GGSSY N DCL++D+
Sbjct  431  VNVGGSSYSNLDCLVEDI  448



>ref|XP_006367216.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Solanum tuberosum]
Length=474

 Score =   249 bits (635),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 110/199 (55%), Positives = 152/199 (76%), Gaps = 0/199 (0%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED +C+  L+ Q  +SV++VS GS++ +++ Q +EFWYGLVNS  +FLWV R   + G +
Sbjct  271  EDMSCIDWLNKQPNKSVLFVSIGSLATMSKAQFLEFWYGLVNSKTRFLWVQRPGSIIGLE  330

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
            D+ + +P EL + TK  G I+ WAPQE VL H ++GGFLTHSGWNSTLESI  GVPMICW
Sbjct  331  DDNNNVPMELVKSTKERGCIISWAPQEKVLAHPSIGGFLTHSGWNSTLESIVEGVPMICW  390

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P+F DQQ NSR+VGEVWK+G+DMKDVCDR+++E ++ ++M+  K EFLE+A++M  LA  
Sbjct  391  PYFVDQQVNSRYVGEVWKLGIDMKDVCDRATIERMVIQVMDVEKIEFLEKAKHMSDLAIA  450

Query  259  AISEGGSSYCNFDCLIQDM  203
            ++ EGGSSY + D LI+D+
Sbjct  451  SVGEGGSSYQDLDRLIEDI  469



>ref|XP_008785470.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Phoenix dactylifera]
Length=489

 Score =   249 bits (636),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/200 (60%), Positives = 155/200 (78%), Gaps = 3/200 (2%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED +C+  LDSQ  RSV+Y+SFGS+++++R +LMEFW+GLV+SGK+FLWV+R DL  GK 
Sbjct  285  EDRSCLKWLDSQPQRSVVYISFGSVTMMSRDELMEFWHGLVDSGKRFLWVVRPDLAEGKI  344

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
            +E   I  +L++ TK  G +VGWAPQE VL H AV  FLTHSGWNSTLES+AAGVPMICW
Sbjct  345  EEA--IQEDLEKETKERGCLVGWAPQEEVLAHPAVACFLTHSGWNSTLESVAAGVPMICW  402

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLER-AENMGKLAK  263
            PFFADQ  NSRFVG+VW+ G+DMKD   RS VE ++RE+ME  + E L R A  M +LA+
Sbjct  403  PFFADQPVNSRFVGDVWRFGVDMKDKRGRSVVERMVREVMEGERAEELRRSAGEMAELAR  462

Query  262  EAISEGGSSYCNFDCLIQDM  203
             ++ EGGSSY +F+ L++D+
Sbjct  463  RSVGEGGSSYRDFENLVKDI  482



>ref|XP_004512576.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Cicer arietinum]
Length=473

 Score =   248 bits (633),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 118/195 (61%), Positives = 145/195 (74%), Gaps = 4/195 (2%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D TCM  LDSQ  +SVIYVSFGS + +  ++++E W+GL+NS K+FLWV+R ++V GK+ 
Sbjct  275  DRTCMTWLDSQPLKSVIYVSFGSTTPMKSEEVIEIWHGLMNSEKRFLWVIRPNMVQGKE-  333

Query  616  EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWP  437
                +  EL+E TK  G IVGW PQE VL H A+G FLTHSGWNSTLES+  GVPMICWP
Sbjct  334  ---VLLKELEEKTKERGLIVGWVPQEEVLAHKAIGAFLTHSGWNSTLESVVCGVPMICWP  390

Query  436  FFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKEA  257
            FFADQQ NSRFV EVWK+GLDMKDVCDR  VE ++ +LM  RK EFL+ A  M KL+ ++
Sbjct  391  FFADQQINSRFVSEVWKIGLDMKDVCDRKVVENMVNDLMVNRKEEFLKSAMEMSKLSCKS  450

Query  256  ISEGGSSYCNFDCLI  212
            +S  GSSY NF  LI
Sbjct  451  VSPSGSSYDNFQALI  465



>ref|XP_003613025.1| UDP-glucuronosyltransferase 1-1 [Medicago truncatula]
 gb|AES95983.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=475

 Score =   248 bits (633),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 118/197 (60%), Positives = 150/197 (76%), Gaps = 6/197 (3%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D TCMA LDSQ  +SVIYVSFGS + + R++++E W+GL+NS K+FLWV+R ++V     
Sbjct  277  DRTCMAWLDSQPLKSVIYVSFGSTTPMKREEIIEIWHGLLNSKKQFLWVIRPNMV-----  331

Query  616  EESPIPSELKEGT-KANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
            +E  + SEL+EGT K  G IVGW PQE VL H A+G FLTH+GWNSTLES+  GVPMICW
Sbjct  332  QEKGLLSELEEGTRKEKGLIVGWVPQEEVLSHKAIGAFLTHNGWNSTLESVVCGVPMICW  391

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P+FADQQ NSRFV +VWK+GLDMKDVCDR  VE ++ ++M  RK EF+  A ++ KLA +
Sbjct  392  PYFADQQINSRFVSDVWKLGLDMKDVCDRKVVENMVNDVMVNRKEEFVRSAMDIAKLASK  451

Query  259  AISEGGSSYCNFDCLIQ  209
            ++S GGSSY NF  LIQ
Sbjct  452  SVSPGGSSYNNFQDLIQ  468



>gb|KJB74147.1| hypothetical protein B456_011G275400 [Gossypium raimondii]
Length=478

 Score =   248 bits (632),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 114/198 (58%), Positives = 146/198 (74%), Gaps = 0/198 (0%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D++C+  L+ Q  RSVIYVSFGSI  ++R+Q +E WYGL+NS  KFL V+R + V GKD 
Sbjct  271  DKSCIFWLNKQPNRSVIYVSFGSIMSMSREQPVELWYGLLNSKTKFLLVVRPNSVIGKDG  330

Query  616  EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWP  437
            E   +  EL E +K  GYIV WAPQEAVL+H A+GGF TH+GWNSTLES+  GVPMICWP
Sbjct  331  EGEDVVMELMEKSKDRGYIVNWAPQEAVLNHPAIGGFFTHNGWNSTLESVVPGVPMICWP  390

Query  436  FFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKEA  257
             FADQ  NSR V EVWK+GLDMKDVCD   VE+++ ++M  RK EF + A  M K+  ++
Sbjct  391  QFADQHVNSRVVSEVWKIGLDMKDVCDSKIVEKMVNDVMVDRKEEFAKSASEMAKVTNQS  450

Query  256  ISEGGSSYCNFDCLIQDM  203
            ++ GGSSY N DCL++D+
Sbjct  451  VNVGGSSYSNLDCLVEDI  468



>gb|KHG01935.1| UDP-glycosyltransferase 85A1 [Gossypium arboreum]
Length=948

 Score =   256 bits (655),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 127/244 (52%), Positives = 172/244 (70%), Gaps = 2/244 (1%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D++C+  LD Q  RSVIYVSFGSI+  +R+QL+E WYGL+NS  KFL V+R + V GKD 
Sbjct  279  DKSCIFWLDKQPNRSVIYVSFGSITSTSREQLVELWYGLLNSKTKFLLVVRPNSVIGKDG  338

Query  616  EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWP  437
            E   +  EL E +K  GYIV WAPQEAVL+H  VGGF TH+GWNSTLESI AGVPMICWP
Sbjct  339  EGEDVVVELMEKSKDQGYIVNWAPQEAVLNHPTVGGFFTHNGWNSTLESIVAGVPMICWP  398

Query  436  FFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKEA  257
            +FADQQ NSR V EVWK+GLDMKDVCD+  VE++++++M  +K EF++ A    K+  ++
Sbjct  399  YFADQQVNSRVVSEVWKIGLDMKDVCDKKIVEKMVKDVMVDQKEEFVQSAAETAKVTNQS  458

Query  256  ISEGGSSYCNFDCLIQDM-IKVNEATREll*nvlg*lvNFPLEFCSMHFQSHIYLLQWST  80
            ++ GGSSY N D LI+D+ I   +  + ++   L  L  F L F + H  +H  L+++++
Sbjct  459  VNVGGSSYSNLDHLIEDIRIMSLKTPKTMILAELLALAGFKLTFLNSH-HNHERLIKFTS  517

Query  79   LGLY  68
            +  Y
Sbjct  518  IVAY  521


 Score =   245 bits (625),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 119/199 (60%), Positives = 146/199 (73%), Gaps = 1/199 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED++C+  LD Q  RSVIYVSFGSI+  +R QL+E WYGL+NS  KFL+V+R D V GKD
Sbjct  736  EDKSCIPWLDKQPNRSVIYVSFGSITSTSRDQLVELWYGLLNSKTKFLFVVRPDSVIGKD  795

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
             E      EL E +K  GYIV WAPQE VL+H AVGGFLTHSGWNSTLESI AGVPM+CW
Sbjct  796  GEGEDFVKELMEKSKDRGYIVDWAPQEVVLNHEAVGGFLTHSGWNSTLESIVAGVPMVCW  855

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P+FADQQ  SR V  VWK+GLDMKDV DR  VE+++ ++M  +K EF+  A +M K+  +
Sbjct  856  PYFADQQVTSRVVSTVWKIGLDMKDVSDRKIVEKMVNDVMVDQK-EFVNSATDMAKVINQ  914

Query  259  AISEGGSSYCNFDCLIQDM  203
             +S GGSS  N D LI+D+
Sbjct  915  CVSIGGSSSNNLDRLIEDI  933



>emb|CDP19644.1| unnamed protein product [Coffea canephora]
Length=493

 Score =   247 bits (631),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/200 (58%), Positives = 154/200 (77%), Gaps = 1/200 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            E+++C++ LD+Q  +SVIYVS GS++++ ++QL+E W+GL NSG +FLWV R   + G D
Sbjct  284  ENKSCISWLDNQPAKSVIYVSIGSLALMGKKQLLEIWHGLANSGVRFLWVQRPGSITGLD  343

Query  619  DE-ESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMIC  443
            +E ++ IP +L   T   G IV WAPQE VL H A+GGFLTHSGWNSTLESI  GVPMIC
Sbjct  344  EENDAGIPLKLCRATTERGCIVSWAPQEEVLAHPAIGGFLTHSGWNSTLESIVEGVPMIC  403

Query  442  WPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAK  263
             P+FADQQ NSR+VGEVWK+GLDMKD CDR  VE ++R+LME+RK EF ++ ++M +LAK
Sbjct  404  CPYFADQQINSRYVGEVWKLGLDMKDTCDRDIVEMMVRDLMEERKDEFSKKVDHMARLAK  463

Query  262  EAISEGGSSYCNFDCLIQDM  203
             ++S GGSSY   + LI+D+
Sbjct  464  ASVSNGGSSYNALNRLIEDI  483



>ref|XP_010658655.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Vitis 
vinifera]
Length=247

 Score =   239 bits (610),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 110/173 (64%), Positives = 134/173 (77%), Gaps = 1/173 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED+TC+A LD Q  +SVIYV FGS+ VI + +L EFWYGLVNSG  FLWVMRSD +  ++
Sbjct  72   EDKTCIAWLDRQPLKSVIYVRFGSLVVIKKDELTEFWYGLVNSGSHFLWVMRSDSLP-RE  130

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
            D E   P+EL EGTK  G +V WAPQE VL H AVG FLTHSGWNSTL+ I AGVPMICW
Sbjct  131  DREGQTPAELLEGTKKRGLLVSWAPQEEVLAHPAVGAFLTHSGWNSTLKGITAGVPMICW  190

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAEN  281
            P FADQQ NSRFV  VWK+G+DMKD CDR  +E+++R LME+++ EF++ A+N
Sbjct  191  PRFADQQINSRFVSHVWKLGIDMKDTCDRIMIEKMVRNLMEEKRAEFMKSADN  243



>ref|XP_011014019.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like isoform 
X2 [Populus euphratica]
Length=496

 Score =   247 bits (631),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 118/207 (57%), Positives = 152/207 (73%), Gaps = 3/207 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED  C++ LD    RSVIYVSFGS+  + R QL+EFW+GLVNSGK FLWV+RSD + G+D
Sbjct  286  EDRGCISWLDFHPSRSVIYVSFGSLVCLVRDQLLEFWHGLVNSGKPFLWVLRSDSILGED  345

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
               S +P ELK  T+  G IV WAPQE VL H A+GGFLTHSGWNSTLESI AGVPMICW
Sbjct  346  GV-SEVPLELKAATEERGCIVDWAPQEEVLAHPAIGGFLTHSGWNSTLESIFAGVPMICW  404

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P FADQQ NSR V E+WK+G DMKD C+R+ +E+L+R+LME    E ++  +   ++A++
Sbjct  405  PMFADQQVNSRCVSELWKIGFDMKDKCERAVIEKLVRDLME--SDEIVKSTDEFARMARD  462

Query  259  AISEGGSSYCNFDCLIQDMIKVNEATR  179
            ++ EGGSSY N   LI+D+  ++ A +
Sbjct  463  SVKEGGSSYSNLQKLIEDIKSISLAGK  489



>ref|XP_007026847.1| UDP-glucosyl transferase 85A3, putative isoform 1 [Theobroma 
cacao]
 gb|EOY07349.1| UDP-glucosyl transferase 85A3, putative isoform 1 [Theobroma 
cacao]
Length=496

 Score =   247 bits (630),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/199 (58%), Positives = 144/199 (72%), Gaps = 1/199 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED +CM  LDSQ  +SVI+VSFGS+   TR Q+ E W+GLVN GK FLW +R D + G+D
Sbjct  284  EDTSCMTWLDSQLSKSVIFVSFGSVISFTRDQMFELWHGLVNCGKPFLWAIRQDSIIGED  343

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
               S I  +LK+ T   G +V WAPQE VL H A+GGF THSGWNSTLESI AGVPMICW
Sbjct  344  GP-SLILGKLKDMTGDKGLLVSWAPQELVLTHPAIGGFFTHSGWNSTLESIFAGVPMICW  402

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P   DQQ NSRFV +VWK+G DMKD CDRS +E+++R+LME ++ E ++    + KLA E
Sbjct  403  PAIGDQQMNSRFVSDVWKIGFDMKDSCDRSLIEKMVRDLMEDKREEIMKSVNEIKKLAHE  462

Query  259  AISEGGSSYCNFDCLIQDM  203
            A+ EGGSS+CN D LI D+
Sbjct  463  AVKEGGSSFCNLDKLIDDI  481



>ref|XP_007026848.1| UDP-glucosyl transferase 85A3, putative isoform 2, partial [Theobroma 
cacao]
 gb|EOY07350.1| UDP-glucosyl transferase 85A3, putative isoform 2, partial [Theobroma 
cacao]
Length=478

 Score =   246 bits (628),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/198 (59%), Positives = 143/198 (72%), Gaps = 1/198 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED +CM  LDSQ  +SVI+VSFGS+   TR Q+ E W+GLVN GK FLW +R D + G+D
Sbjct  282  EDTSCMTWLDSQLSKSVIFVSFGSVISFTRDQMFELWHGLVNCGKPFLWAIRQDSIIGED  341

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
               S I  +LK+ T   G +V WAPQE VL H A+GGF THSGWNSTLESI AGVPMICW
Sbjct  342  GP-SLILGKLKDMTGDKGLLVSWAPQELVLTHPAIGGFFTHSGWNSTLESIFAGVPMICW  400

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P   DQQ NSRFV +VWK+G DMKD CDRS +E+++R+LME ++ E ++    + KLA E
Sbjct  401  PAIGDQQMNSRFVSDVWKIGFDMKDSCDRSLIEKMVRDLMEDKREEIMKSVNEIKKLAHE  460

Query  259  AISEGGSSYCNFDCLIQD  206
            A+ EGGSS+CN D LI D
Sbjct  461  AVKEGGSSFCNLDKLIDD  478



>ref|XP_011014018.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like isoform 
X1 [Populus euphratica]
Length=498

 Score =   247 bits (630),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 118/207 (57%), Positives = 152/207 (73%), Gaps = 3/207 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED  C++ LD    RSVIYVSFGS+  + R QL+EFW+GLVNSGK FLWV+RSD + G+D
Sbjct  288  EDRGCISWLDFHPSRSVIYVSFGSLVCLVRDQLLEFWHGLVNSGKPFLWVLRSDSILGED  347

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
               S +P ELK  T+  G IV WAPQE VL H A+GGFLTHSGWNSTLESI AGVPMICW
Sbjct  348  GV-SEVPLELKAATEERGCIVDWAPQEEVLAHPAIGGFLTHSGWNSTLESIFAGVPMICW  406

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P FADQQ NSR V E+WK+G DMKD C+R+ +E+L+R+LME    E ++  +   ++A++
Sbjct  407  PMFADQQVNSRCVSELWKIGFDMKDKCERAVIEKLVRDLME--SDEIVKSTDEFARMARD  464

Query  259  AISEGGSSYCNFDCLIQDMIKVNEATR  179
            ++ EGGSSY N   LI+D+  ++ A +
Sbjct  465  SVKEGGSSYSNLQKLIEDIKSISLAGK  491



>gb|KHG03787.1| hypothetical protein F383_26945 [Gossypium arboreum]
Length=314

 Score =   240 bits (613),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 112/198 (57%), Positives = 144/198 (73%), Gaps = 0/198 (0%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D++C+  L+ Q  RSVIYVSFGSI+  +R+QL++ WYGL+NS  KFL V+R + V GKD 
Sbjct  107  DKSCIFWLNKQPNRSVIYVSFGSITSTSREQLVKLWYGLLNSKTKFLIVVRPNSVIGKDG  166

Query  616  EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWP  437
            E   +  EL E +K  GYIV WAPQE VL H A+GGF TH+GWNSTLES+ AGVPMICWP
Sbjct  167  EGEDVVMELMEKSKDRGYIVNWAPQEEVLSHPAIGGFFTHNGWNSTLESVVAGVPMICWP  226

Query  436  FFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKEA  257
             FADQ  NSR V EVW++G+DMKDVCD   VE+++ ++M  RK EF + A  M K+  + 
Sbjct  227  QFADQHVNSRVVSEVWEIGMDMKDVCDSKIVEKMVNDVMVDRKEEFAKSAYEMAKVTNQC  286

Query  256  ISEGGSSYCNFDCLIQDM  203
            ++ GGSSY N D LI+D+
Sbjct  287  VNVGGSSYSNLDRLIEDI  304



>gb|KHN04913.1| UDP-glycosyltransferase 85A2 [Glycine soja]
Length=457

 Score =   244 bits (624),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 118/196 (60%), Positives = 148/196 (76%), Gaps = 10/196 (5%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D +CMA L++Q   SVIYVSFGS +++ R+ LME W+GLVNS K+FLWVMR D+VA    
Sbjct  262  DRSCMAWLEAQPQGSVIYVSFGSSTIVKREDLMEIWHGLVNSKKRFLWVMRPDIVAADR-  320

Query  616  EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWP  437
                IP+E++EGT+  G IVGWAPQE VL H A+GGFLT      TL+S+ AGVPMICWP
Sbjct  321  ----IPAEVEEGTRERGLIVGWAPQEDVLAHKAIGGFLT-----PTLDSVVAGVPMICWP  371

Query  436  FFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKEA  257
            +FADQQ NSRFV EVWK+GLDMKDVCDR  VE+++ +LM  RK EFL+ A+ M  LA ++
Sbjct  372  YFADQQINSRFVSEVWKLGLDMKDVCDRHVVEKMVNDLMVHRKEEFLKSAQEMAMLAHKS  431

Query  256  ISEGGSSYCNFDCLIQ  209
            ++ GGSSY +FD LIQ
Sbjct  432  VTPGGSSYSSFDDLIQ  447



>ref|XP_010666054.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Beta 
vulgaris subsp. vulgaris]
Length=495

 Score =   246 bits (627),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 109/206 (53%), Positives = 150/206 (73%), Gaps = 4/206 (2%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED++C+  LD+Q  RSVI+ SFGS   +T++QLMEFW GLVNSG +FLW+ R   V G D
Sbjct  286  EDKSCIEWLDAQPLRSVIFCSFGSHVCLTKEQLMEFWQGLVNSGTRFLWIKRQRSVTGMD  345

Query  619  DE----ESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVP  452
            D+    +  IPS L +G K NGY+  WAPQE VL H ++GGFLTHSGWNSTLESI  G P
Sbjct  346  DDVHKWQEQIPSGLLKGMKENGYVTSWAPQEEVLSHPSIGGFLTHSGWNSTLESIVEGKP  405

Query  451  MICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGK  272
            M+CWP++ DQ   SR+V  VWKVGLDMKD+CDR  +E ++R+LM++R+GE+ +    +  
Sbjct  406  MLCWPYYVDQLIISRYVSHVWKVGLDMKDICDRDIIENMVRDLMDRRRGEYSQNVNALAY  465

Query  271  LAKEAISEGGSSYCNFDCLIQDMIKV  194
            LA++++ E GSSYC+ + L+ D++ +
Sbjct  466  LARQSVHEDGSSYCSLNKLVDDIMSL  491



>ref|XP_004235101.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Solanum 
lycopersicum]
Length=488

 Score =   245 bits (625),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 115/199 (58%), Positives = 144/199 (72%), Gaps = 1/199 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED T +  LD+Q   SVIYVSFGS+ V++R ++MEFW+GL+NS  KFLWVMR +++ G D
Sbjct  272  EDHTSIKWLDAQSKGSVIYVSFGSLVVVSRDEIMEFWHGLMNSKVKFLWVMRPNMLKG-D  330

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
                    EL EG K  GYIV WAPQE VL H +VGGFLTHSGWNSTLESI  G PMICW
Sbjct  331  ASHDQFMKELVEGCKGIGYIVSWAPQEMVLAHPSVGGFLTHSGWNSTLESIIEGKPMICW  390

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P + DQ+  SR V E WK+GLDMKD+CDR  VE+L+++LME +K E+ +  E + +LAK 
Sbjct  391  PQYVDQRVTSRLVNEFWKIGLDMKDICDRFVVEKLVKDLMETKKDEYTKSVEKLSELAKL  450

Query  259  AISEGGSSYCNFDCLIQDM  203
            ++ EGG SY N DCLI D+
Sbjct  451  SVEEGGLSYSNLDCLINDI  469



>ref|XP_010905381.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Elaeis 
guineensis]
Length=491

 Score =   243 bits (621),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 119/204 (58%), Positives = 153/204 (75%), Gaps = 4/204 (2%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED TCM  LDSQ  +SV+YVSFGS++V++++  +EFW GLVNSG++FLWV+R DLV  + 
Sbjct  287  EDRTCMTWLDSQPHKSVVYVSFGSLTVVSQEAFLEFWIGLVNSGQRFLWVVRPDLVEEEM  346

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
                    E+K GTK  G +V W PQE VL H AVG FLTHSGWNSTLES+ AGVPM+CW
Sbjct  347  LPLP---EEVKVGTKERGCLVDWVPQEQVLAHPAVGCFLTHSGWNSTLESLVAGVPMLCW  403

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLER-AENMGKLAK  263
            PFFADQQ NSRFV EVWKVGLDMKD+C RS VE ++RE+ME ++ +   R A  M K+A 
Sbjct  404  PFFADQQINSRFVSEVWKVGLDMKDLCSRSIVEMMVREVMEGQRTDGWRRSAREMAKMAW  463

Query  262  EAISEGGSSYCNFDCLIQDMIKVN  191
            E+++EGGSS+ +F  LIQ ++ ++
Sbjct  464  ESVAEGGSSHADFRRLIQRIMSLS  487



>ref|XP_006362115.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Solanum tuberosum]
Length=489

 Score =   242 bits (618),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 145/199 (73%), Gaps = 1/199 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED T +  L++Q   SVIYVSFGS+ V++R ++MEFW+GL+NS  KFLWVMR +++ G D
Sbjct  273  EDHTSIKWLNAQSNGSVIYVSFGSLLVVSRDEMMEFWHGLMNSKVKFLWVMRPNMLKG-D  331

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
                    EL EG+K  GYIV WAPQ+ VL H +VGGFLTHSGWNSTLESI  G PMICW
Sbjct  332  VSRDQFMKELVEGSKGIGYIVSWAPQKMVLAHPSVGGFLTHSGWNSTLESIIEGKPMICW  391

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P + DQ+  SR V E WK+GLDMKD+CDR  VE+++++LME +K E+ +  E + KLAK 
Sbjct  392  PQYVDQRVTSRLVNEFWKIGLDMKDICDRFVVEKMVKDLMETKKDEYKKSVEKLSKLAKL  451

Query  259  AISEGGSSYCNFDCLIQDM  203
            ++ EGG SY N DCLI D+
Sbjct  452  SVQEGGLSYSNLDCLINDI  470



>ref|XP_003613028.1| Cis-zeatin O-glucosyltransferase [Medicago truncatula]
 gb|AES95986.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=474

 Score =   242 bits (617),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 115/197 (58%), Positives = 147/197 (75%), Gaps = 6/197 (3%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D TCM  L+SQ  +SV+YVSFGSI+ +  ++++E W+GL+NS K FLWV+R ++V     
Sbjct  276  DRTCMTWLESQPLKSVVYVSFGSITPMKGEEIIEIWHGLLNSKKPFLWVIRPNMV-----  330

Query  616  EESPIPSELKEGT-KANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
            +E  +  EL+EGT K  G IVGW PQE VL H A+G FLTHSGWNSTLES+  GVPMICW
Sbjct  331  QEKGLLKELEEGTTKEKGMIVGWVPQEEVLSHKAIGAFLTHSGWNSTLESVVCGVPMICW  390

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P+FADQQ NSRFV +VWK+GLDMKDVCDR  VE ++ ++M  RK EF+  A ++ KLA +
Sbjct  391  PYFADQQINSRFVSDVWKLGLDMKDVCDRKVVENMVNDVMVNRKEEFVRSAMDIAKLASK  450

Query  259  AISEGGSSYCNFDCLIQ  209
            ++S GGSSY NF  LIQ
Sbjct  451  SVSPGGSSYNNFQDLIQ  467



>ref|XP_011000049.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Populus 
euphratica]
Length=486

 Score =   241 bits (616),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 118/207 (57%), Positives = 150/207 (72%), Gaps = 3/207 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED  C+  LDS   RSVIYVSFGS+  + R QL+EFW+GLVNSGK FLWV+RSD + G+D
Sbjct  276  EDRGCITWLDSHPSRSVIYVSFGSLVGLFRDQLLEFWHGLVNSGKPFLWVLRSDSIIGED  335

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
               S +P ELK  T+  G IV WAPQE VL H A+GGFLTHSGWNSTLESI AGVPMICW
Sbjct  336  GV-SEVPLELKAATEERGCIVDWAPQEEVLAHPAIGGFLTHSGWNSTLESIFAGVPMICW  394

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P  ADQQ NSR V E+WK G DMKD C+R+ +E+L+R+LME    E ++  + +  +A++
Sbjct  395  PMLADQQVNSRCVSELWKTGFDMKDKCERAVIEKLVRDLME--SDEIVKATDEIAGMARD  452

Query  259  AISEGGSSYCNFDCLIQDMIKVNEATR  179
            ++ EGGSSY N   LI+D+  ++ A +
Sbjct  453  SVKEGGSSYSNLQKLIEDIKSMSLAGK  479



>ref|XP_009346996.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Pyrus 
x bretschneideri]
Length=485

 Score =   241 bits (614),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 119/205 (58%), Positives = 148/205 (72%), Gaps = 6/205 (3%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED  CMA LDS+   SVIYVSFGS+  +T  QL EFW+GLV+ GK+FLWV+RSD+++G+ 
Sbjct  278  EDRRCMAWLDSKPVGSVIYVSFGSLVELTHDQLFEFWHGLVSCGKQFLWVVRSDMISGEQ  337

Query  619  DEE----SPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVP  452
             E       IP+ELK GTK  G IV WAPQE VL H AVGGFLT  GWNS LE I AGVP
Sbjct  338  GEHVIPTELIPTELKMGTKERGLIVEWAPQEEVLAHKAVGGFLTQCGWNSILEGIWAGVP  397

Query  451  MICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEK--RKGEFLERAENM  278
            M+CWP  A+Q   SR++GEVW++G+DMKD C+RS VE++IR LME+   + + L   E  
Sbjct  398  MLCWPRLAEQLVTSRWIGEVWRIGIDMKDTCERSMVEKMIRRLMEEGDEREQILRSVERF  457

Query  277  GKLAKEAISEGGSSYCNFDCLIQDM  203
             KLA+ A++EGGSSY N D LIQD+
Sbjct  458  SKLARGAVTEGGSSYNNLDKLIQDL  482



>emb|CDP05613.1| unnamed protein product [Coffea canephora]
Length=412

 Score =   239 bits (609),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 117/212 (55%), Positives = 154/212 (73%), Gaps = 11/212 (5%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVA---  629
            ED +C+  LD+Q P+SV+YVSFGSI++ITR++L+EFW+G+VNS  +FLWV+RSD +    
Sbjct  200  EDTSCIKWLDNQPPKSVLYVSFGSITIITREKLLEFWHGIVNSRVRFLWVIRSDSIRVRL  259

Query  628  GKDDEESPIPSE------LKEGTKANGYIVGW--APQEAVLDHLAVGGFLTHSGWNSTLE  473
            G D  E+    +      +   +   GY VG+  APQE VL   A+  FLTHSGWNSTLE
Sbjct  260  GDDGLETDKQYKYLGKKLINNYSSDRGYRVGYFLAPQEEVLARPAIDRFLTHSGWNSTLE  319

Query  472  SIAAGVPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLE  293
            S+  G PMICWP+F DQ  NSRFVGE+WK+GLD+KD CDR  VE++I+ LM +RK EFL+
Sbjct  320  SMVEGKPMICWPYFGDQHPNSRFVGELWKLGLDIKDTCDRKIVEKMIKGLMVERKDEFLQ  379

Query  292  RAENMGKLAKEAISEGGSSYCNFDCLIQDMIK  197
            RA  M KLA+++I EGGSS+CNF  LI D++K
Sbjct  380  RANEMAKLARKSIEEGGSSFCNFLRLIDDIVK  411



>dbj|BAP90373.1| UDP-glycose: glycosyltransferase UGT709H1 [Fagopyrum esculentum]
Length=482

 Score =   240 bits (613),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 140/198 (71%), Gaps = 1/198 (1%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D +C+  LD +  +SV+YVSFGSI+ I+++QLME W GLV S K FLWVMR + + G D+
Sbjct  280  DRSCIKWLDDKPKKSVVYVSFGSITTISKEQLMEIWAGLVQSNKFFLWVMRPNSITG-DN  338

Query  616  EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWP  437
                +  E+ EGT+  GY+VGW PQE VL H A+GGFLTHSGWNSTLESI AGVPM+CWP
Sbjct  339  PTQAVDPEILEGTEKRGYMVGWTPQEEVLAHQAIGGFLTHSGWNSTLESIEAGVPMVCWP  398

Query  436  FFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKEA  257
            +FADQQ NSR+V  VWK+GLDMKD C R  VE ++ ++ME  K   L       +  K +
Sbjct  399  YFADQQVNSRYVSHVWKIGLDMKDKCHRDIVENMVNDMMENMKDGLLSSVTEFSQAVKRS  458

Query  256  ISEGGSSYCNFDCLIQDM  203
            ++EGG+S CN D LI D+
Sbjct  459  VAEGGTSSCNLDRLIDDI  476



>ref|XP_010674285.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Beta 
vulgaris subsp. vulgaris]
Length=536

 Score =   241 bits (616),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 113/204 (55%), Positives = 152/204 (75%), Gaps = 5/204 (2%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLV--AGK  623
            D++C++ LD +  +SVIY+S GS + +T+ QL E W G+V S + FLWV+R +++   G 
Sbjct  334  DKSCISWLDQKPDKSVIYISLGSTTTLTKNQLTELWTGVVQSKRYFLWVVRPNVIIEGGL  393

Query  622  DDEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMIC  443
            D   SPIP++L EGT   G IV WAPQ+ VL H A+GGFLTHSGWNSTLESI AGVPM+C
Sbjct  394  D---SPIPNDLLEGTDKRGCIVKWAPQDEVLTHRAIGGFLTHSGWNSTLESIVAGVPMLC  450

Query  442  WPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAK  263
            WP FADQQ NSRF  EVW++GLDMKD CDR+ VE++I +LM+ +K E    A+ + + AK
Sbjct  451  WPHFADQQLNSRFASEVWRIGLDMKDTCDRTIVEKMINDLMDGKKDELQRSAKRVSQEAK  510

Query  262  EAISEGGSSYCNFDCLIQDMIKVN  191
            ++ISEGGSSY N + LI+D+I ++
Sbjct  511  KSISEGGSSYSNLNRLIEDIIAMS  534



>gb|KDO38337.1| hypothetical protein CISIN_1g011531mg [Citrus sinensis]
Length=483

 Score =   240 bits (612),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 114/201 (57%), Positives = 150/201 (75%), Gaps = 4/201 (2%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED +CM  L+SQ P+SV+YVSFGS+  +TR+Q+ E W+GLVN G++FL V+R DL+ G+ 
Sbjct  278  EDTSCMTWLNSQPPKSVLYVSFGSLVGLTREQMSELWHGLVNRGQRFLLVVRPDLILGEP  337

Query  619  DE-ESPIPSELKEGTK-ANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMI  446
               E+P+     EGT+  N +IV WAPQE VL H AVGGFLTH GWNSTLE IAAGVPMI
Sbjct  338  GAAETPLAQ--NEGTEERNRFIVSWAPQEEVLAHPAVGGFLTHGGWNSTLEGIAAGVPMI  395

Query  445  CWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLA  266
            CWP F+DQ  NSR V EVWK+G DMKD CD S +E+L+R+LME ++ E +   + +  +A
Sbjct  396  CWPQFSDQLVNSRCVSEVWKIGFDMKDTCDGSIIEKLVRDLMENKREEIMGSTDRVATMA  455

Query  265  KEAISEGGSSYCNFDCLIQDM  203
            ++A++EGGSSY N D LI+D+
Sbjct  456  RDAVNEGGSSYRNLDGLIEDI  476



>ref|XP_009589441.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like isoform 
X2 [Nicotiana tomentosiformis]
Length=477

 Score =   239 bits (611),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 108/208 (52%), Positives = 151/208 (73%), Gaps = 1/208 (0%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED + +  LD+Q   SVIYVSFGS++ +++++++EFW+GLVNSG +FLWVMRS+L+ G++
Sbjct  264  EDHSSIQWLDAQPIESVIYVSFGSMATLSKEEILEFWHGLVNSGIRFLWVMRSNLLRGEE  323

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
                 +  EL EG     YIV WAPQE VL H A+GGFLTHSGWNST+ESI  G PMICW
Sbjct  324  SNHQFV-KELAEGCIERAYIVSWAPQEKVLAHSAIGGFLTHSGWNSTMESIVQGKPMICW  382

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
              + DQ+  SRFVGEVWK+G+DMKD+CDR  +E+++++LM   + EF + AE +  LAKE
Sbjct  383  AVYVDQRVTSRFVGEVWKIGVDMKDICDRYIIEKMVKDLMVTNRDEFKKSAEKLSNLAKE  442

Query  259  AISEGGSSYCNFDCLIQDMIKVNEATRE  176
            ++ +GGSSY    CL+ D+ K+    ++
Sbjct  443  SVGDGGSSYNALQCLVDDVKKLGRKGKD  470



>ref|XP_006373896.1| hypothetical protein POPTR_0016s10010g [Populus trichocarpa]
 gb|ERP51693.1| hypothetical protein POPTR_0016s10010g [Populus trichocarpa]
Length=486

 Score =   239 bits (611),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 116/207 (56%), Positives = 150/207 (72%), Gaps = 3/207 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED  CM  LDS   RSVIYVSFGS+  + R QL+EFW+GLVNSGK FLWV+RSD +  ++
Sbjct  276  EDRGCMTWLDSHPSRSVIYVSFGSLVGLFRDQLLEFWHGLVNSGKPFLWVIRSDSIM-EE  334

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
            D  S +P +LK  T+  G IV WAPQE VL H A+GGFLTHSGWNSTLESI AGVPMICW
Sbjct  335  DGVSEVPLQLKAATEERGCIVDWAPQEEVLAHPAIGGFLTHSGWNSTLESIFAGVPMICW  394

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P  ADQQ NSR V E+WK+G DMKD C+R+ +E+L+R+LME    E ++  +    +A++
Sbjct  395  PMIADQQVNSRCVSELWKIGFDMKDKCERAVIEKLVRDLME--SDEIVKSTDEFAGMARD  452

Query  259  AISEGGSSYCNFDCLIQDMIKVNEATR  179
            ++ EGGSSY N   L++D+  ++ A +
Sbjct  453  SVKEGGSSYSNLQKLVEDIKSMSLAGK  479



>ref|XP_003517692.2| PREDICTED: UDP-glycosyltransferase 85A3-like [Glycine max]
Length=505

 Score =   240 bits (612),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 124/204 (61%), Positives = 154/204 (75%), Gaps = 2/204 (1%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D  CM  LDSQ  +SVIYVSFGSI+ +TR++L+E WYGLVNS K+FLWV+R D+V  K++
Sbjct  300  DRRCMTWLDSQPLKSVIYVSFGSIATMTREKLIEIWYGLVNSKKRFLWVVRPDMVGPKEN  359

Query  616  EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWP  437
             +  +P+EL+EGTK  G+IVGWAPQE VL H A+GGFLTHSGWNSTLES+AAGVPMIC P
Sbjct  360  GDR-VPAELEEGTKERGFIVGWAPQEEVLAHKAIGGFLTHSGWNSTLESLAAGVPMICCP  418

Query  436  FFADQQTNSRFVGEVWKVGLDMKDV-CDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
             F DQ  NSRFV EV KVGLDMKDV CDR+ VE ++ +LM+ R   FL  A  +  LA  
Sbjct  419  SFGDQHVNSRFVSEVCKVGLDMKDVACDRNLVENMVNDLMDHRNEVFLNSAREVALLANR  478

Query  259  AISEGGSSYCNFDCLIQDMIKVNE  188
            ++S GGSSY N D LIQ +  +++
Sbjct  479  SVSSGGSSYSNLDGLIQYIRSISQ  502



>ref|XP_008370121.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Malus domestica]
Length=483

 Score =   239 bits (610),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 114/204 (56%), Positives = 150/204 (74%), Gaps = 3/204 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            +D  CM  LDSQ+ RSVI+VSFGS+  +TR QL+EFW+GL++SGK FLWV+RSD++   +
Sbjct  281  QDRRCMTWLDSQQLRSVIFVSFGSLVKLTRVQLLEFWHGLIDSGKPFLWVIRSDML-WNE  339

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
             E      +L+ GTK  G+I  W PQE VL H A+GGFLTHSGWNST+E I AGVPM+CW
Sbjct  340  QEAHATSVKLEVGTKEKGFIAEWVPQEEVLAHKAIGGFLTHSGWNSTIEGIWAGVPMLCW  399

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEK--RKGEFLERAENMGKLA  266
            P  ADQ  NSR+VGE WK+GLDMKD CDRS+VE+++R LME+  R  +  +  +   KLA
Sbjct  400  PQIADQPVNSRWVGEGWKIGLDMKDTCDRSTVEKMVRALMEEGDRSAQIFKSVDTFAKLA  459

Query  265  KEAISEGGSSYCNFDCLIQDMIKV  194
            + A++E GSSY N + LI+D+ K+
Sbjct  460  RHAVNEDGSSYKNLEKLIEDVKKL  483



>ref|XP_009589440.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like isoform 
X1 [Nicotiana tomentosiformis]
Length=488

 Score =   239 bits (610),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 108/208 (52%), Positives = 151/208 (73%), Gaps = 1/208 (0%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED + +  LD+Q   SVIYVSFGS++ +++++++EFW+GLVNSG +FLWVMRS+L+ G++
Sbjct  275  EDHSSIQWLDAQPIESVIYVSFGSMATLSKEEILEFWHGLVNSGIRFLWVMRSNLLRGEE  334

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
                 +  EL EG     YIV WAPQE VL H A+GGFLTHSGWNST+ESI  G PMICW
Sbjct  335  SNHQFV-KELAEGCIERAYIVSWAPQEKVLAHSAIGGFLTHSGWNSTMESIVQGKPMICW  393

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
              + DQ+  SRFVGEVWK+G+DMKD+CDR  +E+++++LM   + EF + AE +  LAKE
Sbjct  394  AVYVDQRVTSRFVGEVWKIGVDMKDICDRYIIEKMVKDLMVTNRDEFKKSAEKLSNLAKE  453

Query  259  AISEGGSSYCNFDCLIQDMIKVNEATRE  176
            ++ +GGSSY    CL+ D+ K+    ++
Sbjct  454  SVGDGGSSYNALQCLVDDVKKLGRKGKD  481



>gb|KHN04919.1| UDP-glycosyltransferase 85A3 [Glycine soja]
Length=486

 Score =   239 bits (610),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 128/207 (62%), Positives = 156/207 (75%), Gaps = 5/207 (2%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKK---FLWVMRSDLVAG  626
            D+ CM  LDSQ  +SVIYVSFGSI+ +TR++L+E WYGLVNS K+   FLWVMR DLV G
Sbjct  278  DQRCMTWLDSQPLKSVIYVSFGSIATMTREKLIEIWYGLVNSKKRKNRFLWVMRPDLVVG  337

Query  625  KDDEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMI  446
            K++ +  IP+EL+EGTK  G+IVGWAPQE VL H A+GGFLTHSGWNSTLES+AAGVPMI
Sbjct  338  KENGDW-IPAELEEGTKERGFIVGWAPQEEVLAHKAIGGFLTHSGWNSTLESLAAGVPMI  396

Query  445  CWPFFADQQTNSRFVGEVWKVGLDMKDV-CDRSSVEELIRELMEKRKGEFLERAENMGKL  269
            C P F DQ  NSRFV EV KVGLDMKDV CDR+ VE ++ +LM+ R   FL  A  +  L
Sbjct  397  CCPSFGDQHVNSRFVSEVCKVGLDMKDVACDRNLVENMVNDLMDHRNEVFLNSAREVALL  456

Query  268  AKEAISEGGSSYCNFDCLIQDMIKVNE  188
            A  ++S GGSSY N D LIQ +  +++
Sbjct  457  ANRSVSSGGSSYSNLDGLIQYIRSISQ  483



>ref|XP_003613026.1| UDP-glucuronosyltransferase 1-6 [Medicago truncatula]
 gb|AES95984.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=466

 Score =   238 bits (606),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 112/197 (57%), Positives = 145/197 (74%), Gaps = 6/197 (3%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D TCM  L+SQ  +SV+YVSFGS + +TR++++EFW+GL+NS K FLWV+R ++V     
Sbjct  268  DRTCMTWLESQPLKSVVYVSFGSTTTMTREEILEFWHGLLNSKKAFLWVIRPNMV-----  322

Query  616  EESPIPSELKEGT-KANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
            +E  +  EL+EGT K  G IV WAPQE VL H A+G FLTHSGWNSTLES+  GVPMICW
Sbjct  323  QEKRLIKELEEGTSKEKGLIVEWAPQEEVLSHKAIGAFLTHSGWNSTLESVVCGVPMICW  382

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P+F+DQ  NSRFV EVWK+GLDMKDVCDR+ VE ++ ++M  +K EF + A  M  LA +
Sbjct  383  PYFSDQPLNSRFVSEVWKLGLDMKDVCDRNVVENMVNDIMVNKKEEFSKSATKMADLASK  442

Query  259  AISEGGSSYCNFDCLIQ  209
            +++  GSSY N   LIQ
Sbjct  443  SVNPDGSSYNNLQDLIQ  459



>ref|XP_006429243.1| hypothetical protein CICLE_v10011602mg [Citrus clementina]
 gb|ESR42483.1| hypothetical protein CICLE_v10011602mg [Citrus clementina]
Length=486

 Score =   238 bits (606),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 110/199 (55%), Positives = 146/199 (73%), Gaps = 0/199 (0%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED +CM  L+SQ P+SV+YVSFGS+  +TR+Q+ E W+GLVNSG++FL V+R DL+ G+ 
Sbjct  281  EDTSCMTWLNSQPPKSVLYVSFGSLVGLTREQMSELWHGLVNSGQRFLLVVRPDLILGEP  340

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
               +   ++ K   + N +IV WAPQE VL H AVGGFLTH GWNSTLE I AGVPMICW
Sbjct  341  GAGATPLAQNKGTEERNRFIVSWAPQEEVLAHPAVGGFLTHGGWNSTLEGIVAGVPMICW  400

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P F+DQ  NSR V EVWK+G DMKD CD S +E+L+R+LME ++ E +   + +  +A +
Sbjct  401  PQFSDQFVNSRCVSEVWKIGFDMKDTCDGSIIEKLVRDLMENKREEIMGSTDRVATMAHD  460

Query  259  AISEGGSSYCNFDCLIQDM  203
            A++EGGSSY N D LI+D+
Sbjct  461  AVNEGGSSYRNLDGLIEDI  479



>ref|XP_007026849.1| UDP-glucosyl transferase 85A3, putative [Theobroma cacao]
 gb|EOY07351.1| UDP-glucosyl transferase 85A3, putative [Theobroma cacao]
Length=468

 Score =   237 bits (604),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 114/198 (58%), Positives = 147/198 (74%), Gaps = 0/198 (0%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D  C+  LDSQ  RSV+YVSFGS  V+T ++L+EFW+GLVNSGK+FLWV+R D++AG+ D
Sbjct  269  DHNCITWLDSQPLRSVVYVSFGSHVVLTSEELLEFWHGLVNSGKRFLWVLRPDIIAGEKD  328

Query  616  EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWP  437
                I  E   GTK  G +V WAPQE VL H +VGGFLTH GWNSTLES+ AGVPM+CWP
Sbjct  329  HNQIIAREPDLGTKEKGLLVDWAPQEEVLAHPSVGGFLTHCGWNSTLESMVAGVPMLCWP  388

Query  436  FFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKEA  257
               DQ  NS  V EVWK+GLD+KD+CDRS+VE+++R LME R+ E +   + + KLA+E+
Sbjct  389  KLPDQLVNSSCVSEVWKIGLDLKDMCDRSTVEKMVRALMEDRREEVMRSVDGISKLARES  448

Query  256  ISEGGSSYCNFDCLIQDM  203
            +S GGSS  N + LIQ++
Sbjct  449  VSHGGSSSSNLEMLIQEL  466



>ref|XP_009594030.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=380

 Score =   234 bits (597),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 110/200 (55%), Positives = 147/200 (74%), Gaps = 3/200 (2%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLV-AGK  623
            ED + +  LD+Q   SVIYVSFGS  V+++++++EF +GL+NS  KFLWVMR +++  GK
Sbjct  169  EDHSSIKWLDAQPMGSVIYVSFGSAVVLSKKEILEFRHGLLNSKVKFLWVMRPNILKGGK  228

Query  622  DDEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMIC  443
             D +     EL EG K NGY+V WAPQ+ VL H ++ GFLTHSGWNSTLES+  G PMIC
Sbjct  229  SDVQ--FMKELAEGCKGNGYVVSWAPQKMVLAHPSISGFLTHSGWNSTLESVIEGKPMIC  286

Query  442  WPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAK  263
            WP + DQ+  SR V E+W++GLDMKD+CDRS++E  I++LME ++ EF +  E + KLAK
Sbjct  287  WPQYVDQRVTSRLVNELWQIGLDMKDMCDRSTIERTIKDLMETKRDEFKKSIEELSKLAK  346

Query  262  EAISEGGSSYCNFDCLIQDM  203
             +I EGGSSY N DCLI D+
Sbjct  347  LSIGEGGSSYNNLDCLIHDI  366



>gb|KHG01936.1| UDP-glycosyltransferase 85A1 [Gossypium arboreum]
Length=913

 Score =   244 bits (624),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 119/199 (60%), Positives = 146/199 (73%), Gaps = 1/199 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED++C+  LD Q  RSVIYVSFGSI+  +R QL+E WYGL+NS  KFL+V+R D V GKD
Sbjct  701  EDKSCIPWLDKQPNRSVIYVSFGSITSTSRDQLVELWYGLLNSKTKFLFVVRPDSVIGKD  760

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
             E      EL E +K  GYIV WAPQE VL+H AVGGFLTHSGWNSTLESI AGVPM+CW
Sbjct  761  GEGEDFVKELMEKSKDRGYIVDWAPQEVVLNHEAVGGFLTHSGWNSTLESIVAGVPMVCW  820

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P+FADQQ  SR V  VWK+GLDMKDV DR  VE+++ ++M  +K EF+  A +M K+  +
Sbjct  821  PYFADQQVTSRVVSTVWKIGLDMKDVSDRKIVEKMVNDVMVDQK-EFVNSATDMAKVINQ  879

Query  259  AISEGGSSYCNFDCLIQDM  203
             +S GGSS  N D LI+D+
Sbjct  880  CVSIGGSSSNNLDRLIEDI  898


 Score =   229 bits (583),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 132/170 (78%), Gaps = 0/170 (0%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D++C+  LD Q  RSVIYVSFGSI+  +R+QL+E WYGL+NS  KFL V+R + V GKD 
Sbjct  279  DKSCIFWLDKQPNRSVIYVSFGSITSTSREQLVELWYGLLNSKTKFLLVVRPNSVIGKDG  338

Query  616  EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWP  437
            E   +  EL E +K  GYIV WAPQEAVL+H  VGGF TH+GWNSTLESI AGVPMICWP
Sbjct  339  EGEDVVVELMEKSKDQGYIVNWAPQEAVLNHPTVGGFFTHNGWNSTLESIVAGVPMICWP  398

Query  436  FFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERA  287
            +FADQQ NSR V EVWK+GLDMKDVCD+  VE++++++M  +K EF++ A
Sbjct  399  YFADQQVNSRVVSEVWKIGLDMKDVCDKKIVEKMVKDVMVDQKEEFVQSA  448



>ref|XP_010674282.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Beta 
vulgaris subsp. vulgaris]
Length=529

 Score =   238 bits (607),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/204 (55%), Positives = 151/204 (74%), Gaps = 5/204 (2%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLV--AGK  623
            D++C++ LD +  +SVIYVS GS + +T+ QL E W GLV S + FLWV+  +++   G 
Sbjct  327  DKSCISWLDQKPDKSVIYVSLGSTTTLTKDQLTELWTGLVQSKRYFLWVVSPNVIIEGGL  386

Query  622  DDEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMIC  443
            D   SP P++L EGT+  G IV W+PQ+ VL H A+GGFLTHSGWNSTLESI AGVPM+C
Sbjct  387  D---SPTPNDLLEGTEKRGCIVKWSPQDEVLTHRAIGGFLTHSGWNSTLESIVAGVPMLC  443

Query  442  WPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAK  263
            WP FADQQ NSRF  EVW++GLDMKD CDR+ VE++I +LM+ +K E    A+ + + AK
Sbjct  444  WPHFADQQLNSRFASEVWRIGLDMKDTCDRTIVEKMINDLMDGKKDELQRSAKRVSQEAK  503

Query  262  EAISEGGSSYCNFDCLIQDMIKVN  191
            ++ISEGGSSY N + LI+D+I ++
Sbjct  504  KSISEGGSSYSNLNRLIEDIIAMS  527



>gb|AIE12478.1| UGT5 [Panax ginseng]
Length=477

 Score =   236 bits (601),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 144/199 (72%), Gaps = 1/199 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            +D TC+  LDSQ  +SV+YVSFGS+ V+T+ QL+EFW+GLVNSG  FLWV+R  LV  ++
Sbjct  276  QDRTCIRWLDSQPSKSVVYVSFGSVVVLTQDQLLEFWHGLVNSGSPFLWVIRPGLVLAEN  335

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
            +     PSEL   T   G IVGW PQE VL H AVGGFL+HSGWNSTLESI AG+PMICW
Sbjct  336  NVAE-TPSELTIATNERGCIVGWGPQEEVLAHRAVGGFLSHSGWNSTLESIWAGMPMICW  394

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P  ADQ  NSR VGE+W+ GLDMKD CDRS+VE+++R LME +  E  +       +A+ 
Sbjct  395  PQIADQWINSRCVGEMWRTGLDMKDTCDRSTVEKMVRGLMEDKNEEIRKSTAIYSSMARN  454

Query  259  AISEGGSSYCNFDCLIQDM  203
            ++++GGSSY +   LI+D+
Sbjct  455  SVAKGGSSYHSMSKLIEDI  473



>ref|XP_009804549.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nicotiana 
sylvestris]
Length=487

 Score =   236 bits (602),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 107/199 (54%), Positives = 147/199 (74%), Gaps = 1/199 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED + +  LD+Q   SVIYVSFGS++ +++++++EFW+GLVNSG +FLWV+RS+L+ G++
Sbjct  274  EDHSSIQWLDAQPIESVIYVSFGSMATLSKEEILEFWHGLVNSGIRFLWVIRSNLLRGEE  333

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
                    EL EG K   YIV WAPQE VL H A+GGFLTHSGWNST+ESI  G PMICW
Sbjct  334  WNHQ-FAKELAEGCKERAYIVSWAPQEEVLAHSAIGGFLTHSGWNSTMESIVQGKPMICW  392

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
              + DQ+  SRFV EVWK+G+DMKD+CDR  +E+++++LM   + EF + AE +  LAKE
Sbjct  393  AVYVDQRVTSRFVSEVWKIGVDMKDICDRYIIEKMVKDLMVTNRDEFKKSAEKLSNLAKE  452

Query  259  AISEGGSSYCNFDCLIQDM  203
            ++ EGGSSY   +CL+ D+
Sbjct  453  SVGEGGSSYNALECLVDDI  471



>ref|XP_010676681.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Beta 
vulgaris subsp. vulgaris]
Length=503

 Score =   236 bits (601),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 117/202 (58%), Positives = 147/202 (73%), Gaps = 3/202 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED +C+A LD+Q   SVIYVSFGS+  +T  QL EFWYGLVNSG +FLWV RS +V   +
Sbjct  290  EDRSCIAWLDAQPSGSVIYVSFGSVVPLTMDQLTEFWYGLVNSGTRFLWVRRSGMVVEME  349

Query  619  DEESP---IPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPM  449
            + E     +P+E+ EGT+  G+IV WAPQE VL H AVGGFLTHSGWNSTLESI  G+PM
Sbjct  350  ESEEISLQVPTEILEGTRNRGFIVKWAPQEEVLAHRAVGGFLTHSGWNSTLESIVEGLPM  409

Query  448  ICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKL  269
            +CWP   DQ   SRFVG+VWK+G+DMKD+CDR  +E ++ +LM+ RK EF  RA  + KL
Sbjct  410  LCWPNGIDQLVISRFVGDVWKIGIDMKDICDRGVIEHMVIDLMKGRKDEFSRRANRLSKL  469

Query  268  AKEAISEGGSSYCNFDCLIQDM  203
            A EA+ EGGSS+     LI+D+
Sbjct  470  AGEAVREGGSSWRALHRLIEDI  491



>ref|XP_007026846.1| UDP-glucosyl transferase 85A3, putative isoform 2 [Theobroma 
cacao]
 gb|EOY07348.1| UDP-glucosyl transferase 85A3, putative isoform 2 [Theobroma 
cacao]
Length=448

 Score =   234 bits (597),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 115/200 (58%), Positives = 144/200 (72%), Gaps = 2/200 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED  CM  LDSQ  RSV++VSFGS   +TR +++EF +GLVNSG  FLWV+R D + G+ 
Sbjct  235  EDRGCMFWLDSQPSRSVVFVSFGSFVGLTRDKMLEFGHGLVNSGYPFLWVIRPDSITGEV  294

Query  619  DEESPIPSELKEGTKAN-GYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMIC  443
            D  S I  ELK   + N G +V WAPQE VL H A+G FLTHSGWNSTLES+ AGVPMIC
Sbjct  295  DP-SLILGELKAMIEDNKGLMVSWAPQEEVLAHPAIGVFLTHSGWNSTLESVYAGVPMIC  353

Query  442  WPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAK  263
            WP   DQQ NSRFV +VWK+GLDMKD CDRS++E+++R LME ++ E ++    + KLA 
Sbjct  354  WPAIGDQQINSRFVSDVWKIGLDMKDTCDRSTIEKMVRSLMEDKREEIMKSVNEIKKLAH  413

Query  262  EAISEGGSSYCNFDCLIQDM  203
            E I EGGSS+ N + LI D+
Sbjct  414  ETIKEGGSSFSNLEKLIDDI  433



>ref|XP_007026845.1| UDP-glucosyl transferase 85A3, putative isoform 1 [Theobroma 
cacao]
 gb|EOY07347.1| UDP-glucosyl transferase 85A3, putative isoform 1 [Theobroma 
cacao]
Length=488

 Score =   235 bits (599),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 116/209 (56%), Positives = 148/209 (71%), Gaps = 2/209 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED  CM  LDSQ  RSV++VSFGS   +TR +++EF +GLVNSG  FLWV+R D + G+ 
Sbjct  277  EDRGCMFWLDSQPSRSVVFVSFGSFVGLTRDKMLEFGHGLVNSGYPFLWVIRPDSITGEV  336

Query  619  DEESPIPSELKEGTKAN-GYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMIC  443
            D  S I  ELK   + N G +V WAPQE VL H A+G FLTHSGWNSTLES+ AGVPMIC
Sbjct  337  DP-SLILGELKAMIEDNKGLMVSWAPQEEVLAHPAIGVFLTHSGWNSTLESVYAGVPMIC  395

Query  442  WPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAK  263
            WP   DQQ NSRFV +VWK+GLDMKD CDRS++E+++R LME ++ E ++    + KLA 
Sbjct  396  WPAIGDQQINSRFVSDVWKIGLDMKDTCDRSTIEKMVRSLMEDKREEIMKSVNEIKKLAH  455

Query  262  EAISEGGSSYCNFDCLIQDMIKVNEATRE  176
            E I EGGSS+ N + LI D+  ++   R+
Sbjct  456  ETIKEGGSSFSNLEKLIDDIWSMSHFARK  484



>emb|CAN67315.1| hypothetical protein VITISV_036458 [Vitis vinifera]
Length=479

 Score =   234 bits (598),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 112/182 (62%), Positives = 138/182 (76%), Gaps = 1/182 (1%)
 Frame = -2

Query  790  TCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEE  611
            T +A   +   +SVIYVSFGS++VITR+QL+EF YGLVNSG +FLWV+R+D +A ++D E
Sbjct  250  TRLASESTNPSKSVIYVSFGSLTVITRKQLIEFCYGLVNSGXRFLWVIRTDSLA-EEDGE  308

Query  610  SPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFF  431
               P+EL EG K   YIV WAPQE VL H AVGGFLTHSGWNSTLESI AGVPMICWP+F
Sbjct  309  RQTPAELLEGAKERSYIVEWAPQEEVLAHPAVGGFLTHSGWNSTLESICAGVPMICWPYF  368

Query  430  ADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKEAIS  251
            ADQQ NSRF   VWK+G DMKD CDR  VE+++R+LME R+ E L+ A+ M   A++ + 
Sbjct  369  ADQQINSRFASHVWKLGSDMKDTCDRLIVEKMVRDLMEXRRDELLKTADMMATRARKCLD  428

Query  250  EG  245
             G
Sbjct  429  RG  430



>gb|AFJ53007.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=480

 Score =   233 bits (595),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 145/203 (71%), Gaps = 4/203 (2%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED+ CM  L+S   +SV+YVSFGS+   T  Q MEFW+GLVN+GK FLWV+R D V+G+D
Sbjct  274  EDKGCMTWLESHPSKSVVYVSFGSLVAFTEAQFMEFWHGLVNTGKPFLWVIRPDSVSGED  333

Query  619  D--EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMI  446
               +   I S LKE       +V WAPQ  VL H AVGGFLTHSGWNSTLE+I  GVPMI
Sbjct  334  GSIQSGRIISGLKEAHGNKCCVVDWAPQLEVLAHEAVGGFLTHSGWNSTLEAILEGVPMI  393

Query  445  CWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEK--RKGEFLERAENMGK  272
            CWP F+DQQ NSR V ++W VGLDMKD CDR +VE+++RELM+   ++ E ++    + +
Sbjct  394  CWPRFSDQQVNSRAVSDIWNVGLDMKDTCDRWTVEKMVRELMDDSCKRDEIVKSTAEIAR  453

Query  271  LAKEAISEGGSSYCNFDCLIQDM  203
            LA+++I EGGSSYCN + LI D+
Sbjct  454  LARDSIKEGGSSYCNLEKLIADV  476



>gb|AFK79038.1| glycosyltransferase UGT6 [Bupleurum chinense]
Length=489

 Score =   233 bits (595),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 112/200 (56%), Positives = 148/200 (74%), Gaps = 2/200 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED +CM  LD+Q  +SVIYVS GS++V++  QLME  +G+VNSGK+FLWV R   ++GKD
Sbjct  282  EDNSCMTWLDAQPRKSVIYVSIGSLAVMSIAQLMELRHGIVNSGKRFLWVQRPGSLSGKD  341

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
             E+  I +EL + T   G IV W  QE VL H A+G FLTHSGWNSTLE I  GVPM+CW
Sbjct  342  -EDYAISTELSDATTERGCIVSWVFQEEVLAHPAIGLFLTHSGWNSTLEGIIEGVPMLCW  400

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P+F DQQ NSRFV EVW VG+D+KD CDR ++E+ +RE+ME+RK EF + A  M KLA++
Sbjct  401  PYFVDQQVNSRFVQEVWSVGIDIKDKCDRVTIEKAVREIMEERKDEFEKSASMMAKLARQ  460

Query  259  AI-SEGGSSYCNFDCLIQDM  203
            ++  +GGSS+ NF+ L+ D+
Sbjct  461  SVCDQGGSSHHNFNRLVNDI  480



>ref|XP_010044032.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Eucalyptus 
grandis]
 gb|KCW86038.1| hypothetical protein EUGRSUZ_B02744 [Eucalyptus grandis]
Length=473

 Score =   232 bits (591),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 111/207 (54%), Positives = 151/207 (73%), Gaps = 2/207 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED +CM  L+SQ  RSV+YVSFGS+  IT  QLMEFW+GLVN G+ FLWV+R D + G++
Sbjct  268  EDRSCMVWLNSQASRSVVYVSFGSLVKITVDQLMEFWHGLVNCGRPFLWVLREDAILGEN  327

Query  619  DEES-PIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMIC  443
            +E++  + SELK  ++    +V WAPQE VL H AVGGFLTHSGWNSTLE I AG+PMIC
Sbjct  328  EEKARSLLSELKVVSERR-RVVDWAPQEEVLAHAAVGGFLTHSGWNSTLEGIVAGIPMIC  386

Query  442  WPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAK  263
            WP  ADQQ NSR+V EVWK+GLDMKD CDRS+VE ++R LM+ +K E ++    +  L+ 
Sbjct  387  WPRIADQQINSRWVSEVWKIGLDMKDTCDRSTVETMVRLLMDDKKEEIMKSMARISALSS  446

Query  262  EAISEGGSSYCNFDCLIQDMIKVNEAT  182
            +++   GSS  N + L++++ K+ + +
Sbjct  447  DSVGPEGSSSKNLERLVKNIRKICQTS  473



>ref|XP_006850414.1| hypothetical protein AMTR_s00165p00029520 [Amborella trichopoda]
 gb|ERN11995.1| hypothetical protein AMTR_s00165p00029520 [Amborella trichopoda]
Length=303

 Score =   226 bits (575),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 119/206 (58%), Positives = 144/206 (70%), Gaps = 5/206 (2%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED +C+  LDSQ P SV+YVSFGS +VI+R+QL EF YG+VNSGK FLWV+R DL+   D
Sbjct  102  EDRSCLTWLDSQAPGSVLYVSFGSYTVISRRQLTEFCYGIVNSGKPFLWVIRPDLL---D  158

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
             EE+ +P EL    +A G  V WAPQE VL H AV GFLTHSGWNSTLES+ AGVPM+CW
Sbjct  159  GEEAVLPEELALQAEAQGRFVKWAPQEEVLHHPAVVGFLTHSGWNSTLESLEAGVPMLCW  218

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
             FFADQQ NSRFV  VW VGLDMKDVCDR  VE  +REL+E         A  M +  +E
Sbjct  219  SFFADQQVNSRFVEGVWGVGLDMKDVCDRVVVEHKVRELVENEGPR--RAARAMAERVRE  276

Query  259  AISEGGSSYCNFDCLIQDMIKVNEAT  182
            +++ GGSS+  F+ LI D+  +   T
Sbjct  277  SVNPGGSSFMEFEELIDDIRSMRACT  302



>ref|XP_011466515.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=475

 Score =   231 bits (588),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/199 (55%), Positives = 140/199 (70%), Gaps = 2/199 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            +D  CM  LDSQ  +SV+YVSFG++  +TR Q+MEFWYGL+ SG  FLWV+RSD+ +  D
Sbjct  270  DDPNCMTWLDSQATKSVLYVSFGTLVTLTRTQIMEFWYGLIYSGHPFLWVIRSDITS--D  327

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
                PIP EL+ GTK  GYIV W  QE VL H +VGGFLTHSGWNSTLESI AG+PMICW
Sbjct  328  LGGDPIPMELEIGTKERGYIVNWVSQEEVLAHKSVGGFLTHSGWNSTLESIVAGIPMICW  387

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P   D    SR V E WK+GL +K+ CDR  +E +IR LME ++GE     + + K+A++
Sbjct  388  PNLGDHYIISRTVSEKWKIGLQLKENCDRKEIETMIRMLMEFKRGEIQSSMDVISKVARD  447

Query  259  AISEGGSSYCNFDCLIQDM  203
            ++ +GGSS  N + LIQD+
Sbjct  448  SVVKGGSSNHNLEMLIQDI  466



>ref|XP_004305167.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=475

 Score =   231 bits (588),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/198 (55%), Positives = 140/198 (71%), Gaps = 2/198 (1%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D  CM  LDSQ  +SV+YVSFG++  +T  Q++EFWYGL+NSG  FLWV+RSD+ +G   
Sbjct  271  DPNCMTWLDSQPTKSVLYVSFGTLVTLTGTQIIEFWYGLINSGHPFLWVIRSDITSGLGG  330

Query  616  EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWP  437
            +  PIP EL+ GTK  GYIV W  QE VL H +VGGFLTHSGWNSTLESI AG+PMICWP
Sbjct  331  D--PIPMELEIGTKERGYIVNWVSQEEVLAHKSVGGFLTHSGWNSTLESIVAGIPMICWP  388

Query  436  FFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKEA  257
               D    SR V E WK+GL +K+ CDR  +E +IR LME ++GE     + + K+A+++
Sbjct  389  NLGDHYIISRTVSEKWKIGLQLKENCDRKEIETMIRMLMEFKRGEIQSSMDVISKVARDS  448

Query  256  ISEGGSSYCNFDCLIQDM  203
            + +GGSS  N + LIQD+
Sbjct  449  VVKGGSSNHNLEMLIQDI  466



>ref|XP_008240016.1| PREDICTED: UDP-glycosyltransferase 85A4-like [Prunus mume]
Length=239

 Score =   223 bits (568),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 106/196 (54%), Positives = 139/196 (71%), Gaps = 4/196 (2%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D  CM  LDSQ  +SVIYVSFG++  +TR Q++EFWYGLVNSG  FLWVMRSD+  G   
Sbjct  39   DLNCMTWLDSQPFKSVIYVSFGTLVHLTRAQVIEFWYGLVNSGHPFLWVMRSDITHG---  95

Query  616  EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWP  437
             +  IP+EL++GTK  GYIV W  QE VL H +VGGFLTHSGWNSTLESI AG+PMICWP
Sbjct  96   -DHQIPAELEKGTKERGYIVDWVSQEEVLAHKSVGGFLTHSGWNSTLESIVAGLPMICWP  154

Query  436  FFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKEA  257
               D    SR V   WK+GL + + CDRS++E +++ LM  ++ E     + + KLA+++
Sbjct  155  NLGDHYIISRTVCRQWKIGLQLNENCDRSNIESMVQTLMGPKREEIQSSMDAISKLARDS  214

Query  256  ISEGGSSYCNFDCLIQ  209
            ++EGGSS+ N + LI+
Sbjct  215  VAEGGSSHNNLEQLIE  230



>emb|CDP04614.1| unnamed protein product [Coffea canephora]
Length=495

 Score =   230 bits (586),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 105/204 (51%), Positives = 149/204 (73%), Gaps = 2/204 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAG-K  623
            ED +C+  LDSQ  +SVIY+SFGS+  IT+ + +EFW+G++NSG++FLWV+R   + G K
Sbjct  282  EDTSCLCWLDSQPLKSVIYISFGSLKNITKDEFLEFWHGIMNSGQRFLWVIRPGSIKGQK  341

Query  622  DDEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMIC  443
             ++      EL  GTK  G I+ W PQE V+ H A+GGFL+HSGWNSTLESI AGVPMIC
Sbjct  342  LEQHDDFLKELNRGTKGKGLILSWVPQEEVIGHSAIGGFLSHSGWNSTLESIIAGVPMIC  401

Query  442  WPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAK  263
            WP + DQQ  SRFV E W +GLDMKD C RS +E+++R+++E R+ +F + A+   KLA+
Sbjct  402  WPCYVDQQVTSRFVSETWTLGLDMKDTCSRSIIEKMVRDIIE-RRCDFDQSADKFSKLAR  460

Query  262  EAISEGGSSYCNFDCLIQDMIKVN  191
            ++++ GGSS+ + D LI D+ K++
Sbjct  461  QSVAAGGSSHIDLDRLIGDIKKLS  484



>gb|KJB76813.1| hypothetical protein B456_012G109200 [Gossypium raimondii]
 gb|KJB76814.1| hypothetical protein B456_012G109200 [Gossypium raimondii]
 gb|KJB76815.1| hypothetical protein B456_012G109200 [Gossypium raimondii]
 gb|KJB76816.1| hypothetical protein B456_012G109200 [Gossypium raimondii]
Length=484

 Score =   229 bits (583),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 114/203 (56%), Positives = 147/203 (72%), Gaps = 1/203 (0%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            E++ C+  LDS   +SV++VSFGS+   T  Q++EFW+GLVNSGK FLWV+RS+ + G+D
Sbjct  275  EEKGCLTWLDSHPSKSVVFVSFGSVVTFTLDQMLEFWHGLVNSGKPFLWVIRSNAIIGED  334

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
            D    I  +LK+ TK  G IV WAPQE VL H AVG FLTHSGWNSTLESI AGVPMICW
Sbjct  335  DPRK-ILEDLKDNTKGKGSIVSWAPQEEVLAHPAVGAFLTHSGWNSTLESIYAGVPMICW  393

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P F DQ  NSR V  VW+VG DMKD C RS VE+++R+++E +  E ++  E + K A+E
Sbjct  394  PLFVDQYVNSRCVSHVWRVGFDMKDSCHRSIVEKMVRDVIEMKNEEIMKSMEEISKQAQE  453

Query  259  AISEGGSSYCNFDCLIQDMIKVN  191
            ++ E G SYCN D +IQD++ VN
Sbjct  454  SVKESGPSYCNLDKMIQDIMSVN  476



>ref|XP_006357782.1| PREDICTED: UDP-glycosyltransferase 85A1-like [Solanum tuberosum]
Length=484

 Score =   228 bits (581),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/208 (50%), Positives = 148/208 (71%), Gaps = 1/208 (0%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED + +  LD+Q   SVIYVSFGS++ +T+++++EFW+GLVNSG +FLWVMRSDL+  ++
Sbjct  271  EDHSSIQWLDAQPIESVIYVSFGSLATLTKEEMLEFWHGLVNSGIRFLWVMRSDLLREEE  330

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
                 +  EL  G K   YIV WAPQE VL H A+GGFLTHSGWNST+ESI    PMICW
Sbjct  331  FSHQFV-KELAAGCKERAYIVSWAPQEKVLSHPAIGGFLTHSGWNSTMESIVERKPMICW  389

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
              + DQ+  SRFVGEVWK+GLDMKD+CDR ++E+++++LM   K +  +  + +  LA+ 
Sbjct  390  AVYVDQRVTSRFVGEVWKIGLDMKDICDRDNIEKVVKDLMVTNKDKLKKSVDKLSMLAEI  449

Query  259  AISEGGSSYCNFDCLIQDMIKVNEATRE  176
            ++ EGGSSY  F+ L+ D+ K+    ++
Sbjct  450  SVGEGGSSYNAFEYLVDDIKKLGRRDKD  477



>gb|KHG08953.1| hypothetical protein F383_15475 [Gossypium arboreum]
Length=484

 Score =   228 bits (580),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 147/203 (72%), Gaps = 1/203 (0%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            E++ C+  LDS   +SV++VSFGS+   T  Q++EFW+GLVNSGK FLWV+RS+ + G+D
Sbjct  275  EEKGCLTWLDSHPSKSVVFVSFGSVVTFTLDQMLEFWHGLVNSGKPFLWVIRSNAIIGED  334

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
            D    I  +LK+ TK  G IV WAPQE VL H AVG FLTHSGWNSTLESI AGVPMICW
Sbjct  335  DPRK-ILEDLKDNTKGKGSIVSWAPQEEVLAHPAVGAFLTHSGWNSTLESIYAGVPMICW  393

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P F DQ  NSR V  VW+VG DMKD C RS +E+++R+++E +  E ++  E + K A+E
Sbjct  394  PLFVDQYVNSRCVSYVWRVGFDMKDSCHRSIIEKMVRDVIEMKNEEIMKSMEEISKQAQE  453

Query  259  AISEGGSSYCNFDCLIQDMIKVN  191
            ++ E G SYCN D +IQD++ VN
Sbjct  454  SVKESGPSYCNLDKMIQDIMSVN  476



>ref|XP_006850416.1| hypothetical protein AMTR_s00165p00031520 [Amborella trichopoda]
 gb|ERN11997.1| hypothetical protein AMTR_s00165p00031520 [Amborella trichopoda]
Length=303

 Score =   222 bits (566),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 109/199 (55%), Positives = 137/199 (69%), Gaps = 5/199 (3%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED +C+  LDS  P SV+YVSFGS  V++R QL+EF YG++NS K FLWV+R DL+AG  
Sbjct  102  EDHSCLTWLDSHAPNSVLYVSFGSYVVMSRGQLIEFCYGIINSRKPFLWVIRPDLLAG--  159

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
             +E  +P EL    KA G  V WAPQ+ VL H AV GFLTHSGWNSTLES+ A VPM+CW
Sbjct  160  -DEMVLPEELTVEAKARGRFVEWAPQKQVLQHPAVAGFLTHSGWNSTLESLVAEVPMLCW  218

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            PFF DQQ NSRFV  VW +GLDMKD C+R  +E L+ EL+E        RA  M + A++
Sbjct  219  PFFVDQQINSRFVERVWGMGLDMKDTCERVVIEHLVSELVESEGLRTATRA--MAEKARQ  276

Query  259  AISEGGSSYCNFDCLIQDM  203
            ++   GSSY  F+ L+ D+
Sbjct  277  SVDPSGSSYLEFEELVNDI  295



>ref|XP_010316060.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like isoform 
X2 [Solanum lycopersicum]
Length=469

 Score =   226 bits (577),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 106/208 (51%), Positives = 147/208 (71%), Gaps = 1/208 (0%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED + +  LD+Q   SVIYVSFGS++ +T+++++EFW+GLVNSG +FLWVMRSDL+  ++
Sbjct  253  EDGSSIQWLDAQPVESVIYVSFGSLATLTKEEMLEFWHGLVNSGIRFLWVMRSDLLREEE  312

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
                 +  EL +G K   YIV WAPQE VL H A+GGFLTHSGWNST+ESI    PMICW
Sbjct  313  FSHQFV-KELADGCKERAYIVSWAPQEKVLSHPAIGGFLTHSGWNSTMESIVERKPMICW  371

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
              + DQ+  SRFVGEVWK+GLDMKD+CDR  +E+ +++LM   K +  +  + +  LAK 
Sbjct  372  AVYVDQRVTSRFVGEVWKIGLDMKDICDRYIIEKAVKDLMVTNKDKLKKSVDKLSMLAKI  431

Query  259  AISEGGSSYCNFDCLIQDMIKVNEATRE  176
            ++ EGGSSY  F+ L+ D+ K+    ++
Sbjct  432  SVGEGGSSYNAFESLVIDIKKLGRRDKD  459



>ref|XP_004231996.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like isoform 
X1 [Solanum lycopersicum]
Length=477

 Score =   227 bits (578),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 106/208 (51%), Positives = 147/208 (71%), Gaps = 1/208 (0%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED + +  LD+Q   SVIYVSFGS++ +T+++++EFW+GLVNSG +FLWVMRSDL+  ++
Sbjct  261  EDGSSIQWLDAQPVESVIYVSFGSLATLTKEEMLEFWHGLVNSGIRFLWVMRSDLLREEE  320

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
                 +  EL +G K   YIV WAPQE VL H A+GGFLTHSGWNST+ESI    PMICW
Sbjct  321  FSHQFV-KELADGCKERAYIVSWAPQEKVLSHPAIGGFLTHSGWNSTMESIVERKPMICW  379

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
              + DQ+  SRFVGEVWK+GLDMKD+CDR  +E+ +++LM   K +  +  + +  LAK 
Sbjct  380  AVYVDQRVTSRFVGEVWKIGLDMKDICDRYIIEKAVKDLMVTNKDKLKKSVDKLSMLAKI  439

Query  259  AISEGGSSYCNFDCLIQDMIKVNEATRE  176
            ++ EGGSSY  F+ L+ D+ K+    ++
Sbjct  440  SVGEGGSSYNAFESLVIDIKKLGRRDKD  467



>ref|XP_010316061.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Solanum 
lycopersicum]
Length=482

 Score =   227 bits (578),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 104/208 (50%), Positives = 149/208 (72%), Gaps = 1/208 (0%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED + +  LD+Q   SVIYVSFGS++ +T+++++EFW+GLVNSG +FLWVMRSDL+  ++
Sbjct  269  EDHSSIQWLDAQPIESVIYVSFGSLATLTKEEMLEFWHGLVNSGIRFLWVMRSDLLR-EE  327

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
            +    +  EL +G K   YIV WAPQE VL H A+GGFLTHSGWNST+ESI    PMICW
Sbjct  328  EFSHQLVKELADGCKERAYIVSWAPQEKVLSHPAIGGFLTHSGWNSTMESIVERKPMICW  387

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
              + DQ+  SRFV EVWK+GLDMKD+CDR ++E+++++LM   K +  +  + +  LA+ 
Sbjct  388  AVYVDQRVTSRFVSEVWKIGLDMKDICDRDNIEKVVKDLMVTNKEKLKKSVDKLSMLAEI  447

Query  259  AISEGGSSYCNFDCLIQDMIKVNEATRE  176
            ++ EGGSSY  F+ L+ D+ K+    ++
Sbjct  448  SVGEGGSSYNAFEYLVDDIKKLGRRDKD  475



>ref|XP_007208247.1| hypothetical protein PRUPE_ppa016769mg [Prunus persica]
 gb|EMJ09446.1| hypothetical protein PRUPE_ppa016769mg [Prunus persica]
Length=380

 Score =   223 bits (567),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/196 (54%), Positives = 140/196 (71%), Gaps = 4/196 (2%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D  CM  LDSQ  +SVIYVSFG++  +TR Q++EFWYGLVNSG  FLWVMRSD+ +G   
Sbjct  180  DLNCMTWLDSQPSKSVIYVSFGTLVHLTRAQVIEFWYGLVNSGHPFLWVMRSDITSG---  236

Query  616  EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWP  437
             +  IP+EL++GTK  GY+V W  QE VL H +VGGFLTHSGWNSTLESI AG+PMI WP
Sbjct  237  -DHQIPTELEKGTKERGYVVDWVSQEEVLAHKSVGGFLTHSGWNSTLESIVAGLPMISWP  295

Query  436  FFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKEA  257
             F D    SR V + WK+GL + + CDRS++E +++ LM  +  E     + + KLA+++
Sbjct  296  KFGDHYIISRTVCQQWKIGLQLNENCDRSNIESMVQTLMGPKGEEIQSSMDAISKLARDS  355

Query  256  ISEGGSSYCNFDCLIQ  209
            ++EGGSS+ N + LI+
Sbjct  356  VAEGGSSHNNLEQLIE  371



>ref|XP_008370128.1| PREDICTED: UDP-glycosyltransferase 85A1-like [Malus domestica]
Length=290

 Score =   220 bits (560),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 108/186 (58%), Positives = 135/186 (73%), Gaps = 3/186 (2%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED  C A LDS++  SVIYVSFGS+  +T  QL EFW+GLV+ GK+FLWV+RSD+++GK 
Sbjct  99   EDRRCTAWLDSKQVGSVIYVSFGSLVKLTHDQLFEFWHGLVSCGKQFLWVVRSDMISGKK  158

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
             E   IP+ELK GTK  G IV WAPQE VL H AVGGFLT  GWNS LE I AGVPM+CW
Sbjct  159  XEHV-IPTELKMGTKERGLIVEWAPQEEVLAHKAVGGFLTQCGWNSILEGIWAGVPMLCW  217

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEK--RKGEFLERAENMGKLA  266
            P  A+Q   SR++GEVW++G+DMKD C+RS VE++IR LME+   + + L   E   KLA
Sbjct  218  PRLAEQLVTSRWIGEVWRIGIDMKDTCERSMVEKMIRRLMEEGDEREQILRSVERFSKLA  277

Query  265  KEAISE  248
            + A+ E
Sbjct  278  RGAVVE  283



>ref|XP_006357780.1| PREDICTED: UDP-glycosyltransferase 85A1-like [Solanum tuberosum]
Length=489

 Score =   225 bits (574),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 104/208 (50%), Positives = 146/208 (70%), Gaps = 1/208 (0%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED + +  LD+    SVIYVSFGS++ +T+++++EFW+GLVNSG +FLWVMRSDL+  ++
Sbjct  276  EDHSSIQWLDAHPTESVIYVSFGSLATLTKKEILEFWHGLVNSGIRFLWVMRSDLLREEE  335

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
                 +  EL +G +   YIV WAPQE VL H A+GGFLTHSGWNST+ESI    PMICW
Sbjct  336  FSHQFV-KELTDGCEERAYIVSWAPQEKVLSHPAIGGFLTHSGWNSTMESIVERKPMICW  394

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
              + DQ+  SRFVGEVWK+GLDMKD+CDR  +E+ ++ELM   K +  +  + +  LA+ 
Sbjct  395  AVYVDQRVTSRFVGEVWKIGLDMKDICDRYIIEKAVKELMVTNKDKLKKSVDKLSMLAEI  454

Query  259  AISEGGSSYCNFDCLIQDMIKVNEATRE  176
            ++ EGGSSY  F+ L+ D+ K+    ++
Sbjct  455  SVGEGGSSYNAFEYLVNDIKKLGRRNKD  482



>ref|XP_007207791.1| hypothetical protein PRUPE_ppa025605mg [Prunus persica]
 gb|EMJ08990.1| hypothetical protein PRUPE_ppa025605mg [Prunus persica]
Length=483

 Score =   225 bits (574),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 105/196 (54%), Positives = 138/196 (70%), Gaps = 4/196 (2%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D  CM  LDSQ  RSVIYVSFG++  +TR Q++EFWYGLVNSG  F+WV+RSD++ G   
Sbjct  274  DPNCMTWLDSQPSRSVIYVSFGTLVNLTRAQMIEFWYGLVNSGHPFMWVIRSDIIYGAHQ  333

Query  616  EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWP  437
                IP+EL+ GTK  GYIV W  QE VL H AVGGFLTHSGWNSTLESI AG+PMICWP
Sbjct  334  ----IPAELEIGTKERGYIVDWVSQEEVLAHKAVGGFLTHSGWNSTLESIVAGLPMICWP  389

Query  436  FFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKEA  257
               D    SR V + WK+GL + ++CDR ++E +I+ LM  ++ E     + + KLA+++
Sbjct  390  NLGDHYIISRTVSQKWKIGLQLNEICDRCNIETMIQTLMGPKREEIQSSIDTISKLARDS  449

Query  256  ISEGGSSYCNFDCLIQ  209
            + +GGSS+ N + LI+
Sbjct  450  VVKGGSSHNNLEQLIE  465



>gb|ACU22679.1| unknown [Glycine max]
Length=259

 Score =   217 bits (553),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 104/199 (52%), Positives = 139/199 (70%), Gaps = 7/199 (4%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED +C+  LD Q+ +SV+YVSFG++  ++ +QLMEFW+GLVNS K FLWV++ +L+  K+
Sbjct  61   EDRSCITWLDHQKAKSVLYVSFGTVVNLSYEQLMEFWHGLVNSLKPFLWVIQKELIIQKN  120

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
                 +P EL+ GTK  G++V WAPQE VL + AVGGFLTH GWNSTLESIA GVPM+CW
Sbjct  121  -----VPIELEIGTKERGFLVNWAPQEEVLANPAVGGFLTHCGWNSTLESIAEGVPMLCW  175

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P   DQ  NSR V E WK+GL+M   CDR  VE ++R++ME    + +  A ++ K A  
Sbjct  176  PSITDQTVNSRCVSEQWKIGLNMNGSCDRFVVENMVRDIMENE--DLMRSANDVAKKALH  233

Query  259  AISEGGSSYCNFDCLIQDM  203
             I E GSSY N + LI+D+
Sbjct  234  GIKENGSSYHNLENLIKDI  252



>ref|XP_008242262.1| PREDICTED: UDP-glycosyltransferase 85A7-like [Prunus mume]
Length=456

 Score =   223 bits (568),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 105/196 (54%), Positives = 138/196 (70%), Gaps = 4/196 (2%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D  CM  LDSQ  +SVIYVSFG++  +T  Q++EFWYGLVNSG  FLWVMRSD+ +G   
Sbjct  256  DLNCMTWLDSQPSKSVIYVSFGTLVHLTHAQVIEFWYGLVNSGHPFLWVMRSDITSGDHQ  315

Query  616  EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWP  437
                IP+EL++GTK  GYIV W  QE VL H +VGGFLTHSGWNSTLESI AG+PMICWP
Sbjct  316  ----IPAELEKGTKERGYIVDWVSQEEVLAHKSVGGFLTHSGWNSTLESIVAGLPMICWP  371

Query  436  FFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKEA  257
               D    SR V   WK+GL + + CDRS++E +++ LM  ++ E     + + KLA+++
Sbjct  372  NLGDHYIISRTVCRQWKIGLQLNENCDRSNIESMVQTLMGPKREEIQSSMDAISKLARDS  431

Query  256  ISEGGSSYCNFDCLIQ  209
            ++EGGSS+ N + LI+
Sbjct  432  VAEGGSSHNNLEQLIE  447



>gb|KJB74139.1| hypothetical protein B456_011G275100 [Gossypium raimondii]
Length=477

 Score =   223 bits (569),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 108/181 (60%), Positives = 134/181 (74%), Gaps = 3/181 (2%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D++CM  L+ Q  RSVIYVSFGSI+  +R+QL+E WYGL+NS  KFL V+R + V GKD 
Sbjct  279  DKSCMFWLNKQPNRSVIYVSFGSITSTSREQLVELWYGLLNSKTKFLLVVRPNSVIGKDG  338

Query  616  EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWP  437
            E   +  EL E +K  GYIV WAPQEAVL+H A+GGF TH+GWNSTLES+ AGVPMICWP
Sbjct  339  EGEDVVMELMEKSKDRGYIVNWAPQEAVLNHPAIGGFFTHNGWNSTLESVVAGVPMICWP  398

Query  436  FFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKEA  257
             FADQ  N R V EVWK+GLDMKDVCD   VE+++ ++M  RK EF   A++  ++AKE 
Sbjct  399  QFADQHVNCRVVSEVWKIGLDMKDVCDSKIVEKMVNDVMVDRKEEF---AKSASEIAKEE  455

Query  256  I  254
            I
Sbjct  456  I  456



>emb|CBI31575.3| unnamed protein product [Vitis vinifera]
Length=482

 Score =   223 bits (569),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 109/199 (55%), Positives = 140/199 (70%), Gaps = 21/199 (11%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED +C+A LD Q  +SVIYVSFGS++VI+R+QL+EF +GLVNSG +FLWV+R+D +A ++
Sbjct  276  EDRSCIAWLDHQPSKSVIYVSFGSLTVISRKQLIEFCHGLVNSGSRFLWVIRTDSLA-EE  334

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
            D E   P+EL EG K   YIV                     GWNSTLESI AGVPMICW
Sbjct  335  DGEHQTPAELMEGAKERSYIV--------------------DGWNSTLESICAGVPMICW  374

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P+FADQQ NSRFV  VWK+G DMKD CDR  VE+++R+LME+RK E L+ A+ M   A++
Sbjct  375  PYFADQQINSRFVSHVWKLGSDMKDTCDRLIVEKMVRDLMEERKDELLKTADKMATRARK  434

Query  259  AISEGGSSYCNFDCLIQDM  203
             +SEGGSSYCN   L+ ++
Sbjct  435  CVSEGGSSYCNLSSLVDEI  453



>ref|XP_008346926.1| PREDICTED: UDP-glycosyltransferase 85A7-like [Malus domestica]
Length=476

 Score =   223 bits (569),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 103/197 (52%), Positives = 142/197 (72%), Gaps = 3/197 (2%)
 Frame = -2

Query  793  ETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDE  614
            + CM  LD+   RSVIYVSFGS+  +T +Q++EFWYGLV SG+ F+WV+RSD+ + +D +
Sbjct  275  QKCMTWLDNHPSRSVIYVSFGSLVKLTHEQVIEFWYGLVKSGQPFIWVIRSDITSRQDLD  334

Query  613  ESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPF  434
               +P+EL+ GTK  G+IV WAPQE VL H+AVGGFLTHSGWNSTLE I AGVPMIC+P 
Sbjct  335  ---VPAELETGTKERGFIVEWAPQEEVLAHIAVGGFLTHSGWNSTLEGIVAGVPMICFPI  391

Query  433  FADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKEAI  254
              D    SR V   WK+GL + + CDRS +E +I++LM  +K    +  ++  KLA++++
Sbjct  392  LGDHMIVSRTVCLKWKIGLPLSENCDRSEIETVIKDLMGYKKEGIQKSMDSTSKLARDSV  451

Query  253  SEGGSSYCNFDCLIQDM  203
             +GGSS+CN + LIQ +
Sbjct  452  KKGGSSHCNLELLIQQI  468



>gb|KJB74138.1| hypothetical protein B456_011G275100 [Gossypium raimondii]
 gb|KJB74140.1| hypothetical protein B456_011G275100 [Gossypium raimondii]
Length=469

 Score =   223 bits (568),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/175 (60%), Positives = 129/175 (74%), Gaps = 0/175 (0%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D++CM  L+ Q  RSVIYVSFGSI+  +R+QL+E WYGL+NS  KFL V+R + V GKD 
Sbjct  279  DKSCMFWLNKQPNRSVIYVSFGSITSTSREQLVELWYGLLNSKTKFLLVVRPNSVIGKDG  338

Query  616  EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWP  437
            E   +  EL E +K  GYIV WAPQEAVL+H A+GGF TH+GWNSTLES+ AGVPMICWP
Sbjct  339  EGEDVVMELMEKSKDRGYIVNWAPQEAVLNHPAIGGFFTHNGWNSTLESVVAGVPMICWP  398

Query  436  FFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGK  272
             FADQ  N R V EVWK+GLDMKDVCD   VE+++ ++M  RK EF + A  + K
Sbjct  399  QFADQHVNCRVVSEVWKIGLDMKDVCDSKIVEKMVNDVMVDRKEEFAKSASEIAK  453



>gb|AFJ53008.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=487

 Score =   223 bits (568),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 118/202 (58%), Positives = 148/202 (73%), Gaps = 7/202 (3%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            E+ +C+  LD Q   SV+YV+FGSI+V+T  +++EFW GL +S  +FLWVMR  L+  K+
Sbjct  282  EEASCLKWLDQQPEGSVLYVNFGSITVMTADRIVEFWEGLSSSKHRFLWVMRPGLIPDKE  341

Query  619  DEESPIPSEL---KEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPM  449
             E+  IP E+   KEG      +VGWAPQE VL+H AVGGFLTHSGWNSTLES+AAGVPM
Sbjct  342  LEK--IPQEILNQKEGFYK--VVVGWAPQEEVLNHAAVGGFLTHSGWNSTLESVAAGVPM  397

Query  448  ICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKL  269
            ICWPFFADQ  NSR V EV+ +GLDMKDVCDR  VE ++ +LM++RK EF   A  M  L
Sbjct  398  ICWPFFADQLVNSRVVSEVYNLGLDMKDVCDRKVVERMVNDLMDERKDEFQSLAAKMAAL  457

Query  268  AKEAISEGGSSYCNFDCLIQDM  203
            AK ++SEGGSS  N + LIQD+
Sbjct  458  AKGSVSEGGSSCRNLEVLIQDI  479



>ref|XP_007009137.1| UDP-glucosyltransferase family 1 protein, putative [Theobroma 
cacao]
 gb|EOY17947.1| UDP-glucosyltransferase family 1 protein, putative [Theobroma 
cacao]
Length=460

 Score =   221 bits (563),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 108/199 (54%), Positives = 134/199 (67%), Gaps = 29/199 (15%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED  C++ LD Q  +SV+YV F                             R + V GKD
Sbjct  283  EDRNCISWLDKQPKQSVVYVKF-----------------------------RPNSVTGKD  313

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
             +   +P EL EGT+  G IVGWAPQE VL+H AVGGFLTHSGWNSTLES+ AGVPMICW
Sbjct  314  GQGEDVPVELLEGTQERGCIVGWAPQEEVLNHSAVGGFLTHSGWNSTLESVVAGVPMICW  373

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P+FADQQ NSRFV EVWK+GLDMKDVCDR +VE+++ +LM  ++ EF++ A  M KLAKE
Sbjct  374  PYFADQQVNSRFVSEVWKLGLDMKDVCDRKAVEKMVNDLMMDKREEFVKSAAEMAKLAKE  433

Query  259  AISEGGSSYCNFDCLIQDM  203
            +++ GGSSYCN D LI+D+
Sbjct  434  SVNVGGSSYCNLDRLIEDI  452



>ref|XP_007026851.1| UDP-Glycosyltransferase superfamily protein isoform 2 [Theobroma 
cacao]
 gb|EOY07353.1| UDP-Glycosyltransferase superfamily protein isoform 2 [Theobroma 
cacao]
Length=489

 Score =   222 bits (565),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 106/202 (52%), Positives = 144/202 (71%), Gaps = 3/202 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGK-  623
            ED  C+  LDSQ   SVI+VSFGS+  ++R Q++E   GL+NS + FLWV+  + + G+ 
Sbjct  282  EDTNCITWLDSQPSGSVIFVSFGSLVSLSRSQILEIGQGLLNSCRPFLWVILPNPIVGQQ  341

Query  622  DDEESP--IPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPM  449
            +D+ +P  I  EL+  +K  G IV WAPQE VL H A+GGFLTHSGWNST+ESI A VPM
Sbjct  342  EDDSTPGQILMELENMSKEKGLIVSWAPQEKVLAHPAIGGFLTHSGWNSTMESIYARVPM  401

Query  448  ICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKL  269
            ICWP  ADQ  NSR V E+W++G DMKD CDRS+VE+L+ +LME ++ E ++  + + + 
Sbjct  402  ICWPTEADQLVNSRCVSELWRIGFDMKDTCDRSTVEKLVNDLMEDKRDEIMKSMDKITRQ  461

Query  268  AKEAISEGGSSYCNFDCLIQDM  203
            A+E++ EGGSSYCN   LI D+
Sbjct  462  AEESVQEGGSSYCNLQRLITDI  483



>ref|XP_007026850.1| UDP-glucosyl transferase 85A4-like protein isoform 1 [Theobroma 
cacao]
 gb|EOY07352.1| UDP-glucosyl transferase 85A4-like protein isoform 1 [Theobroma 
cacao]
Length=490

 Score =   221 bits (564),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 106/202 (52%), Positives = 144/202 (71%), Gaps = 3/202 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGK-  623
            ED  C+  LDSQ   SVI+VSFGS+  ++R Q++E   GL+NS + FLWV+  + + G+ 
Sbjct  283  EDTNCITWLDSQPSGSVIFVSFGSLVSLSRSQILEIGQGLLNSCRPFLWVILPNPIVGQQ  342

Query  622  DDEESP--IPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPM  449
            +D+ +P  I  EL+  +K  G IV WAPQE VL H A+GGFLTHSGWNST+ESI A VPM
Sbjct  343  EDDSTPGQILMELENMSKEKGLIVSWAPQEKVLAHPAIGGFLTHSGWNSTMESIYARVPM  402

Query  448  ICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKL  269
            ICWP  ADQ  NSR V E+W++G DMKD CDRS+VE+L+ +LME ++ E ++  + + + 
Sbjct  403  ICWPTEADQLVNSRCVSELWRIGFDMKDTCDRSTVEKLVNDLMEDKRDEIMKSMDKITRQ  462

Query  268  AKEAISEGGSSYCNFDCLIQDM  203
            A+E++ EGGSSYCN   LI D+
Sbjct  463  AEESVQEGGSSYCNLQRLITDI  484



>dbj|BAM63146.1| uncharacterized glucosyltransferase 2 [Ipomoea nil]
Length=464

 Score =   221 bits (563),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 105/203 (52%), Positives = 139/203 (68%), Gaps = 0/203 (0%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED TC+  LD Q   SVIYVSFGS++ +T  QLME W+GLV S  +FLWV+R D+V    
Sbjct  261  EDNTCIQWLDEQPDESVIYVSFGSLNTLTMAQLMEVWHGLVASAVRFLWVLRPDIVKDNL  320

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
              +  + +EL++G   NG IV WAPQE VL H A+GGF THSGWNSTLESI AG PMIC 
Sbjct  321  SSDQNLVTELRKGCSENGQIVSWAPQEEVLAHRAIGGFWTHSGWNSTLESIIAGKPMICS  380

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
                DQ    R V EVWK+G+DM+D CDR S+E++++E+M  R  E  + A+   KLA+E
Sbjct  381  AQIVDQLITRRVVSEVWKIGVDMEDKCDRLSIEKMVKEVMGSRGQELKKSAQKFSKLARE  440

Query  259  AISEGGSSYCNFDCLIQDMIKVN  191
            +++ GGSSY N D LI ++ +++
Sbjct  441  SVNNGGSSYTNLDHLINEIRRLS  463



>ref|XP_007207618.1| hypothetical protein PRUPE_ppa019804mg [Prunus persica]
 gb|EMJ08817.1| hypothetical protein PRUPE_ppa019804mg [Prunus persica]
Length=474

 Score =   221 bits (563),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 105/196 (54%), Positives = 138/196 (70%), Gaps = 4/196 (2%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D  CM  LDSQ  +SVIYVSFG++  +TR Q++EFWYGLVNSG  FLWVMRSD+ +G   
Sbjct  274  DLNCMTWLDSQPSKSVIYVSFGTLVHLTRAQVIEFWYGLVNSGHPFLWVMRSDITSG---  330

Query  616  EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWP  437
             +  IP+EL+ GTK  G IV W  QE VL H +VGGFLTHSGWNSTLESI AG+PMICWP
Sbjct  331  -DHQIPAELENGTKERGCIVDWVSQEEVLAHKSVGGFLTHSGWNSTLESIVAGLPMICWP  389

Query  436  FFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKEA  257
               D    SR V   WK+GL + + CDRS++E +++ LM  ++ E     + + KLA+++
Sbjct  390  KLGDHYIISRTVCRQWKIGLQLNENCDRSNIESMVQTLMGSKREEIQSSMDAISKLARDS  449

Query  256  ISEGGSSYCNFDCLIQ  209
            ++EGGSS+ N + LI+
Sbjct  450  VAEGGSSHNNLEQLIE  465



>gb|AFJ53010.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=459

 Score =   220 bits (561),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 108/202 (53%), Positives = 145/202 (72%), Gaps = 4/202 (2%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED +CM  LD Q P+SV+Y +FGSI+V+  ++L+E W+GL+NS +KFLWV+R   +   +
Sbjct  253  EDRSCMKWLDLQPPKSVLYANFGSITVMKPEELVEIWHGLINSKQKFLWVIRQGTITSIE  312

Query  619  DEESPIPSEL-KEGTKANGYIV--GWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPM  449
            +  S  P EL K G+K + ++V  GW  Q+ VLDH ++GGFLTHSGWNSTLE+I AGVPM
Sbjct  313  NT-SEFPEELVKGGSKGDEFMVLSGWVAQKEVLDHGSIGGFLTHSGWNSTLETIVAGVPM  371

Query  448  ICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKL  269
            IC P+FADQQ NSRF  EVWK+GLDMKD C R  VE ++ ELM +RK EF   A  M +L
Sbjct  372  ICLPYFADQQVNSRFTSEVWKLGLDMKDSCKRGVVERMVNELMVERKEEFGRCAAKMAEL  431

Query  268  AKEAISEGGSSYCNFDCLIQDM  203
            A+ ++S GG S  N + LI+++
Sbjct  432  ARMSVSTGGCSSRNLEDLIEEI  453



>ref|XP_007207170.1| hypothetical protein PRUPE_ppa022102mg [Prunus persica]
 gb|EMJ08369.1| hypothetical protein PRUPE_ppa022102mg [Prunus persica]
Length=474

 Score =   220 bits (561),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/196 (53%), Positives = 136/196 (69%), Gaps = 4/196 (2%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D  CM  LDSQ  +SVIYVSFG++  +TR Q++EFWYGL+NSG  FLWVMRSD+ +G   
Sbjct  274  DLNCMTWLDSQPSKSVIYVSFGTLVHLTRAQVIEFWYGLINSGHPFLWVMRSDITSGDHQ  333

Query  616  EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWP  437
                IP EL+ GTK  G IV W  QE VL H +VGGFLTHSGWNSTLESI AG+PMICWP
Sbjct  334  ----IPPELENGTKERGCIVDWVSQEEVLAHKSVGGFLTHSGWNSTLESIVAGLPMICWP  389

Query  436  FFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKEA  257
               D    SR V   WK+GL + + CDRS++E +++ LM  ++ E     + + KLA+++
Sbjct  390  NLGDHYIISRTVCRQWKIGLQLNENCDRSNIESMVQTLMGSKREEIQSSMDAISKLARDS  449

Query  256  ISEGGSSYCNFDCLIQ  209
            ++EGGSS+ N + LI+
Sbjct  450  VAEGGSSHNNLEQLIE  465



>ref|XP_009759439.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Nicotiana 
sylvestris]
Length=483

 Score =   221 bits (562),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 111/212 (52%), Positives = 153/212 (72%), Gaps = 6/212 (3%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED + +  LD+Q   SV+YVSFGS+ V+++++++EF +GL+NS  KFLWVMR +++ G +
Sbjct  272  EDHSSIKWLDAQPMGSVLYVSFGSVVVVSKEEILEFQHGLLNSKVKFLWVMRPNILKGGE  331

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
             +   +  EL EG K NGYIV WAPQ+ VL H A+ GFLTHSGWNSTLES++ G PMICW
Sbjct  332  SDVQFM-KELAEGCKGNGYIVSWAPQKMVLAHPAIAGFLTHSGWNSTLESVSEGKPMICW  390

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P + DQ+ NSR V E+W++GLDMK +CDRS++E +I++LME ++ E  +  E + KLAK 
Sbjct  391  PHYVDQRVNSRLVNELWQIGLDMKGICDRSTIERMIKDLMEIKRDELKKSIEELSKLAKL  450

Query  259  AISEGGSSYCNFDCLIQDM-----IKVNEATR  179
            ++ EGGSSY N DCLI D+      K NE  R
Sbjct  451  SVEEGGSSYNNLDCLIDDIKELARTKENENIR  482



>gb|KJB74137.1| hypothetical protein B456_011G275000 [Gossypium raimondii]
Length=469

 Score =   220 bits (560),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/175 (60%), Positives = 129/175 (74%), Gaps = 0/175 (0%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D++C+  L+ Q  RSVIYVSF SI+ ++R+QL+E WYGL+NS  KFL V+R D V GKD 
Sbjct  279  DKSCIFWLNKQPNRSVIYVSFVSITSMSREQLVELWYGLLNSKTKFLLVVRPDSVIGKDG  338

Query  616  EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWP  437
            E   +  EL E +K  GYIV  APQEAVL+H A+GGF TH+GWNSTLES+ AGVPMICWP
Sbjct  339  EGEDVVMELMEKSKDRGYIVNCAPQEAVLNHPAIGGFFTHNGWNSTLESVVAGVPMICWP  398

Query  436  FFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGK  272
             FADQ  NSR V EVWK+GLDMKDVCD   VE+++ ++M  RK EF + A  M K
Sbjct  399  QFADQHVNSRVVSEVWKIGLDMKDVCDSKMVEKMVNDVMVDRKEEFAKSASEMAK  453



>ref|XP_008242242.1| PREDICTED: UDP-glycosyltransferase 85A1-like [Prunus mume]
Length=448

 Score =   219 bits (557),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/193 (54%), Positives = 136/193 (70%), Gaps = 4/193 (2%)
 Frame = -2

Query  787  CMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDDEES  608
            CM  LDSQ  +SVIYVSFG++  +TR Q++EFWYGLVNSG  FLWVM+SD+ +G      
Sbjct  251  CMTWLDSQPFKSVIYVSFGTLVHLTRAQVIEFWYGLVNSGHPFLWVMKSDITSGDHQ---  307

Query  607  PIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWPFFA  428
             IP EL++GTK  GYIV W  QE VL H +VGGFLTHSGWNSTLESI AG+PMICWP   
Sbjct  308  -IPVELEKGTKERGYIVDWVSQEEVLAHKSVGGFLTHSGWNSTLESIVAGLPMICWPNLG  366

Query  427  DQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKEAISE  248
            D    SR V   WK+GL + + CDRS++E +++ LM  ++ E     + + KLA++ ++E
Sbjct  367  DHYIISRTVCRQWKIGLQLNENCDRSNIESMVQTLMGPKREEIQSSMDAISKLARDNVAE  426

Query  247  GGSSYCNFDCLIQ  209
            GGSS+ N + LI+
Sbjct  427  GGSSHNNLEQLIE  439



>emb|CDO99846.1| unnamed protein product [Coffea canephora]
Length=424

 Score =   218 bits (555),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 108/205 (53%), Positives = 134/205 (65%), Gaps = 38/205 (19%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED +CMA LD +   SVIYVSFGS++V+TR QL EFW+GLVNSGK FLW           
Sbjct  257  EDRSCMAWLDRKPRNSVIYVSFGSMTVLTRNQLFEFWHGLVNSGKPFLW-----------  305

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
                                        VL H AVGGFLTHSGWNSTLESI  GVPMICW
Sbjct  306  ---------------------------EVLAHPAVGGFLTHSGWNSTLESIYEGVPMICW  338

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            PF+ADQQ NSR VGEVWKVGLDMKD C+R++VE++I++LM+ ++ EF+  A+   KLA+ 
Sbjct  339  PFYADQQVNSRLVGEVWKVGLDMKDTCERATVEKMIKDLMDVKRDEFMLCAKEKAKLARR  398

Query  259  AISEGGSSYCNFDCLIQDMIKVNEA  185
            ++ + GSS+CN D LI D+  +N A
Sbjct  399  SVEQAGSSHCNLDRLIDDINMMNRA  423



>ref|XP_003520949.1| PREDICTED: UDP-glycosyltransferase 85A7-like [Glycine max]
Length=477

 Score =   218 bits (555),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/199 (52%), Positives = 139/199 (70%), Gaps = 7/199 (4%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED +C+  LD Q+ +SV+YVSFG++  ++ +QLMEFW+GLVNS K FLWV++ +L+  K+
Sbjct  279  EDRSCITWLDHQKAKSVLYVSFGTVVNLSYEQLMEFWHGLVNSLKPFLWVIQKELIIQKN  338

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
                 +P EL+ GTK  G++V WAPQE VL + AVGGFLTH GWNSTLESIA GVPM+CW
Sbjct  339  -----VPIELEIGTKERGFLVNWAPQEEVLANPAVGGFLTHCGWNSTLESIAEGVPMLCW  393

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P   DQ  NSR V E WK+GL+M   CDR  VE ++R++ME    + +  A ++ K A  
Sbjct  394  PSITDQTVNSRCVSEQWKIGLNMNGSCDRFVVENMVRDIMENE--DLMRSANDVAKKALH  451

Query  259  AISEGGSSYCNFDCLIQDM  203
             I E GSSY N + LI+D+
Sbjct  452  GIKENGSSYHNLENLIKDI  470



>gb|AFJ53009.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=485

 Score =   218 bits (555),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 108/202 (53%), Positives = 145/202 (72%), Gaps = 4/202 (2%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED +CM  LD Q P+SV+YV+FGSI+V+  ++L+E W+GL+NS +KFLWV+R   +   +
Sbjct  279  EDRSCMKWLDLQPPKSVLYVNFGSITVMKPEELVEIWHGLINSKQKFLWVIRQGTITSIE  338

Query  619  DEESPIPSEL-KEGTKANGYIV--GWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPM  449
            +  S  P EL K G+K + ++V  GW  Q+ VLDH ++GGFLTHSGWNSTLE+I AGVPM
Sbjct  339  NT-SEFPEELVKGGSKGDEFMVLSGWVAQKEVLDHESIGGFLTHSGWNSTLETIVAGVPM  397

Query  448  ICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKL  269
            IC P+FADQQ NSRF  EVWK+GLDMKD C+R  VE ++ ELM +RK EF   A  M +L
Sbjct  398  ICLPYFADQQVNSRFTSEVWKLGLDMKDSCERGVVERMVNELMVERKEEFGRCAAKMAEL  457

Query  268  AKEAISEGGSSYCNFDCLIQDM  203
            A  ++S  G S  N + LI+++
Sbjct  458  AGMSVSSDGCSSRNLEDLIEEI  479



>ref|XP_008242286.1| PREDICTED: UDP-glycosyltransferase 85A7-like [Prunus mume]
Length=474

 Score =   217 bits (552),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 103/198 (52%), Positives = 136/198 (69%), Gaps = 4/198 (2%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D  CM  LD Q  RSVIYVSFG++  +TR Q++EFWYGLVNS   F+WV+RSD++     
Sbjct  274  DPNCMTWLDFQPSRSVIYVSFGTLVNLTRAQIIEFWYGLVNSRHPFMWVIRSDIIYRAHQ  333

Query  616  EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWP  437
                IP+EL+ GTK  GYIV W  QE VL H AVGGFLTHSGWNSTLESI AG+PMICWP
Sbjct  334  ----IPAELEIGTKERGYIVDWVSQEEVLAHKAVGGFLTHSGWNSTLESIVAGLPMICWP  389

Query  436  FFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKEA  257
               D    SR V + WK+GL +K+ CDR ++E +I+ LM  ++ E     + + KLA+++
Sbjct  390  NLGDHYIISRTVSQKWKIGLQLKENCDRCNIETMIQTLMGPKREEIQSSMDTISKLARDS  449

Query  256  ISEGGSSYCNFDCLIQDM  203
            + +GGSS+ N + LI+ +
Sbjct  450  VVKGGSSHNNLEQLIEHI  467



>ref|XP_007206751.1| hypothetical protein PRUPE_ppa025141mg [Prunus persica]
 gb|EMJ07950.1| hypothetical protein PRUPE_ppa025141mg [Prunus persica]
Length=482

 Score =   217 bits (552),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 102/196 (52%), Positives = 137/196 (70%), Gaps = 4/196 (2%)
 Frame = -2

Query  796  DETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKDD  617
            D  CM  LDSQ  +S+IYVSFG++  +TR Q++EFWYGLVNSG  FLWVMRSD+ +G   
Sbjct  274  DLNCMTWLDSQPSKSIIYVSFGTLVHLTRAQVIEFWYGLVNSGHPFLWVMRSDITSG---  330

Query  616  EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICWP  437
             +  IP+EL+ GTK  G IV W  QE VL H +VGGFLTHSGWNSTLESI AG+PMICWP
Sbjct  331  -DHQIPAELENGTKERGCIVDWVSQEEVLAHKSVGGFLTHSGWNSTLESIVAGLPMICWP  389

Query  436  FFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKEA  257
               D    S  V   WK+GL + + CDRS++E +++ LM  ++ E     + + KL++++
Sbjct  390  KLGDHYIISSTVCRQWKIGLQLNENCDRSNIESMVQTLMGSKREEIQSSMDAISKLSRDS  449

Query  256  ISEGGSSYCNFDCLIQ  209
            ++EGGSS+ N + LI+
Sbjct  450  VAEGGSSHNNLEQLIE  465



>ref|XP_003526577.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Glycine max]
 gb|KHN08945.1| UDP-glycosyltransferase 85A3 [Glycine soja]
Length=486

 Score =   213 bits (541),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 108/202 (53%), Positives = 141/202 (70%), Gaps = 6/202 (3%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED  C+  LD+ EP+SVIYV+FGSI+V+T  QL+EF +GL NSGK FLWV+R DLV    
Sbjct  281  EDRECLKWLDTNEPKSVIYVNFGSITVMTNHQLIEFAWGLANSGKTFLWVIRPDLV----  336

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
            DE + +P E    TK  G + GW PQE VL H A+GGFLTHSGWNST+ES+  GVPMICW
Sbjct  337  DENTILPYEFVLETKDRGQLSGWCPQEEVLAHPAIGGFLTHSGWNSTIESLCNGVPMICW  396

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKG-EFLERAENMGKLAK  263
            PFFA+Q TN RF  + W VG+ ++    R  VE L+RELME +KG E   +A    KLA+
Sbjct  397  PFFAEQPTNCRFCCKEWGVGMQIEGDVTRDRVERLVRELMEGQKGKELTMKALEWKKLAE  456

Query  262  EA-ISEGGSSYCNFDCLIQDMI  200
            +A I + GSS+ N+D +++ ++
Sbjct  457  DATILKEGSSFLNYDNMVRQVL  478



>gb|EPS60746.1| hypothetical protein M569_14056, partial [Genlisea aurea]
Length=455

 Score =   211 bits (538),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 109/173 (63%), Positives = 131/173 (76%), Gaps = 3/173 (2%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED T +  L+SQ P+SVIYVSFGS++ +T ++ +EFWYGLVNSG  FLWVMR D +AG D
Sbjct  283  EDRTSIDWLNSQPPKSVIYVSFGSLTQLTEEEHLEFWYGLVNSGHMFLWVMRPDSIAGSD  342

Query  619  DEE--SPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMI  446
            +    + IP EL+EGTK  GY+V W PQ  VL H +VG F TH GWNSTLESI AGVPMI
Sbjct  343  NRHRNAAIPKELEEGTKQRGYLVEWVPQMEVLAHPSVGAFFTHGGWNSTLESICAGVPMI  402

Query  445  CWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELM-EKRKGEFLER  290
            CWP+FADQQTNSRFV   WKVG DMKD CDR  VEE++RE+M ++R+ E  ER
Sbjct  403  CWPYFADQQTNSRFVSHEWKVGFDMKDSCDRVVVEEMVREVMGDRRRDELSER  455



>emb|CDP16023.1| unnamed protein product [Coffea canephora]
Length=279

 Score =   206 bits (523),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 123/164 (75%), Gaps = 1/164 (1%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAG-K  623
            ED +C+  LDSQ  ++V+Y+SFGS+  IT+ + +EFW+G+VNSG++FLWV+R   + G K
Sbjct  68   EDASCLCWLDSQPLKTVVYISFGSLKNITKDEFLEFWHGIVNSGQRFLWVIRPGSINGQK  127

Query  622  DDEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMIC  443
             ++      EL E TK  G I+ W PQE V+ H A+GGFLTHSGWNSTLESI AGVPMIC
Sbjct  128  LEQHDDFLKELNEDTKERGLILSWVPQEEVIGHPAIGGFLTHSGWNSTLESIIAGVPMIC  187

Query  442  WPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKR  311
            WP + DQQ  SRFV E W +GLDMKD C+RS +E+++R+++E+R
Sbjct  188  WPSYVDQQVTSRFVSETWTLGLDMKDTCNRSIIEKMVRDIIERR  231



>ref|XP_007141198.1| hypothetical protein PHAVU_008G175300g [Phaseolus vulgaris]
 gb|ESW13192.1| hypothetical protein PHAVU_008G175300g [Phaseolus vulgaris]
Length=484

 Score =   211 bits (538),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 107/202 (53%), Positives = 143/202 (71%), Gaps = 6/202 (3%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED  CM  L+++EP SV+YV+FGSI+V+T  QL+EF +GL NS K FLWV+R DLVAG  
Sbjct  278  EDSECMEWLNTKEPNSVVYVNFGSITVVTSAQLVEFAWGLGNSNKTFLWVIRPDLVAG--  335

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
             E   +P E  E TK  G +  W  QE VL+H A+GGFLTHSGWNSTLES+ AGVPMICW
Sbjct  336  -ENVVLPPEFVEQTKNRGLLSSWCSQEQVLNHPAIGGFLTHSGWNSTLESVCAGVPMICW  394

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFL-ERAENMGKLAK  263
            PFFA+QQTN RF  + W +G++++DV  R  +E L++ELM+  KG+ + E+A    KLAK
Sbjct  395  PFFAEQQTNCRFCCKEWGIGMEIEDV-KRDKIESLVKELMDGEKGKQMKEKALQWKKLAK  453

Query  262  EAIS-EGGSSYCNFDCLIQDMI  200
             A S   G+S+ N D ++ +++
Sbjct  454  SAASGPYGTSFLNLDNMVHEVL  475



>ref|XP_008219317.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=482

 Score =   211 bits (537),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 103/201 (51%), Positives = 139/201 (69%), Gaps = 4/201 (2%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            E+  C+  LDS+EP SV+YV+FGSI+V+T +QL+EF +GL NS + F WV+R DLV G  
Sbjct  280  EEPECLEWLDSKEPNSVVYVNFGSITVMTAEQLIEFAWGLANSNQTFFWVIRPDLVGG--  337

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
             + + +P E  E TK    +  W PQE VL H AVGGFLTHSGWNST+ES+ AGVPMICW
Sbjct  338  -DSAVVPPEFVEETKERSLLAHWCPQEQVLSHPAVGGFLTHSGWNSTIESVCAGVPMICW  396

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKG-EFLERAENMGKLAK  263
            PFFA+QQTN R+  + W +G+++K    R+ VE L+R+LME  +G +  ++A    KLAK
Sbjct  397  PFFAEQQTNCRYTEKEWGIGMEIKSDVKRNYVEGLVRKLMEGEEGKDMRKKALEWKKLAK  456

Query  262  EAISEGGSSYCNFDCLIQDMI  200
            EA S  GSS+   D +I  ++
Sbjct  457  EATSPNGSSFVPLDKMINQVL  477



>gb|KHN13067.1| UDP-glycosyltransferase 85A3 [Glycine soja]
Length=478

 Score =   211 bits (536),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 111/209 (53%), Positives = 142/209 (68%), Gaps = 5/209 (2%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            E+  C+  L+S+EP SV+YV+FGSI V+T  QL E  +GL NS K FLWV+R DLVAG+ 
Sbjct  273  EEPKCLEWLNSKEPNSVVYVNFGSIMVMTSDQLTELAWGLANSNKNFLWVIRPDLVAGEI  332

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
            +    +P+E  + TK  G +  W PQE VL H AVGGFLTH GWNSTLES+  GVPM+CW
Sbjct  333  N--CALPNEFVKETKDRGMLASWCPQEEVLAHPAVGGFLTHCGWNSTLESVCEGVPMLCW  390

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKG-EFLERAENMGKLAK  263
            PFFA+QQTN RF  + W +GL+++DV  R  VE L+RELME  KG E  ERA    KLA 
Sbjct  391  PFFAEQQTNCRFCCKEWGIGLEIEDV-KREKVEALVRELMEGEKGKEMKERALEWKKLAH  449

Query  262  EAISEG-GSSYCNFDCLIQDMIKVNEATR  179
            EA S   GSS+ N D +++ ++    AT+
Sbjct  450  EAASSPHGSSFVNMDNVVRQVLMNKIATK  478



>ref|XP_003546715.1| PREDICTED: UDP-glycosyltransferase 85A3 [Glycine max]
Length=478

 Score =   211 bits (536),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 111/209 (53%), Positives = 142/209 (68%), Gaps = 5/209 (2%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            E+  C+  L+S+EP SV+YV+FGSI V+T  QL E  +GL NS K FLWV+R DLVAG+ 
Sbjct  273  EEPKCLEWLNSKEPNSVVYVNFGSIMVMTSDQLTELAWGLANSNKNFLWVIRPDLVAGEI  332

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
            +    +P+E  + TK  G +  W PQE VL H AVGGFLTH GWNSTLES+  GVPM+CW
Sbjct  333  N--CALPNEFVKETKDRGMLASWCPQEEVLAHPAVGGFLTHCGWNSTLESVCEGVPMLCW  390

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKG-EFLERAENMGKLAK  263
            PFFA+QQTN RF  + W +GL+++DV  R  VE L+RELME  KG E  ERA    KLA 
Sbjct  391  PFFAEQQTNCRFCCKEWGIGLEIEDV-KREKVEALVRELMEGEKGKEMKERALEWKKLAH  449

Query  262  EAISEG-GSSYCNFDCLIQDMIKVNEATR  179
            EA S   GSS+ N D +++ ++    AT+
Sbjct  450  EAASSPHGSSFVNMDNVVRQVLMNKIATK  478



>emb|CAN77812.1| hypothetical protein VITISV_010344 [Vitis vinifera]
Length=642

 Score =   214 bits (545),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 101/184 (55%), Positives = 130/184 (71%), Gaps = 20/184 (11%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED +C+A LD Q  +S IYVSFGSI+VIT++Q+MEFW+                    + 
Sbjct  273  EDRSCLAWLDRQPSKSXIYVSFGSITVITKEQMMEFWH--------------------EK  312

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
            D E  + ++L+E TK  G IV WAPQE VL H AVGGFLTH GWNSTLESI AGVPMICW
Sbjct  313  DGEFQLQAQLREVTKERGQIVDWAPQEEVLAHPAVGGFLTHGGWNSTLESIVAGVPMICW  372

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P+F+DQQ NSRFV  VWK G+DMKD CDR +VE+++R++ME+R+ EF +  + M KLA+ 
Sbjct  373  PYFSDQQLNSRFVSHVWKXGMDMKDTCDRITVEKMVRDVMEERRAEFTKSVDAMAKLARS  432

Query  259  AISE  248
            ++SE
Sbjct  433  SLSE  436



>ref|XP_010666049.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Beta 
vulgaris subsp. vulgaris]
Length=516

 Score =   211 bits (538),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 102/205 (50%), Positives = 137/205 (67%), Gaps = 6/205 (3%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED  CMA LD Q  RSVI+ SFGS  VIT++QL EF +GLV+S   FLW+ R   V G +
Sbjct  305  EDRNCMAWLDKQPLRSVIFCSFGSQVVITKEQLTEFLHGLVDSKTLFLWMNRPGSVIGLE  364

Query  619  D------EESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAG  458
            +      ++  +  +L +G K NG IV W PQ  VL H A+GGFLTH GWNS +ES+ AG
Sbjct  365  ENYEMLEKQVLMHGDLLKGIKKNGCIVSWVPQVEVLSHPAIGGFLTHGGWNSVIESVVAG  424

Query  457  VPMICWPFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENM  278
            VPM+CWP + DQ  NSR   EVWK+G+D+KD C+R+ VE+++R++M  R+ E LE A  M
Sbjct  425  VPMVCWPHYVDQLVNSRLATEVWKLGVDIKDSCNRAIVEKVVRDIMCLRRDELLENATKM  484

Query  277  GKLAKEAISEGGSSYCNFDCLIQDM  203
              LA  ++ +GG+SY +   LI+DM
Sbjct  485  ANLASTSVQKGGTSYESMKNLIKDM  509



>gb|AAR06913.1| UDP-glycosyltransferase 85A8 [Stevia rebaudiana]
Length=479

 Score =   211 bits (536),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 102/201 (51%), Positives = 143/201 (71%), Gaps = 4/201 (2%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED +C+  LD+++P SV+YV+FGSI+V+T++QL+EF +GL NS K FLW+ R D+V G  
Sbjct  279  EDVSCINWLDTKKPNSVVYVNFGSITVMTKEQLIEFGWGLANSKKDFLWITRPDIVGGN-  337

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
              E+ IP+E  E TK  G +  W  QE VL H ++G FLTHSGWNST+ESI+ GVPMICW
Sbjct  338  --EAMIPAEFIEETKERGMVTSWCSQEEVLKHPSIGVFLTHSGWNSTIESISNGVPMICW  395

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLE-RAENMGKLAK  263
            PFFA+QQTN R+    W++GL++     R  VE  +RE+M+  KG+ ++ +A    K A+
Sbjct  396  PFFAEQQTNCRYCCVEWEIGLEIDTDVKREEVEAQVREMMDGSKGKMMKNKALEWKKKAE  455

Query  262  EAISEGGSSYCNFDCLIQDMI  200
            EA+S GGSSY NF+ L+ D++
Sbjct  456  EAVSIGGSSYLNFEKLVTDVL  476



>gb|KCW44219.1| hypothetical protein EUGRSUZ_L023571, partial [Eucalyptus grandis]
Length=214

 Score =   202 bits (515),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 104/201 (52%), Positives = 135/201 (67%), Gaps = 4/201 (2%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            E+  C+  LDS+EP SV+YV+FGSI+V+T  QL EF +GL NS K FLW++R DLVA   
Sbjct  13   EEPGCLPWLDSKEPGSVVYVNFGSITVMTTGQLTEFAWGLANSQKPFLWIIRPDLVA---  69

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
             E + +P E  E     G +V W  QE VL H A+GGFLTHSGWNSTLES+  GVP+ICW
Sbjct  70   SESAVLPPEFVEEIAGRGMLVSWCQQEEVLKHRAIGGFLTHSGWNSTLESLCGGVPVICW  129

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKG-EFLERAENMGKLAK  263
            PFFA+QQTN R+    W +G+++ +   R  VE L+RELME  KG E  ++A      A+
Sbjct  130  PFFAEQQTNCRYSCTEWGIGMEIDNDVKRDEVEGLVRELMEGEKGKEMRKKAMEWKAKAE  189

Query  262  EAISEGGSSYCNFDCLIQDMI  200
            EAI  GG+SY N D LI +++
Sbjct  190  EAIMLGGTSYNNVDKLISEVL  210



>dbj|BAJ98857.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=465

 Score =   210 bits (534),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 101/196 (52%), Positives = 130/196 (66%), Gaps = 4/196 (2%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED+ CMA LD Q  RSV+YVS GS++VI+ +Q  EF  GLVNSG  FLWV+R D++    
Sbjct  265  EDDGCMAWLDGQADRSVVYVSLGSLAVISLEQFTEFLSGLVNSGYTFLWVLRPDMIGAS-  323

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
             + + +   +    K    +VGWAPQ  VL H AVG FLTH+GWNSTLE IA GVP++CW
Sbjct  324  -QSAVLQEAVGAAGKGKARVVGWAPQRDVLRHRAVGCFLTHAGWNSTLEGIAEGVPLVCW  382

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            PFF DQQ NSRFVG VW  GLDMKDVCDR+ VE ++R+ ME    +    A+ + +  + 
Sbjct  383  PFFLDQQINSRFVGAVWGAGLDMKDVCDRAVVEGMVRQAMESE--QLRMSAQTLSQEVRR  440

Query  259  AISEGGSSYCNFDCLI  212
             ++EGGSS   F  L+
Sbjct  441  DVAEGGSSATEFQRLL  456



>ref|XP_011008547.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Populus 
euphratica]
Length=478

 Score =   210 bits (535),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 103/204 (50%), Positives = 139/204 (68%), Gaps = 4/204 (2%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED  C+  L+++EP+SV+YV+FGSI+V+T  QL+EF  GLVNS   FLW++R DLV G  
Sbjct  277  EDHECLQWLETKEPKSVVYVNFGSITVMTADQLVEFAMGLVNSNIPFLWIIRPDLVIG--  334

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
             E + +P+E  E T+  G+I  W PQE VL+H AVGGFLTHSGW ST+ES+ AGVPM+CW
Sbjct  335  -ESAVLPAEFAEETERRGFITSWCPQEEVLNHPAVGGFLTHSGWGSTIESLCAGVPMVCW  393

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLE-RAENMGKLAK  263
            PFFADQ  N R+    W VG+++ +   R  VE L++ELME  KGE +  +A    +LA+
Sbjct  394  PFFADQAMNCRYSCNEWGVGMEIDNNVKREEVEMLVKELMEGEKGEKMRGKAMEWKRLAE  453

Query  262  EAISEGGSSYCNFDCLIQDMIKVN  191
            EA+   G+S  N D  I ++I  N
Sbjct  454  EAVGPEGTSSINLDKFIHEIISSN  477



>gb|AAB99950.1| UDP-glucuronosyltransferase [Pisum sativum]
Length=347

 Score =   206 bits (525),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 105/202 (52%), Positives = 139/202 (69%), Gaps = 6/202 (3%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            E+  C+  L+S+EP SV+YV+ GSI+V+T +Q++EF +GL NS   FLWV+R DLVAG  
Sbjct  149  EEPECLEWLNSKEPNSVVYVNLGSITVMTNEQMIEFAWGLANSKIPFLWVIRPDLVAG--  206

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
             E S +P E  E TK  G +  W PQE VLDH A+GGFLTHSGWNSTLES+  GVPMICW
Sbjct  207  -ENSVLPQEFLEETKNRGMLSSWCPQEEVLDHSAIGGFLTHSGWNSTLESVCGGVPMICW  265

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKG-EFLERAENMGKLAK  263
            PFFA+QQTN RF    W +GL+++D   R  +E L++E++E  KG E  E+A    KLA 
Sbjct  266  PFFAEQQTNCRFCCHEWGIGLEIEDA-KRDKIESLVKEMVEGEKGKEMKEKALEWKKLAP  324

Query  262  EAIS-EGGSSYCNFDCLIQDMI  200
             A S   GSS+ N + + +D++
Sbjct  325  NAASGPNGSSFMNLEKMFRDVL  346



>ref|XP_002308831.2| hypothetical protein POPTR_0006s02390g [Populus trichocarpa]
 gb|EEE92354.2| hypothetical protein POPTR_0006s02390g [Populus trichocarpa]
Length=480

 Score =   210 bits (534),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/201 (49%), Positives = 141/201 (70%), Gaps = 4/201 (2%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            E+  C+  LDS +P+SVIYV+FGSI+ +T++QL+EF  GL  SG  FLW++R D+V G  
Sbjct  281  EEVECLQWLDSNKPKSVIYVNFGSITTVTKEQLVEFGMGLAKSGHPFLWIIRPDMVTG--  338

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
             + + +P E  E TK   +I  W PQE VL+H ++GGFLTHSGW ST+ESI++GVPM+CW
Sbjct  339  -DSAILPPEFTEETKERSFICSWCPQEEVLNHPSIGGFLTHSGWGSTIESISSGVPMLCW  397

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFL-ERAENMGKLAK  263
            PFFADQQTN R+    W +G+++ +   R  VE+L+RELME  KG+ + ++A    KLA+
Sbjct  398  PFFADQQTNCRYTCSEWGIGMEIDNNVKRDKVEKLVRELMEGEKGKSMKKKAMEWKKLAE  457

Query  262  EAISEGGSSYCNFDCLIQDMI  200
            EA    GSS  N D L+++++
Sbjct  458  EASGPSGSSSMNLDKLVKEVL  478



>ref|XP_007222804.1| hypothetical protein PRUPE_ppa005043mg [Prunus persica]
 gb|EMJ24003.1| hypothetical protein PRUPE_ppa005043mg [Prunus persica]
Length=480

 Score =   209 bits (533),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/201 (51%), Positives = 139/201 (69%), Gaps = 4/201 (2%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            E+  C+  LDS+EP SV+YV+FGSI+V+T +QL+EF +GL NS + F WV+R DLV G  
Sbjct  280  EEPECLEWLDSKEPNSVVYVNFGSITVMTAEQLIEFAWGLANSNQTFFWVIRPDLVGG--  337

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
             + + +P E  E TK    +  W PQE VL H AVGGFLTHSGWNST+ES+ AGVPMICW
Sbjct  338  -DSAVVPPEFVEETKERSLLANWCPQEQVLSHPAVGGFLTHSGWNSTIESVCAGVPMICW  396

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKG-EFLERAENMGKLAK  263
            PFFA+QQTN R+  + W +G++++    R+ VE L+R+LME  +G E  ++A    KLA 
Sbjct  397  PFFAEQQTNCRYSEKEWAIGMEIESDVKRNYVEGLVRKLMEGDEGKEMRKKALEWKKLAT  456

Query  262  EAISEGGSSYCNFDCLIQDMI  200
            EAIS  GSS+   D ++  ++
Sbjct  457  EAISPNGSSFVGLDKMVNQVL  477



>gb|AFK34769.1| unknown [Lotus japonicus]
Length=484

 Score =   209 bits (532),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 105/202 (52%), Positives = 139/202 (69%), Gaps = 6/202 (3%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED  C+  LD++EP SV+YV+FGSI+V+T +Q++EF +GL NS K FLWV+R DLVAGK 
Sbjct  282  EDSECLKWLDTKEPNSVVYVNFGSIAVMTSEQMVEFAWGLANSNKTFLWVIRPDLVAGK-  340

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
               + +P E    T   G +  W PQE VL H A+GGFLTHSGWNSTLESI  GVPMICW
Sbjct  341  --HAVLPEEFVAATNDRGRLSSWTPQEDVLTHPAIGGFLTHSGWNSTLESICGGVPMICW  398

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFL-ERAENMGKLAK  263
            PFFA+QQTN R+  E W +GL+++D   R  VE L+RELM+  KG+ + E A    KLA 
Sbjct  399  PFFAEQQTNCRYCCEEWGIGLEIEDA-KRDRVESLVRELMDGEKGKLMKENALKWKKLAH  457

Query  262  E-AISEGGSSYCNFDCLIQDMI  200
            + A+   GSS+ N + + + ++
Sbjct  458  DSAVGPKGSSFVNLENMFRGVL  479



>ref|XP_011014733.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Populus 
euphratica]
Length=478

 Score =   209 bits (532),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 102/204 (50%), Positives = 139/204 (68%), Gaps = 4/204 (2%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED  C+  L+++EP+SV+YV+FGSI+V+T  QL+EF  GLVNS   FLW++R DLV G  
Sbjct  277  EDHECLQWLETKEPKSVVYVNFGSITVMTADQLVEFAMGLVNSNIPFLWIIRPDLVIG--  334

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
             E + +P+E  E T+  G+I  W PQE VL+H AVGGFLTHSGW ST+ES+ AGVPM+CW
Sbjct  335  -ESAVLPAEFAEETEKRGFITSWCPQEEVLNHPAVGGFLTHSGWGSTIESLCAGVPMLCW  393

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLE-RAENMGKLAK  263
            PFFADQ  N R+    W VG+++ +   R  VE L++ELME  KGE +  +A    +LA+
Sbjct  394  PFFADQAMNCRYSCNEWGVGMEIDNNVKREEVEMLVKELMEGEKGEKMRGKAMEWKRLAE  453

Query  262  EAISEGGSSYCNFDCLIQDMIKVN  191
            EA+   G+S  N D  + ++I  N
Sbjct  454  EAVGPEGTSSINLDKFLHEIISSN  477



>ref|XP_004154178.1| PREDICTED: UDP-glycosyltransferase 85A1-like [Cucumis sativus]
Length=260

 Score =   203 bits (516),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 105/208 (50%), Positives = 138/208 (66%), Gaps = 4/208 (2%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            E   CM  LDSQ+P SV+YV+FGSI+V++ + L+EF +GL NS K FLW++R DLV G  
Sbjct  51   EQSECMKWLDSQQPNSVVYVNFGSITVMSPEHLVEFAWGLANSEKPFLWIVRPDLVEG--  108

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
             E + +P+E    TK  G +  W  QE VL H +VGGFLTHSGWNST+ESIA GV MI W
Sbjct  109  -ETALLPAEFLAETKERGMLGDWCNQEEVLKHPSVGGFLTHSGWNSTMESIAGGVAMISW  167

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLER-AENMGKLAK  263
            PFFA+QQTN R+    W  GL++     R  VE+L+RELME  KGE ++R AE   + A+
Sbjct  168  PFFAEQQTNCRYCKTEWGNGLEIDSNVRREDVEKLVRELMEGEKGEDMKRNAEEWKRKAE  227

Query  262  EAISEGGSSYCNFDCLIQDMIKVNEATR  179
            EA   GGSS  N D +I +++   E ++
Sbjct  228  EACKNGGSSLTNLDRVISEILSSKEKSK  255



>ref|XP_002513937.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
 gb|EEF48520.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
Length=492

 Score =   209 bits (532),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 104/197 (53%), Positives = 135/197 (69%), Gaps = 4/197 (2%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            E   C+  LDS+EP SVIYV+FGS++V+T QQL+EF +GL NS K FLWV+R DLV G  
Sbjct  294  EQPGCLEWLDSKEPNSVIYVNFGSVTVMTPQQLVEFAWGLANSKKTFLWVIRPDLVTG--  351

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
             E + IP E  + TK  G +  W PQE VL H ++GGFLTHSGWNST+ES+A GVPMICW
Sbjct  352  -ESAIIPPEFLKETKERGLLANWCPQEEVLMHPSIGGFLTHSGWNSTIESLAGGVPMICW  410

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKG-EFLERAENMGKLAK  263
            PFFA+QQTNS F    W +G+++ +  +R+ +E L++ELM  + G E   +A      A+
Sbjct  411  PFFAEQQTNSWFCCNKWCIGMEIDNDANRTEIERLVKELMNSKPGSEVKNKAMEWKMKAE  470

Query  262  EAISEGGSSYCNFDCLI  212
            EA S  GSSY N D +I
Sbjct  471  EATSRTGSSYMNLDKMI  487



>ref|XP_008219319.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=490

 Score =   209 bits (532),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 102/201 (51%), Positives = 139/201 (69%), Gaps = 4/201 (2%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            E+  C+  LDS+EP SV+YV+FGSI+V+T +QL+EF +GL NS + F WV+R DLV G  
Sbjct  280  EEPECLEWLDSKEPNSVVYVNFGSITVMTAEQLIEFAWGLANSNQTFFWVIRPDLVGG--  337

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
             + + +P E  E TK    +  W PQE VL H AVGGFLTHSGWNSTLES+ AGVPMICW
Sbjct  338  -DSAVVPPEFVEETKERSLLANWCPQEQVLSHSAVGGFLTHSGWNSTLESVCAGVPMICW  396

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKG-EFLERAENMGKLAK  263
            PFFA+QQTNSR+  + W +G++++    R+ +E L+R+LME  +G E  ++A    KLA 
Sbjct  397  PFFAEQQTNSRYSEKEWGIGMEIERDVKRNYIEGLVRKLMEGDEGKEMRKKALEWKKLAT  456

Query  262  EAISEGGSSYCNFDCLIQDMI  200
            EA S  GSS+   D ++  ++
Sbjct  457  EATSPNGSSFVGLDKMVNQVL  477



>ref|XP_007141200.1| hypothetical protein PHAVU_008G175500g [Phaseolus vulgaris]
 gb|ESW13194.1| hypothetical protein PHAVU_008G175500g [Phaseolus vulgaris]
Length=484

 Score =   209 bits (532),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 105/202 (52%), Positives = 145/202 (72%), Gaps = 6/202 (3%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            E+  CM  L+++EP SV+YV+FGSI+V+T +QL+EF +GL NS K FLWV+R DLVAG  
Sbjct  278  EESECMEWLNTKEPNSVVYVNFGSITVMTSEQLVEFAWGLGNSNKSFLWVIRPDLVAG--  335

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
             E + +P E  + TK  G +  W  QE VL+H A+GGFLTHSGWNSTLES+ AGVPMICW
Sbjct  336  -ENAILPPEFVKQTKNRGLLSSWCSQEQVLNHPAIGGFLTHSGWNSTLESVCAGVPMICW  394

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFL-ERAENMGKLAK  263
            PFFA+QQTN RF  + W +G++++DV  R  +E L++ELM+  KG+ + E+A    KLAK
Sbjct  395  PFFAEQQTNCRFCCKEWGIGMEIEDV-KRDKIESLVKELMDGEKGKQMKEKALQWKKLAK  453

Query  262  EAIS-EGGSSYCNFDCLIQDMI  200
             A S   G+S+ N D ++ +++
Sbjct  454  TAASGPYGTSFLNLDNMVHEVL  475



>ref|XP_010066663.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like isoform 
X2 [Eucalyptus grandis]
 gb|KCW64631.1| hypothetical protein EUGRSUZ_G02215 [Eucalyptus grandis]
 gb|KCW64633.1| hypothetical protein EUGRSUZ_G02216 [Eucalyptus grandis]
Length=401

 Score =   207 bits (526),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 100/201 (50%), Positives = 137/201 (68%), Gaps = 4/201 (2%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED  C+  LDS+EP+SV+YV+FGSI+V+TR++L+EF  GL NS   FLW++R DLV+G  
Sbjct  203  EDTECLRWLDSKEPKSVLYVNFGSIAVLTREELIEFAMGLANSEHPFLWIIRPDLVSG--  260

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
             + + +P E  E T+       W PQEAVL+HL+ GGFLTH GWNS +ES+++GVPMICW
Sbjct  261  -DSAVLPREFLEETEGRSMYADWCPQEAVLNHLSTGGFLTHCGWNSVIESVSSGVPMICW  319

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFL-ERAENMGKLAK  263
            P F DQ TN  +    W++GL++  V  R  VE+L+R+LME  KG+ + ER     KLA+
Sbjct  320  PSFGDQSTNCAYACSKWEIGLELSGVVKREEVEKLVRDLMEGDKGKQMKERITEWKKLAQ  379

Query  262  EAISEGGSSYCNFDCLIQDMI  200
            EA    GSS  NFD L+ + +
Sbjct  380  EATEPNGSSSINFDKLLNEFL  400



>gb|KHN34757.1| UDP-glycosyltransferase 85A2 [Glycine soja]
Length=459

 Score =   208 bits (530),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 106/202 (52%), Positives = 143/202 (71%), Gaps = 6/202 (3%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            E+  C+  LD++EP SV+YV+FGSI+V+T +QL+EF +GL NS K FLWV+R DLVAG  
Sbjct  253  EESECVEWLDTKEPNSVVYVNFGSIAVMTSEQLIEFAWGLANSNKTFLWVIRPDLVAG--  310

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
             E + +PSE  + T+  G +  W  QE VL H A+GGFLTHSGWNSTLES+  GVPMICW
Sbjct  311  -ENALLPSEFVKQTEKRGLLSSWCSQEQVLTHPAIGGFLTHSGWNSTLESVCGGVPMICW  369

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKG-EFLERAENMGKLAK  263
            PFFA+QQTN  F  + W +GL+++DV +R  +E L+RELM+  KG E  E+A    +LAK
Sbjct  370  PFFAEQQTNCWFCCKEWGIGLEIEDV-ERDKIESLVRELMDGEKGKEMKEKALQWKELAK  428

Query  262  E-AISEGGSSYCNFDCLIQDMI  200
              A    GSS+ N D +++D++
Sbjct  429  SAAFGPVGSSFANLDNMVRDVL  450



>ref|XP_007042920.1| UDP-glucosyl transferase 85A2 [Theobroma cacao]
 gb|EOX98751.1| UDP-glucosyl transferase 85A2 [Theobroma cacao]
Length=519

 Score =   209 bits (533),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 104/208 (50%), Positives = 142/208 (68%), Gaps = 4/208 (2%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            E+  C+  L+S+EP+SV+YV+FGSI+V+T QQL+EF +GL NS   FLW++R DLV G  
Sbjct  278  EEPECLQWLNSKEPKSVVYVNFGSITVMTAQQLVEFAWGLANSKHTFLWIIRPDLVRG--  335

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
             + S +P E  E T+  G +  W PQE VL+H A+ GFLTHSGWNST+ESI  GVPMI W
Sbjct  336  -DSSILPPEFLEETEERGLMASWCPQEQVLNHPAIAGFLTHSGWNSTVESIGYGVPMISW  394

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLE-RAENMGKLAK  263
            PFFA+QQTN RF    W VG+++ +   R  VE L+RELME  KG+ +  +A    K A+
Sbjct  395  PFFAEQQTNCRFACTEWGVGMEIDNNVKREEVERLVRELMEGEKGKGMRNKAMEWKKKAE  454

Query  262  EAISEGGSSYCNFDCLIQDMIKVNEATR  179
            +A S  GSS+ N + LI+D++  ++  R
Sbjct  455  QAASPNGSSFLNLEKLIKDVLLKHQTVR  482



>gb|KHN15666.1| UDP-glycosyltransferase 85A7 [Glycine soja]
Length=459

 Score =   208 bits (529),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 97/199 (49%), Positives = 135/199 (68%), Gaps = 0/199 (0%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED++C+  LD Q+ RSV+YVSFG+++ ++ +QL+E W+GLV S K FLWV+R  L+ G+ 
Sbjct  254  EDKSCITWLDQQKARSVLYVSFGTLAKVSHEQLVEIWHGLVGSLKPFLWVIRQGLIIGEG  313

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
                 +P EL+  TK  G +V WAPQE VL H +VGGF THSGWNSTLE I  GVPM+CW
Sbjct  314  GLGHNVPMELELKTKERGLMVNWAPQEEVLAHPSVGGFFTHSGWNSTLECITEGVPMLCW  373

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            P  ADQ  NSR V E W +GLDM  +CDR  VE++++ LME +          + + A +
Sbjct  374  PLIADQTVNSRCVSEQWGIGLDMNGICDRLIVEKMVKNLMENQIERLTSSTNEIAEKAHD  433

Query  259  AISEGGSSYCNFDCLIQDM  203
            +++E GSS+ N + LI+D+
Sbjct  434  SVNENGSSFHNIENLIKDI  452



>ref|XP_003560194.1| PREDICTED: 7-deoxyloganetic acid glucosyltransferase-like [Brachypodium 
distachyon]
Length=479

 Score =   208 bits (530),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 101/203 (50%), Positives = 132/203 (65%), Gaps = 4/203 (2%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            EDE CM  LD Q  +SV+YVS GS++VI+ +Q  EF +GLVN+G  FLW +R D V    
Sbjct  273  EDEGCMEWLDGQADKSVVYVSLGSLAVISLEQFTEFLHGLVNAGYAFLWALRPDTVGAS-  331

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
             + + +   ++        +V WAPQ  VL H AVG FLTH+GWNSTLE I  GVP++CW
Sbjct  332  -QSTVLQEAVEAAANGKARVVDWAPQRDVLRHRAVGCFLTHAGWNSTLEGIVEGVPLVCW  390

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKLAKE  260
            PFF DQQTNSRFVG VW  GLDMKDVC+R+ VE ++RE ME   GE    A+ + K  + 
Sbjct  391  PFFGDQQTNSRFVGAVWGTGLDMKDVCERAVVEGMVREAME--SGELRRSAQALAKEVRR  448

Query  259  AISEGGSSYCNFDCLIQDMIKVN  191
             ++EGGSS   F  L+  + ++N
Sbjct  449  DVAEGGSSASEFRRLVGFIKELN  471



>ref|XP_010094135.1| UDP-glycosyltransferase 85A2 [Morus notabilis]
 gb|EXB55268.1| UDP-glycosyltransferase 85A2 [Morus notabilis]
Length=360

 Score =   205 bits (522),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 100/201 (50%), Positives = 140/201 (70%), Gaps = 4/201 (2%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            E+  C+  L+S++  SV+YV+FGSI+V+TRQQL+EF +GL NS K F+W++R DLVA   
Sbjct  154  EESQCLQWLNSKQLNSVVYVNFGSITVMTRQQLIEFAWGLSNSKKPFVWIIRPDLVA---  210

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
            D+   +P E  E T+  G + GW PQE +L H +VGGFLTH GWNST+ES+  GVP++CW
Sbjct  211  DDSGILPPEFVEETRERGVLAGWCPQETMLRHPSVGGFLTHCGWNSTIESLTTGVPIVCW  270

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLER-AENMGKLAK  263
            PFFA+QQTN RF    W VG+++     R  VE+L+RELM+  KG+ + R A    + A+
Sbjct  271  PFFAEQQTNCRFSCGEWSVGMEIDSDVKREKVEKLVRELMDGEKGKEMRRNALEWKRKAE  330

Query  262  EAISEGGSSYCNFDCLIQDMI  200
            EA   GGSS  NF+ LI++++
Sbjct  331  EATEAGGSSLTNFEKLIEEVL  351



>ref|XP_002322559.2| hypothetical protein POPTR_0016s02220g [Populus trichocarpa]
 gb|EEF04320.2| hypothetical protein POPTR_0016s02220g [Populus trichocarpa]
Length=478

 Score =   208 bits (530),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 102/204 (50%), Positives = 139/204 (68%), Gaps = 4/204 (2%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED  C+  L+++EP+SV+YV+FGSI+V+T  QL+EF  GLVNS   FLW++R DLV G  
Sbjct  277  EDHECLQWLETKEPKSVVYVNFGSITVMTADQLVEFAMGLVNSNIPFLWIIRPDLVVG--  334

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
             E + +P+E +E T+  G+I  W PQE VL+H AVGGFLTHSGW ST+ES+ AGVP+ CW
Sbjct  335  -ESAVLPAEFEEETEKRGFITSWCPQEEVLNHPAVGGFLTHSGWGSTIESLCAGVPLACW  393

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLE-RAENMGKLAK  263
            PFFADQ  N R+    W VG+++ +   R  VE L++ELME  KGE +  +A    +LA+
Sbjct  394  PFFADQAMNCRYSCNEWGVGMEIDNNVKREEVEMLVKELMEGEKGEKMRGKAMEWKRLAE  453

Query  262  EAISEGGSSYCNFDCLIQDMIKVN  191
            EA+   G+S  N D  I ++I  N
Sbjct  454  EAVGPEGTSSINLDKFIHEIISSN  477



>ref|XP_011045673.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Populus 
euphratica]
Length=474

 Score =   208 bits (529),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 101/198 (51%), Positives = 135/198 (68%), Gaps = 4/198 (2%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            E+  C+  LDS+EP SV+YV+FGSI+VIT QQ+MEF +GL NS   FLW++R DLV G  
Sbjct  272  EEPECLEWLDSKEPNSVVYVNFGSITVITPQQMMEFAWGLANSNTPFLWIIRPDLVEG--  329

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
             E S +PSE    TK  G +  W PQE VL H ++GGFL+H+GWNST++SI AGVP+ICW
Sbjct  330  -ESSMLPSEFVSETKKRGMLANWCPQELVLKHPSIGGFLSHTGWNSTMDSICAGVPLICW  388

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLER-AENMGKLAK  263
            PFFADQQTN  F    W +G+ + +   R  VE+L+RELM+  KG+ ++R A      A+
Sbjct  389  PFFADQQTNCMFACTKWGIGMQIDNNVKRDEVEKLVRELMKGEKGKDMKRKAMEWKTKAE  448

Query  262  EAISEGGSSYCNFDCLIQ  209
            E    GGSS+ N + L++
Sbjct  449  EVTRPGGSSFENLEALVK  466



>ref|XP_008219313.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=482

 Score =   208 bits (530),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 101/201 (50%), Positives = 139/201 (69%), Gaps = 4/201 (2%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            E+  C+  LDS+EP SV+YV+FGSI+V+T +QL+EF +GL +S + F WV+R DLV G  
Sbjct  280  EEPECLEWLDSKEPNSVVYVNFGSITVMTAEQLIEFAWGLASSNQTFFWVIRPDLVGG--  337

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
             + + +P E  E TK    +  W PQE VL H AVGGFLTHSGWNST+ES+ AGVPMICW
Sbjct  338  -DSAVVPPEFVEETKERSLLAHWCPQEQVLSHPAVGGFLTHSGWNSTIESVCAGVPMICW  396

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKG-EFLERAENMGKLAK  263
            PFFA+QQTN R+  + W +G+++K    R+ +E L+R+LME  +G +  ++A    KLAK
Sbjct  397  PFFAEQQTNCRYTEKEWGIGMEIKSDVKRNYIEGLVRKLMEGEEGKDMRKKALEWKKLAK  456

Query  262  EAISEGGSSYCNFDCLIQDMI  200
            EA S  GSS+   D +I  ++
Sbjct  457  EATSPNGSSFVPLDKMINQVL  477



>ref|XP_008219315.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=482

 Score =   208 bits (530),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 101/201 (50%), Positives = 139/201 (69%), Gaps = 4/201 (2%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            E+  C+  LDS+EP SV+YV+FGSI+V+T +QL+EF +GL +S + F WV+R DLV G  
Sbjct  280  EEPECLEWLDSKEPNSVVYVNFGSITVMTAEQLIEFAWGLASSNQTFFWVIRPDLVGG--  337

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
             + + +P E  E TK    +  W PQE VL H AVGGFLTHSGWNST+ES+ AGVPMICW
Sbjct  338  -DSAVVPPEFVEETKERSLLAHWCPQEQVLSHPAVGGFLTHSGWNSTIESVCAGVPMICW  396

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKG-EFLERAENMGKLAK  263
            PFFA+QQTN R+  + W +G+++K    R+ +E L+R+LME  +G +  ++A    KLAK
Sbjct  397  PFFAEQQTNCRYTEKEWGIGMEIKSDVKRNYIEGLVRKLMEGEEGKDMRKKALEWKKLAK  456

Query  262  EAISEGGSSYCNFDCLIQDMI  200
            EA S  GSS+   D +I  ++
Sbjct  457  EATSPNGSSFVPLDKMINQVL  477



>ref|XP_003542333.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Glycine max]
Length=485

 Score =   208 bits (530),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 106/202 (52%), Positives = 143/202 (71%), Gaps = 6/202 (3%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            E+  C+  LD++EP SV+YV+FGSI+V+T +QL+EF +GL NS K FLWV+R DLVAG  
Sbjct  279  EESECVEWLDTKEPNSVVYVNFGSIAVMTSEQLIEFAWGLANSNKTFLWVIRPDLVAG--  336

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
             E + +PSE  + T+  G +  W  QE VL H A+GGFLTHSGWNSTLES+  GVPMICW
Sbjct  337  -ENALLPSEFVKQTEKRGLLSSWCSQEQVLTHPAIGGFLTHSGWNSTLESVCGGVPMICW  395

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKG-EFLERAENMGKLAK  263
            PFFA+QQTN  F  + W +GL+++DV +R  +E L+RELM+  KG E  E+A    +LAK
Sbjct  396  PFFAEQQTNCWFCCKEWGIGLEIEDV-ERDKIESLVRELMDGEKGKEMKEKALQWKELAK  454

Query  262  E-AISEGGSSYCNFDCLIQDMI  200
              A    GSS+ N D +++D++
Sbjct  455  SAAFGPVGSSFANLDNMVRDVL  476



>ref|XP_010063153.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
 gb|KCW70348.1| hypothetical protein EUGRSUZ_F03591 [Eucalyptus grandis]
Length=498

 Score =   208 bits (530),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 101/201 (50%), Positives = 138/201 (69%), Gaps = 4/201 (2%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED  C+  LDS+EP+SVIYVSFGS++ +TRQQL+EF  GL NS K FLWV+R D V G  
Sbjct  299  EDNECLQWLDSKEPKSVIYVSFGSVAFMTRQQLIEFAMGLANSNKSFLWVLRPDAVEG--  356

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
             +   +P E  E T+  G+  GW PQE VL H ++GGFLTH GWNST+ES++AGVPM+CW
Sbjct  357  -DTMTLPREFVEETRERGFFSGWCPQEKVLCHPSIGGFLTHCGWNSTIESLSAGVPMLCW  415

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLE-RAENMGKLAK  263
            P F DQ TN +++ + W VGL++    +R  VE L+RELME   G+ +  +A    K+A+
Sbjct  416  PHFGDQLTNCKYICDDWGVGLEIDSNVNRDEVERLVRELMEAEVGKKMRNKAMEWKKVAE  475

Query  262  EAISEGGSSYCNFDCLIQDMI  200
            EA+ E GSS  N + L+ +++
Sbjct  476  EAVGEKGSSSMNMEKLLDEVL  496



>ref|XP_002263158.1| PREDICTED: 7-deoxyloganetin glucosyltransferase [Vitis vinifera]
Length=475

 Score =   207 bits (528),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 101/201 (50%), Positives = 141/201 (70%), Gaps = 4/201 (2%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            E+  C+  L+S++P SV+YV+FGSI+V+T +QL+EF +GL NS K FLW++R DLV G  
Sbjct  275  EETECLQWLNSKQPNSVVYVNFGSITVMTPEQLVEFAWGLANSHKPFLWIIRPDLVVG--  332

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
             +   +P E    T   G + GW PQE VL+H +VGGFLTHSGWNST+ESI AGVPMICW
Sbjct  333  -DSVILPPEFVNETIQRGLMAGWCPQEKVLNHPSVGGFLTHSGWNSTIESICAGVPMICW  391

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFLERAENMGKL-AK  263
            PFFA+QQTN R+    W VG+++ +  +R  VE+L++ELME  KG+ +++A    +  A+
Sbjct  392  PFFAEQQTNCRYACTEWGVGMEIDNNVERDEVEKLVKELMEGEKGKSMKKAAMEWRTKAE  451

Query  262  EAISEGGSSYCNFDCLIQDMI  200
            EA +  GSSY N D L+  ++
Sbjct  452  EATAPCGSSYLNLDKLVDILL  472



>ref|XP_010066661.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like isoform 
X2 [Eucalyptus grandis]
 ref|XP_010066662.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like isoform 
X1 [Eucalyptus grandis]
Length=447

 Score =   207 bits (526),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/201 (50%), Positives = 137/201 (68%), Gaps = 4/201 (2%)
 Frame = -2

Query  799  EDETCMAXLDSQEPRSVIYVSFGSISVITRQQLMEFWYGLVNSGKKFLWVMRSDLVAGKD  620
            ED  C+  LDS+EP+SV+YV+FGSI+V+TR++L+EF  GL NS   FLW++R DLV+G  
Sbjct  249  EDTECLRWLDSKEPKSVLYVNFGSIAVLTREELIEFAMGLANSEHPFLWIIRPDLVSG--  306

Query  619  DEESPIPSELKEGTKANGYIVGWAPQEAVLDHLAVGGFLTHSGWNSTLESIAAGVPMICW  440
             + + +P E  E T+       W PQEAVL+HL+ GGFLTH GWNS +ES+++GVPMICW
Sbjct  307  -DSAVLPREFLEETEGRSMYADWCPQEAVLNHLSTGGFLTHCGWNSVIESVSSGVPMICW  365

Query  439  PFFADQQTNSRFVGEVWKVGLDMKDVCDRSSVEELIRELMEKRKGEFL-ERAENMGKLAK  263
            P F DQ TN  +    W++GL++  V  R  VE+L+R+LME  KG+ + ER     KLA+
Sbjct  366  PSFGDQSTNCAYACSKWEIGLELSGVVKREEVEKLVRDLMEGDKGKQMKERITEWKKLAQ  425

Query  262  EAISEGGSSYCNFDCLIQDMI  200
            EA    GSS  NFD L+ + +
Sbjct  426  EATEPNGSSSINFDKLLNEFL  446



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1580279231195