BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF009D09

Length=751
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009598546.1|  PREDICTED: probable beta-1,3-galactosyltrans...    366   2e-122   Nicotiana tomentosiformis
ref|XP_009770915.1|  PREDICTED: probable beta-1,3-galactosyltrans...    365   1e-121   Nicotiana sylvestris
ref|XP_006366587.1|  PREDICTED: probable beta-1,3-galactosyltrans...    363   4e-121   Solanum tuberosum [potatoes]
ref|XP_006366586.1|  PREDICTED: probable beta-1,3-galactosyltrans...    363   5e-121   Solanum tuberosum [potatoes]
emb|CDP10795.1|  unnamed protein product                                361   2e-120   Coffea canephora [robusta coffee]
ref|XP_010323831.1|  PREDICTED: probable beta-1,3-galactosyltrans...    360   7e-120   Solanum lycopersicum
ref|XP_004243473.1|  PREDICTED: probable beta-1,3-galactosyltrans...    360   8e-120   Solanum lycopersicum
gb|EYU34029.1|  hypothetical protein MIMGU_mgv1a007633mg                359   1e-119   Erythranthe guttata [common monkey flower]
ref|XP_006375531.1|  hypothetical protein POPTR_0014s15200g             353   1e-118   
ref|XP_011100272.1|  PREDICTED: probable beta-1,3-galactosyltrans...    357   1e-118   Sesamum indicum [beniseed]
ref|XP_006592811.1|  PREDICTED: probable beta-1,3-galactosyltrans...    355   2e-118   
ref|XP_011047262.1|  PREDICTED: probable beta-1,3-galactosyltrans...    356   2e-118   Populus euphratica
gb|KHF99242.1|  putative beta-1,3-galactosyltransferase 2 -like p...    356   3e-118   Gossypium arboreum [tree cotton]
ref|XP_011047261.1|  PREDICTED: probable beta-1,3-galactosyltrans...    356   3e-118   Populus euphratica
gb|KDP22716.1|  hypothetical protein JCGZ_01818                         352   3e-118   Jatropha curcas
gb|KJB80507.1|  hypothetical protein B456_013G101400                    356   3e-118   Gossypium raimondii
gb|KJB80505.1|  hypothetical protein B456_013G101400                    355   4e-118   Gossypium raimondii
ref|XP_010484738.1|  PREDICTED: probable beta-1,3-galactosyltrans...    355   4e-118   Camelina sativa [gold-of-pleasure]
ref|XP_010475189.1|  PREDICTED: probable beta-1,3-galactosyltrans...    355   4e-118   Camelina sativa [gold-of-pleasure]
ref|XP_010484744.1|  PREDICTED: probable beta-1,3-galactosyltrans...    355   5e-118   Camelina sativa [gold-of-pleasure]
ref|XP_010475190.1|  PREDICTED: probable beta-1,3-galactosyltrans...    355   5e-118   Camelina sativa [gold-of-pleasure]
ref|XP_002320464.1|  galactosyltransferase family protein               355   6e-118   Populus trichocarpa [western balsam poplar]
ref|XP_011095407.1|  PREDICTED: probable beta-1,3-galactosyltrans...    355   7e-118   Sesamum indicum [beniseed]
ref|XP_006375532.1|  hypothetical protein POPTR_0014s15200g             355   8e-118   Populus trichocarpa [western balsam poplar]
ref|XP_006304048.1|  hypothetical protein CARUB_v10009858mg             351   8e-118   
ref|XP_003543389.1|  PREDICTED: probable beta-1,3-galactosyltrans...    355   8e-118   Glycine max [soybeans]
ref|XP_002892271.1|  galactosyltransferase family protein               355   1e-117   Arabidopsis lyrata subsp. lyrata
ref|NP_001077462.1|  putative beta-1,3-galactosyltransferase 2          355   1e-117   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003540300.1|  PREDICTED: probable beta-1,3-galactosyltrans...    354   1e-117   Glycine max [soybeans]
gb|KDO54673.1|  hypothetical protein CISIN_1g015407mg                   351   1e-117   Citrus sinensis [apfelsine]
ref|NP_172009.1|  putative beta-1,3-galactosyltransferase 2             354   1e-117   
ref|XP_006592810.1|  PREDICTED: probable beta-1,3-galactosyltrans...    353   1e-117   
ref|XP_006447567.1|  hypothetical protein CICLE_v10015443mg             350   3e-117   
gb|KDO54670.1|  hypothetical protein CISIN_1g015407mg                   353   5e-117   Citrus sinensis [apfelsine]
ref|XP_009775718.1|  PREDICTED: probable beta-1,3-galactosyltrans...    352   6e-117   Nicotiana sylvestris
gb|KDO54671.1|  hypothetical protein CISIN_1g015407mg                   352   6e-117   Citrus sinensis [apfelsine]
ref|XP_002524194.1|  Beta-1,3-galactosyltransferase sqv-2, putative     351   6e-117   
ref|XP_009775717.1|  PREDICTED: probable beta-1,3-galactosyltrans...    352   6e-117   Nicotiana sylvestris
gb|KDO54672.1|  hypothetical protein CISIN_1g015407mg                   352   8e-117   Citrus sinensis [apfelsine]
ref|XP_006418057.1|  hypothetical protein EUTSA_v10007787mg             352   9e-117   Eutrema salsugineum [saltwater cress]
ref|XP_010457598.1|  PREDICTED: probable beta-1,3-galactosyltrans...    352   1e-116   Camelina sativa [gold-of-pleasure]
ref|XP_010457599.1|  PREDICTED: probable beta-1,3-galactosyltrans...    352   1e-116   Camelina sativa [gold-of-pleasure]
ref|XP_006447568.1|  hypothetical protein CICLE_v10015443mg             352   1e-116   Citrus clementina [clementine]
ref|XP_002268282.1|  PREDICTED: probable beta-1,3-galactosyltrans...    352   1e-116   Vitis vinifera
ref|XP_010557003.1|  PREDICTED: probable beta-1,3-galactosyltrans...    352   1e-116   Tarenaya hassleriana [spider flower]
ref|XP_010657202.1|  PREDICTED: probable beta-1,3-galactosyltrans...    352   1e-116   Vitis vinifera
ref|XP_006469679.1|  PREDICTED: probable beta-1,3-galactosyltrans...    351   2e-116   Citrus sinensis [apfelsine]
ref|XP_010657203.1|  PREDICTED: probable beta-1,3-galactosyltrans...    351   2e-116   Vitis vinifera
ref|XP_003539862.1|  PREDICTED: probable beta-1,3-galactosyltrans...    351   2e-116   Glycine max [soybeans]
ref|XP_004159203.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...    351   2e-116   
gb|KHN21228.1|  Putative beta-1,3-galactosyltransferase 2               351   2e-116   Glycine soja [wild soybean]
ref|XP_006469680.1|  PREDICTED: probable beta-1,3-galactosyltrans...    351   2e-116   Citrus sinensis [apfelsine]
ref|XP_008455443.1|  PREDICTED: probable beta-1,3-galactosyltrans...    351   2e-116   Cucumis melo [Oriental melon]
ref|XP_004144497.1|  PREDICTED: probable beta-1,3-galactosyltrans...    351   2e-116   Cucumis sativus [cucumbers]
gb|KEH29682.1|  beta-1,3-galactosyltransferase-like protein             349   2e-116   Medicago truncatula
ref|XP_010557001.1|  PREDICTED: probable beta-1,3-galactosyltrans...    351   3e-116   Tarenaya hassleriana [spider flower]
ref|XP_006294322.1|  hypothetical protein CARUB_v10023330mg             350   3e-116   Capsella rubella
ref|XP_010522344.1|  PREDICTED: probable beta-1,3-galactosyltrans...    350   4e-116   Tarenaya hassleriana [spider flower]
ref|XP_010522341.1|  PREDICTED: probable beta-1,3-galactosyltrans...    350   5e-116   
gb|KFK42855.1|  hypothetical protein AALP_AA1G047700                    350   5e-116   Arabis alpina [alpine rockcress]
ref|XP_011048789.1|  PREDICTED: probable beta-1,3-galactosyltrans...    350   5e-116   Populus euphratica
ref|XP_004487414.1|  PREDICTED: probable beta-1,3-galactosyltrans...    350   5e-116   Cicer arietinum [garbanzo]
ref|XP_010104592.1|  putative beta-1,3-galactosyltransferase 2          350   6e-116   
ref|XP_011048788.1|  PREDICTED: probable beta-1,3-galactosyltrans...    350   6e-116   Populus euphratica
ref|XP_002302876.1|  hypothetical protein POPTR_0002s21280g             350   7e-116   Populus trichocarpa [western balsam poplar]
ref|XP_010276120.1|  PREDICTED: probable beta-1,3-galactosyltrans...    350   7e-116   Nelumbo nucifera [Indian lotus]
ref|XP_009624798.1|  PREDICTED: probable beta-1,3-galactosyltrans...    348   8e-116   Nicotiana tomentosiformis
ref|XP_006475058.1|  PREDICTED: probable beta-1,3-galactosyltrans...    348   8e-116   
gb|KGN63249.1|  hypothetical protein Csa_2G418850                       350   8e-116   Cucumis sativus [cucumbers]
emb|CDY12206.1|  BnaC04g12360D                                          350   8e-116   Brassica napus [oilseed rape]
ref|XP_004151891.1|  PREDICTED: probable beta-1,3-galactosyltrans...    350   8e-116   
ref|XP_009361001.1|  PREDICTED: probable beta-1,3-galactosyltrans...    348   9e-116   Pyrus x bretschneideri [bai li]
ref|XP_004172360.1|  PREDICTED: probable beta-1,3-galactosyltrans...    349   1e-115   
ref|XP_009774309.1|  PREDICTED: probable beta-1,3-galactosyltrans...    349   1e-115   Nicotiana sylvestris
ref|XP_008455884.1|  PREDICTED: probable beta-1,3-galactosyltrans...    349   1e-115   Cucumis melo [Oriental melon]
gb|KDP39142.1|  hypothetical protein JCGZ_00899                         349   1e-115   Jatropha curcas
ref|XP_009397181.1|  PREDICTED: probable beta-1,3-galactosyltrans...    349   1e-115   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009610750.1|  PREDICTED: probable beta-1,3-galactosyltrans...    349   1e-115   Nicotiana tomentosiformis
ref|XP_009143989.1|  PREDICTED: probable beta-1,3-galactosyltrans...    349   1e-115   Brassica rapa
ref|XP_009624796.1|  PREDICTED: probable beta-1,3-galactosyltrans...    349   1e-115   Nicotiana tomentosiformis
emb|CDY48266.1|  BnaA05g10880D                                          349   1e-115   Brassica napus [oilseed rape]
ref|XP_009143988.1|  PREDICTED: probable beta-1,3-galactosyltrans...    349   2e-115   Brassica rapa
ref|XP_009624797.1|  PREDICTED: probable beta-1,3-galactosyltrans...    348   2e-115   Nicotiana tomentosiformis
ref|XP_011463344.1|  PREDICTED: probable beta-1,3-galactosyltrans...    348   2e-115   Fragaria vesca subsp. vesca
ref|XP_007149975.1|  hypothetical protein PHAVU_005G115300g             348   2e-115   Phaseolus vulgaris [French bean]
ref|XP_004287949.1|  PREDICTED: probable beta-1,3-galactosyltrans...    348   2e-115   Fragaria vesca subsp. vesca
ref|XP_003527496.1|  PREDICTED: probable beta-1,3-galactosyltrans...    348   2e-115   Glycine max [soybeans]
ref|XP_006346208.1|  PREDICTED: probable beta-1,3-galactosyltrans...    348   3e-115   Solanum tuberosum [potatoes]
ref|XP_006855892.1|  hypothetical protein AMTR_s00037p00154410          348   3e-115   Amborella trichopoda
ref|XP_010469587.1|  PREDICTED: probable beta-1,3-galactosyltrans...    348   4e-115   Camelina sativa [gold-of-pleasure]
ref|XP_007132543.1|  hypothetical protein PHAVU_011G103400g             348   4e-115   Phaseolus vulgaris [French bean]
ref|XP_010469586.1|  PREDICTED: probable beta-1,3-galactosyltrans...    348   4e-115   Camelina sativa [gold-of-pleasure]
emb|CAN63417.1|  hypothetical protein VITISV_007689                     347   4e-115   Vitis vinifera
gb|KEH29683.1|  beta-1,3-galactosyltransferase-like protein             348   4e-115   Medicago truncatula
ref|XP_007215471.1|  hypothetical protein PRUPE_ppa006530mg             348   5e-115   Prunus persica
gb|EYU27344.1|  hypothetical protein MIMGU_mgv1a007546mg                348   5e-115   Erythranthe guttata [common monkey flower]
ref|XP_008229956.1|  PREDICTED: probable beta-1,3-galactosyltrans...    348   5e-115   Prunus mume [ume]
ref|XP_007215470.1|  hypothetical protein PRUPE_ppa006530mg             347   5e-115   Prunus persica
ref|XP_010278672.1|  PREDICTED: probable beta-1,3-galactosyltrans...    347   5e-115   Nelumbo nucifera [Indian lotus]
ref|XP_006410375.1|  hypothetical protein EUTSA_v10016736mg             347   6e-115   Eutrema salsugineum [saltwater cress]
ref|XP_009361000.1|  PREDICTED: probable beta-1,3-galactosyltrans...    347   7e-115   Pyrus x bretschneideri [bai li]
ref|XP_006475057.1|  PREDICTED: probable beta-1,3-galactosyltrans...    347   7e-115   Citrus sinensis [apfelsine]
ref|XP_004244109.1|  PREDICTED: probable beta-1,3-galactosyltrans...    347   8e-115   Solanum lycopersicum
ref|XP_006452382.1|  hypothetical protein CICLE_v10008439mg             347   8e-115   Citrus clementina [clementine]
ref|XP_009119197.1|  PREDICTED: probable beta-1,3-galactosyltrans...    347   1e-114   Brassica rapa
ref|XP_010413995.1|  PREDICTED: probable beta-1,3-galactosyltrans...    347   1e-114   Camelina sativa [gold-of-pleasure]
ref|XP_010413996.1|  PREDICTED: probable beta-1,3-galactosyltrans...    347   1e-114   Camelina sativa [gold-of-pleasure]
ref|XP_010510018.1|  PREDICTED: probable beta-1,3-galactosyltrans...    347   1e-114   Camelina sativa [gold-of-pleasure]
ref|XP_009398227.1|  PREDICTED: probable beta-1,3-galactosyltrans...    347   1e-114   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010046417.1|  PREDICTED: probable beta-1,3-galactosyltrans...    347   1e-114   Eucalyptus grandis [rose gum]
ref|XP_009119198.1|  PREDICTED: probable beta-1,3-galactosyltrans...    347   1e-114   Brassica rapa
emb|CDY46836.1|  BnaA10g03200D                                          346   2e-114   Brassica napus [oilseed rape]
ref|XP_010929797.1|  PREDICTED: probable beta-1,3-galactosyltrans...    346   2e-114   Elaeis guineensis
ref|XP_008342011.1|  PREDICTED: probable beta-1,3-galactosyltrans...    346   2e-114   Malus domestica [apple tree]
ref|XP_008342010.1|  PREDICTED: probable beta-1,3-galactosyltrans...    346   3e-114   Malus domestica [apple tree]
ref|XP_002279814.2|  PREDICTED: probable beta-1,3-galactosyltrans...    346   3e-114   Vitis vinifera
ref|XP_009353285.1|  PREDICTED: probable beta-1,3-galactosyltrans...    346   3e-114   Pyrus x bretschneideri [bai li]
ref|XP_009353286.1|  PREDICTED: probable beta-1,3-galactosyltrans...    345   3e-114   Pyrus x bretschneideri [bai li]
emb|CDY49507.1|  BnaC05g03190D                                          346   3e-114   Brassica napus [oilseed rape]
ref|XP_008804298.1|  PREDICTED: probable beta-1,3-galactosyltrans...    346   3e-114   Phoenix dactylifera
ref|XP_008385877.1|  PREDICTED: probable beta-1,3-galactosyltrans...    345   3e-114   
ref|XP_008226884.1|  PREDICTED: probable beta-1,3-galactosyltrans...    345   4e-114   Prunus mume [ume]
ref|XP_008226885.1|  PREDICTED: probable beta-1,3-galactosyltrans...    345   4e-114   Prunus mume [ume]
emb|CDP05735.1|  unnamed protein product                                345   4e-114   Coffea canephora [robusta coffee]
ref|XP_010675728.1|  PREDICTED: probable beta-1,3-galactosyltrans...    345   5e-114   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002529902.1|  Beta-1,3-galactosyltransferase sqv-2, putative     339   5e-114   
ref|XP_004982530.1|  PREDICTED: probable beta-1,3-galactosyltrans...    345   6e-114   Setaria italica
ref|XP_008359262.1|  PREDICTED: probable beta-1,3-galactosyltrans...    345   8e-114   
ref|XP_008359264.1|  PREDICTED: probable beta-1,3-galactosyltrans...    345   9e-114   
ref|XP_008379640.1|  PREDICTED: probable beta-1,3-galactosyltrans...    344   1e-113   Malus domestica [apple tree]
ref|XP_008379639.1|  PREDICTED: probable beta-1,3-galactosyltrans...    344   1e-113   Malus domestica [apple tree]
ref|XP_009408655.1|  PREDICTED: probable beta-1,3-galactosyltrans...    344   1e-113   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004515096.1|  PREDICTED: probable beta-1,3-galactosyltrans...    344   1e-113   Cicer arietinum [garbanzo]
ref|XP_010313672.1|  PREDICTED: probable beta-1,3-galactosyltrans...    343   2e-113   Solanum lycopersicum
ref|XP_007211967.1|  hypothetical protein PRUPE_ppa006589mg             343   2e-113   
ref|XP_004251520.1|  PREDICTED: probable beta-1,3-galactosyltrans...    343   2e-113   Solanum lycopersicum
ref|XP_004294404.1|  PREDICTED: probable beta-1,3-galactosyltrans...    343   2e-113   Fragaria vesca subsp. vesca
ref|XP_006351966.1|  PREDICTED: probable beta-1,3-galactosyltrans...    343   2e-113   Solanum tuberosum [potatoes]
ref|XP_011461040.1|  PREDICTED: probable beta-1,3-galactosyltrans...    343   3e-113   Fragaria vesca subsp. vesca
ref|XP_006351967.1|  PREDICTED: probable beta-1,3-galactosyltrans...    343   3e-113   Solanum tuberosum [potatoes]
ref|XP_010089999.1|  putative beta-1,3-galactosyltransferase 2          343   4e-113   Morus notabilis
ref|NP_180802.1|  putative beta-1,3-galactosyltransferase 3             343   5e-113   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002879388.1|  galactosyltransferase family protein               342   5e-113   Arabidopsis lyrata subsp. lyrata
ref|XP_009338706.1|  PREDICTED: probable beta-1,3-galactosyltrans...    342   6e-113   Pyrus x bretschneideri [bai li]
ref|XP_009338707.1|  PREDICTED: probable beta-1,3-galactosyltrans...    342   7e-113   Pyrus x bretschneideri [bai li]
gb|EPS73703.1|  hypothetical protein M569_01053                         335   7e-113   Genlisea aurea
ref|XP_010063020.1|  PREDICTED: probable beta-1,3-galactosyltrans...    342   9e-113   Eucalyptus grandis [rose gum]
gb|KJB80508.1|  hypothetical protein B456_013G101400                    342   9e-113   Gossypium raimondii
ref|XP_010063019.1|  PREDICTED: probable beta-1,3-galactosyltrans...    342   1e-112   Eucalyptus grandis [rose gum]
ref|XP_006365959.1|  PREDICTED: probable beta-1,3-galactosyltrans...    340   2e-112   Solanum tuberosum [potatoes]
ref|XP_008808431.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...    340   4e-112   
gb|KHN03478.1|  Putative beta-1,3-galactosyltransferase 2               337   8e-112   Glycine soja [wild soybean]
ref|XP_003596979.1|  hypothetical protein MTR_2g088270                  339   1e-111   Medicago truncatula
ref|XP_004149353.1|  PREDICTED: probable beta-1,3-galactosyltrans...    339   1e-111   Cucumis sativus [cucumbers]
ref|XP_003550487.1|  PREDICTED: probable beta-1,3-galactosyltrans...    338   1e-111   Glycine max [soybeans]
ref|NP_001141034.1|  hypothetical protein                               337   2e-111   Zea mays [maize]
ref|XP_008463407.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...    338   2e-111   
ref|XP_009782227.1|  PREDICTED: probable beta-1,3-galactosyltrans...    338   3e-111   Nicotiana sylvestris
ref|XP_006452383.1|  hypothetical protein CICLE_v10008439mg             334   4e-111   
gb|KHG10854.1|  putative beta-1,3-galactosyltransferase 2 -like p...    338   5e-111   Gossypium arboreum [tree cotton]
ref|XP_002464309.1|  hypothetical protein SORBIDRAFT_01g015960          337   5e-111   Sorghum bicolor [broomcorn]
ref|XP_007153952.1|  hypothetical protein PHAVU_003G079100g             336   7e-111   Phaseolus vulgaris [French bean]
ref|XP_010457596.1|  PREDICTED: probable beta-1,3-galactosyltrans...    338   7e-111   Camelina sativa [gold-of-pleasure]
ref|XP_010457597.1|  PREDICTED: probable beta-1,3-galactosyltrans...    338   8e-111   Camelina sativa [gold-of-pleasure]
ref|XP_007020793.1|  Galactosyltransferase family protein               337   1e-110   
ref|XP_008681412.1|  PREDICTED: hypothetical protein isoform X1         337   1e-110   Zea mays [maize]
ref|XP_009612460.1|  PREDICTED: probable beta-1,3-galactosyltrans...    335   2e-110   Nicotiana tomentosiformis
gb|KJB57752.1|  hypothetical protein B456_009G178900                    334   3e-110   Gossypium raimondii
ref|NP_001050543.1|  Os03g0577500                                       335   4e-110   
gb|KJB13704.1|  hypothetical protein B456_002G089700                    333   5e-110   Gossypium raimondii
gb|KJB57747.1|  hypothetical protein B456_009G178900                    335   5e-110   Gossypium raimondii
ref|XP_010923856.1|  PREDICTED: probable beta-1,3-galactosyltrans...    335   5e-110   Elaeis guineensis
gb|KHG03847.1|  putative beta-1,3-galactosyltransferase 2 -like p...    335   7e-110   Gossypium arboreum [tree cotton]
ref|XP_006452384.1|  hypothetical protein CICLE_v10008439mg             335   7e-110   
ref|XP_006650268.1|  PREDICTED: probable beta-1,3-galactosyltrans...    334   8e-110   Oryza brachyantha
gb|KJB13705.1|  hypothetical protein B456_002G089700                    333   1e-109   Gossypium raimondii
ref|XP_011097870.1|  PREDICTED: probable beta-1,3-galactosyltrans...    334   1e-109   Sesamum indicum [beniseed]
ref|XP_010655390.1|  PREDICTED: probable beta-1,3-galactosyltrans...    333   2e-109   Vitis vinifera
ref|XP_002518474.1|  Beta-1,3-galactosyltransferase sqv-2, putative     332   3e-109   Ricinus communis
gb|KJB13702.1|  hypothetical protein B456_002G089700                    332   4e-109   Gossypium raimondii
ref|XP_007026088.1|  Galactosyltransferase family protein isoform 1     333   5e-109   
ref|XP_003562342.1|  PREDICTED: probable beta-1,3-galactosyltrans...    332   9e-109   Brachypodium distachyon [annual false brome]
gb|KDO78242.1|  hypothetical protein CISIN_1g015962mg                   330   9e-109   Citrus sinensis [apfelsine]
gb|KJB69212.1|  hypothetical protein B456_011G013600                    330   9e-109   Gossypium raimondii
gb|KHG30061.1|  putative beta-1,3-galactosyltransferase 4 -like p...    332   1e-108   Gossypium arboreum [tree cotton]
gb|KDO78243.1|  hypothetical protein CISIN_1g015962mg                   328   1e-108   Citrus sinensis [apfelsine]
ref|XP_011097866.1|  PREDICTED: probable beta-1,3-galactosyltrans...    333   1e-108   
ref|XP_010536663.1|  PREDICTED: probable beta-1,3-galactosyltrans...    331   2e-108   Tarenaya hassleriana [spider flower]
ref|XP_010536662.1|  PREDICTED: probable beta-1,3-galactosyltrans...    331   3e-108   
ref|XP_006467430.1|  PREDICTED: probable beta-1,3-galactosyltrans...    330   3e-108   Citrus sinensis [apfelsine]
ref|XP_006467429.1|  PREDICTED: probable beta-1,3-galactosyltrans...    330   4e-108   Citrus sinensis [apfelsine]
ref|XP_002269415.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    330   5e-108   Vitis vinifera
ref|XP_010652984.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    329   5e-108   Vitis vinifera
gb|KCW70545.1|  hypothetical protein EUGRSUZ_F03738                     327   5e-108   Eucalyptus grandis [rose gum]
ref|XP_007039333.1|  Galactosyltransferase family protein isoform 2     329   6e-108   
gb|KJB69210.1|  hypothetical protein B456_011G013600                    330   7e-108   Gossypium raimondii
gb|KJB69211.1|  hypothetical protein B456_011G013600                    330   7e-108   Gossypium raimondii
gb|EYU23928.1|  hypothetical protein MIMGU_mgv1a007764mg                329   7e-108   Erythranthe guttata [common monkey flower]
gb|KDP20741.1|  hypothetical protein JCGZ_21212                         328   8e-108   Jatropha curcas
ref|XP_007039332.1|  Galactosyltransferase family protein isoform 1     328   1e-107   
ref|XP_010092200.1|  putative beta-1,3-galactosyltransferase 2          328   1e-107   Morus notabilis
gb|KCW70544.1|  hypothetical protein EUGRSUZ_F03738                     327   2e-107   Eucalyptus grandis [rose gum]
ref|XP_002518935.1|  Beta-1,3-galactosyltransferase sqv-2, putative     328   2e-107   Ricinus communis
ref|XP_007045661.1|  Galactosyltransferase family protein               329   2e-107   
ref|XP_007039335.1|  Beta-1,3-galactosyltransferase 6 isoform 4         329   2e-107   
ref|XP_001758882.1|  predicted protein                                  328   3e-107   
ref|XP_010916559.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    327   3e-107   Elaeis guineensis
gb|KDP25226.1|  hypothetical protein JCGZ_20382                         327   3e-107   Jatropha curcas
ref|XP_004507687.1|  PREDICTED: probable beta-1,3-galactosyltrans...    327   4e-107   Cicer arietinum [garbanzo]
gb|EYU22897.1|  hypothetical protein MIMGU_mgv1a007777mg                327   5e-107   Erythranthe guttata [common monkey flower]
ref|XP_001781844.1|  predicted protein                                  326   5e-107   
gb|EPS64555.1|  hypothetical protein M569_10226                         327   5e-107   Genlisea aurea
ref|XP_011074895.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    326   6e-107   Sesamum indicum [beniseed]
gb|KJB62839.1|  hypothetical protein B456_009G440200                    325   6e-107   Gossypium raimondii
gb|KDP32735.1|  hypothetical protein JCGZ_12027                         327   7e-107   Jatropha curcas
ref|XP_011040606.1|  PREDICTED: probable beta-1,3-galactosyltrans...    327   8e-107   Populus euphratica
gb|KJB62840.1|  hypothetical protein B456_009G440200                    325   8e-107   Gossypium raimondii
ref|XP_010063328.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    326   8e-107   Eucalyptus grandis [rose gum]
ref|XP_010063326.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    326   9e-107   Eucalyptus grandis [rose gum]
ref|XP_010063329.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    326   9e-107   Eucalyptus grandis [rose gum]
ref|XP_010245068.1|  PREDICTED: beta-1,3-galactosyltransferase 7        326   1e-106   Nelumbo nucifera [Indian lotus]
ref|XP_010063327.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    326   1e-106   Eucalyptus grandis [rose gum]
ref|XP_009601250.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    323   1e-106   Nicotiana tomentosiformis
ref|XP_006439187.1|  hypothetical protein CICLE_v10020627mg             323   1e-106   
gb|KDO76779.1|  hypothetical protein CISIN_1g021312mg                   323   2e-106   Citrus sinensis [apfelsine]
gb|EPS60081.1|  hypothetical protein M569_14722                         321   2e-106   Genlisea aurea
ref|XP_009786663.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    323   2e-106   Nicotiana sylvestris
ref|NP_001183433.1|  uncharacterized protein LOC100501859               318   2e-106   
ref|XP_003523469.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    325   2e-106   Glycine max [soybeans]
gb|KHN47065.1|  Beta-1,3-galactosyltransferase 7                        324   2e-106   Glycine soja [wild soybean]
ref|XP_006578989.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    325   3e-106   Glycine max [soybeans]
ref|XP_006364961.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    322   3e-106   Solanum tuberosum [potatoes]
ref|XP_006439188.1|  hypothetical protein CICLE_v10020627mg             318   3e-106   
ref|XP_003601132.1|  Avr9 elicitor response protein                     325   3e-106   Medicago truncatula
ref|XP_003601133.1|  Avr9 elicitor response protein                     325   4e-106   Medicago truncatula
ref|XP_010251481.1|  PREDICTED: probable beta-1,3-galactosyltrans...    325   4e-106   Nelumbo nucifera [Indian lotus]
ref|XP_009601249.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    324   4e-106   Nicotiana tomentosiformis
ref|XP_006449734.1|  hypothetical protein CICLE_v10015441mg             323   4e-106   
gb|KJB62836.1|  hypothetical protein B456_009G440200                    325   5e-106   Gossypium raimondii
ref|XP_009367323.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    324   5e-106   Pyrus x bretschneideri [bai li]
ref|XP_010943123.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    324   5e-106   Elaeis guineensis
ref|XP_004515660.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    324   5e-106   Cicer arietinum [garbanzo]
ref|XP_004515661.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    324   6e-106   Cicer arietinum [garbanzo]
ref|XP_009367325.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    324   6e-106   Pyrus x bretschneideri [bai li]
emb|CAA06925.1|  Avr9 elicitor response protein                         324   6e-106   Nicotiana tabacum [American tobacco]
dbj|BAJ89822.1|  predicted protein                                      324   6e-106   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009786662.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    324   6e-106   Nicotiana sylvestris
ref|XP_009367326.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    324   6e-106   Pyrus x bretschneideri [bai li]
ref|XP_009367324.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    324   8e-106   Pyrus x bretschneideri [bai li]
emb|CDP18301.1|  unnamed protein product                                323   9e-106   Coffea canephora [robusta coffee]
ref|NP_001149120.1|  beta-1,3-galactosyltransferase sqv-2               323   9e-106   
ref|XP_006439190.1|  hypothetical protein CICLE_v10020627mg             323   1e-105   
gb|KJB64380.1|  hypothetical protein B456_010G046600                    321   1e-105   Gossypium raimondii
ref|XP_002300511.1|  hypothetical protein POPTR_0001s45420g             322   1e-105   
ref|XP_009399227.1|  PREDICTED: probable beta-1,3-galactosyltrans...    323   1e-105   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006476263.1|  PREDICTED: probable beta-1,3-galactosyltrans...    323   2e-105   
ref|XP_006476264.1|  PREDICTED: probable beta-1,3-galactosyltrans...    323   2e-105   
ref|XP_002977391.1|  glycosyltransferase-like protein                   323   2e-105   Selaginella moellendorffii
ref|XP_001779676.1|  predicted protein                                  323   2e-105   
gb|KHG03200.1|  Beta-1,3-galactosyltransferase 7 -like protein          323   2e-105   Gossypium arboreum [tree cotton]
ref|XP_006449733.1|  hypothetical protein CICLE_v10015441mg             323   2e-105   
ref|XP_007136194.1|  hypothetical protein PHAVU_009G026100g             322   2e-105   Phaseolus vulgaris [French bean]
gb|EMS64796.1|  putative beta-1,3-galactosyltransferase 2               323   3e-105   Triticum urartu
ref|XP_006846610.1|  hypothetical protein AMTR_s00156p00023720          322   3e-105   Amborella trichopoda
dbj|BAJ89733.1|  predicted protein                                      322   3e-105   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006364960.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    322   3e-105   Solanum tuberosum [potatoes]
ref|XP_004250351.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    322   3e-105   Solanum lycopersicum
ref|XP_006370727.1|  hypothetical protein POPTR_0001s45420g             322   3e-105   
ref|XP_009419577.1|  PREDICTED: probable beta-1,3-galactosyltrans...    322   4e-105   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK45039.1|  hypothetical protein AALP_AA1G336200                    322   4e-105   Arabis alpina [alpine rockcress]
ref|XP_001754566.1|  predicted protein                                  322   4e-105   
ref|XP_006828867.1|  hypothetical protein AMTR_s00001p00171620          322   4e-105   Amborella trichopoda
ref|XP_002974972.1|  glycosyltransferase-like protein                   322   4e-105   Selaginella moellendorffii
ref|XP_008677265.1|  PREDICTED: beta-1,3-galactosyltransferase sq...    322   5e-105   
ref|XP_004162968.1|  PREDICTED: probable beta-1,3-galactosyltrans...    315   5e-105   
ref|NP_001045990.1|  Os02g0164300                                       314   6e-105   
ref|NP_567762.1|  putative beta-1,3-galactosyltransferase 4             322   6e-105   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002867534.1|  galactosyltransferase family protein               322   6e-105   Arabidopsis lyrata subsp. lyrata
ref|XP_008378522.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    322   6e-105   Malus domestica [apple tree]
ref|NP_174569.1|  putative beta-1,3-galactosyltransferase               322   7e-105   
emb|CAB36540.1|  Avr9 elicitor response like protein                    322   7e-105   
ref|XP_008378524.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    321   8e-105   
ref|XP_006596309.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    321   8e-105   
ref|XP_007212259.1|  hypothetical protein PRUPE_ppa006626mg             321   8e-105   
gb|KHN06134.1|  Beta-1,3-galactosyltransferase 7                        321   9e-105   
ref|XP_008378526.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    321   9e-105   
ref|XP_008378523.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    321   1e-104   
ref|XP_010534616.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    321   1e-104   
ref|XP_009114848.1|  PREDICTED: probable beta-1,3-galactosyltrans...    321   1e-104   
gb|KJB64379.1|  hypothetical protein B456_010G046600                    321   1e-104   
ref|XP_003526605.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    321   1e-104   
ref|XP_002893747.1|  galactosyltransferase family protein               321   1e-104   
gb|EMT25658.1|  Putative beta-1,3-galactosyltransferase 2               321   1e-104   
ref|XP_008802092.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    321   1e-104   
ref|XP_010095510.1|  Beta-1,3-galactosyltransferase 7                   321   1e-104   
ref|XP_010277678.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    320   1e-104   
emb|CDY54843.1|  BnaC05g51320D                                          322   1e-104   
ref|XP_002451594.1|  hypothetical protein SORBIDRAFT_04g004400          321   2e-104   
ref|XP_006581562.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    320   2e-104   
gb|KJB64381.1|  hypothetical protein B456_010G046600                    320   2e-104   
ref|XP_008437459.1|  PREDICTED: probable beta-1,3-galactosyltrans...    320   2e-104   
ref|XP_008233932.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    320   2e-104   
ref|XP_004295272.1|  PREDICTED: probable beta-1,3-galactosyltrans...    319   2e-104   
ref|XP_010104914.1|  putative beta-1,3-galactosyltransferase 6          321   2e-104   
ref|XP_008233934.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    320   2e-104   
ref|XP_011038007.1|  PREDICTED: probable beta-1,3-galactosyltrans...    320   2e-104   
ref|XP_008233935.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    320   2e-104   
ref|XP_007222961.1|  hypothetical protein PRUPE_ppa006755mg             320   2e-104   
ref|XP_008233933.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    320   3e-104   
ref|XP_006413124.1|  hypothetical protein EUTSA_v10025360mg             320   3e-104   
gb|KHN26051.1|  Beta-1,3-galactosyltransferase 7                        317   3e-104   
ref|XP_006304992.1|  hypothetical protein CARUB_v10009358mg             320   3e-104   
ref|XP_004145877.1|  PREDICTED: probable beta-1,3-galactosyltrans...    320   4e-104   
gb|KGN49967.1|  hypothetical protein Csa_5G146900                       320   4e-104   
ref|XP_009401434.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    320   4e-104   
ref|XP_002302264.1|  galactosyltransferase family protein               319   4e-104   
ref|XP_006647402.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    319   4e-104   
ref|XP_011470881.1|  PREDICTED: probable beta-1,3-galactosyltrans...    319   5e-104   
ref|XP_011027638.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    319   5e-104   
ref|XP_002988781.1|  glycosyltransferase-like protein                   319   6e-104   
ref|XP_011027637.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    319   6e-104   
ref|XP_008224857.1|  PREDICTED: probable beta-1,3-galactosyltrans...    319   7e-104   
ref|XP_011027636.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    319   7e-104   
ref|XP_002513842.1|  Beta-1,3-galactosyltransferase sqv-2, putative     319   7e-104   
ref|XP_011027635.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    318   7e-104   
ref|XP_009367010.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    318   8e-104   
ref|XP_010438680.1|  PREDICTED: probable beta-1,3-galactosyltrans...    319   1e-103   
ref|XP_010433424.1|  PREDICTED: probable beta-1,3-galactosyltrans...    319   1e-103   
ref|XP_011097468.1|  PREDICTED: beta-1,3-galactosyltransferase 7        318   1e-103   
ref|XP_010438679.1|  PREDICTED: probable beta-1,3-galactosyltrans...    319   1e-103   
ref|XP_008437460.1|  PREDICTED: probable beta-1,3-galactosyltrans...    318   1e-103   
ref|XP_008338811.1|  PREDICTED: beta-1,3-galactosyltransferase 7        318   1e-103   
gb|ACF79671.1|  unknown                                                 318   1e-103   
gb|KJB52408.1|  hypothetical protein B456_008G260300                    316   1e-103   
ref|NP_001131318.1|  uncharacterized protein LOC100192632               318   2e-103   
ref|XP_003542690.1|  PREDICTED: beta-1,3-galactosyltransferase 7        318   2e-103   
ref|XP_006646915.1|  PREDICTED: probable beta-1,3-galactosyltrans...    318   2e-103   
ref|XP_006836897.1|  hypothetical protein AMTR_s00099p00123290          318   2e-103   
ref|XP_008778068.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    312   2e-103   
emb|CDX93812.1|  BnaA09g24120D                                          317   2e-103   
ref|NP_001141176.1|  hypothetical protein                               314   2e-103   
ref|XP_009109161.1|  PREDICTED: probable beta-1,3-galactosyltrans...    318   2e-103   
dbj|BAD25162.1|  putative Avr9 elicitor response protein                318   2e-103   
dbj|BAD17751.1|  putative avr9 elicitor response protein                318   2e-103   
gb|EAY84604.1|  hypothetical protein OsI_05972                          317   2e-103   
ref|XP_004951866.1|  PREDICTED: probable beta-1,3-galactosyltrans...    318   2e-103   
emb|CDX97371.1|  BnaC08g12360D                                          318   3e-103   
ref|XP_002278708.1|  PREDICTED: probable beta-1,3-galactosyltrans...    318   3e-103   
ref|XP_009414059.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    317   3e-103   
ref|XP_010448195.1|  PREDICTED: probable beta-1,3-galactosyltrans...    318   3e-103   
gb|ADE77778.1|  unknown                                                 315   3e-103   
ref|XP_010686831.1|  PREDICTED: probable beta-1,3-galactosyltrans...    317   3e-103   
ref|XP_010448194.1|  PREDICTED: probable beta-1,3-galactosyltrans...    317   3e-103   
ref|XP_004952712.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    317   3e-103   
ref|XP_008444116.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    317   3e-103   
ref|XP_008352694.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    318   4e-103   
ref|XP_006415137.1|  hypothetical protein EUTSA_v10007803mg             317   4e-103   
ref|XP_008444117.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    317   4e-103   
ref|XP_006389613.1|  hypothetical protein POPTR_0021s00630g             317   4e-103   
gb|KHG17244.1|  putative beta-1,3-galactosyltransferase 6 -like p...    317   4e-103   
gb|KGN54610.1|  hypothetical protein Csa_4G377730                       317   4e-103   
ref|XP_004142613.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    317   4e-103   
ref|XP_008392652.1|  PREDICTED: probable beta-1,3-galactosyltrans...    317   5e-103   
ref|XP_011047977.1|  PREDICTED: probable beta-1,3-galactosyltrans...    316   5e-103   
ref|XP_008245629.1|  PREDICTED: probable beta-1,3-galactosyltrans...    317   5e-103   
ref|XP_002462477.1|  hypothetical protein SORBIDRAFT_02g026360          317   5e-103   
ref|XP_009589155.1|  PREDICTED: probable beta-1,3-galactosyltrans...    317   5e-103   
ref|XP_007209207.1|  hypothetical protein PRUPE_ppa006612mg             317   5e-103   
gb|KJB52405.1|  hypothetical protein B456_008G260300                    317   6e-103   
gb|ADE75915.1|  unknown                                                 311   6e-103   
ref|XP_011047978.1|  PREDICTED: probable beta-1,3-galactosyltrans...    316   6e-103   
ref|XP_003575190.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    317   6e-103   
emb|CDY46675.1|  BnaA03g48330D                                          317   6e-103   
ref|XP_009344054.1|  PREDICTED: probable beta-1,3-galactosyltrans...    317   8e-103   
ref|XP_002454032.1|  hypothetical protein SORBIDRAFT_04g023470          316   8e-103   
ref|XP_010053046.1|  PREDICTED: probable beta-1,3-galactosyltrans...    314   9e-103   
ref|NP_001141890.1|  hypothetical protein                               316   1e-102   
ref|XP_008777928.1|  PREDICTED: probable beta-1,3-galactosyltrans...    314   1e-102   
ref|XP_010542088.1|  PREDICTED: probable beta-1,3-galactosyltrans...    315   1e-102   
gb|KDO80826.1|  hypothetical protein CISIN_1g015683mg                   311   2e-102   
ref|XP_009782081.1|  PREDICTED: probable beta-1,3-galactosyltrans...    315   2e-102   
ref|XP_004300420.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    315   2e-102   
ref|XP_008681428.1|  PREDICTED: hypothetical protein isoform X1         315   2e-102   
ref|XP_011037627.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...    315   2e-102   
gb|ACG41551.1|  avr9 elicitor response protein                          315   2e-102   
ref|XP_002305569.1|  hypothetical protein POPTR_0004s01390g             314   2e-102   
gb|KFK42176.1|  hypothetical protein AALP_AA2G220800                    315   2e-102   
gb|KFK42175.1|  hypothetical protein AALP_AA2G220800                    315   2e-102   
ref|XP_010461115.1|  PREDICTED: probable beta-1,3-galactosyltrans...    316   3e-102   
ref|XP_009357459.1|  PREDICTED: probable beta-1,3-galactosyltrans...    315   3e-102   
ref|XP_011465327.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    315   3e-102   
ref|XP_010461116.1|  PREDICTED: probable beta-1,3-galactosyltrans...    315   3e-102   
ref|XP_006390051.1|  hypothetical protein EUTSA_v10018693mg             314   3e-102   
ref|XP_008782246.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    315   3e-102   
ref|XP_010053045.1|  PREDICTED: probable beta-1,3-galactosyltrans...    315   4e-102   
gb|KJB57750.1|  hypothetical protein B456_009G178900                    316   4e-102   
ref|XP_002285826.1|  PREDICTED: beta-1,3-galactosyltransferase 7        314   5e-102   
ref|XP_002979099.1|  glycosyltransferase-like protein                   313   7e-102   
ref|XP_007141114.1|  hypothetical protein PHAVU_008G168500g             313   8e-102   
ref|XP_006660681.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    310   1e-101   
ref|XP_009106424.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    313   1e-101   
ref|XP_010499840.1|  PREDICTED: probable beta-1,3-galactosyltrans...    313   1e-101   
ref|XP_007039334.1|  Beta-1,3-galactosyltransferase 6 isoform 3         313   1e-101   
ref|XP_008439989.1|  PREDICTED: probable beta-1,3-galactosyltrans...    313   1e-101   
ref|NP_001063339.1|  Os09g0452900                                       313   1e-101   
ref|XP_006472695.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    313   1e-101   
gb|EMS52307.1|  putative beta-1,3-galactosyltransferase 2               313   1e-101   
ref|XP_009106423.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    312   1e-101   
ref|XP_006472694.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    313   2e-101   
gb|AFK48973.1|  unknown                                                 312   2e-101   
gb|AGZ15279.1|  putative Avr9 elicitor response protein                 312   2e-101   
emb|CDX88390.1|  BnaC06g38340D                                          312   2e-101   
ref|XP_004956987.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    312   2e-101   
emb|CDX92791.1|  BnaC07g40490D                                          312   3e-101   
ref|XP_008374141.1|  PREDICTED: probable beta-1,3-galactosyltrans...    312   3e-101   
gb|KDO80824.1|  hypothetical protein CISIN_1g015683mg                   312   3e-101   
ref|XP_006434095.1|  hypothetical protein CICLE_v10001364mg             312   3e-101   
ref|XP_006301157.1|  hypothetical protein CARUB_v10021555mg             311   4e-101   
ref|XP_006441805.1|  hypothetical protein CICLE_v10024512mg             312   4e-101   
gb|KDO80825.1|  hypothetical protein CISIN_1g015683mg                   312   4e-101   
ref|XP_004245304.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    311   5e-101   
ref|XP_002513511.1|  transferase, transferring glycosyl groups, p...    313   5e-101   
ref|XP_006434096.1|  hypothetical protein CICLE_v10001364mg             311   6e-101   
ref|XP_002306601.2|  galactosyltransferase family protein               311   8e-101   
ref|XP_010428866.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    311   9e-101   
gb|EMT26667.1|  Beta-1,3-galactosyltransferase 7                        311   9e-101   
ref|XP_010471981.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    311   9e-101   
gb|AAG51626.1|AC012193_8  putative (Avr9) elicitor response prote...    310   9e-101   
ref|NP_974164.2|  beta-1,3-galactosyltransferase 7                      310   9e-101   
gb|KJB26942.1|  hypothetical protein B456_004G268200                    310   1e-100   
ref|XP_010471980.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    311   1e-100   
gb|KEH28821.1|  beta-1,3-galactosyltransferase-like protein             310   1e-100   
ref|XP_006840618.1|  hypothetical protein AMTR_s00084p00079370          311   1e-100   
ref|XP_010428865.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    310   1e-100   
gb|AHL38868.1|  glycosyltransferase                                     310   1e-100   
ref|XP_004134762.1|  PREDICTED: probable beta-1,3-galactosyltrans...    311   1e-100   
ref|XP_010677269.1|  PREDICTED: probable beta-1,3-galactosyltrans...    311   1e-100   
ref|XP_010677261.1|  PREDICTED: probable beta-1,3-galactosyltrans...    311   1e-100   
ref|XP_011081357.1|  PREDICTED: probable beta-1,3-galactosyltrans...    311   1e-100   
ref|XP_010233857.1|  PREDICTED: probable beta-1,3-galactosyltrans...    311   1e-100   
ref|XP_010252349.1|  PREDICTED: probable beta-1,3-galactosyltrans...    310   1e-100   
ref|XP_004970763.1|  PREDICTED: probable beta-1,3-galactosyltrans...    310   1e-100   
ref|XP_004155605.1|  PREDICTED: probable beta-1,3-galactosyltrans...    310   1e-100   
gb|KDP22107.1|  hypothetical protein JCGZ_25938                         312   2e-100   
gb|ACL53751.1|  unknown                                                 311   2e-100   
ref|XP_003576598.1|  PREDICTED: probable beta-1,3-galactosyltrans...    310   2e-100   
ref|XP_010478679.1|  PREDICTED: probable beta-1,3-galactosyltrans...    310   2e-100   
ref|NP_001149873.1|  LOC100283501                                       311   2e-100   
ref|XP_010416737.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    311   2e-100   
ref|XP_010672316.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    310   2e-100   
ref|XP_010416738.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    311   2e-100   
ref|XP_010672363.1|  PREDICTED: beta-1,3-galactosyltransferase 7 ...    310   2e-100   
ref|XP_004966215.1|  PREDICTED: probable beta-1,3-galactosyltrans...    310   3e-100   
ref|XP_011097092.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    310   3e-100   
ref|XP_009137625.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...    310   3e-100   
dbj|BAK03918.1|  predicted protein                                      309   4e-100   
dbj|BAJ94062.1|  predicted protein                                      309   4e-100   
ref|XP_006478362.1|  PREDICTED: probable beta-1,3-galactosyltrans...    310   5e-100   
ref|XP_002970340.1|  glycosyltransferase-like protein                   309   6e-100   
ref|XP_002889162.1|  galactosyltransferase family protein               308   6e-100   
ref|XP_006415086.1|  hypothetical protein EUTSA_v10007836mg             308   7e-100   
emb|CDY67379.1|  BnaCnng54730D                                          308   9e-100   
ref|XP_009151468.1|  PREDICTED: probable beta-1,3-galactosyltrans...    308   9e-100   
ref|XP_010911041.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    308   1e-99    
gb|EMS67042.1|  putative beta-1,3-galactosyltransferase 2               306   1e-99    
ref|XP_008364090.1|  PREDICTED: probable beta-1,3-galactosyltrans...    308   1e-99    
ref|XP_002968104.1|  glycosyltransferase-like protein                   308   1e-99    
ref|XP_009360212.1|  PREDICTED: probable beta-1,3-galactosyltrans...    308   1e-99    
emb|CBI16979.3|  unnamed protein product                                307   1e-99    
ref|XP_007019713.1|  Galactosyltransferase family protein isoform 1     308   2e-99    
ref|XP_010910268.1|  PREDICTED: probable beta-1,3-galactosyltrans...    308   2e-99    
ref|NP_174609.1|  putative beta-1,3-galactosyltransferase 8             307   2e-99    
gb|KJB59160.1|  hypothetical protein B456_009G242100                    306   2e-99    
ref|XP_004962000.1|  PREDICTED: probable beta-1,3-galactosyltrans...    307   2e-99    
ref|XP_009777689.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    307   3e-99    
ref|XP_010542535.1|  PREDICTED: probable beta-1,3-galactosyltrans...    307   3e-99    
gb|EAZ14356.1|  hypothetical protein OsJ_04276                          304   3e-99    
ref|NP_001185130.1|  putative beta-1,3-galactosyltransferase 8          307   3e-99    
ref|XP_006355190.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    307   3e-99    
ref|XP_010542528.1|  PREDICTED: probable beta-1,3-galactosyltrans...    307   3e-99    
ref|XP_003564759.2|  PREDICTED: probable beta-1,3-galactosyltrans...    307   3e-99    
ref|XP_009777688.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    307   4e-99    
ref|NP_001044974.1|  Os01g0877400                                       307   4e-99    
ref|XP_002265159.2|  PREDICTED: probable beta-1,3-galactosyltrans...    308   5e-99    
ref|XP_004167799.1|  PREDICTED: probable beta-1,3-galactosyltrans...    299   5e-99    
gb|EYU21104.1|  hypothetical protein MIMGU_mgv1a007738mg                306   5e-99    
gb|EYU22689.1|  hypothetical protein MIMGU_mgv1a007366mg                303   6e-99    
ref|XP_009607565.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    306   6e-99    
gb|ADN34055.1|  galactosyltransferase                                   305   8e-99    
ref|XP_008441012.1|  PREDICTED: probable beta-1,3-galactosyltrans...    305   8e-99    
ref|XP_002893769.1|  galactosyltransferase family protein               306   8e-99    
ref|XP_008441020.1|  PREDICTED: probable beta-1,3-galactosyltrans...    305   8e-99    
ref|XP_010461174.1|  PREDICTED: probable beta-1,3-galactosyltrans...    306   9e-99    
gb|EMT12895.1|  Putative beta-1,3-galactosyltransferase 2               305   9e-99    
ref|XP_009774684.1|  PREDICTED: beta-1,3-galactosyltransferase 7-...    301   9e-99    
ref|XP_011095109.1|  PREDICTED: probable beta-1,3-galactosyltrans...    306   9e-99    
ref|XP_010461176.1|  PREDICTED: probable beta-1,3-galactosyltrans...    305   1e-98    
ref|XP_009359950.1|  PREDICTED: probable beta-1,3-galactosyltrans...    305   1e-98    
ref|XP_006304768.1|  hypothetical protein CARUB_v10012254mg             305   2e-98    
ref|XP_009602082.1|  PREDICTED: probable beta-1,3-galactosyltrans...    306   2e-98    



>ref|XP_009598546.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Nicotiana 
tomentosiformis]
Length=410

 Score =   366 bits (940),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAVKLWDAEYY+KVDDDVHVNIGTL ETLARHRKKPRVYIGCMKSGPVL+QKGVRYHEPE
Sbjct  232  TAVKLWDAEYYVKVDDDVHVNIGTLAETLARHRKKPRVYIGCMKSGPVLAQKGVRYHEPE  291

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGETGNKYFRHATGQ+YAISKDLA+YIS NQHVLHKYANEDVSLGAWFIGLDVHH+D
Sbjct  292  YWKFGETGNKYFRHATGQIYAISKDLASYISVNQHVLHKYANEDVSLGAWFIGLDVHHID  351

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR+VDR+KEVHRRCGEGE  LW AA 
Sbjct  352  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRSVDRLKEVHRRCGEGENALWKAAI  410



>ref|XP_009770915.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Nicotiana 
sylvestris]
Length=410

 Score =   365 bits (936),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAVKLWDAEYY+KVDDDVHVNIGTL ETLARHRKKPRVYIGCMKSGPVL+QKGVRYHEPE
Sbjct  232  TAVKLWDAEYYVKVDDDVHVNIGTLAETLARHRKKPRVYIGCMKSGPVLAQKGVRYHEPE  291

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGETGNKYFRHATGQ+YAISKDLA+YIS N+HVLHKYANEDVSLGAWFIGLDVHH+D
Sbjct  292  YWKFGETGNKYFRHATGQIYAISKDLASYISVNKHVLHKYANEDVSLGAWFIGLDVHHID  351

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR+VDR+KEVHRRCGEGE  LW AA 
Sbjct  352  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRSVDRLKEVHRRCGEGENTLWKAAI  410



>ref|XP_006366587.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X2 [Solanum tuberosum]
Length=406

 Score =   363 bits (932),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 164/179 (92%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAVKLWDAEYY+KVDDDVHVNIGTL ETLARHRKKPRVYIGCMKSGPVL+QKGVRYHEPE
Sbjct  228  TAVKLWDAEYYVKVDDDVHVNIGTLAETLARHRKKPRVYIGCMKSGPVLAQKGVRYHEPE  287

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGETGNKYFRHATGQ+YAISKDLA+YIS NQHVLHKYANEDVSLGAWFIGLDV H+D
Sbjct  288  YWKFGETGNKYFRHATGQIYAISKDLASYISVNQHVLHKYANEDVSLGAWFIGLDVLHID  347

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGN+CVASFDWTCSGICR+VDR+KEVH+RCGEGEK LW AA 
Sbjct  348  DRRLCCGTPPDCEWKAQAGNVCVASFDWTCSGICRSVDRLKEVHKRCGEGEKALWKAAI  406



>ref|XP_006366586.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X1 [Solanum tuberosum]
Length=408

 Score =   363 bits (932),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 164/179 (92%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAVKLWDAEYY+KVDDDVHVNIGTL ETLARHRKKPRVYIGCMKSGPVL+QKGVRYHEPE
Sbjct  230  TAVKLWDAEYYVKVDDDVHVNIGTLAETLARHRKKPRVYIGCMKSGPVLAQKGVRYHEPE  289

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGETGNKYFRHATGQ+YAISKDLA+YIS NQHVLHKYANEDVSLGAWFIGLDV H+D
Sbjct  290  YWKFGETGNKYFRHATGQIYAISKDLASYISVNQHVLHKYANEDVSLGAWFIGLDVLHID  349

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGN+CVASFDWTCSGICR+VDR+KEVH+RCGEGEK LW AA 
Sbjct  350  DRRLCCGTPPDCEWKAQAGNVCVASFDWTCSGICRSVDRLKEVHKRCGEGEKALWKAAI  408



>emb|CDP10795.1| unnamed protein product [Coffea canephora]
Length=409

 Score =   361 bits (927),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 162/179 (91%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV +WDAEYY+KVDDDVHVNI TLG+TLARHRKKPR+YIGCMKSGPVL+QKGVRYHEPE
Sbjct  231  TAVTMWDAEYYVKVDDDVHVNIATLGDTLARHRKKPRIYIGCMKSGPVLAQKGVRYHEPE  290

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAISKDLATYIS NQHVLHKYANEDVSLG+WFIGLDV H+D
Sbjct  291  YWKFGEAGNKYFRHATGQLYAISKDLATYISVNQHVLHKYANEDVSLGSWFIGLDVLHID  350

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR+VDRIKEVHRRCGEGE  +W AAF
Sbjct  351  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRSVDRIKEVHRRCGEGENAIWTAAF  409



>ref|XP_010323831.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Solanum lycopersicum]
Length=406

 Score =   360 bits (924),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 162/179 (91%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAVKLWDAEYY+KVDDDVHVNIGTL ETL RHRKK RVYIGCMKSGPVL+QKGVRYHEPE
Sbjct  228  TAVKLWDAEYYVKVDDDVHVNIGTLAETLTRHRKKSRVYIGCMKSGPVLAQKGVRYHEPE  287

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGETGNKYFRHATGQ+YAISKDLA+YIS NQHVLHKYANEDVSLGAWFIGLDV H+D
Sbjct  288  YWKFGETGNKYFRHATGQIYAISKDLASYISVNQHVLHKYANEDVSLGAWFIGLDVQHID  347

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGN+CVASFDWTCSGICR+VDR+KEVH+RCGEGEK LW AA 
Sbjct  348  DRRLCCGTPPDCEWKAQAGNVCVASFDWTCSGICRSVDRLKEVHKRCGEGEKALWKAAI  406



>ref|XP_004243473.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Solanum lycopersicum]
Length=408

 Score =   360 bits (923),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 162/179 (91%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAVKLWDAEYY+KVDDDVHVNIGTL ETL RHRKK RVYIGCMKSGPVL+QKGVRYHEPE
Sbjct  230  TAVKLWDAEYYVKVDDDVHVNIGTLAETLTRHRKKSRVYIGCMKSGPVLAQKGVRYHEPE  289

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGETGNKYFRHATGQ+YAISKDLA+YIS NQHVLHKYANEDVSLGAWFIGLDV H+D
Sbjct  290  YWKFGETGNKYFRHATGQIYAISKDLASYISVNQHVLHKYANEDVSLGAWFIGLDVQHID  349

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGN+CVASFDWTCSGICR+VDR+KEVH+RCGEGEK LW AA 
Sbjct  350  DRRLCCGTPPDCEWKAQAGNVCVASFDWTCSGICRSVDRLKEVHKRCGEGEKALWKAAI  408



>gb|EYU34029.1| hypothetical protein MIMGU_mgv1a007633mg [Erythranthe guttata]
Length=401

 Score =   359 bits (922),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 161/179 (90%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDAEYY+KVDDDVHVNI TLGETLARHRKKPRVYIGCMKSGPVLSQ+GVRYHEPE
Sbjct  223  TAVSLWDAEYYVKVDDDVHVNIATLGETLARHRKKPRVYIGCMKSGPVLSQRGVRYHEPE  282

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            +WKFGETGNKYFRHATGQLYAISKDLA+YIS NQHVLHK+ANEDVSLG+WFIGLDV H+D
Sbjct  283  FWKFGETGNKYFRHATGQLYAISKDLASYISVNQHVLHKFANEDVSLGSWFIGLDVKHID  342

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDW+CSGICR+VDRIKEVHRRCGEGE  +W A F
Sbjct  343  DRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSVDRIKEVHRRCGEGEDAVWKATF  401



>ref|XP_006375531.1| hypothetical protein POPTR_0014s15200g [Populus trichocarpa]
 gb|ERP53328.1| hypothetical protein POPTR_0014s15200g [Populus trichocarpa]
Length=303

 Score =   353 bits (906),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 160/179 (89%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDA++Y+KVDDDVHVNI TLGETL RHRKKPRVYIGCMKSGPVL+QKGVRYHEPE
Sbjct  125  TAVALWDADFYVKVDDDVHVNIATLGETLVRHRKKPRVYIGCMKSGPVLNQKGVRYHEPE  184

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAISKDLATYIS NQH+LHKYANEDVSLG+WFIGLDV H+D
Sbjct  185  YWKFGEAGNKYFRHATGQLYAISKDLATYISINQHLLHKYANEDVSLGSWFIGLDVDHID  244

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDW+CSGICR+ DRIKEVHRRCGEGEK LW A F
Sbjct  245  DRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSADRIKEVHRRCGEGEKALWRATF  303



>ref|XP_011100272.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Sesamum 
indicum]
Length=405

 Score =   357 bits (915),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDAEYY+KVDDDVHVNI TLGETLARHRKKPRVYIGCMKSGPVL+Q+GVRYHEPE
Sbjct  227  TAVSLWDAEYYVKVDDDVHVNIATLGETLARHRKKPRVYIGCMKSGPVLAQRGVRYHEPE  286

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            +WKFGE GNKYFRHATGQLYAISKDLA+YIS NQHVLHKYANEDVSLG+WFIGLDV H+D
Sbjct  287  HWKFGEPGNKYFRHATGQLYAISKDLASYISVNQHVLHKYANEDVSLGSWFIGLDVRHID  346

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGN+CVASFDW+CSGICR+VDRIKEVHRRCGEGE  +W A F
Sbjct  347  DRRLCCGTPPDCEWKAQAGNVCVASFDWSCSGICRSVDRIKEVHRRCGEGEDAIWKAVF  405



>ref|XP_006592811.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X3 [Glycine max]
Length=371

 Score =   355 bits (911),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDA++YIKVDDDVHVNI TLG+TL RHR KPRVYIGCMKSGPVLSQKGVRYHEPE
Sbjct  193  TAVNLWDADFYIKVDDDVHVNIATLGQTLLRHRSKPRVYIGCMKSGPVLSQKGVRYHEPE  252

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAISKDLATYIS N+HVLHKYANEDVSLG+WFIGLDV H+D
Sbjct  253  YWKFGEAGNKYFRHATGQLYAISKDLATYISNNKHVLHKYANEDVSLGSWFIGLDVDHID  312

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGN+CVASFDWTCSGICR+ +RIKEVH+RCGEGEK LWNA+F
Sbjct  313  DRRLCCGTPPDCEWKAQAGNVCVASFDWTCSGICRSAERIKEVHKRCGEGEKALWNASF  371



>ref|XP_011047262.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Populus euphratica]
Length=405

 Score =   356 bits (914),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 161/179 (90%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDA++Y+KVDDDVHVNI TLGETL RHRKKPRVYIGCMKSGPVL+QKGVRYHEPE
Sbjct  227  TAVALWDADFYVKVDDDVHVNIATLGETLVRHRKKPRVYIGCMKSGPVLNQKGVRYHEPE  286

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAISKDLATYIS NQHVLHKYANEDVSLG+WFIGLDV H+D
Sbjct  287  YWKFGEAGNKYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLGSWFIGLDVDHID  346

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDW+CSGICR+ DRIKEVHRRCGEGEK LW A F
Sbjct  347  DRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSADRIKEVHRRCGEGEKALWRATF  405



>gb|KHF99242.1| putative beta-1,3-galactosyltransferase 2 -like protein [Gossypium 
arboreum]
Length=404

 Score =   356 bits (913),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 160/179 (89%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDA++Y+KVDDDVHVNI TLGETL RHRKKPRVYIGCMKSGPVLSQKGVRYHEPE
Sbjct  226  TAVALWDADFYVKVDDDVHVNIATLGETLVRHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  285

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            +WKFGETGNKYFRHATGQLYAISKDLA+YIS N+HVLHKYANEDVSLG+WFIGLDV H+D
Sbjct  286  HWKFGETGNKYFRHATGQLYAISKDLASYISINRHVLHKYANEDVSLGSWFIGLDVEHID  345

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR+ DRIKEVHRRCGEGE  LW+A F
Sbjct  346  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRSADRIKEVHRRCGEGETALWSATF  404



>ref|XP_011047261.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Populus euphratica]
Length=408

 Score =   356 bits (913),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 161/179 (90%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDA++Y+KVDDDVHVNI TLGETL RHRKKPRVYIGCMKSGPVL+QKGVRYHEPE
Sbjct  230  TAVALWDADFYVKVDDDVHVNIATLGETLVRHRKKPRVYIGCMKSGPVLNQKGVRYHEPE  289

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAISKDLATYIS NQHVLHKYANEDVSLG+WFIGLDV H+D
Sbjct  290  YWKFGEAGNKYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLGSWFIGLDVDHID  349

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDW+CSGICR+ DRIKEVHRRCGEGEK LW A F
Sbjct  350  DRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSADRIKEVHRRCGEGEKALWRATF  408



>gb|KDP22716.1| hypothetical protein JCGZ_01818 [Jatropha curcas]
Length=303

 Score =   352 bits (903),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 160/179 (89%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDA++Y+KVDDDVHVNI TLGETL RHRKK RVYIGCMKSGPVL+QKGVRYHEPE
Sbjct  125  TAVALWDADFYVKVDDDVHVNIATLGETLVRHRKKQRVYIGCMKSGPVLNQKGVRYHEPE  184

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAISKDLATYIS NQHVLHKYANEDVSLG+WFIGLDV H+D
Sbjct  185  YWKFGEAGNKYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLGSWFIGLDVEHID  244

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC++ DRIKEVHRRCGEGE VLW+A F
Sbjct  245  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICKSADRIKEVHRRCGEGENVLWSATF  303



>gb|KJB80507.1| hypothetical protein B456_013G101400 [Gossypium raimondii]
Length=405

 Score =   356 bits (913),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 160/179 (89%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            T+V LWDA++Y+KVDDDVHVNI TLGETL RHRK PRVYIGCMKSGPVLSQKGVRYHEPE
Sbjct  227  TSVALWDADFYVKVDDDVHVNIATLGETLVRHRKNPRVYIGCMKSGPVLSQKGVRYHEPE  286

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            +WKFGETGNKYFRHATGQLYAISKDLA+YIS NQHVLHKYANEDVSLG+WFIGLDV HVD
Sbjct  287  HWKFGETGNKYFRHATGQLYAISKDLASYISINQHVLHKYANEDVSLGSWFIGLDVEHVD  346

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR+ DRIKEVHRRCGEGE  LW+A F
Sbjct  347  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRSADRIKEVHRRCGEGENALWSATF  405



>gb|KJB80505.1| hypothetical protein B456_013G101400 [Gossypium raimondii]
Length=404

 Score =   355 bits (912),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 160/179 (89%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            T+V LWDA++Y+KVDDDVHVNI TLGETL RHRK PRVYIGCMKSGPVLSQKGVRYHEPE
Sbjct  226  TSVALWDADFYVKVDDDVHVNIATLGETLVRHRKNPRVYIGCMKSGPVLSQKGVRYHEPE  285

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            +WKFGETGNKYFRHATGQLYAISKDLA+YIS NQHVLHKYANEDVSLG+WFIGLDV HVD
Sbjct  286  HWKFGETGNKYFRHATGQLYAISKDLASYISINQHVLHKYANEDVSLGSWFIGLDVEHVD  345

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR+ DRIKEVHRRCGEGE  LW+A F
Sbjct  346  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRSADRIKEVHRRCGEGENALWSATF  404



>ref|XP_010484738.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Camelina sativa]
Length=408

 Score =   355 bits (912),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TA  +WDA++Y+KVDDDVHVNI TLGETL RHRKKPRVYIGCMKSGPVLSQKGVRYHEPE
Sbjct  230  TAFSMWDADFYVKVDDDVHVNIATLGETLVRHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  289

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAIS+DLA+YIS NQHVLHKYANEDVSLGAWFIG+DV H+D
Sbjct  290  YWKFGENGNKYFRHATGQLYAISRDLASYISINQHVLHKYANEDVSLGAWFIGIDVKHID  349

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDW+CSGICR+ DRIKEVHRRCGEGEK LW+A F
Sbjct  350  DRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSADRIKEVHRRCGEGEKALWSATF  408



>ref|XP_010475189.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Camelina sativa]
Length=409

 Score =   355 bits (912),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TA  +WDA++Y+KVDDDVHVNI TLGETL RHRKKPRVYIGCMKSGPVLSQKGVRYHEPE
Sbjct  231  TAFSMWDADFYVKVDDDVHVNIATLGETLVRHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  290

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAIS+DLA+YIS NQHVLHKYANEDVSLGAWFIG+DV H+D
Sbjct  291  YWKFGENGNKYFRHATGQLYAISRDLASYISINQHVLHKYANEDVSLGAWFIGIDVKHID  350

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDW+CSGICR+ DRIKEVHRRCGEGEK LW+A F
Sbjct  351  DRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSADRIKEVHRRCGEGEKALWSATF  409



>ref|XP_010484744.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Camelina sativa]
Length=405

 Score =   355 bits (911),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TA  +WDA++Y+KVDDDVHVNI TLGETL RHRKKPRVYIGCMKSGPVLSQKGVRYHEPE
Sbjct  227  TAFSMWDADFYVKVDDDVHVNIATLGETLVRHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  286

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAIS+DLA+YIS NQHVLHKYANEDVSLGAWFIG+DV H+D
Sbjct  287  YWKFGENGNKYFRHATGQLYAISRDLASYISINQHVLHKYANEDVSLGAWFIGIDVKHID  346

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDW+CSGICR+ DRIKEVHRRCGEGEK LW+A F
Sbjct  347  DRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSADRIKEVHRRCGEGEKALWSATF  405



>ref|XP_010475190.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Camelina sativa]
Length=406

 Score =   355 bits (911),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TA  +WDA++Y+KVDDDVHVNI TLGETL RHRKKPRVYIGCMKSGPVLSQKGVRYHEPE
Sbjct  228  TAFSMWDADFYVKVDDDVHVNIATLGETLVRHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  287

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAIS+DLA+YIS NQHVLHKYANEDVSLGAWFIG+DV H+D
Sbjct  288  YWKFGENGNKYFRHATGQLYAISRDLASYISINQHVLHKYANEDVSLGAWFIGIDVKHID  347

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDW+CSGICR+ DRIKEVHRRCGEGEK LW+A F
Sbjct  348  DRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSADRIKEVHRRCGEGEKALWSATF  406



>ref|XP_002320464.1| galactosyltransferase family protein [Populus trichocarpa]
 gb|EEE98779.1| galactosyltransferase family protein [Populus trichocarpa]
Length=405

 Score =   355 bits (911),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 160/179 (89%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDA++Y+KVDDDVHVNI TLGETL RHRKKPRVYIGCMKSGPVL+QKGVRYHEPE
Sbjct  227  TAVALWDADFYVKVDDDVHVNIATLGETLVRHRKKPRVYIGCMKSGPVLNQKGVRYHEPE  286

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAISKDLATYIS NQH+LHKYANEDVSLG+WFIGLDV H+D
Sbjct  287  YWKFGEAGNKYFRHATGQLYAISKDLATYISINQHLLHKYANEDVSLGSWFIGLDVDHID  346

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDW+CSGICR+ DRIKEVHRRCGEGEK LW A F
Sbjct  347  DRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSADRIKEVHRRCGEGEKALWRATF  405



>ref|XP_011095407.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Sesamum 
indicum]
Length=405

 Score =   355 bits (910),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 160/179 (89%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV+LWDA++Y+KVDDDVHVNI TLG TLARHR KPRVYIGCMKSGPVL+QKGVRYHEPE
Sbjct  227  TAVQLWDADFYVKVDDDVHVNIATLGATLARHRSKPRVYIGCMKSGPVLAQKGVRYHEPE  286

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAISKDLATYIS NQHVLHKYANEDVSLG+WFIGLDV H+D
Sbjct  287  YWKFGEHGNKYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLGSWFIGLDVEHID  346

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDW+CSGIC + DRIKEVHRRCGEGE VLWN+AF
Sbjct  347  DRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICNSADRIKEVHRRCGEGETVLWNSAF  405



>ref|XP_006375532.1| hypothetical protein POPTR_0014s15200g [Populus trichocarpa]
 gb|ERP53329.1| hypothetical protein POPTR_0014s15200g [Populus trichocarpa]
Length=408

 Score =   355 bits (910),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 160/179 (89%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDA++Y+KVDDDVHVNI TLGETL RHRKKPRVYIGCMKSGPVL+QKGVRYHEPE
Sbjct  230  TAVALWDADFYVKVDDDVHVNIATLGETLVRHRKKPRVYIGCMKSGPVLNQKGVRYHEPE  289

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAISKDLATYIS NQH+LHKYANEDVSLG+WFIGLDV H+D
Sbjct  290  YWKFGEAGNKYFRHATGQLYAISKDLATYISINQHLLHKYANEDVSLGSWFIGLDVDHID  349

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDW+CSGICR+ DRIKEVHRRCGEGEK LW A F
Sbjct  350  DRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSADRIKEVHRRCGEGEKALWRATF  408



>ref|XP_006304048.1| hypothetical protein CARUB_v10009858mg [Capsella rubella]
 gb|EOA36946.1| hypothetical protein CARUB_v10009858mg [Capsella rubella]
Length=303

 Score =   351 bits (900),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TA  +WDA++Y+KVDDDVHVNI TLGETL RHRKKPRVYIGCMKSGPVLSQKGVRYHEPE
Sbjct  125  TAFSMWDADFYVKVDDDVHVNIATLGETLVRHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  184

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAIS+DLA+YIS NQHVLHKYANEDVSLGAWFIG+DV H+D
Sbjct  185  YWKFGENGNKYFRHATGQLYAISRDLASYISINQHVLHKYANEDVSLGAWFIGIDVKHID  244

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWK QAGNICVASFDW+CSGICR+ DRIKEVHRRCGEGEK LW+A F
Sbjct  245  DRRLCCGTPPDCEWKTQAGNICVASFDWSCSGICRSADRIKEVHRRCGEGEKALWSATF  303



>ref|XP_003543389.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Glycine 
max]
 gb|KHN36530.1| Putative beta-1,3-galactosyltransferase 2 [Glycine soja]
Length=407

 Score =   355 bits (910),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDA++YIKVDDDVHVNI TLG+TL RHR KPRVYIGCMKSGPVLSQKGVRYHEPE
Sbjct  229  TAVNLWDADFYIKVDDDVHVNIATLGQTLVRHRSKPRVYIGCMKSGPVLSQKGVRYHEPE  288

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAISKDLATYIS N+HVLHKYANEDVSLG+WFIGLDV+H+D
Sbjct  289  YWKFGEAGNKYFRHATGQLYAISKDLATYISNNKHVLHKYANEDVSLGSWFIGLDVNHID  348

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGN+CVASFDWTCSGICR+ +RIKEVH+RCGEGEK LWNA+F
Sbjct  349  DRRLCCGTPPDCEWKAQAGNVCVASFDWTCSGICRSAERIKEVHKRCGEGEKALWNASF  407



>ref|XP_002892271.1| galactosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68530.1| galactosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=407

 Score =   355 bits (910),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TA  +WDA++Y+KVDDDVHVNI TLGETL RHRKKPRVYIGCMKSGPVLSQKGVRYHEPE
Sbjct  229  TAFSMWDADFYVKVDDDVHVNIATLGETLVRHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  288

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAIS+DLA+YIS NQHVLHKYANEDVSLGAWFIG+DV H+D
Sbjct  289  YWKFGENGNKYFRHATGQLYAISRDLASYISINQHVLHKYANEDVSLGAWFIGIDVKHID  348

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDW+CSGICR+ DRIKEVHRRCGEGEK LW+A F
Sbjct  349  DRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSADRIKEVHRRCGEGEKALWSATF  407



>ref|NP_001077462.1| putative beta-1,3-galactosyltransferase 2 [Arabidopsis thaliana]
 sp|A8MRC7.1|B3GT2_ARATH RecName: Full=Probable beta-1,3-galactosyltransferase 2 [Arabidopsis 
thaliana]
 gb|AEE27798.1| putative beta-1,3-galactosyltransferase 2 [Arabidopsis thaliana]
 gb|AHL38970.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=407

 Score =   355 bits (910),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TA  +WDA++Y+KVDDDVHVNI TLGETL RHRKKPRVYIGCMKSGPVLSQKGVRYHEPE
Sbjct  229  TAFSMWDADFYVKVDDDVHVNIATLGETLVRHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  288

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAIS+DLA+YIS NQHVLHKYANEDVSLGAWFIG+DV H+D
Sbjct  289  YWKFGENGNKYFRHATGQLYAISRDLASYISINQHVLHKYANEDVSLGAWFIGIDVKHID  348

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDW+CSGICR+ DRIKEVHRRCGEGEK LW+A F
Sbjct  349  DRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSADRIKEVHRRCGEGEKALWSATF  407



>ref|XP_003540300.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoformX1 
[Glycine max]
 gb|KHN44874.1| Putative beta-1,3-galactosyltransferase 2 [Glycine soja]
Length=407

 Score =   354 bits (909),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDA++YIKVDDDVHVNI TLG+TL RHR KPRVYIGCMKSGPVLSQKGVRYHEPE
Sbjct  229  TAVNLWDADFYIKVDDDVHVNIATLGQTLLRHRSKPRVYIGCMKSGPVLSQKGVRYHEPE  288

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAISKDLATYIS N+HVLHKYANEDVSLG+WFIGLDV H+D
Sbjct  289  YWKFGEAGNKYFRHATGQLYAISKDLATYISNNKHVLHKYANEDVSLGSWFIGLDVDHID  348

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGN+CVASFDWTCSGICR+ +RIKEVH+RCGEGEK LWNA+F
Sbjct  349  DRRLCCGTPPDCEWKAQAGNVCVASFDWTCSGICRSAERIKEVHKRCGEGEKALWNASF  407



>gb|KDO54673.1| hypothetical protein CISIN_1g015407mg [Citrus sinensis]
Length=303

 Score =   351 bits (900),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDA++Y+KVDDDVHVNI TLG+TL RHR KPRVYIGCMKSGPVL+QKGVRYHEPE
Sbjct  125  TAVSLWDADFYVKVDDDVHVNIATLGQTLVRHRSKPRVYIGCMKSGPVLNQKGVRYHEPE  184

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GN+YFRHATGQLYAISKDLA YIS NQHVLHKYANEDVSLG+WFIGLDV H+D
Sbjct  185  YWKFGEAGNRYFRHATGQLYAISKDLAAYISINQHVLHKYANEDVSLGSWFIGLDVEHID  244

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR+ DRIKEVHRRCGEGE  LW+A F
Sbjct  245  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRSADRIKEVHRRCGEGENALWSATF  303



>ref|NP_172009.1| putative beta-1,3-galactosyltransferase 2 [Arabidopsis thaliana]
 gb|AAK63859.1|AF389287_1 At1g05170/YUP8H12_22 [Arabidopsis thaliana]
 gb|AAB71461.1| Similar to Sequence 10 from patent 5477002 (gb|1253956) [Arabidopsis 
thaliana]
 gb|AAM47315.1| At1g05170/YUP8H12_22 [Arabidopsis thaliana]
 gb|AEE27797.1| putative beta-1,3-galactosyltransferase 2 [Arabidopsis thaliana]
Length=404

 Score =   354 bits (909),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TA  +WDA++Y+KVDDDVHVNI TLGETL RHRKKPRVYIGCMKSGPVLSQKGVRYHEPE
Sbjct  226  TAFSMWDADFYVKVDDDVHVNIATLGETLVRHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  285

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAIS+DLA+YIS NQHVLHKYANEDVSLGAWFIG+DV H+D
Sbjct  286  YWKFGENGNKYFRHATGQLYAISRDLASYISINQHVLHKYANEDVSLGAWFIGIDVKHID  345

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDW+CSGICR+ DRIKEVHRRCGEGEK LW+A F
Sbjct  346  DRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSADRIKEVHRRCGEGEKALWSATF  404



>ref|XP_006592810.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X2 [Glycine max]
Length=383

 Score =   353 bits (907),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDA++YIKVDDDVHVNI TLG+TL RHR KPRVYIGCMKSGPVLSQKGVRYHEPE
Sbjct  205  TAVNLWDADFYIKVDDDVHVNIATLGQTLLRHRSKPRVYIGCMKSGPVLSQKGVRYHEPE  264

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAISKDLATYIS N+HVLHKYANEDVSLG+WFIGLDV H+D
Sbjct  265  YWKFGEAGNKYFRHATGQLYAISKDLATYISNNKHVLHKYANEDVSLGSWFIGLDVDHID  324

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGN+CVASFDWTCSGICR+ +RIKEVH+RCGEGEK LWNA+F
Sbjct  325  DRRLCCGTPPDCEWKAQAGNVCVASFDWTCSGICRSAERIKEVHKRCGEGEKALWNASF  383



>ref|XP_006447567.1| hypothetical protein CICLE_v10015443mg [Citrus clementina]
 gb|ESR60807.1| hypothetical protein CICLE_v10015443mg [Citrus clementina]
Length=303

 Score =   350 bits (897),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDA++++KVDDDVHVNI TLG+TL RHR KPRVYIGCMKSGPVL+QKGVRYHEPE
Sbjct  125  TAVSLWDADFFVKVDDDVHVNIATLGQTLVRHRSKPRVYIGCMKSGPVLNQKGVRYHEPE  184

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GN+YFRHATGQLYAISKDLA YIS NQHVLHKYANEDVSLG+WFIGLDV H+D
Sbjct  185  YWKFGEAGNRYFRHATGQLYAISKDLAAYISINQHVLHKYANEDVSLGSWFIGLDVEHID  244

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR+ DRIKEVHRRCGEGE  LW+A F
Sbjct  245  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRSADRIKEVHRRCGEGENALWSATF  303



>gb|KDO54670.1| hypothetical protein CISIN_1g015407mg [Citrus sinensis]
Length=407

 Score =   353 bits (905),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDA++Y+KVDDDVHVNI TLG+TL RHR KPRVYIGCMKSGPVL+QKGVRYHEPE
Sbjct  229  TAVSLWDADFYVKVDDDVHVNIATLGQTLVRHRSKPRVYIGCMKSGPVLNQKGVRYHEPE  288

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GN+YFRHATGQLYAISKDLA YIS NQHVLHKYANEDVSLG+WFIGLDV H+D
Sbjct  289  YWKFGEAGNRYFRHATGQLYAISKDLAAYISINQHVLHKYANEDVSLGSWFIGLDVEHID  348

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR+ DRIKEVHRRCGEGE  LW+A F
Sbjct  349  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRSADRIKEVHRRCGEGENALWSATF  407



>ref|XP_009775718.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Nicotiana sylvestris]
Length=404

 Score =   352 bits (904),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 162/179 (91%), Positives = 168/179 (94%), Gaps = 3/179 (2%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDAEYYIKVDDDVHVNI TLGETLARHRKKPR+YIGCMKSGPVLS+KGVRYHEPE
Sbjct  229  TAVNLWDAEYYIKVDDDVHVNIATLGETLARHRKKPRIYIGCMKSGPVLSRKGVRYHEPE  288

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFG   +KYFRHATGQ+YAISKDLATYIS NQHVLHKY NEDVSLGAWFIGLDV H+D
Sbjct  289  YWKFG---DKYFRHATGQIYAISKDLATYISVNQHVLHKYTNEDVSLGAWFIGLDVQHID  345

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR+VDRIKEVHRRCGEGE  LW AAF
Sbjct  346  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRSVDRIKEVHRRCGEGENALWKAAF  404



>gb|KDO54671.1| hypothetical protein CISIN_1g015407mg [Citrus sinensis]
Length=405

 Score =   352 bits (904),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDA++Y+KVDDDVHVNI TLG+TL RHR KPRVYIGCMKSGPVL+QKGVRYHEPE
Sbjct  227  TAVSLWDADFYVKVDDDVHVNIATLGQTLVRHRSKPRVYIGCMKSGPVLNQKGVRYHEPE  286

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GN+YFRHATGQLYAISKDLA YIS NQHVLHKYANEDVSLG+WFIGLDV H+D
Sbjct  287  YWKFGEAGNRYFRHATGQLYAISKDLAAYISINQHVLHKYANEDVSLGSWFIGLDVEHID  346

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR+ DRIKEVHRRCGEGE  LW+A F
Sbjct  347  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRSADRIKEVHRRCGEGENALWSATF  405



>ref|XP_002524194.1| Beta-1,3-galactosyltransferase sqv-2, putative [Ricinus communis]
 gb|EEF38209.1| Beta-1,3-galactosyltransferase sqv-2, putative [Ricinus communis]
Length=374

 Score =   351 bits (901),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDA++Y+KVDDDVHVNI TLGETL RHRKK R+YIGCMKSGPVL+QKGVRYHEPE
Sbjct  196  TAVALWDADFYVKVDDDVHVNIATLGETLVRHRKKSRLYIGCMKSGPVLNQKGVRYHEPE  255

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            +WKFGE GNKYFRHATGQLYAISKDLATYIS NQHVLHKYANEDVSLG+WFIGLDV H+D
Sbjct  256  FWKFGEAGNKYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLGSWFIGLDVEHID  315

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDW+CSGICR+ DRIKEVHRRCGEGE  LW+A F
Sbjct  316  DRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSADRIKEVHRRCGEGENALWSATF  374



>ref|XP_009775717.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Nicotiana sylvestris]
Length=405

 Score =   352 bits (904),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 162/179 (91%), Positives = 168/179 (94%), Gaps = 3/179 (2%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDAEYYIKVDDDVHVNI TLGETLARHRKKPR+YIGCMKSGPVLS+KGVRYHEPE
Sbjct  230  TAVNLWDAEYYIKVDDDVHVNIATLGETLARHRKKPRIYIGCMKSGPVLSRKGVRYHEPE  289

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFG   +KYFRHATGQ+YAISKDLATYIS NQHVLHKY NEDVSLGAWFIGLDV H+D
Sbjct  290  YWKFG---DKYFRHATGQIYAISKDLATYISVNQHVLHKYTNEDVSLGAWFIGLDVQHID  346

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR+VDRIKEVHRRCGEGE  LW AAF
Sbjct  347  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRSVDRIKEVHRRCGEGENALWKAAF  405



>gb|KDO54672.1| hypothetical protein CISIN_1g015407mg [Citrus sinensis]
Length=404

 Score =   352 bits (903),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDA++Y+KVDDDVHVNI TLG+TL RHR KPRVYIGCMKSGPVL+QKGVRYHEPE
Sbjct  226  TAVSLWDADFYVKVDDDVHVNIATLGQTLVRHRSKPRVYIGCMKSGPVLNQKGVRYHEPE  285

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GN+YFRHATGQLYAISKDLA YIS NQHVLHKYANEDVSLG+WFIGLDV H+D
Sbjct  286  YWKFGEAGNRYFRHATGQLYAISKDLAAYISINQHVLHKYANEDVSLGSWFIGLDVEHID  345

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR+ DRIKEVHRRCGEGE  LW+A F
Sbjct  346  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRSADRIKEVHRRCGEGENALWSATF  404



>ref|XP_006418057.1| hypothetical protein EUTSA_v10007787mg [Eutrema salsugineum]
 gb|ESQ36410.1| hypothetical protein EUTSA_v10007787mg [Eutrema salsugineum]
Length=407

 Score =   352 bits (903),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TA  +WDA++Y+KVDDDVHVNI TLGETL RHRKKPRVYIGCMKSGPVLSQKGVRYHEPE
Sbjct  229  TAFSMWDADFYVKVDDDVHVNIATLGETLVRHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  288

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQ+YAIS+DLA+YIS NQHVLHKYANEDVSLGAWFIG+DV H+D
Sbjct  289  YWKFGENGNKYFRHATGQIYAISRDLASYISINQHVLHKYANEDVSLGAWFIGIDVKHID  348

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR+ DRIKEVHRRCGEGE  LW+A F
Sbjct  349  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRSADRIKEVHRRCGEGENALWSATF  407



>ref|XP_010457598.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X3 [Camelina sativa]
Length=408

 Score =   352 bits (903),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TA  +WDA++Y+KVDDDVHVNI TLGETL RHRKKPRVYIGCMKSGPVLS KGVRYHEPE
Sbjct  230  TAFSMWDADFYVKVDDDVHVNIATLGETLVRHRKKPRVYIGCMKSGPVLSHKGVRYHEPE  289

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAIS+DLA+YIS NQHVLHKYANEDVSLGAWFIG+DV H+D
Sbjct  290  YWKFGENGNKYFRHATGQLYAISRDLASYISINQHVLHKYANEDVSLGAWFIGIDVKHID  349

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDW+CSGICR+ DRIKEVHRRCGEGEK LW+A F
Sbjct  350  DRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSADRIKEVHRRCGEGEKALWSATF  408



>ref|XP_010457599.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X4 [Camelina sativa]
Length=405

 Score =   352 bits (903),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TA  +WDA++Y+KVDDDVHVNI TLGETL RHRKKPRVYIGCMKSGPVLS KGVRYHEPE
Sbjct  227  TAFSMWDADFYVKVDDDVHVNIATLGETLVRHRKKPRVYIGCMKSGPVLSHKGVRYHEPE  286

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAIS+DLA+YIS NQHVLHKYANEDVSLGAWFIG+DV H+D
Sbjct  287  YWKFGENGNKYFRHATGQLYAISRDLASYISINQHVLHKYANEDVSLGAWFIGIDVKHID  346

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDW+CSGICR+ DRIKEVHRRCGEGEK LW+A F
Sbjct  347  DRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSADRIKEVHRRCGEGEKALWSATF  405



>ref|XP_006447568.1| hypothetical protein CICLE_v10015443mg [Citrus clementina]
 ref|XP_006469678.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X1 [Citrus sinensis]
 gb|ESR60808.1| hypothetical protein CICLE_v10015443mg [Citrus clementina]
Length=407

 Score =   352 bits (903),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDA++++KVDDDVHVNI TLG+TL RHR KPRVYIGCMKSGPVL+QKGVRYHEPE
Sbjct  229  TAVSLWDADFFVKVDDDVHVNIATLGQTLVRHRSKPRVYIGCMKSGPVLNQKGVRYHEPE  288

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GN+YFRHATGQLYAISKDLA YIS NQHVLHKYANEDVSLG+WFIGLDV H+D
Sbjct  289  YWKFGEAGNRYFRHATGQLYAISKDLAAYISINQHVLHKYANEDVSLGSWFIGLDVEHID  348

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR+ DRIKEVHRRCGEGE  LW+A F
Sbjct  349  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRSADRIKEVHRRCGEGENALWSATF  407



>ref|XP_002268282.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Vitis vinifera]
 emb|CBI28801.3| unnamed protein product [Vitis vinifera]
Length=407

 Score =   352 bits (902),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDAE+YIKVDDDVHVNI TLGETL RHRKKPRVYIGCMKSGPVL+QKGVRYHEPE
Sbjct  229  TAVALWDAEFYIKVDDDVHVNIATLGETLVRHRKKPRVYIGCMKSGPVLAQKGVRYHEPE  288

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAISKDLA YIS NQHVLHKYANEDVSLG+WFIGLD  H+D
Sbjct  289  YWKFGEAGNKYFRHATGQLYAISKDLARYISINQHVLHKYANEDVSLGSWFIGLDAEHID  348

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGN CVASFDW+CSGICR+ +RIKEVHRRCGEGE  LWNA F
Sbjct  349  DRRLCCGTPPDCEWKAQAGNACVASFDWSCSGICRSSERIKEVHRRCGEGENALWNAVF  407



>ref|XP_010557003.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X3 [Tarenaya hassleriana]
Length=405

 Score =   352 bits (902),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV +WDA++Y+KVDDDVHVNI TLGETL RHRKK RVYIGCMKSGPVLSQKGVRYHEPE
Sbjct  227  TAVSMWDADFYVKVDDDVHVNIATLGETLVRHRKKSRVYIGCMKSGPVLSQKGVRYHEPE  286

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAIS+DLA+YIS NQHVLHKYANEDVSLGAWFIGLDV H+D
Sbjct  287  YWKFGEAGNKYFRHATGQLYAISRDLASYISINQHVLHKYANEDVSLGAWFIGLDVEHID  346

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR+ DRIKEVHRRCGEGE  LW++ F
Sbjct  347  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRSADRIKEVHRRCGEGETALWSSTF  405



>ref|XP_010657202.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Vitis vinifera]
Length=405

 Score =   352 bits (902),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDAE+YIKVDDDVHVNI TLGETL RHRKKPRVYIGCMKSGPVL+QKGVRYHEPE
Sbjct  227  TAVALWDAEFYIKVDDDVHVNIATLGETLVRHRKKPRVYIGCMKSGPVLAQKGVRYHEPE  286

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAISKDLA YIS NQHVLHKYANEDVSLG+WFIGLD  H+D
Sbjct  287  YWKFGEAGNKYFRHATGQLYAISKDLARYISINQHVLHKYANEDVSLGSWFIGLDAEHID  346

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGN CVASFDW+CSGICR+ +RIKEVHRRCGEGE  LWNA F
Sbjct  347  DRRLCCGTPPDCEWKAQAGNACVASFDWSCSGICRSSERIKEVHRRCGEGENALWNAVF  405



>ref|XP_006469679.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X2 [Citrus sinensis]
Length=405

 Score =   351 bits (901),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDA++++KVDDDVHVNI TLG+TL RHR KPRVYIGCMKSGPVL+QKGVRYHEPE
Sbjct  227  TAVSLWDADFFVKVDDDVHVNIATLGQTLVRHRSKPRVYIGCMKSGPVLNQKGVRYHEPE  286

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GN+YFRHATGQLYAISKDLA YIS NQHVLHKYANEDVSLG+WFIGLDV H+D
Sbjct  287  YWKFGEAGNRYFRHATGQLYAISKDLAAYISINQHVLHKYANEDVSLGSWFIGLDVEHID  346

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR+ DRIKEVHRRCGEGE  LW+A F
Sbjct  347  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRSADRIKEVHRRCGEGENALWSATF  405



>ref|XP_010657203.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X3 [Vitis vinifera]
Length=404

 Score =   351 bits (901),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDAE+YIKVDDDVHVNI TLGETL RHRKKPRVYIGCMKSGPVL+QKGVRYHEPE
Sbjct  226  TAVALWDAEFYIKVDDDVHVNIATLGETLVRHRKKPRVYIGCMKSGPVLAQKGVRYHEPE  285

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAISKDLA YIS NQHVLHKYANEDVSLG+WFIGLD  H+D
Sbjct  286  YWKFGEAGNKYFRHATGQLYAISKDLARYISINQHVLHKYANEDVSLGSWFIGLDAEHID  345

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGN CVASFDW+CSGICR+ +RIKEVHRRCGEGE  LWNA F
Sbjct  346  DRRLCCGTPPDCEWKAQAGNACVASFDWSCSGICRSSERIKEVHRRCGEGENALWNAVF  404



>ref|XP_003539862.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Glycine 
max]
Length=406

 Score =   351 bits (901),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDA++Y+KVDDDVHVNI TLGETL RHR KPR+YIGCMKSGPVLSQKGVRYHEPE
Sbjct  228  TAVNLWDADFYVKVDDDVHVNIATLGETLVRHRSKPRIYIGCMKSGPVLSQKGVRYHEPE  287

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GN+YFRHATGQLYAIS DLATYIS NQ+VLHKYANEDVSLG+WFIGLDV H+D
Sbjct  288  YWKFGEAGNRYFRHATGQLYAISNDLATYISINQNVLHKYANEDVSLGSWFIGLDVEHID  347

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDW+CSGICR+ +RIKEVHRRCGEGE VLW+A+F
Sbjct  348  DRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSAERIKEVHRRCGEGENVLWSASF  406



>ref|XP_004159203.1| PREDICTED: LOW QUALITY PROTEIN: probable beta-1,3-galactosyltransferase 
2-like [Cucumis sativus]
Length=407

 Score =   351 bits (901),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDA++YIKVDDDVHVNI TLGETL RHR KPRVYIGCMKSGPVLSQKGVRYHEPE
Sbjct  229  TAVALWDADFYIKVDDDVHVNIATLGETLVRHRSKPRVYIGCMKSGPVLSQKGVRYHEPE  288

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            +WKFGE GNKYFRHATGQLYAISKDLATYIS NQHVLHKYANEDVSLG+WFIGLDV H+D
Sbjct  289  HWKFGEFGNKYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLGSWFIGLDVEHID  348

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDW+CSGICR+ +RIKEVHRRCGEGE  LW+A F
Sbjct  349  DRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSAERIKEVHRRCGEGENTLWSATF  407



>gb|KHN21228.1| Putative beta-1,3-galactosyltransferase 2 [Glycine soja]
Length=406

 Score =   351 bits (901),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDA++Y+KVDDDVHVNI TLGETL RHR KPR+YIGCMKSGPVLSQKGVRYHEPE
Sbjct  228  TAVNLWDADFYVKVDDDVHVNIATLGETLVRHRSKPRIYIGCMKSGPVLSQKGVRYHEPE  287

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GN+YFRHATGQLYAIS DLATYIS NQ+VLHKYANEDVSLG+WFIGLDV H+D
Sbjct  288  YWKFGEAGNRYFRHATGQLYAISNDLATYISINQNVLHKYANEDVSLGSWFIGLDVEHID  347

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDW+CSGICR+ +RIKEVHRRCGEGE VLW+A+F
Sbjct  348  DRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSAERIKEVHRRCGEGENVLWSASF  406



>ref|XP_006469680.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X3 [Citrus sinensis]
Length=404

 Score =   351 bits (901),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDA++++KVDDDVHVNI TLG+TL RHR KPRVYIGCMKSGPVL+QKGVRYHEPE
Sbjct  226  TAVSLWDADFFVKVDDDVHVNIATLGQTLVRHRSKPRVYIGCMKSGPVLNQKGVRYHEPE  285

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GN+YFRHATGQLYAISKDLA YIS NQHVLHKYANEDVSLG+WFIGLDV H+D
Sbjct  286  YWKFGEAGNRYFRHATGQLYAISKDLAAYISINQHVLHKYANEDVSLGSWFIGLDVEHID  345

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR+ DRIKEVHRRCGEGE  LW+A F
Sbjct  346  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRSADRIKEVHRRCGEGENALWSATF  404



>ref|XP_008455443.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Cucumis 
melo]
Length=407

 Score =   351 bits (901),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDA++YIKVDDDVHVNI TLGETL RHR KPRVYIGCMKSGPVLSQKGVRYHEPE
Sbjct  229  TAVALWDADFYIKVDDDVHVNIATLGETLVRHRSKPRVYIGCMKSGPVLSQKGVRYHEPE  288

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            +WKFGE GNKYFRHATGQLYAISKDLATYIS NQHVLHKYANEDVSLG+WFIGLDV H+D
Sbjct  289  HWKFGEFGNKYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLGSWFIGLDVEHID  348

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDW+CSGICR+ +RIKEVHRRCGEGE  LW+A F
Sbjct  349  DRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSAERIKEVHRRCGEGENTLWSATF  407



>ref|XP_004144497.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Cucumis 
sativus]
 gb|KGN43517.1| hypothetical protein Csa_7G043590 [Cucumis sativus]
Length=407

 Score =   351 bits (901),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDA++YIKVDDDVHVNI TLGETL RHR KPRVYIGCMKSGPVLSQKGVRYHEPE
Sbjct  229  TAVALWDADFYIKVDDDVHVNIATLGETLVRHRSKPRVYIGCMKSGPVLSQKGVRYHEPE  288

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            +WKFGE GNKYFRHATGQLYAISKDLATYIS NQHVLHKYANEDVSLG+WFIGLDV H+D
Sbjct  289  HWKFGEFGNKYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLGSWFIGLDVEHID  348

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDW+CSGICR+ +RIKEVHRRCGEGE  LW+A F
Sbjct  349  DRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSAERIKEVHRRCGEGENTLWSATF  407



>gb|KEH29682.1| beta-1,3-galactosyltransferase-like protein [Medicago truncatula]
Length=349

 Score =   349 bits (895),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDA++Y+KVDDDVHVNI TLGETL RHR K R+YIGCMKSGPVLSQKGVRYHEPE
Sbjct  171  TAVSLWDADFYVKVDDDVHVNIATLGETLVRHRSKQRIYIGCMKSGPVLSQKGVRYHEPE  230

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            +WKFGE+GNKYFRHATGQLYAIS DLATYIS NQ+VLHKYANEDVS+GAWFIGLDV H+D
Sbjct  231  HWKFGESGNKYFRHATGQLYAISNDLATYISTNQNVLHKYANEDVSIGAWFIGLDVEHID  290

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDW+CSGICR+ DRIKEVHRRCGEGE  LW+A+F
Sbjct  291  DRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSADRIKEVHRRCGEGENALWSASF  349



>ref|XP_010557001.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010557002.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Tarenaya hassleriana]
Length=408

 Score =   351 bits (900),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV +WDA++Y+KVDDDVHVNI TLGETL RHRKK RVYIGCMKSGPVLSQKGVRYHEPE
Sbjct  230  TAVSMWDADFYVKVDDDVHVNIATLGETLVRHRKKSRVYIGCMKSGPVLSQKGVRYHEPE  289

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAIS+DLA+YIS NQHVLHKYANEDVSLGAWFIGLDV H+D
Sbjct  290  YWKFGEAGNKYFRHATGQLYAISRDLASYISINQHVLHKYANEDVSLGAWFIGLDVEHID  349

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR+ DRIKEVHRRCGEGE  LW + F
Sbjct  350  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRSADRIKEVHRRCGEGETALWRSTF  408



>ref|XP_006294322.1| hypothetical protein CARUB_v10023330mg [Capsella rubella]
 gb|EOA27220.1| hypothetical protein CARUB_v10023330mg [Capsella rubella]
Length=408

 Score =   350 bits (899),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV +WDAEYY+KVDDDVHVNI TLGETL RHRKKPRVYIGCMKSGPVLSQKGVRYHEPE
Sbjct  230  TAVSMWDAEYYVKVDDDVHVNIATLGETLVRHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  289

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAIS+DLA+YIS NQHVLHKYANEDV+LGAWFIGLDV H+D
Sbjct  290  YWKFGENGNKYFRHATGQLYAISRDLASYISLNQHVLHKYANEDVTLGAWFIGLDVTHID  349

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR+ DRIKEVH+RCGE E  +W A F
Sbjct  350  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRSADRIKEVHKRCGEPENAIWKARF  408



>ref|XP_010522344.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Tarenaya hassleriana]
Length=405

 Score =   350 bits (899),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV +WDA++Y+KVDDDVHVNI TLGETL RH+KKPRVYIGCMKSGPVLSQKGVRYHEPE
Sbjct  227  TAVSMWDADFYVKVDDDVHVNIATLGETLIRHQKKPRVYIGCMKSGPVLSQKGVRYHEPE  286

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            +WKFGE+GNKYFRHATGQLYAISKDLA+YIS NQ+VLHKYANEDVSLG+WFIGLDV H+D
Sbjct  287  FWKFGESGNKYFRHATGQLYAISKDLASYISINQNVLHKYANEDVSLGSWFIGLDVEHID  346

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDW+CSGICR+ DRIKEVHRRCGEGE  LW +AF
Sbjct  347  DRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSADRIKEVHRRCGEGENALWRSAF  405



>ref|XP_010522341.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010522342.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010522343.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Tarenaya hassleriana]
Length=408

 Score =   350 bits (899),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV +WDA++Y+KVDDDVHVNI TLGETL RH+KKPRVYIGCMKSGPVLSQKGVRYHEPE
Sbjct  230  TAVSMWDADFYVKVDDDVHVNIATLGETLIRHQKKPRVYIGCMKSGPVLSQKGVRYHEPE  289

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            +WKFGE+GNKYFRHATGQLYAISKDLA+YIS NQ+VLHKYANEDVSLG+WFIGLDV H+D
Sbjct  290  FWKFGESGNKYFRHATGQLYAISKDLASYISINQNVLHKYANEDVSLGSWFIGLDVEHID  349

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDW+CSGICR+ DRIKEVHRRCGEGE  LW +AF
Sbjct  350  DRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSADRIKEVHRRCGEGENALWRSAF  408



>gb|KFK42855.1| hypothetical protein AALP_AA1G047700 [Arabis alpina]
Length=408

 Score =   350 bits (899),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TA  +WDA++Y+KVDDDVHVNI TLGETL RHRKKPRVYIGCMKSGPVL QKGVRYHEPE
Sbjct  230  TAFSMWDADFYVKVDDDVHVNIATLGETLVRHRKKPRVYIGCMKSGPVLYQKGVRYHEPE  289

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQ+YAIS+DLA+YIS NQHVLHKYANEDVSLGAWFIG+DV H+D
Sbjct  290  YWKFGENGNKYFRHATGQIYAISRDLASYISINQHVLHKYANEDVSLGAWFIGIDVKHID  349

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR+ DRIKEVHRRCGEGE  LW+A F
Sbjct  350  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRSADRIKEVHRRCGEGENALWSATF  408



>ref|XP_011048789.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Populus euphratica]
Length=405

 Score =   350 bits (898),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDA++Y+KVDDDVHVNI TLGETL RHRKKPRVYIGCMKSGPVL+QKGVRYHEPE
Sbjct  227  TAVTLWDADFYVKVDDDVHVNIATLGETLVRHRKKPRVYIGCMKSGPVLNQKGVRYHEPE  286

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAISKDLA YIS NQHVLHK+ANEDVSLG+WFIGLD  H+D
Sbjct  287  YWKFGEAGNKYFRHATGQLYAISKDLAKYISINQHVLHKFANEDVSLGSWFIGLDAEHID  346

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDW+CSGICR+ DRIKEVHRRCGEGE  LW+A F
Sbjct  347  DRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSADRIKEVHRRCGEGENALWSATF  405



>ref|XP_004487414.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Cicer 
arietinum]
Length=408

 Score =   350 bits (898),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDA++YIKVDDDVHVNI TLGETL RHR KPRVYIGCMKSGPVLSQKGVRYHEPE
Sbjct  230  TAVNLWDADFYIKVDDDVHVNIATLGETLVRHRSKPRVYIGCMKSGPVLSQKGVRYHEPE  289

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            +WKFGE GNKYFRHATGQLYAISKDLA YIS N+HVLHKYANEDVSLGAWFIGLDV H+D
Sbjct  290  HWKFGENGNKYFRHATGQLYAISKDLAAYISTNKHVLHKYANEDVSLGAWFIGLDVDHID  349

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGN+CVASFDWTCSGICR+ +RIKEVH++CGEGEK LW+A+F
Sbjct  350  DRRLCCGTPPDCEWKAQAGNVCVASFDWTCSGICRSAERIKEVHKKCGEGEKALWSASF  408



>ref|XP_010104592.1| putative beta-1,3-galactosyltransferase 2 [Morus notabilis]
 gb|EXC01255.1| putative beta-1,3-galactosyltransferase 2 [Morus notabilis]
Length=420

 Score =   350 bits (899),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDA++Y+KVDDDVHVNIGTLGETL RHR KPRVYIGCMKSGPVLSQKGVRYHEPE
Sbjct  242  TAVALWDADFYVKVDDDVHVNIGTLGETLNRHRLKPRVYIGCMKSGPVLSQKGVRYHEPE  301

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAIS DLATYIS NQHVLHKYANEDVSLG+WFIGLD  H+D
Sbjct  302  YWKFGEAGNKYFRHATGQLYAISNDLATYISINQHVLHKYANEDVSLGSWFIGLDAEHID  361

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDW+CSGICR+ DRIKEVHRRCGEGE  LW+++F
Sbjct  362  DRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSADRIKEVHRRCGEGENALWSSSF  420



>ref|XP_011048788.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Populus euphratica]
Length=408

 Score =   350 bits (898),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDA++Y+KVDDDVHVNI TLGETL RHRKKPRVYIGCMKSGPVL+QKGVRYHEPE
Sbjct  230  TAVTLWDADFYVKVDDDVHVNIATLGETLVRHRKKPRVYIGCMKSGPVLNQKGVRYHEPE  289

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAISKDLA YIS NQHVLHK+ANEDVSLG+WFIGLD  H+D
Sbjct  290  YWKFGEAGNKYFRHATGQLYAISKDLAKYISINQHVLHKFANEDVSLGSWFIGLDAEHID  349

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDW+CSGICR+ DRIKEVHRRCGEGE  LW+A F
Sbjct  350  DRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSADRIKEVHRRCGEGENALWSATF  408



>ref|XP_002302876.1| hypothetical protein POPTR_0002s21280g [Populus trichocarpa]
 gb|EEE82149.1| hypothetical protein POPTR_0002s21280g [Populus trichocarpa]
Length=405

 Score =   350 bits (897),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDA++Y+KVDDDVHVNI TLGETL RHRKKPRVYIGCMKSGPVL+QKGVRYHEPE
Sbjct  227  TAVTLWDADFYVKVDDDVHVNIATLGETLVRHRKKPRVYIGCMKSGPVLNQKGVRYHEPE  286

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAISKDLA YIS NQHVLHK+ANEDVSLG+WFIGLD  H+D
Sbjct  287  YWKFGEAGNKYFRHATGQLYAISKDLAKYISINQHVLHKFANEDVSLGSWFIGLDAEHID  346

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDW+CSGICR+ DRIKEVHRRCGEGE  LW+A F
Sbjct  347  DRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSADRIKEVHRRCGEGENALWSATF  405



>ref|XP_010276120.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Nelumbo 
nucifera]
Length=404

 Score =   350 bits (897),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDA++YIKVDDDVHVNI TLG TLARHR KPRVYIGCMKSGPVL+QKGVRYHEPE
Sbjct  226  TAVALWDADFYIKVDDDVHVNIATLGMTLARHRSKPRVYIGCMKSGPVLAQKGVRYHEPE  285

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAISKDLATYIS NQHVLHKYANEDVSLGAWFIG+DV H+D
Sbjct  286  YWKFGEQGNKYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLGAWFIGVDVEHID  345

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGN+C ASFDW+CSGICR+ +RIKEVH+RCGEGEK LW+A F
Sbjct  346  DRRLCCGTPPDCEWKAQAGNVCAASFDWSCSGICRSAERIKEVHQRCGEGEKALWSAVF  404



>ref|XP_009624798.1| PREDICTED: probable beta-1,3-galactosyltransferase 3 isoform 
X3 [Nicotiana tomentosiformis]
Length=365

 Score =   348 bits (893),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 160/179 (89%), Positives = 167/179 (93%), Gaps = 3/179 (2%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDAEYYIKVDDDVHVNI TLGETLARHRKKPR+YIGCMKSGPVLS+KGVRYHEPE
Sbjct  190  TAVNLWDAEYYIKVDDDVHVNIATLGETLARHRKKPRIYIGCMKSGPVLSRKGVRYHEPE  249

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFG   +KYFRHATGQ+YAISKDLA+YIS NQHVLHKY NEDVSLGAWFIGLDV H+D
Sbjct  250  YWKFG---DKYFRHATGQIYAISKDLASYISVNQHVLHKYTNEDVSLGAWFIGLDVQHID  306

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR+VDRIKEVHR CGEGE  LW AAF
Sbjct  307  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRSVDRIKEVHRHCGEGENALWKAAF  365



>ref|XP_006475058.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X3 [Citrus sinensis]
 ref|XP_006475059.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X4 [Citrus sinensis]
 gb|KDO62742.1| hypothetical protein CISIN_1g015419mg [Citrus sinensis]
Length=367

 Score =   348 bits (893),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 154/179 (86%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDA++Y+KVDDDVHVNI TLG TLARHR KPRVYIGCMKSGPVL+QKGVRYHEPE
Sbjct  189  TAVALWDADFYVKVDDDVHVNIATLGATLARHRSKPRVYIGCMKSGPVLAQKGVRYHEPE  248

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAISKDLA+YIS NQHVLHK+ANEDVSLG+WFIGLD  H+D
Sbjct  249  YWKFGEEGNKYFRHATGQLYAISKDLASYISINQHVLHKFANEDVSLGSWFIGLDAEHID  308

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGN+CVASFDW+CSGICR+ +R+KEVHRRCGEGE  LW+AAF
Sbjct  309  DRRLCCGTPPDCEWKAQAGNVCVASFDWSCSGICRSAERMKEVHRRCGEGENALWSAAF  367



>gb|KGN63249.1| hypothetical protein Csa_2G418850 [Cucumis sativus]
Length=409

 Score =   350 bits (897),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDA++Y+KVDDDVHVNIGTLGETLARHR KPRVYIGCMKSGPVLSQ+GVRYHEPE
Sbjct  231  TAVSLWDADFYVKVDDDVHVNIGTLGETLARHRSKPRVYIGCMKSGPVLSQRGVRYHEPE  290

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            +WKFGE GNKYFRHATGQLYAIS DLATYIS NQH+LHKYANEDVSLG+W IGLDV H+D
Sbjct  291  HWKFGEAGNKYFRHATGQLYAISNDLATYISINQHILHKYANEDVSLGSWIIGLDVEHID  350

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNIC+ASFDW+CSGIC++ +RIKEVHRRCGEGE VLW+A F
Sbjct  351  DRRLCCGTPPDCEWKAQAGNICIASFDWSCSGICKSAERIKEVHRRCGEGENVLWSATF  409



>emb|CDY12206.1| BnaC04g12360D [Brassica napus]
Length=409

 Score =   350 bits (897),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TA  +WDA++Y+KVDDDVHVNI TLGETL RHRKKPRVYIGCMKSGPVLSQKGVRYHEPE
Sbjct  231  TAFSMWDADFYVKVDDDVHVNIATLGETLVRHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  290

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAIS+DLA+Y+S NQHVLHKYANEDV+LGAWFIGLDV H+D
Sbjct  291  YWKFGENGNKYFRHATGQLYAISRDLASYVSINQHVLHKYANEDVTLGAWFIGLDVTHID  350

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR+ DRIKEVHRRCGE EK +W A F
Sbjct  351  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRSADRIKEVHRRCGEPEKAIWKATF  409



>ref|XP_004151891.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Cucumis 
sativus]
Length=408

 Score =   350 bits (897),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDA++Y+KVDDDVHVNIGTLGETLARHR KPRVYIGCMKSGPVLSQ+GVRYHEPE
Sbjct  230  TAVSLWDADFYVKVDDDVHVNIGTLGETLARHRSKPRVYIGCMKSGPVLSQRGVRYHEPE  289

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            +WKFGE GNKYFRHATGQLYAIS DLATYIS NQH+LHKYANEDVSLG+W IGLDV H+D
Sbjct  290  HWKFGEAGNKYFRHATGQLYAISNDLATYISINQHILHKYANEDVSLGSWIIGLDVEHID  349

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNIC+ASFDW+CSGIC++ +RIKEVHRRCGEGE VLW+A F
Sbjct  350  DRRLCCGTPPDCEWKAQAGNICIASFDWSCSGICKSAERIKEVHRRCGEGENVLWSATF  408



>ref|XP_009361001.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Pyrus x bretschneideri]
Length=365

 Score =   348 bits (893),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV  WDA++Y+KVDDDVHVNIGTLG TLARHR KPRVYIGCMKSGPVL+QKGVRYHEPE
Sbjct  187  TAVASWDADFYVKVDDDVHVNIGTLGATLARHRPKPRVYIGCMKSGPVLAQKGVRYHEPE  246

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAISKDLATYIS NQHVLHKY NEDVSLG+WFIGLDV  VD
Sbjct  247  YWKFGEEGNKYFRHATGQLYAISKDLATYISINQHVLHKYVNEDVSLGSWFIGLDVEQVD  306

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGN+CVASFDW+CSGIC++ +RIKEVHRRCGEGE  LWNAAF
Sbjct  307  DRRLCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSSERIKEVHRRCGEGENALWNAAF  365



>ref|XP_004172360.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Cucumis 
sativus]
Length=408

 Score =   349 bits (896),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDA++Y+KVDDDVHVNIGTLGETLARHR KPRVYIGCMKSGPVLSQ+GVRYHEPE
Sbjct  230  TAVSLWDADFYVKVDDDVHVNIGTLGETLARHRSKPRVYIGCMKSGPVLSQRGVRYHEPE  289

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            +WKFGE GNKYFRHATGQLYAIS DLATYIS NQH+LHKYANEDVSLG+W IGLDV H+D
Sbjct  290  HWKFGEAGNKYFRHATGQLYAISNDLATYISINQHILHKYANEDVSLGSWIIGLDVEHID  349

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNIC+ASFDW+CSGIC++ +RIKEVHRRCGEGE VLW+A F
Sbjct  350  DRRLCCGTPPDCEWKAQAGNICIASFDWSCSGICKSAERIKEVHRRCGEGENVLWSATF  408



>ref|XP_009774309.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Nicotiana 
sylvestris]
Length=409

 Score =   349 bits (896),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDA++Y+KVDDDVHVNIG LG TLARHR KPRVYIGCMKSGPVL+QKGVRYHEPE
Sbjct  231  TAVALWDADFYVKVDDDVHVNIGALGATLARHRSKPRVYIGCMKSGPVLAQKGVRYHEPE  290

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            +WKFGE GN+YFRHATGQLYAISKDLATYIS NQHVLHKY NEDVSLG+W IGLDV H+D
Sbjct  291  HWKFGEDGNRYFRHATGQLYAISKDLATYISINQHVLHKYVNEDVSLGSWLIGLDVEHID  350

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDW+CSGICR+VDRIKEVHRRCGEGE  LWNA F
Sbjct  351  DRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSVDRIKEVHRRCGEGENALWNAVF  409



>ref|XP_008455884.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Cucumis 
melo]
Length=408

 Score =   349 bits (896),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDA++Y+KVDDDVHVNIGTLGETLARHR KPRVYIGCMKSGPVLSQ+GVRYHEPE
Sbjct  230  TAVSLWDADFYVKVDDDVHVNIGTLGETLARHRSKPRVYIGCMKSGPVLSQRGVRYHEPE  289

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            +WKFGE GNKYFRHATGQLYAIS DLATYIS NQH+LHKYANEDVSLG+W IGLDV H+D
Sbjct  290  HWKFGEAGNKYFRHATGQLYAISNDLATYISINQHILHKYANEDVSLGSWIIGLDVEHID  349

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNIC+ASFDW+CSGIC++ +RIKEVHRRCGEGE VLW+A F
Sbjct  350  DRRLCCGTPPDCEWKAQAGNICIASFDWSCSGICKSAERIKEVHRRCGEGENVLWSATF  408



>gb|KDP39142.1| hypothetical protein JCGZ_00899 [Jatropha curcas]
Length=404

 Score =   349 bits (895),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDA++Y+KVDDDVHVNI TLG TLARHR KPRVYIGCMKSGPVL+QKGV+YHEPE
Sbjct  226  TAVALWDADFYVKVDDDVHVNIATLGATLARHRSKPRVYIGCMKSGPVLAQKGVKYHEPE  285

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAIS DLATY+S NQHVLHKYANEDVSLG+WFIGLDV H+D
Sbjct  286  YWKFGEEGNKYFRHATGQLYAISNDLATYVSINQHVLHKYANEDVSLGSWFIGLDVDHID  345

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDW+CSGIC++VDRIKEVHRRCGEGE  LW+A F
Sbjct  346  DRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICKSVDRIKEVHRRCGEGENALWSAEF  404



>ref|XP_009397181.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Musa acuminata 
subsp. malaccensis]
Length=405

 Score =   349 bits (895),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV +WDA++YIKVDDDVHVNI TLG TLA+HR KPRVYIGCMKSGPVL+QKGVRYHEPE
Sbjct  227  TAVSMWDADFYIKVDDDVHVNIATLGATLAKHRSKPRVYIGCMKSGPVLAQKGVRYHEPE  286

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLG+WFIGLDV H+D
Sbjct  287  YWKFGEEGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGSWFIGLDVEHID  346

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDW+CSGIC + +RIKEVHRRCGEGEK +W A F
Sbjct  347  DRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICNSAERIKEVHRRCGEGEKTVWKAVF  405



>ref|XP_009610750.1| PREDICTED: probable beta-1,3-galactosyltransferase 4 [Nicotiana 
tomentosiformis]
Length=409

 Score =   349 bits (896),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDA++Y+KVDDDVHVNIG LG TLARHR KPRVYIGCMKSGPVL+QKGVRYHEPE
Sbjct  231  TAVALWDADFYVKVDDDVHVNIGALGATLARHRSKPRVYIGCMKSGPVLAQKGVRYHEPE  290

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            +WKFGE GN+YFRHATGQLYAISKDLATYIS NQHVLHKY NEDVSLG+W IGLDV H+D
Sbjct  291  HWKFGEDGNRYFRHATGQLYAISKDLATYISINQHVLHKYVNEDVSLGSWLIGLDVEHID  350

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDW+CSGICR+VDRIKEVHRRCGEGE  LWNA F
Sbjct  351  DRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSVDRIKEVHRRCGEGENALWNAVF  409



>ref|XP_009143989.1| PREDICTED: probable beta-1,3-galactosyltransferase 3 isoform 
X2 [Brassica rapa]
Length=406

 Score =   349 bits (895),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TA  +WDA++YIKVDDDVHVNI TLGETL RHRKKPRVYIGCMKSGPVLSQKGVRYHEPE
Sbjct  228  TAFSMWDADFYIKVDDDVHVNIATLGETLVRHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  287

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAIS+DLA+YIS NQHVLHKYANEDV+LGAWFIGLDV H+D
Sbjct  288  YWKFGENGNKYFRHATGQLYAISRDLASYISINQHVLHKYANEDVTLGAWFIGLDVTHID  347

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR+ DRIKEVHRRCGE E  +W A F
Sbjct  348  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRSADRIKEVHRRCGEPENAIWKATF  406



>ref|XP_009624796.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Nicotiana tomentosiformis]
Length=404

 Score =   349 bits (895),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 160/179 (89%), Positives = 167/179 (93%), Gaps = 3/179 (2%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDAEYYIKVDDDVHVNI TLGETLARHRKKPR+YIGCMKSGPVLS+KGVRYHEPE
Sbjct  229  TAVNLWDAEYYIKVDDDVHVNIATLGETLARHRKKPRIYIGCMKSGPVLSRKGVRYHEPE  288

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFG   +KYFRHATGQ+YAISKDLA+YIS NQHVLHKY NEDVSLGAWFIGLDV H+D
Sbjct  289  YWKFG---DKYFRHATGQIYAISKDLASYISVNQHVLHKYTNEDVSLGAWFIGLDVQHID  345

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR+VDRIKEVHR CGEGE  LW AAF
Sbjct  346  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRSVDRIKEVHRHCGEGENALWKAAF  404



>emb|CDY48266.1| BnaA05g10880D [Brassica napus]
Length=409

 Score =   349 bits (895),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TA  +WDA++YIKVDDDVHVNI TLGETL RHRKKPRVYIGCMKSGPVLSQKGVRYHEPE
Sbjct  231  TAFSMWDADFYIKVDDDVHVNIATLGETLVRHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  290

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAIS+DLA+YIS NQHVLHKYANEDV+LGAWFIGLDV H+D
Sbjct  291  YWKFGENGNKYFRHATGQLYAISRDLASYISINQHVLHKYANEDVTLGAWFIGLDVTHID  350

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR+ DRIKEVHRRCGE E  +W A F
Sbjct  351  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRSADRIKEVHRRCGEPENAIWKATF  409



>ref|XP_009143988.1| PREDICTED: probable beta-1,3-galactosyltransferase 3 isoform 
X1 [Brassica rapa]
Length=409

 Score =   349 bits (895),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TA  +WDA++YIKVDDDVHVNI TLGETL RHRKKPRVYIGCMKSGPVLSQKGVRYHEPE
Sbjct  231  TAFSMWDADFYIKVDDDVHVNIATLGETLVRHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  290

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAIS+DLA+YIS NQHVLHKYANEDV+LGAWFIGLDV H+D
Sbjct  291  YWKFGENGNKYFRHATGQLYAISRDLASYISINQHVLHKYANEDVTLGAWFIGLDVTHID  350

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR+ DRIKEVHRRCGE E  +W A F
Sbjct  351  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRSADRIKEVHRRCGEPENAIWKATF  409



>ref|XP_009624797.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Nicotiana tomentosiformis]
Length=402

 Score =   348 bits (894),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 160/179 (89%), Positives = 167/179 (93%), Gaps = 3/179 (2%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDAEYYIKVDDDVHVNI TLGETLARHRKKPR+YIGCMKSGPVLS+KGVRYHEPE
Sbjct  227  TAVNLWDAEYYIKVDDDVHVNIATLGETLARHRKKPRIYIGCMKSGPVLSRKGVRYHEPE  286

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFG   +KYFRHATGQ+YAISKDLA+YIS NQHVLHKY NEDVSLGAWFIGLDV H+D
Sbjct  287  YWKFG---DKYFRHATGQIYAISKDLASYISVNQHVLHKYTNEDVSLGAWFIGLDVQHID  343

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR+VDRIKEVHR CGEGE  LW AAF
Sbjct  344  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRSVDRIKEVHRHCGEGENALWKAAF  402



>ref|XP_011463344.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Fragaria vesca subsp. vesca]
Length=404

 Score =   348 bits (894),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV  WDA++Y+KVDDDVHVNI TLGETL RHRKK R+YIGCMKSGPVL+QKGVRYHEPE
Sbjct  226  TAVATWDADFYVKVDDDVHVNIATLGETLVRHRKKSRLYIGCMKSGPVLAQKGVRYHEPE  285

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAISKDLATYIS NQHVLHKYANEDVSLGAWFIGLDV H+D
Sbjct  286  YWKFGEPGNKYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLGAWFIGLDVEHID  345

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGN+CVASFDW+CSGICR+ +RIKEVHRRCGEGE  LW+A+F
Sbjct  346  DRRLCCGTPPDCEWKAQAGNVCVASFDWSCSGICRSAERIKEVHRRCGEGENALWSASF  404



>ref|XP_007149975.1| hypothetical protein PHAVU_005G115300g [Phaseolus vulgaris]
 gb|ESW21969.1| hypothetical protein PHAVU_005G115300g [Phaseolus vulgaris]
Length=407

 Score =   348 bits (894),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 169/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDA++YIKVDDDVHVNI TLG+TL RHR K RVYIGCMKSGPVLSQKGVRYHEPE
Sbjct  229  TAVNLWDADFYIKVDDDVHVNIATLGQTLVRHRSKQRVYIGCMKSGPVLSQKGVRYHEPE  288

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAISKDLATYIS N+HVLHKYANEDVSLG+WFIGLDV H+D
Sbjct  289  YWKFGEAGNKYFRHATGQLYAISKDLATYISNNKHVLHKYANEDVSLGSWFIGLDVDHID  348

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGN+CVASFDWTCSGICR+ +RIKEVH+RCGEGEK LW+A+F
Sbjct  349  DRRLCCGTPPDCEWKAQAGNVCVASFDWTCSGICRSAERIKEVHKRCGEGEKALWSASF  407



>ref|XP_004287949.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Fragaria vesca subsp. vesca]
Length=407

 Score =   348 bits (894),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV  WDA++Y+KVDDDVHVNI TLGETL RHRKK R+YIGCMKSGPVL+QKGVRYHEPE
Sbjct  229  TAVATWDADFYVKVDDDVHVNIATLGETLVRHRKKSRLYIGCMKSGPVLAQKGVRYHEPE  288

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAISKDLATYIS NQHVLHKYANEDVSLGAWFIGLDV H+D
Sbjct  289  YWKFGEPGNKYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLGAWFIGLDVEHID  348

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGN+CVASFDW+CSGICR+ +RIKEVHRRCGEGE  LW+A+F
Sbjct  349  DRRLCCGTPPDCEWKAQAGNVCVASFDWSCSGICRSAERIKEVHRRCGEGENALWSASF  407



>ref|XP_003527496.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Glycine 
max]
 gb|KHN41227.1| Putative beta-1,3-galactosyltransferase 2 [Glycine soja]
Length=407

 Score =   348 bits (894),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 154/179 (86%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDA++Y+KVDDDVHVNI TLG+TL RHR KPR+YIGCMKSGPVLSQKGVRYHEPE
Sbjct  229  TAVNLWDADFYVKVDDDVHVNIATLGQTLVRHRSKPRIYIGCMKSGPVLSQKGVRYHEPE  288

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GN+YFRHATGQLYAIS DLATYIS NQ+VLHKYANEDVSLG+WFIGLDV H+D
Sbjct  289  YWKFGEAGNRYFRHATGQLYAISNDLATYISINQNVLHKYANEDVSLGSWFIGLDVEHID  348

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDW+CSGICR+ +RIKEVHRRCGEGE  LW+A+F
Sbjct  349  DRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSAERIKEVHRRCGEGENALWSASF  407



>ref|XP_006346208.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Solanum 
tuberosum]
Length=408

 Score =   348 bits (893),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDA++YIKVDDDVHVNIG LG TLARH  KPRVYIGCMKSGPVL+QKGVRYHEPE
Sbjct  230  TAVALWDADFYIKVDDDVHVNIGALGATLARHHSKPRVYIGCMKSGPVLAQKGVRYHEPE  289

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            +WKFGE GN+YFRHATGQLYAISKDLATYIS NQHVLHKY NEDVSLG+W IGLDV H+D
Sbjct  290  HWKFGEDGNRYFRHATGQLYAISKDLATYISLNQHVLHKYVNEDVSLGSWLIGLDVEHID  349

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDW+CSGICR+VDRIKEVHRRCGEGE  LWNA+F
Sbjct  350  DRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSVDRIKEVHRRCGEGENALWNASF  408



>ref|XP_006855892.1| hypothetical protein AMTR_s00037p00154410 [Amborella trichopoda]
 gb|ERN17359.1| hypothetical protein AMTR_s00037p00154410 [Amborella trichopoda]
Length=405

 Score =   348 bits (893),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDA++YIKVDDDVHVNI TLG TL RHR KPRVYIGCMKSGPVL+QKGVRYHEPE
Sbjct  227  TAVSLWDADFYIKVDDDVHVNIATLGTTLVRHRAKPRVYIGCMKSGPVLAQKGVRYHEPE  286

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAISKDLATYIS NQHVLHKYANEDVSLGAWFIGLDV H+D
Sbjct  287  YWKFGEEGNKYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLGAWFIGLDVEHID  346

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDW+CSGIC++ +RIKEVH+RCGEGE  LW+A F
Sbjct  347  DRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICKSAERIKEVHQRCGEGEHALWSAVF  405



>ref|XP_010469587.1| PREDICTED: probable beta-1,3-galactosyltransferase 3 isoform 
X2 [Camelina sativa]
Length=405

 Score =   348 bits (892),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV +WDAE+Y+KVDDDVHVNI TLGETL RHRKKPR+YIGCMKSGPVLSQKGVRYHEPE
Sbjct  227  TAVSMWDAEFYVKVDDDVHVNIATLGETLVRHRKKPRLYIGCMKSGPVLSQKGVRYHEPE  286

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAIS+DLA+YIS NQ VLHKYANEDV+LGAWFIGLDV H+D
Sbjct  287  YWKFGENGNKYFRHATGQLYAISRDLASYISLNQRVLHKYANEDVTLGAWFIGLDVTHID  346

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR+ DRIKEVH+RCGE E  +W A+F
Sbjct  347  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRSADRIKEVHKRCGEPENAIWKASF  405



>ref|XP_007132543.1| hypothetical protein PHAVU_011G103400g [Phaseolus vulgaris]
 gb|ESW04537.1| hypothetical protein PHAVU_011G103400g [Phaseolus vulgaris]
Length=406

 Score =   348 bits (892),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDA++Y+KVDDDVHVNI TLGETL RHR KPR+YIGCMKSGPVLSQKGVRYHEPE
Sbjct  228  TAVNLWDADFYVKVDDDVHVNIATLGETLVRHRSKPRIYIGCMKSGPVLSQKGVRYHEPE  287

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAIS DLATYIS NQ VLHKYANEDVSLG+WFIGLD  H+D
Sbjct  288  YWKFGEAGNKYFRHATGQLYAISNDLATYISINQDVLHKYANEDVSLGSWFIGLDAEHID  347

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDW+CSGICR+ +RIKEVHRRCGEGE  LW+A+F
Sbjct  348  DRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSAERIKEVHRRCGEGENALWSASF  406



>ref|XP_010469586.1| PREDICTED: probable beta-1,3-galactosyltransferase 3 isoform 
X1 [Camelina sativa]
Length=408

 Score =   348 bits (892),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV +WDAE+Y+KVDDDVHVNI TLGETL RHRKKPR+YIGCMKSGPVLSQKGVRYHEPE
Sbjct  230  TAVSMWDAEFYVKVDDDVHVNIATLGETLVRHRKKPRLYIGCMKSGPVLSQKGVRYHEPE  289

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAIS+DLA+YIS NQ VLHKYANEDV+LGAWFIGLDV H+D
Sbjct  290  YWKFGENGNKYFRHATGQLYAISRDLASYISLNQRVLHKYANEDVTLGAWFIGLDVTHID  349

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR+ DRIKEVH+RCGE E  +W A+F
Sbjct  350  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRSADRIKEVHKRCGEPENAIWKASF  408



>emb|CAN63417.1| hypothetical protein VITISV_007689 [Vitis vinifera]
Length=373

 Score =   347 bits (889),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV +WDA++Y+KVDDDVHVNI TLG TLARHR KPR+YIGCMKSGPVL+QKGVRYHEPE
Sbjct  195  TAVAMWDADFYVKVDDDVHVNIATLGATLARHRSKPRIYIGCMKSGPVLAQKGVRYHEPE  254

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAISKDLATYIS NQHVLHKYANEDVSLG+WFIGLD  H+D
Sbjct  255  YWKFGEEGNKYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLGSWFIGLDAEHID  314

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDW+CSGICR+ +RI+EVHRRCGEGE  +W+A F
Sbjct  315  DRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSSERIREVHRRCGEGENAVWSAVF  373



>gb|KEH29683.1| beta-1,3-galactosyltransferase-like protein [Medicago truncatula]
Length=407

 Score =   348 bits (892),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDA++Y+KVDDDVHVNI TLGETL RHR K R+YIGCMKSGPVLSQKGVRYHEPE
Sbjct  229  TAVSLWDADFYVKVDDDVHVNIATLGETLVRHRSKQRIYIGCMKSGPVLSQKGVRYHEPE  288

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            +WKFGE+GNKYFRHATGQLYAIS DLATYIS NQ+VLHKYANEDVS+GAWFIGLDV H+D
Sbjct  289  HWKFGESGNKYFRHATGQLYAISNDLATYISTNQNVLHKYANEDVSIGAWFIGLDVEHID  348

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDW+CSGICR+ DRIKEVHRRCGEGE  LW+A+F
Sbjct  349  DRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSADRIKEVHRRCGEGENALWSASF  407



>ref|XP_007215471.1| hypothetical protein PRUPE_ppa006530mg [Prunus persica]
 gb|EMJ16670.1| hypothetical protein PRUPE_ppa006530mg [Prunus persica]
Length=407

 Score =   348 bits (892),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV  WDA++Y+KVDDDVHVNI TLG TL RHRKK R+YIGCMKSGPVL+QKGVRYHEPE
Sbjct  229  TAVATWDADFYVKVDDDVHVNIATLGGTLVRHRKKQRLYIGCMKSGPVLAQKGVRYHEPE  288

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAISKDLATYIS NQHVLHKYANEDVSLGAWFIGLDV H+D
Sbjct  289  YWKFGEPGNKYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLGAWFIGLDVQHID  348

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDW+CSGICR+ DRIKEVHRRCGEGE  LW+A+F
Sbjct  349  DRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSADRIKEVHRRCGEGENALWSASF  407



>gb|EYU27344.1| hypothetical protein MIMGU_mgv1a007546mg [Erythranthe guttata]
Length=404

 Score =   348 bits (892),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV+LWDA++Y+KVDDDVHVNI TLG TLARHR K RVYIGCMKSGPVL+QKGVRYHEPE
Sbjct  226  TAVQLWDADFYVKVDDDVHVNIATLGATLARHRSKERVYIGCMKSGPVLAQKGVRYHEPE  285

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAIS+DLATYIS NQH LHKYANEDVSLGAWFIGLDV H+D
Sbjct  286  YWKFGEQGNKYFRHATGQLYAISRDLATYISKNQHFLHKYANEDVSLGAWFIGLDVEHID  345

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGN+CVASFDW+CSGIC + DRIKEVHRRCGEGE  LWN AF
Sbjct  346  DRRLCCGTPPDCEWKAQAGNVCVASFDWSCSGICNSADRIKEVHRRCGEGEHTLWNTAF  404



>ref|XP_008229956.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Prunus 
mume]
Length=407

 Score =   348 bits (892),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV  WDA++Y+KVDDDVHVNI TLGETL RHRKK R+YIGCMKSGPVL+QKGVRYHEPE
Sbjct  229  TAVATWDADFYVKVDDDVHVNIATLGETLVRHRKKQRLYIGCMKSGPVLAQKGVRYHEPE  288

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAISKDLATYIS NQHVLH+YANEDVSLGAWFIGLDV H+D
Sbjct  289  YWKFGEPGNKYFRHATGQLYAISKDLATYISINQHVLHRYANEDVSLGAWFIGLDVQHID  348

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDW+CSGICR+ +RIKEVHRRCGEGE  LW+A+F
Sbjct  349  DRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSAERIKEVHRRCGEGENALWSASF  407



>ref|XP_007215470.1| hypothetical protein PRUPE_ppa006530mg [Prunus persica]
 gb|EMJ16669.1| hypothetical protein PRUPE_ppa006530mg [Prunus persica]
Length=404

 Score =   347 bits (891),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV  WDA++Y+KVDDDVHVNI TLG TL RHRKK R+YIGCMKSGPVL+QKGVRYHEPE
Sbjct  226  TAVATWDADFYVKVDDDVHVNIATLGGTLVRHRKKQRLYIGCMKSGPVLAQKGVRYHEPE  285

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAISKDLATYIS NQHVLHKYANEDVSLGAWFIGLDV H+D
Sbjct  286  YWKFGEPGNKYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLGAWFIGLDVQHID  345

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDW+CSGICR+ DRIKEVHRRCGEGE  LW+A+F
Sbjct  346  DRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSADRIKEVHRRCGEGENALWSASF  404



>ref|XP_010278672.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Nelumbo nucifera]
Length=405

 Score =   347 bits (891),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDA++Y+KVDDDVHVNI TLG TLARHR KPRVYIGCMKSGPVL+QKGVRYHEPE
Sbjct  227  TAVALWDADFYVKVDDDVHVNIATLGTTLARHRSKPRVYIGCMKSGPVLAQKGVRYHEPE  286

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAISKDLATY+S NQHVLHKYANEDVSLGAWFIGLDV H+D
Sbjct  287  YWKFGEEGNKYFRHATGQLYAISKDLATYMSINQHVLHKYANEDVSLGAWFIGLDVEHID  346

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGN+CVASFDW+CSGIC++ +RIKEVH+RCGEGE  LW+A F
Sbjct  347  DRRLCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSAERIKEVHQRCGEGENALWSAVF  405



>ref|XP_006410375.1| hypothetical protein EUTSA_v10016736mg [Eutrema salsugineum]
 gb|ESQ51828.1| hypothetical protein EUTSA_v10016736mg [Eutrema salsugineum]
Length=408

 Score =   347 bits (891),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TA  +WDA++Y+KVDDDVHVNI TLGETL RHRKKPRVYIGCMKSGPVLSQKGVRYHEPE
Sbjct  230  TAFSMWDADFYVKVDDDVHVNIATLGETLVRHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  289

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAIS+DLA+YIS NQHVLHKYANEDV+LGAWFIGLDV H+D
Sbjct  290  YWKFGENGNKYFRHATGQLYAISRDLASYISTNQHVLHKYANEDVTLGAWFIGLDVTHID  349

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR+ DRIKEVH+RCGE E  +W A F
Sbjct  350  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRSADRIKEVHKRCGEPENAIWKATF  408



>ref|XP_009361000.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Pyrus x bretschneideri]
Length=403

 Score =   347 bits (890),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV  WDA++Y+KVDDDVHVNIGTLG TLARHR KPRVYIGCMKSGPVL+QKGVRYHEPE
Sbjct  225  TAVASWDADFYVKVDDDVHVNIGTLGATLARHRPKPRVYIGCMKSGPVLAQKGVRYHEPE  284

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAISKDLATYIS NQHVLHKY NEDVSLG+WFIGLDV  VD
Sbjct  285  YWKFGEEGNKYFRHATGQLYAISKDLATYISINQHVLHKYVNEDVSLGSWFIGLDVEQVD  344

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGN+CVASFDW+CSGIC++ +RIKEVHRRCGEGE  LWNAAF
Sbjct  345  DRRLCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSSERIKEVHRRCGEGENALWNAAF  403



>ref|XP_006475057.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X2 [Citrus sinensis]
 gb|KDO62741.1| hypothetical protein CISIN_1g015419mg [Citrus sinensis]
Length=406

 Score =   347 bits (890),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 154/179 (86%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDA++Y+KVDDDVHVNI TLG TLARHR KPRVYIGCMKSGPVL+QKGVRYHEPE
Sbjct  228  TAVALWDADFYVKVDDDVHVNIATLGATLARHRSKPRVYIGCMKSGPVLAQKGVRYHEPE  287

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAISKDLA+YIS NQHVLHK+ANEDVSLG+WFIGLD  H+D
Sbjct  288  YWKFGEEGNKYFRHATGQLYAISKDLASYISINQHVLHKFANEDVSLGSWFIGLDAEHID  347

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGN+CVASFDW+CSGICR+ +R+KEVHRRCGEGE  LW+AAF
Sbjct  348  DRRLCCGTPPDCEWKAQAGNVCVASFDWSCSGICRSAERMKEVHRRCGEGENALWSAAF  406



>ref|XP_004244109.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Solanum 
lycopersicum]
Length=408

 Score =   347 bits (890),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDA++YIKVDDDVHVNIG LG TLARH  KPRVYIGCMKSGPVL+QKGVRYHEPE
Sbjct  230  TAVALWDADFYIKVDDDVHVNIGALGATLARHHSKPRVYIGCMKSGPVLAQKGVRYHEPE  289

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            +WKFGE GNKYFRHATGQLYAISKDLATYIS NQHVLHKY NEDVSLG+W IGLDV H+D
Sbjct  290  HWKFGEDGNKYFRHATGQLYAISKDLATYISLNQHVLHKYVNEDVSLGSWLIGLDVEHID  349

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDW+CSGICR+VDRI EVHRRCGEGE  LWNA+F
Sbjct  350  DRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSVDRIMEVHRRCGEGENALWNASF  408



>ref|XP_006452382.1| hypothetical protein CICLE_v10008439mg [Citrus clementina]
 ref|XP_006475056.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X1 [Citrus sinensis]
 gb|ESR65622.1| hypothetical protein CICLE_v10008439mg [Citrus clementina]
 gb|KDO62740.1| hypothetical protein CISIN_1g015419mg [Citrus sinensis]
Length=407

 Score =   347 bits (890),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 154/179 (86%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDA++Y+KVDDDVHVNI TLG TLARHR KPRVYIGCMKSGPVL+QKGVRYHEPE
Sbjct  229  TAVALWDADFYVKVDDDVHVNIATLGATLARHRSKPRVYIGCMKSGPVLAQKGVRYHEPE  288

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAISKDLA+YIS NQHVLHK+ANEDVSLG+WFIGLD  H+D
Sbjct  289  YWKFGEEGNKYFRHATGQLYAISKDLASYISINQHVLHKFANEDVSLGSWFIGLDAEHID  348

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGN+CVASFDW+CSGICR+ +R+KEVHRRCGEGE  LW+AAF
Sbjct  349  DRRLCCGTPPDCEWKAQAGNVCVASFDWSCSGICRSAERMKEVHRRCGEGENALWSAAF  407



>ref|XP_009119197.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Brassica rapa]
Length=411

 Score =   347 bits (890),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 154/179 (86%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TA  +WDA++Y+KVDDDVHVNI TLGETL RHRKKPRVYIGCMKSGPVL QKGVRYHEPE
Sbjct  233  TAFSMWDADFYVKVDDDVHVNIATLGETLVRHRKKPRVYIGCMKSGPVLYQKGVRYHEPE  292

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQ+YAIS+DLA+YIS NQHVLHKYANEDVSLGAWFIG+DV H+D
Sbjct  293  YWKFGENGNKYFRHATGQIYAISRDLASYISINQHVLHKYANEDVSLGAWFIGIDVKHID  352

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR+ DR+KEVHRRC EGE  LW+A F
Sbjct  353  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRSADRLKEVHRRCSEGENALWSATF  411



>ref|XP_010413995.1| PREDICTED: probable beta-1,3-galactosyltransferase 3 isoform 
X1 [Camelina sativa]
Length=408

 Score =   347 bits (890),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV +WDAE+Y+KVDDDVHVNI TLGETL RHRKKPR+YIGCMKSGPVLSQKGVRYHEPE
Sbjct  230  TAVSMWDAEFYVKVDDDVHVNIATLGETLVRHRKKPRLYIGCMKSGPVLSQKGVRYHEPE  289

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAIS+DLA+YIS NQ VLHKYANEDV+LGAWFIGLDV H+D
Sbjct  290  YWKFGENGNKYFRHATGQLYAISRDLASYISLNQRVLHKYANEDVTLGAWFIGLDVTHID  349

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR+ DRIKEVH+RCGE E  +W A F
Sbjct  350  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRSADRIKEVHKRCGEPENAIWKARF  408



>ref|XP_010413996.1| PREDICTED: probable beta-1,3-galactosyltransferase 3 isoform 
X2 [Camelina sativa]
Length=405

 Score =   347 bits (889),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV +WDAE+Y+KVDDDVHVNI TLGETL RHRKKPR+YIGCMKSGPVLSQKGVRYHEPE
Sbjct  227  TAVSMWDAEFYVKVDDDVHVNIATLGETLVRHRKKPRLYIGCMKSGPVLSQKGVRYHEPE  286

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAIS+DLA+YIS NQ VLHKYANEDV+LGAWFIGLDV H+D
Sbjct  287  YWKFGENGNKYFRHATGQLYAISRDLASYISLNQRVLHKYANEDVTLGAWFIGLDVTHID  346

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR+ DRIKEVH+RCGE E  +W A F
Sbjct  347  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRSADRIKEVHKRCGEPENAIWKARF  405



>ref|XP_010510018.1| PREDICTED: probable beta-1,3-galactosyltransferase 3 [Camelina 
sativa]
Length=408

 Score =   347 bits (889),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV +WDAE+Y+KVDDDVHVNI TLGETL RHRKKPR+YIGCMKSGPVLSQKGVRYHEPE
Sbjct  230  TAVSMWDAEFYVKVDDDVHVNIATLGETLVRHRKKPRLYIGCMKSGPVLSQKGVRYHEPE  289

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAIS+DLA+YIS NQ VLHKYANEDV+LGAWFIGLDV H+D
Sbjct  290  YWKFGENGNKYFRHATGQLYAISRDLASYISLNQRVLHKYANEDVTLGAWFIGLDVTHID  349

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR+ DRIKEVH+RCGE E  +W A F
Sbjct  350  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRSADRIKEVHKRCGEPENAIWKARF  408



>ref|XP_009398227.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Musa acuminata 
subsp. malaccensis]
Length=413

 Score =   347 bits (890),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV +WDA++YIKVDDDVHVNI TLG TLA+HR KPRVYIGCMKSGPVL+QKGVRYHEPE
Sbjct  235  TAVSMWDADFYIKVDDDVHVNIATLGATLAKHRSKPRVYIGCMKSGPVLAQKGVRYHEPE  294

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAISKDLATYIS NQHVLHKYANEDVSLG+WFIGLDV H+D
Sbjct  295  YWKFGEEGNKYFRHATGQLYAISKDLATYISMNQHVLHKYANEDVSLGSWFIGLDVEHID  354

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDW+CSGIC + +RIKEVHRRCGEG+  L NA F
Sbjct  355  DRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICNSAERIKEVHRRCGEGKNALLNAVF  413



>ref|XP_010046417.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Eucalyptus 
grandis]
 gb|KCW88779.1| hypothetical protein EUGRSUZ_A01123 [Eucalyptus grandis]
 gb|KCW88780.1| hypothetical protein EUGRSUZ_A01123 [Eucalyptus grandis]
Length=407

 Score =   347 bits (889),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV  WDA++Y+KVDDDVHVNI TLGETL RHR K RVYIGCMKSGPVLSQKGVRYHEPE
Sbjct  228  TAVATWDADFYVKVDDDVHVNIATLGETLVRHRPKRRVYIGCMKSGPVLSQKGVRYHEPE  287

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            +WKFGE+GNKYFRHATGQLYAISKDLATYIS NQHVLHKYANEDVSLG+WFIGLDV H+D
Sbjct  288  HWKFGESGNKYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLGSWFIGLDVEHID  347

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDW+CSGICR+V+RIKEVHRRCGEGE  LW+A F
Sbjct  348  DRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSVERIKEVHRRCGEGENALWSATF  406



>ref|XP_009119198.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Brassica rapa]
Length=408

 Score =   347 bits (889),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 154/179 (86%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TA  +WDA++Y+KVDDDVHVNI TLGETL RHRKKPRVYIGCMKSGPVL QKGVRYHEPE
Sbjct  230  TAFSMWDADFYVKVDDDVHVNIATLGETLVRHRKKPRVYIGCMKSGPVLYQKGVRYHEPE  289

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQ+YAIS+DLA+YIS NQHVLHKYANEDVSLGAWFIG+DV H+D
Sbjct  290  YWKFGENGNKYFRHATGQIYAISRDLASYISINQHVLHKYANEDVSLGAWFIGIDVKHID  349

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR+ DR+KEVHRRC EGE  LW+A F
Sbjct  350  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRSADRLKEVHRRCSEGENALWSATF  408



>emb|CDY46836.1| BnaA10g03200D [Brassica napus]
Length=407

 Score =   346 bits (888),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 154/179 (86%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TA  +WDA++Y+KVDDDVHVNI TLGETL RHRKKPRVYIGCMKSGPVL QKGVRYHEPE
Sbjct  229  TAFSMWDADFYVKVDDDVHVNIATLGETLVRHRKKPRVYIGCMKSGPVLYQKGVRYHEPE  288

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQ+YAIS+DLA+YIS NQHVLHKYANEDVSLGAWFIG+DV H+D
Sbjct  289  YWKFGENGNKYFRHATGQIYAISRDLASYISINQHVLHKYANEDVSLGAWFIGIDVKHID  348

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR+ DR+KEVHRRC EGE  LW+A F
Sbjct  349  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRSADRLKEVHRRCSEGENTLWSATF  407



>ref|XP_010929797.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Elaeis 
guineensis]
Length=411

 Score =   346 bits (888),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 154/179 (86%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV +WDA++YIKVDDDVHVNI TLG TLARHR  PRVYIGCMKSGPVL++KGVRYHEPE
Sbjct  233  TAVAMWDADFYIKVDDDVHVNIATLGTTLARHRSNPRVYIGCMKSGPVLARKGVRYHEPE  292

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQ+YAISKDLATYIS NQHVLH+YANEDVSLGAWFIGLDV H+D
Sbjct  293  YWKFGEEGNKYFRHATGQIYAISKDLATYISINQHVLHRYANEDVSLGAWFIGLDVEHID  352

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDW+CSGICR+ +RI+EVHRRCGEGE  LW+A F
Sbjct  353  DRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSAERIREVHRRCGEGENALWSAIF  411



>ref|XP_008342011.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Malus domestica]
Length=405

 Score =   346 bits (887),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV  WDA++Y+KVDDDVHVNI TLGETL RHRKK  +YIGCMKSGPVL+QKGVRYHEPE
Sbjct  226  TAVATWDADFYVKVDDDVHVNIATLGETLVRHRKKQHLYIGCMKSGPVLAQKGVRYHEPE  285

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAISKDLATYIS NQHVLHKYANEDVSLGAWFIGLDV H+D
Sbjct  286  YWKFGEPGNKYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLGAWFIGLDVQHID  345

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC++ +RIKEVHRRCGEGE  LW+A F
Sbjct  346  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICKSAERIKEVHRRCGEGENALWSATF  404



>ref|XP_008342010.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Malus domestica]
Length=408

 Score =   346 bits (887),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV  WDA++Y+KVDDDVHVNI TLGETL RHRKK  +YIGCMKSGPVL+QKGVRYHEPE
Sbjct  229  TAVATWDADFYVKVDDDVHVNIATLGETLVRHRKKQHLYIGCMKSGPVLAQKGVRYHEPE  288

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAISKDLATYIS NQHVLHKYANEDVSLGAWFIGLDV H+D
Sbjct  289  YWKFGEPGNKYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLGAWFIGLDVQHID  348

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC++ +RIKEVHRRCGEGE  LW+A F
Sbjct  349  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICKSAERIKEVHRRCGEGENALWSATF  407



>ref|XP_002279814.2| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Vitis vinifera]
 emb|CBI26647.3| unnamed protein product [Vitis vinifera]
Length=405

 Score =   346 bits (887),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV +WDA++Y+KVDDDVHVNI TLG TLARHR KPR+YIGCMKSGPVL+QKGVRYHEPE
Sbjct  227  TAVAMWDADFYVKVDDDVHVNIATLGATLARHRSKPRIYIGCMKSGPVLAQKGVRYHEPE  286

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAISKDLATYIS NQHVLHKYANEDVSLG+WFIGLD  H+D
Sbjct  287  YWKFGEEGNKYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLGSWFIGLDAEHID  346

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDW+CSGICR+ +RI+EVHRRCGEGE  +W+A F
Sbjct  347  DRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSSERIREVHRRCGEGENAVWSAVF  405



>ref|XP_009353285.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Pyrus x bretschneideri]
Length=408

 Score =   346 bits (887),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV  WDA++Y+KVDDDVHVNI TLGETL RHRKK R+YIGCMKSGPVL+QKGVRYHEPE
Sbjct  229  TAVATWDADFYVKVDDDVHVNIATLGETLVRHRKKKRLYIGCMKSGPVLAQKGVRYHEPE  288

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAISKDLATYIS NQHVLHKYANEDVSLG+WFIGLDV H+D
Sbjct  289  YWKFGEPGNKYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLGSWFIGLDVQHID  348

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDW+CSGIC++ +RIKEVHRRCGEGE  LW+A F
Sbjct  349  DRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICKSAERIKEVHRRCGEGENALWSARF  407



>ref|XP_009353286.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Pyrus x bretschneideri]
Length=405

 Score =   345 bits (886),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV  WDA++Y+KVDDDVHVNI TLGETL RHRKK R+YIGCMKSGPVL+QKGVRYHEPE
Sbjct  226  TAVATWDADFYVKVDDDVHVNIATLGETLVRHRKKKRLYIGCMKSGPVLAQKGVRYHEPE  285

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAISKDLATYIS NQHVLHKYANEDVSLG+WFIGLDV H+D
Sbjct  286  YWKFGEPGNKYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLGSWFIGLDVQHID  345

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDW+CSGIC++ +RIKEVHRRCGEGE  LW+A F
Sbjct  346  DRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICKSAERIKEVHRRCGEGENALWSARF  404



>emb|CDY49507.1| BnaC05g03190D [Brassica napus]
Length=410

 Score =   346 bits (887),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 154/179 (86%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TA  +WDA++Y+KVDDDVHVNI TLGETL RHRKKPRVYIGCMKSGPVL QKGVRYHEPE
Sbjct  232  TAFSMWDADFYVKVDDDVHVNIATLGETLVRHRKKPRVYIGCMKSGPVLYQKGVRYHEPE  291

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQ+YAIS+DLA+YIS NQHVLHKYANEDVSLGAWFIG+DV H+D
Sbjct  292  YWKFGENGNKYFRHATGQIYAISRDLASYISINQHVLHKYANEDVSLGAWFIGIDVKHID  351

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR+ DR+KEVHRRC EGE  LW+A F
Sbjct  352  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRSADRLKEVHRRCSEGENALWSATF  410



>ref|XP_008804298.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Phoenix 
dactylifera]
Length=411

 Score =   346 bits (887),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV +WDA++Y+KVDDD+HVNIGTLG TLARHR  PRVYIGCMKSGPVL++KGVRYHEPE
Sbjct  233  TAVAMWDADFYVKVDDDIHVNIGTLGLTLARHRSNPRVYIGCMKSGPVLARKGVRYHEPE  292

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GN+YFRHATGQ+YAISKDLATYIS NQHVLHKYANEDVSLGAWFIGLDV H+D
Sbjct  293  YWKFGEEGNRYFRHATGQIYAISKDLATYISINQHVLHKYANEDVSLGAWFIGLDVEHID  352

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDW+CSGICR+ +R++EVHRRCGEGE  LW+A F
Sbjct  353  DRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSAERVREVHRRCGEGENALWSATF  411



>ref|XP_008385877.1| PREDICTED: probable beta-1,3-galactosyltransferase 2, partial 
[Malus domestica]
Length=407

 Score =   345 bits (886),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDA++Y+KVDDDVHVNIGTLG TLARHR KPRVYIGCMKSGPVL+QKGVRYHEPE
Sbjct  229  TAVALWDADFYVKVDDDVHVNIGTLGATLARHRXKPRVYIGCMKSGPVLAQKGVRYHEPE  288

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFG  GNKYFRHATGQLYAISKDLA YIS NQHVLHKYANEDVSLG+WFIGLDV  +D
Sbjct  289  YWKFGAEGNKYFRHATGQLYAISKDLANYISNNQHVLHKYANEDVSLGSWFIGLDVEQID  348

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGN+CVASFDW+CSGIC++ +RIKEVH+RCGEGE  LWNAAF
Sbjct  349  DRRLCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSSERIKEVHKRCGEGENALWNAAF  407



>ref|XP_008226884.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Prunus mume]
Length=404

 Score =   345 bits (885),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV  WDA++Y+KVDDDVHVNIGTLG TLARHR  PRVYIGCMKSGPVL++KGVRYHEPE
Sbjct  226  TAVASWDADFYVKVDDDVHVNIGTLGATLARHRSNPRVYIGCMKSGPVLARKGVRYHEPE  285

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAISKDLATYIS NQHVLHKYANEDVSLG+WFIGLDV  +D
Sbjct  286  YWKFGEEGNKYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLGSWFIGLDVEQID  345

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGN+CVASFDWTCSGIC++ +RIKEVHRRCGEGE  LWNA F
Sbjct  346  DRRLCCGTPPDCEWKAQAGNVCVASFDWTCSGICKSSERIKEVHRRCGEGENALWNAVF  404



>ref|XP_008226885.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Prunus mume]
Length=403

 Score =   345 bits (885),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV  WDA++Y+KVDDDVHVNIGTLG TLARHR  PRVYIGCMKSGPVL++KGVRYHEPE
Sbjct  225  TAVASWDADFYVKVDDDVHVNIGTLGATLARHRSNPRVYIGCMKSGPVLARKGVRYHEPE  284

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAISKDLATYIS NQHVLHKYANEDVSLG+WFIGLDV  +D
Sbjct  285  YWKFGEEGNKYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLGSWFIGLDVEQID  344

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGN+CVASFDWTCSGIC++ +RIKEVHRRCGEGE  LWNA F
Sbjct  345  DRRLCCGTPPDCEWKAQAGNVCVASFDWTCSGICKSSERIKEVHRRCGEGENALWNAVF  403



>emb|CDP05735.1| unnamed protein product [Coffea canephora]
Length=403

 Score =   345 bits (885),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDA++Y+KVDDDVHVNIGTLG TL+RH  KPRVYIGCMKSGPVL+QKGVRYHEPE
Sbjct  225  TAVALWDADFYVKVDDDVHVNIGTLGATLSRHLSKPRVYIGCMKSGPVLAQKGVRYHEPE  284

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            +WKFGE GNKYFRHATGQLYAISKDLATYIS NQHVLHKYANEDVSLG+WFIGLDV H+D
Sbjct  285  HWKFGEYGNKYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLGSWFIGLDVEHID  344

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DR+LCCGTPPDCEWKAQAGNICVASFDW CSGIC +V+RIKEVHRRCGEGE  LWNA F
Sbjct  345  DRQLCCGTPPDCEWKAQAGNICVASFDWRCSGICNSVERIKEVHRRCGEGENALWNAVF  403



>ref|XP_010675728.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Beta vulgaris 
subsp. vulgaris]
Length=399

 Score =   345 bits (884),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV  WDAE+Y+KVDDDVHVNI TLG TL RHR KPR+YIGCMKSGPVL+QKGVRYHEPE
Sbjct  221  TAVAKWDAEFYVKVDDDVHVNIATLGATLIRHRSKPRLYIGCMKSGPVLAQKGVRYHEPE  280

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            +WKFG+ GNKYFRHATGQLYAIS+DLATYIS NQHVLHKYANEDVSLGAWFIGLDV H+D
Sbjct  281  HWKFGDDGNKYFRHATGQLYAISRDLATYISINQHVLHKYANEDVSLGAWFIGLDVEHID  340

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGN+CVASFDWTCSG+C++V+R+KEVHRRCGEGEK LW+A F
Sbjct  341  DRRLCCGTPPDCEWKAQAGNVCVASFDWTCSGVCKSVERMKEVHRRCGEGEKALWSATF  399



>ref|XP_002529902.1| Beta-1,3-galactosyltransferase sqv-2, putative [Ricinus communis]
 gb|EEF32456.1| Beta-1,3-galactosyltransferase sqv-2, putative [Ricinus communis]
Length=238

 Score =   339 bits (869),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 154/179 (86%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDA++Y+KVDDDVHVNI TLG TLARHR KPRVYIGCMKSGPVL+ KGV+YHEPE
Sbjct  60   TAVALWDADFYVKVDDDVHVNIATLGTTLARHRSKPRVYIGCMKSGPVLAHKGVKYHEPE  119

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAIS DLATYIS NQHVLHKYANEDVSLG+WFIGLDV H+D
Sbjct  120  YWKFGEEGNKYFRHATGQLYAISNDLATYISINQHVLHKYANEDVSLGSWFIGLDVEHID  179

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDW+CSGIC++V+RIKEVH RCGEGE  LW+A F
Sbjct  180  DRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICKSVERIKEVHGRCGEGENALWSAEF  238



>ref|XP_004982530.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Setaria 
italica]
Length=405

 Score =   345 bits (884),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 154/178 (87%), Positives = 166/178 (93%), Gaps = 0/178 (0%)
 Frame = -3

Query  746  AVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPEY  567
            AV +WDAEYYIKVDDDVHVNI TLG TL+RHR KPRVY+GCMKSGPVL+QKGVRYHEPEY
Sbjct  228  AVSMWDAEYYIKVDDDVHVNIATLGNTLSRHRSKPRVYVGCMKSGPVLAQKGVRYHEPEY  287

Query  566  WKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVDD  387
            WKFGE GNKYFRHATGQLYAISKDLA+YI+ NQHVLHKYANEDVSLGAWFIGLDV HVDD
Sbjct  288  WKFGEWGNKYFRHATGQLYAISKDLASYIALNQHVLHKYANEDVSLGAWFIGLDVEHVDD  347

Query  386  RRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            RRLCCGTPPDCEWKAQAGN+CVASFDW+CSGIC++ DRIKEVH+RCGE E  +WNA F
Sbjct  348  RRLCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSADRIKEVHQRCGESENAIWNAKF  405



>ref|XP_008359262.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Malus domestica]
Length=412

 Score =   345 bits (884),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 154/179 (86%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV  WDA++Y+KVDDDVHVNIGTLG TLARHR KPRVYIGCMKSGPVL+QKGVRYHEPE
Sbjct  234  TAVAXWDADFYVKVDDDVHVNIGTLGATLARHRSKPRVYIGCMKSGPVLAQKGVRYHEPE  293

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFG  GNKYFRHATGQLYAISKDLA YIS NQHVLHKYANEDVSLG+WFIGLDV  +D
Sbjct  294  YWKFGAEGNKYFRHATGQLYAISKDLANYISNNQHVLHKYANEDVSLGSWFIGLDVEQID  353

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGN+CVASFDW+CSGIC++ +RIKEVH+RCGEGE  LWNAAF
Sbjct  354  DRRLCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSSERIKEVHKRCGEGENALWNAAF  412



>ref|XP_008359264.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Malus domestica]
Length=411

 Score =   345 bits (884),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 154/179 (86%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV  WDA++Y+KVDDDVHVNIGTLG TLARHR KPRVYIGCMKSGPVL+QKGVRYHEPE
Sbjct  233  TAVAXWDADFYVKVDDDVHVNIGTLGATLARHRSKPRVYIGCMKSGPVLAQKGVRYHEPE  292

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFG  GNKYFRHATGQLYAISKDLA YIS NQHVLHKYANEDVSLG+WFIGLDV  +D
Sbjct  293  YWKFGAEGNKYFRHATGQLYAISKDLANYISNNQHVLHKYANEDVSLGSWFIGLDVEQID  352

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGN+CVASFDW+CSGIC++ +RIKEVH+RCGEGE  LWNAAF
Sbjct  353  DRRLCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSSERIKEVHKRCGEGENALWNAAF  411



>ref|XP_008379640.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Malus domestica]
Length=405

 Score =   344 bits (883),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 154/179 (86%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV  WDA++Y+KVDDDVHVNI TLGETL RHRKK R+YIGCMKSGPVL+QKGVRYHEPE
Sbjct  226  TAVATWDADFYVKVDDDVHVNIATLGETLVRHRKKKRLYIGCMKSGPVLAQKGVRYHEPE  285

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAISKDLATY+S NQHVLHKYANEDVSLG+WFIGLDV H+D
Sbjct  286  YWKFGEPGNKYFRHATGQLYAISKDLATYVSINQHVLHKYANEDVSLGSWFIGLDVQHID  345

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDW+CSGIC++ +RIKEVHRRCGEGE  LW+A F
Sbjct  346  DRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICKSAERIKEVHRRCGEGENALWSARF  404



>ref|XP_008379639.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Malus domestica]
Length=408

 Score =   344 bits (883),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 154/179 (86%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV  WDA++Y+KVDDDVHVNI TLGETL RHRKK R+YIGCMKSGPVL+QKGVRYHEPE
Sbjct  229  TAVATWDADFYVKVDDDVHVNIATLGETLVRHRKKKRLYIGCMKSGPVLAQKGVRYHEPE  288

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAISKDLATY+S NQHVLHKYANEDVSLG+WFIGLDV H+D
Sbjct  289  YWKFGEPGNKYFRHATGQLYAISKDLATYVSINQHVLHKYANEDVSLGSWFIGLDVQHID  348

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDW+CSGIC++ +RIKEVHRRCGEGE  LW+A F
Sbjct  349  DRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICKSAERIKEVHRRCGEGENALWSARF  407



>ref|XP_009408655.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Musa acuminata 
subsp. malaccensis]
Length=406

 Score =   344 bits (882),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 154/179 (86%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV +WDA++YIKVDDDVHVNI TLG TLA+HR KPRVYIGCMKSGPVL+QKGVRYHEPE
Sbjct  228  TAVSMWDADFYIKVDDDVHVNIATLGTTLAKHRSKPRVYIGCMKSGPVLAQKGVRYHEPE  287

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAIS DLA YIS NQHVLHKYANEDVSLG+WFIGLDV H+D
Sbjct  288  YWKFGEDGNKYFRHATGQLYAISNDLAAYISMNQHVLHKYANEDVSLGSWFIGLDVEHID  347

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGIC + +RI EVHRRCGEGEK++W+A F
Sbjct  348  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICNSAERINEVHRRCGEGEKMVWDAVF  406



>ref|XP_004515096.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Cicer 
arietinum]
Length=408

 Score =   344 bits (882),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDA++Y+KVDDDVHVNI TLGETL RHR K R+YIGCMKSGPVLSQKGVRYHEPE
Sbjct  230  TAVSLWDADFYVKVDDDVHVNIATLGETLVRHRSKQRIYIGCMKSGPVLSQKGVRYHEPE  289

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            +WKFGE+GNKYFRHATGQLYAIS DLATYIS NQ+VLHKYANEDVS+GAWFIGLDV H+D
Sbjct  290  HWKFGESGNKYFRHATGQLYAISNDLATYISTNQNVLHKYANEDVSIGAWFIGLDVEHID  349

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRR+CCGTPPDCEWKAQAGNICVASFDW+CSGICR+ +RIKEVH+RCGEGE  LW+A+F
Sbjct  350  DRRICCGTPPDCEWKAQAGNICVASFDWSCSGICRSAERIKEVHKRCGEGENALWSASF  408



>ref|XP_010313672.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Solanum lycopersicum]
Length=395

 Score =   343 bits (880),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 165/179 (92%), Gaps = 3/179 (2%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDAEYYIKVDDDVHVNI TL ETL RH KKPR+YIGCMKSGPVLS+KGVRYHEPE
Sbjct  220  TAVNLWDAEYYIKVDDDVHVNIATLAETLVRHSKKPRIYIGCMKSGPVLSRKGVRYHEPE  279

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFG   +KYFRHATGQ+YAISKDLATYISANQHVLHKY NEDVSLGAWFIGLDV H+D
Sbjct  280  YWKFG---DKYFRHATGQIYAISKDLATYISANQHVLHKYTNEDVSLGAWFIGLDVQHID  336

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGN+CVASFDWTCSGICR+VDR+KEVHR CGEGE  LW AAF
Sbjct  337  DRRLCCGTPPDCEWKAQAGNVCVASFDWTCSGICRSVDRMKEVHRHCGEGENALWKAAF  395



>ref|XP_007211967.1| hypothetical protein PRUPE_ppa006589mg [Prunus persica]
 gb|EMJ13166.1| hypothetical protein PRUPE_ppa006589mg [Prunus persica]
Length=404

 Score =   343 bits (881),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 154/179 (86%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV  WDA++Y+KVDDDVHVNIGTLG TLARHR  PRVYIGCMKSGPVL++KGVRYHEPE
Sbjct  226  TAVASWDADFYVKVDDDVHVNIGTLGATLARHRSNPRVYIGCMKSGPVLARKGVRYHEPE  285

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAISKDLATYIS NQHVLHKYANEDVSLG+WFIGLDV  +D
Sbjct  286  YWKFGEEGNKYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLGSWFIGLDVEQID  345

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGN+CVASFDW+CSGIC++ +RIKEVHRRCGEGE  LWNA F
Sbjct  346  DRRLCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSSERIKEVHRRCGEGENALWNAVF  404



>ref|XP_004251520.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Solanum lycopersicum]
Length=397

 Score =   343 bits (880),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 165/179 (92%), Gaps = 3/179 (2%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDAEYYIKVDDDVHVNI TL ETL RH KKPR+YIGCMKSGPVLS+KGVRYHEPE
Sbjct  222  TAVNLWDAEYYIKVDDDVHVNIATLAETLVRHSKKPRIYIGCMKSGPVLSRKGVRYHEPE  281

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFG   +KYFRHATGQ+YAISKDLATYISANQHVLHKY NEDVSLGAWFIGLDV H+D
Sbjct  282  YWKFG---DKYFRHATGQIYAISKDLATYISANQHVLHKYTNEDVSLGAWFIGLDVQHID  338

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGN+CVASFDWTCSGICR+VDR+KEVHR CGEGE  LW AAF
Sbjct  339  DRRLCCGTPPDCEWKAQAGNVCVASFDWTCSGICRSVDRMKEVHRHCGEGENALWKAAF  397



>ref|XP_004294404.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Fragaria vesca subsp. vesca]
Length=407

 Score =   343 bits (881),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV  WDAE+Y+KVDDDVHVNIGTLG TL RHR KPRVYIGCMKSGPVL+QKGVRYHEPE
Sbjct  229  TAVSSWDAEFYVKVDDDVHVNIGTLGTTLGRHRLKPRVYIGCMKSGPVLAQKGVRYHEPE  288

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAIS+DLATYIS NQHVLHKY NEDVSLG+W +GLDV H+D
Sbjct  289  YWKFGEEGNKYFRHATGQLYAISRDLATYISINQHVLHKYVNEDVSLGSWLLGLDVEHID  348

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGN+CVASFDW+CSGIC++V+RIKEVHRRCGEGE  LW+A F
Sbjct  349  DRRLCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVERIKEVHRRCGEGENALWSAVF  407



>ref|XP_006351966.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X1 [Solanum tuberosum]
Length=397

 Score =   343 bits (880),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 166/179 (93%), Gaps = 3/179 (2%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDAEYYIKVDDDVHVNI TL ETLARHR KPR+YIGCMKSGPVLS+KGVRYHEPE
Sbjct  222  TAVNLWDAEYYIKVDDDVHVNIATLVETLARHRTKPRIYIGCMKSGPVLSRKGVRYHEPE  281

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFG   +KYFRHATGQ+YAISKDLATYISANQHVLHKY NEDVSLG+WFIGLDV H+D
Sbjct  282  YWKFG---DKYFRHATGQIYAISKDLATYISANQHVLHKYTNEDVSLGSWFIGLDVQHID  338

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGN+CVASFDWTCSGICR+VDR+KEVHR CGEGE  LW AAF
Sbjct  339  DRRLCCGTPPDCEWKAQAGNVCVASFDWTCSGICRSVDRMKEVHRHCGEGENALWKAAF  397



>ref|XP_011461040.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Fragaria vesca subsp. vesca]
Length=406

 Score =   343 bits (880),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV  WDAE+Y+KVDDDVHVNIGTLG TL RHR KPRVYIGCMKSGPVL+QKGVRYHEPE
Sbjct  228  TAVSSWDAEFYVKVDDDVHVNIGTLGTTLGRHRLKPRVYIGCMKSGPVLAQKGVRYHEPE  287

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAIS+DLATYIS NQHVLHKY NEDVSLG+W +GLDV H+D
Sbjct  288  YWKFGEEGNKYFRHATGQLYAISRDLATYISINQHVLHKYVNEDVSLGSWLLGLDVEHID  347

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGN+CVASFDW+CSGIC++V+RIKEVHRRCGEGE  LW+A F
Sbjct  348  DRRLCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVERIKEVHRRCGEGENALWSAVF  406



>ref|XP_006351967.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X2 [Solanum tuberosum]
Length=395

 Score =   343 bits (879),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 166/179 (93%), Gaps = 3/179 (2%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDAEYYIKVDDDVHVNI TL ETLARHR KPR+YIGCMKSGPVLS+KGVRYHEPE
Sbjct  220  TAVNLWDAEYYIKVDDDVHVNIATLVETLARHRTKPRIYIGCMKSGPVLSRKGVRYHEPE  279

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFG   +KYFRHATGQ+YAISKDLATYISANQHVLHKY NEDVSLG+WFIGLDV H+D
Sbjct  280  YWKFG---DKYFRHATGQIYAISKDLATYISANQHVLHKYTNEDVSLGSWFIGLDVQHID  336

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGN+CVASFDWTCSGICR+VDR+KEVHR CGEGE  LW AAF
Sbjct  337  DRRLCCGTPPDCEWKAQAGNVCVASFDWTCSGICRSVDRMKEVHRHCGEGENALWKAAF  395



>ref|XP_010089999.1| putative beta-1,3-galactosyltransferase 2 [Morus notabilis]
 gb|EXB38730.1| putative beta-1,3-galactosyltransferase 2 [Morus notabilis]
Length=404

 Score =   343 bits (879),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = -3

Query  746  AVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPEY  567
            AV LWDA++Y+KVDDDVHVNI TLG TLARHR K RVYIGCMKSGPVL+QKGVRYHEPE+
Sbjct  227  AVALWDADFYVKVDDDVHVNIATLGATLARHRDKSRVYIGCMKSGPVLAQKGVRYHEPEH  286

Query  566  WKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVDD  387
            WKFGE GNKYFRHATGQLYAISKDLATYIS NQHVLH+YANEDVSLG+WFIGLDV H+DD
Sbjct  287  WKFGEDGNKYFRHATGQLYAISKDLATYISINQHVLHRYANEDVSLGSWFIGLDVEHIDD  346

Query  386  RRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            RRLCCGTPPDCEWKAQAGN+CVASFDW+CSGICR+V+R+KEVHRRCGEGE  LW+A F
Sbjct  347  RRLCCGTPPDCEWKAQAGNVCVASFDWSCSGICRSVERMKEVHRRCGEGENALWSAEF  404



>ref|NP_180802.1| putative beta-1,3-galactosyltransferase 3 [Arabidopsis thaliana]
 sp|Q9ZV71.1|B3GT3_ARATH RecName: Full=Probable beta-1,3-galactosyltransferase 3 [Arabidopsis 
thaliana]
 gb|AAC69935.1| unknown protein [Arabidopsis thaliana]
 gb|AAO42172.1| unknown protein [Arabidopsis thaliana]
 gb|AEC08684.1| putative beta-1,3-galactosyltransferase 3 [Arabidopsis thaliana]
 gb|AHL38822.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=409

 Score =   343 bits (879),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV  WDAE+Y+KVDDDVHVNI TLGETL RHRKK RVY+GCMKSGPVLSQKGVRYHEPE
Sbjct  231  TAVSKWDAEFYVKVDDDVHVNIATLGETLVRHRKKHRVYLGCMKSGPVLSQKGVRYHEPE  290

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAIS+DLA+YIS NQHVLHKYANEDV+LGAWFIGLDV H+D
Sbjct  291  YWKFGENGNKYFRHATGQLYAISRDLASYISLNQHVLHKYANEDVTLGAWFIGLDVTHID  350

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR+ DRIKEVH+RCGE E  +W A F
Sbjct  351  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRSADRIKEVHKRCGEPENAIWKARF  409



>ref|XP_002879388.1| galactosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55647.1| galactosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=409

 Score =   342 bits (878),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV  WDAE+Y+KVDDDVHVNI TLGETL RHRKK RVYIGCMKSGPVLSQKGVRYHEPE
Sbjct  231  TAVSKWDAEFYVKVDDDVHVNIATLGETLVRHRKKHRVYIGCMKSGPVLSQKGVRYHEPE  290

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAIS+DLA+YI+ NQHVLHKYANEDV+LGAWFIGLDV H+D
Sbjct  291  YWKFGENGNKYFRHATGQLYAISRDLASYIALNQHVLHKYANEDVTLGAWFIGLDVTHID  350

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR+ DRIKEVH+RCGE E  +W A F
Sbjct  351  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRSADRIKEVHKRCGEPENAIWKARF  409



>ref|XP_009338706.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Pyrus x bretschneideri]
Length=411

 Score =   342 bits (878),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV  WDA++Y+KVDDDVHVNIGTLG TLARHR KPRVYIGCMKSGPV++QKGVRYHEPE
Sbjct  233  TAVASWDADFYVKVDDDVHVNIGTLGATLARHRSKPRVYIGCMKSGPVIAQKGVRYHEPE  292

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFG  GNKYFRHATGQLYAISKDLA YIS NQHVLHKYANEDVSLG+WFIGLDV  +D
Sbjct  293  YWKFGAEGNKYFRHATGQLYAISKDLANYISNNQHVLHKYANEDVSLGSWFIGLDVEQID  352

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGN+CVASFDW+CSGIC++ +RIKEVH+RCGEGE  LWNAAF
Sbjct  353  DRRLCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSSERIKEVHKRCGEGENALWNAAF  411



>ref|XP_009338707.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Pyrus x bretschneideri]
Length=410

 Score =   342 bits (878),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV  WDA++Y+KVDDDVHVNIGTLG TLARHR KPRVYIGCMKSGPV++QKGVRYHEPE
Sbjct  232  TAVASWDADFYVKVDDDVHVNIGTLGATLARHRSKPRVYIGCMKSGPVIAQKGVRYHEPE  291

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFG  GNKYFRHATGQLYAISKDLA YIS NQHVLHKYANEDVSLG+WFIGLDV  +D
Sbjct  292  YWKFGAEGNKYFRHATGQLYAISKDLANYISNNQHVLHKYANEDVSLGSWFIGLDVEQID  351

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGN+CVASFDW+CSGIC++ +RIKEVH+RCGEGE  LWNAAF
Sbjct  352  DRRLCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSSERIKEVHKRCGEGENALWNAAF  410



>gb|EPS73703.1| hypothetical protein M569_01053, partial [Genlisea aurea]
Length=221

 Score =   335 bits (860),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 150/178 (84%), Positives = 165/178 (93%), Gaps = 0/178 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV+LWDA++Y+KVDDDVHVN+GTLG TL RHR  PRVYIGCMKSGPVL+QKGVRYHEPE
Sbjct  44   TAVRLWDADFYVKVDDDVHVNVGTLGATLFRHRSMPRVYIGCMKSGPVLAQKGVRYHEPE  103

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            +WKFGE GNKYFRHATGQLYAIS+DLA YIS NQHVLHKYANEDVSLG+WFIGLDV H+D
Sbjct  104  FWKFGEQGNKYFRHATGQLYAISRDLAAYISINQHVLHKYANEDVSLGSWFIGLDVEHID  163

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAA  216
            DRRLCCGTPPDCEWKAQAGN CVASFDW+CSGIC + DRIKEVHRRCGEG+  LWN++
Sbjct  164  DRRLCCGTPPDCEWKAQAGNACVASFDWSCSGICNSADRIKEVHRRCGEGDTALWNSS  221



>ref|XP_010063020.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Eucalyptus grandis]
 gb|KCW70193.1| hypothetical protein EUGRSUZ_F03473 [Eucalyptus grandis]
Length=402

 Score =   342 bits (876),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDA++Y+KVDDDVHVNI TLG TL RHR KPRVYIGCMKSGPVL+QKGVRYHEPE
Sbjct  224  TAVALWDADFYVKVDDDVHVNIATLGATLMRHRSKPRVYIGCMKSGPVLAQKGVRYHEPE  283

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            +WKFGE GN+YFRHATGQLYAISKDLATYIS NQHVLHKYANEDVSLG+WFIGLD  H+D
Sbjct  284  HWKFGEEGNRYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLGSWFIGLDAEHID  343

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGN+CVASFDW+CSGIC++V+R+K VHRRCGEGE VLW+ AF
Sbjct  344  DRRLCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVERMKVVHRRCGEGENVLWSTAF  402



>gb|KJB80508.1| hypothetical protein B456_013G101400 [Gossypium raimondii]
Length=398

 Score =   342 bits (876),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 162/169 (96%), Gaps = 0/169 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            T+V LWDA++Y+KVDDDVHVNI TLGETL RHRK PRVYIGCMKSGPVLSQKGVRYHEPE
Sbjct  226  TSVALWDADFYVKVDDDVHVNIATLGETLVRHRKNPRVYIGCMKSGPVLSQKGVRYHEPE  285

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            +WKFGETGNKYFRHATGQLYAISKDLA+YIS NQHVLHKYANEDVSLG+WFIGLDV HVD
Sbjct  286  HWKFGETGNKYFRHATGQLYAISKDLASYISINQHVLHKYANEDVSLGSWFIGLDVEHVD  345

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGE  243
            DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICR+ DRIKEVHRRCGE
Sbjct  346  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRSADRIKEVHRRCGE  394



>ref|XP_010063019.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Eucalyptus grandis]
 gb|KCW70192.1| hypothetical protein EUGRSUZ_F03473 [Eucalyptus grandis]
Length=403

 Score =   342 bits (876),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDA++Y+KVDDDVHVNI TLG TL RHR KPRVYIGCMKSGPVL+QKGVRYHEPE
Sbjct  225  TAVALWDADFYVKVDDDVHVNIATLGATLMRHRSKPRVYIGCMKSGPVLAQKGVRYHEPE  284

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            +WKFGE GN+YFRHATGQLYAISKDLATYIS NQHVLHKYANEDVSLG+WFIGLD  H+D
Sbjct  285  HWKFGEEGNRYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLGSWFIGLDAEHID  344

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGN+CVASFDW+CSGIC++V+R+K VHRRCGEGE VLW+ AF
Sbjct  345  DRRLCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVERMKVVHRRCGEGENVLWSTAF  403



>ref|XP_006365959.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Solanum 
tuberosum]
Length=395

 Score =   340 bits (873),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TA+ LWDA++Y+KVDDDVHVNIGTL  TLA HR KPRVYIGCMKSGPVL+QKGVRYHEPE
Sbjct  217  TAISLWDADFYVKVDDDVHVNIGTLAATLATHRSKPRVYIGCMKSGPVLAQKGVRYHEPE  276

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            +WKFGE GNKYFRHATGQLYAISKDLATYIS N+H+LHKYANEDV+LG+WFIGLDV H+D
Sbjct  277  HWKFGEDGNKYFRHATGQLYAISKDLATYISINRHILHKYANEDVTLGSWFIGLDVEHID  336

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DR++CCGTPPDCEWKAQ GNICVASFDW+CSGIC++VDRIKEVHRRCGEGE  LW+  F
Sbjct  337  DRKMCCGTPPDCEWKAQTGNICVASFDWSCSGICKSVDRIKEVHRRCGEGENALWSTVF  395



>ref|XP_008808431.1| PREDICTED: LOW QUALITY PROTEIN: probable beta-1,3-galactosyltransferase 
2 [Phoenix dactylifera]
Length=411

 Score =   340 bits (873),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 154/179 (86%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV  WDA +YIKVDDDVHVNI TLG TLARHR KPRVYIGCMKSGPVL++KGVRYHEPE
Sbjct  233  TAVATWDAYFYIKVDDDVHVNIATLGATLARHRSKPRVYIGCMKSGPVLARKGVRYHEPE  292

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAISKDLATYIS NQHVLHKYANEDVSLGAWFIGLDV H+D
Sbjct  293  YWKFGEEGNKYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLGAWFIGLDVEHID  352

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGN CVASFDW+CSGIC++ +RI+EVHRRCGEG+  LW+A F
Sbjct  353  DRRLCCGTPPDCEWKAQAGNTCVASFDWSCSGICKSAERIREVHRRCGEGKNALWSANF  411



>gb|KHN03478.1| Putative beta-1,3-galactosyltransferase 2 [Glycine soja]
Length=334

 Score =   337 bits (864),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDAE+Y+KVDDDVHVN+ TLG TL+ HRKKPRVYIGCMKSGPVL+QKGVRYHEPE
Sbjct  156  TAVALWDAEFYVKVDDDVHVNLATLGLTLSMHRKKPRVYIGCMKSGPVLAQKGVRYHEPE  215

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAIS+DLATYIS NQ +LHKYANEDVSLG+WFIGLDV HVD
Sbjct  216  YWKFGEVGNKYFRHATGQLYAISQDLATYISINQGMLHKYANEDVSLGSWFIGLDVDHVD  275

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRR+CCGTPPDCEWKAQAGNICVASFDW CSGICR+V+R+KEVH+RCGE E  LW+  F
Sbjct  276  DRRMCCGTPPDCEWKAQAGNICVASFDWKCSGICRSVERMKEVHQRCGEDENALWSGTF  334



>ref|XP_003596979.1| hypothetical protein MTR_2g088270 [Medicago truncatula]
 gb|AES67230.1| beta-1,3-galactosyltransferase-like protein [Medicago truncatula]
Length=402

 Score =   339 bits (869),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 154/179 (86%), Positives = 168/179 (94%), Gaps = 1/179 (1%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDA++YIKVDDDVHVNI TLGETL RHR KPRVYIGCMKSGPVL+QKGVRYHEPE
Sbjct  225  TAVNLWDADFYIKVDDDVHVNIATLGETLIRHRSKPRVYIGCMKSGPVLAQKGVRYHEPE  284

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGETGNKYFRHATGQLYA+SKDLATYI+ N++VLHKYANEDVSLGAWFIGLDV H+D
Sbjct  285  YWKFGETGNKYFRHATGQLYAVSKDLATYIATNKNVLHKYANEDVSLGAWFIGLDVEHID  344

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGT  DCEWKAQAGN CVASFDWTCSGICR+ +RIKEVH++CGEGEK LW+A+F
Sbjct  345  DRRLCCGT-TDCEWKAQAGNACVASFDWTCSGICRSAERIKEVHKKCGEGEKALWSASF  402



>ref|XP_004149353.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Cucumis 
sativus]
 gb|KGN56118.1| hypothetical protein Csa_3G076540 [Cucumis sativus]
Length=407

 Score =   339 bits (869),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDA++Y+KVDDDVHVNI TL  TLARHR K RVY+GCMKSGPVL+QKGVRYHEPE
Sbjct  229  TAVALWDADFYVKVDDDVHVNIATLASTLARHRSKSRVYMGCMKSGPVLAQKGVRYHEPE  288

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAISKDLATYIS NQH+LHKYANEDVSLG+WFIGLDV H+D
Sbjct  289  YWKFGEEGNKYFRHATGQLYAISKDLATYISINQHILHKYANEDVSLGSWFIGLDVEHID  348

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNIC+ASFDW+CSGIC++ +R+KEVHRRCGEGE  L +A F
Sbjct  349  DRRLCCGTPPDCEWKAQAGNICIASFDWSCSGICKSAERMKEVHRRCGEGENALLSAVF  407



>ref|XP_003550487.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X1 [Glycine max]
 ref|XP_006600308.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X2 [Glycine max]
Length=374

 Score =   338 bits (866),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDAE+Y+KVDDDVHVN+ TLG TL+ HRKKPRVYIGCMKSGPVL+QKGVRYHEPE
Sbjct  196  TAVALWDAEFYVKVDDDVHVNLATLGLTLSMHRKKPRVYIGCMKSGPVLAQKGVRYHEPE  255

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAIS+DLATYIS NQ +LHKYANEDVSLG+WFIGLDV HVD
Sbjct  256  YWKFGEVGNKYFRHATGQLYAISQDLATYISINQGMLHKYANEDVSLGSWFIGLDVDHVD  315

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRR+CCGTPPDCEWKAQAGNICVASFDW CSGICR+V+R+KEVH+RCGE E  LW+  F
Sbjct  316  DRRMCCGTPPDCEWKAQAGNICVASFDWKCSGICRSVERMKEVHQRCGEDENALWSGTF  374



>ref|NP_001141034.1| hypothetical protein [Zea mays]
 gb|ACF85234.1| unknown [Zea mays]
 gb|AFW68304.1| hypothetical protein ZEAMMB73_372854 [Zea mays]
 gb|AFW68305.1| hypothetical protein ZEAMMB73_372854 [Zea mays]
Length=361

 Score =   337 bits (864),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
             AV  WDAEYY+KVDDDVHVNI TLG TLARHR KPR Y+GCMKSGPVL+QKGVRYHEPE
Sbjct  183  AAVSTWDAEYYVKVDDDVHVNIATLGNTLARHRSKPRAYVGCMKSGPVLAQKGVRYHEPE  242

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GN+YFRHA+GQLYAISKDLA+YI+ NQHVLHKYANEDVSLG+WFIGLDV HVD
Sbjct  243  YWKFGEWGNRYFRHASGQLYAISKDLASYIALNQHVLHKYANEDVSLGSWFIGLDVEHVD  302

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGN CVASFDW+CSGIC++ DRIKEVH+RCGE E  +WNA F
Sbjct  303  DRRLCCGTPPDCEWKAQAGNACVASFDWSCSGICKSADRIKEVHQRCGESENAIWNAEF  361



>ref|XP_008463407.1| PREDICTED: LOW QUALITY PROTEIN: probable beta-1,3-galactosyltransferase 
3 [Cucumis melo]
Length=412

 Score =   338 bits (868),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDA++Y+KVDDDVHVNI TL  TLARHR K RVY+GCMKSGPVL+QKGVRYHEPE
Sbjct  234  TAVALWDADFYVKVDDDVHVNIATLASTLARHRSKSRVYMGCMKSGPVLAQKGVRYHEPE  293

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAISKDLATYIS NQH+LHKYANEDVSLG+WFIGLDV H+D
Sbjct  294  YWKFGEEGNKYFRHATGQLYAISKDLATYISINQHILHKYANEDVSLGSWFIGLDVEHID  353

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNIC+ASFDW+CSGIC++ +R+KEVHRRCGEGE  L +A F
Sbjct  354  DRRLCCGTPPDCEWKAQAGNICIASFDWSCSGICKSAERMKEVHRRCGEGENALLSAVF  412



>ref|XP_009782227.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Nicotiana sylvestris]
Length=398

 Score =   338 bits (866),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TA+ LWDA++Y+KVDDDVHVN+GTL  TLAR+R KP VYIGCMKSGPVL+QKGVRYHEPE
Sbjct  220  TAISLWDADFYVKVDDDVHVNLGTLAATLARNRSKPMVYIGCMKSGPVLAQKGVRYHEPE  279

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            +WKFGE GN+YFRHATGQLYAISKDLATYIS N+H+LHKYANEDV+LG+WFIGLDV HVD
Sbjct  280  HWKFGEDGNRYFRHATGQLYAISKDLATYISINRHILHKYANEDVTLGSWFIGLDVEHVD  339

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DR+LCCGTPPDCE KAQAGNICVASFDW+CSGIC++V+RIKEVHRRCGEGE  LW+AAF
Sbjct  340  DRKLCCGTPPDCELKAQAGNICVASFDWSCSGICKSVERIKEVHRRCGEGENALWSAAF  398



>ref|XP_006452383.1| hypothetical protein CICLE_v10008439mg [Citrus clementina]
 gb|ESR65623.1| hypothetical protein CICLE_v10008439mg [Citrus clementina]
Length=313

 Score =   334 bits (857),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 149/172 (87%), Positives = 162/172 (94%), Gaps = 0/172 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDA++Y+KVDDDVHVNI TLG TLARHR KPRVYIGCMKSGPVL+QKGVRYHEPE
Sbjct  125  TAVALWDADFYVKVDDDVHVNIATLGATLARHRSKPRVYIGCMKSGPVLAQKGVRYHEPE  184

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAISKDLA+YIS NQHVLHK+ANEDVSLG+WFIGLD  H+D
Sbjct  185  YWKFGEEGNKYFRHATGQLYAISKDLASYISINQHVLHKFANEDVSLGSWFIGLDAEHID  244

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEK  234
            DRRLCCGTPPDCEWKAQAGN+CVASFDW+CSGICR+ +R+KEVHRRCGEG K
Sbjct  245  DRRLCCGTPPDCEWKAQAGNVCVASFDWSCSGICRSAERMKEVHRRCGEGGK  296



>gb|KHG10854.1| putative beta-1,3-galactosyltransferase 2 -like protein [Gossypium 
arboreum]
Length=418

 Score =   338 bits (866),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDAE+Y+KVDDDVHVN+ TLG TLA HRKKPRVYIGCMKSGPVL++KGV+YHEPE
Sbjct  222  TAVSLWDAEFYVKVDDDVHVNLATLGMTLAEHRKKPRVYIGCMKSGPVLARKGVKYHEPE  281

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAISKDLATYI  NQ VLHKYANEDVSLG+WFIGLDV HVD
Sbjct  282  YWKFGEVGNKYFRHATGQLYAISKDLATYILINQDVLHKYANEDVSLGSWFIGLDVEHVD  341

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDW CSGICR+V+RI EVH RCGE +  LW A F
Sbjct  342  DRRLCCGTPPDCEWKAQAGNICVASFDWKCSGICRSVERIMEVHERCGEDKNALWTANF  400



>ref|XP_002464309.1| hypothetical protein SORBIDRAFT_01g015960 [Sorghum bicolor]
 gb|EER91307.1| hypothetical protein SORBIDRAFT_01g015960 [Sorghum bicolor]
Length=409

 Score =   337 bits (865),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
             AV +WDAEYYIKVDDDVHVNI TLG  LARHR KPR YIGCMKSGPVL+QKGVRYHEPE
Sbjct  231  AAVSMWDAEYYIKVDDDVHVNIATLGNVLARHRSKPRAYIGCMKSGPVLAQKGVRYHEPE  290

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAISKDLA+YI+ NQHVLHKYANEDVSLG+WFIGLDV HVD
Sbjct  291  YWKFGEWGNKYFRHATGQLYAISKDLASYIALNQHVLHKYANEDVSLGSWFIGLDVEHVD  350

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGT PDCEWKAQAGN+C ASFDW+CSGIC++ DRIKEVH+RCGE E  +WNA F
Sbjct  351  DRRLCCGTTPDCEWKAQAGNVCAASFDWSCSGICKSADRIKEVHQRCGESENAIWNAKF  409



>ref|XP_007153952.1| hypothetical protein PHAVU_003G079100g [Phaseolus vulgaris]
 gb|ESW25946.1| hypothetical protein PHAVU_003G079100g [Phaseolus vulgaris]
Length=380

 Score =   336 bits (862),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDAE+Y+KVDDDVHVN+ TLG TL+ HR KPRVY+GCMKSGPVL+QKGV+YHEPE
Sbjct  202  TAVALWDAEFYVKVDDDVHVNLATLGLTLSMHRMKPRVYVGCMKSGPVLAQKGVKYHEPE  261

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAISKDLATYIS NQ VLHKYANEDVSLG+WFIGLDV HVD
Sbjct  262  YWKFGEVGNKYFRHATGQLYAISKDLATYISINQDVLHKYANEDVSLGSWFIGLDVDHVD  321

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRR+CCGTPPDCEWKAQAGN+CVASFDW CSGICR+V+R+KEVH RCGE E  LW+AA 
Sbjct  322  DRRMCCGTPPDCEWKAQAGNVCVASFDWKCSGICRSVERMKEVHLRCGEDENALWSAAL  380



>ref|XP_010457596.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X1 [Camelina sativa]
Length=441

 Score =   338 bits (867),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 158/212 (75%), Positives = 169/212 (80%), Gaps = 33/212 (16%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIG---------------------------------TLGE  669
            TA  +WDA++Y+KVDDDVHVNIG                                 TLGE
Sbjct  230  TAFSMWDADFYVKVDDDVHVNIGKFSKRVELVLCDVAYVMLVNTNGFNVSLKMSAATLGE  289

Query  668  TLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLA  489
            TL RHRKKPRVYIGCMKSGPVLS KGVRYHEPEYWKFGE GNKYFRHATGQLYAIS+DLA
Sbjct  290  TLVRHRKKPRVYIGCMKSGPVLSHKGVRYHEPEYWKFGENGNKYFRHATGQLYAISRDLA  349

Query  488  TYISANQHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFD  309
            +YIS NQHVLHKYANEDVSLGAWFIG+DV H+DDRRLCCGTPPDCEWKAQAGNICVASFD
Sbjct  350  SYISINQHVLHKYANEDVSLGAWFIGIDVKHIDDRRLCCGTPPDCEWKAQAGNICVASFD  409

Query  308  WTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            W+CSGICR+ DRIKEVHRRCGEGEK LW+A F
Sbjct  410  WSCSGICRSADRIKEVHRRCGEGEKALWSATF  441



>ref|XP_010457597.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Camelina sativa]
Length=438

 Score =   338 bits (867),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 158/212 (75%), Positives = 169/212 (80%), Gaps = 33/212 (16%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIG---------------------------------TLGE  669
            TA  +WDA++Y+KVDDDVHVNIG                                 TLGE
Sbjct  227  TAFSMWDADFYVKVDDDVHVNIGKFSKRVELVLCDVAYVMLVNTNGFNVSLKMSAATLGE  286

Query  668  TLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLA  489
            TL RHRKKPRVYIGCMKSGPVLS KGVRYHEPEYWKFGE GNKYFRHATGQLYAIS+DLA
Sbjct  287  TLVRHRKKPRVYIGCMKSGPVLSHKGVRYHEPEYWKFGENGNKYFRHATGQLYAISRDLA  346

Query  488  TYISANQHVLHKYANEDVSLGAWFIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFD  309
            +YIS NQHVLHKYANEDVSLGAWFIG+DV H+DDRRLCCGTPPDCEWKAQAGNICVASFD
Sbjct  347  SYISINQHVLHKYANEDVSLGAWFIGIDVKHIDDRRLCCGTPPDCEWKAQAGNICVASFD  406

Query  308  WTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            W+CSGICR+ DRIKEVHRRCGEGEK LW+A F
Sbjct  407  WSCSGICRSADRIKEVHRRCGEGEKALWSATF  438



>ref|XP_007020793.1| Galactosyltransferase family protein [Theobroma cacao]
 gb|EOY12318.1| Galactosyltransferase family protein [Theobroma cacao]
Length=406

 Score =   337 bits (863),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 154/179 (86%), Positives = 167/179 (93%), Gaps = 1/179 (1%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TA  LWDA++Y+KVDDDVHVNI TLG TLARHR KPRVYIGCMKSGPVL+QKGVRYHEPE
Sbjct  229  TAAALWDADFYVKVDDDVHVNIATLGATLARHRSKPRVYIGCMKSGPVLAQKGVRYHEPE  288

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAISKDLA+YIS NQHVLHKYANEDVSLG+WFIGLDV H+D
Sbjct  289  YWKFGEEGNKYFRHATGQLYAISKDLASYISINQHVLHKYANEDVSLGSWFIGLDVDHID  348

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGT  DCEWKAQAGNICVASFDWTCSGIC++V+R+KEVHRRCGEG+  LW+AAF
Sbjct  349  DRRLCCGT-TDCEWKAQAGNICVASFDWTCSGICKSVERMKEVHRRCGEGKNALWSAAF  406



>ref|XP_008681412.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|AFW68303.1| hypothetical protein ZEAMMB73_372854 [Zea mays]
Length=416

 Score =   337 bits (863),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 150/178 (84%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = -3

Query  746  AVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPEY  567
            AV  WDAEYY+KVDDDVHVNI TLG TLARHR KPR Y+GCMKSGPVL+QKGVRYHEPEY
Sbjct  239  AVSTWDAEYYVKVDDDVHVNIATLGNTLARHRSKPRAYVGCMKSGPVLAQKGVRYHEPEY  298

Query  566  WKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVDD  387
            WKFGE GN+YFRHA+GQLYAISKDLA+YI+ NQHVLHKYANEDVSLG+WFIGLDV HVDD
Sbjct  299  WKFGEWGNRYFRHASGQLYAISKDLASYIALNQHVLHKYANEDVSLGSWFIGLDVEHVDD  358

Query  386  RRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            RRLCCGTPPDCEWKAQAGN CVASFDW+CSGIC++ DRIKEVH+RCGE E  +WNA F
Sbjct  359  RRLCCGTPPDCEWKAQAGNACVASFDWSCSGICKSADRIKEVHQRCGESENAIWNAEF  416



>ref|XP_009612460.1| PREDICTED: probable beta-1,3-galactosyltransferase 4 isoform 
X1 [Nicotiana tomentosiformis]
Length=398

 Score =   335 bits (860),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 147/179 (82%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TA+ LWDA++Y+KVDDDVHVNIG L  TLARHR  PRVYIGCMKSGPVL+QKGVRYHEPE
Sbjct  220  TAIALWDADFYVKVDDDVHVNIGALAATLARHRSTPRVYIGCMKSGPVLAQKGVRYHEPE  279

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            +WKFGE GN+YFRHATGQLYAISKDLATYIS N+H+LHKYANEDV+LG+WFIGLDV H+D
Sbjct  280  HWKFGEDGNRYFRHATGQLYAISKDLATYISINRHILHKYANEDVTLGSWFIGLDVEHID  339

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DR+LCCGTPPDCE KAQAGNICVASFDW+CSGIC++V+RIKEVH RCGEGE  LW+A F
Sbjct  340  DRKLCCGTPPDCELKAQAGNICVASFDWSCSGICKSVERIKEVHSRCGEGENALWSAIF  398



>gb|KJB57752.1| hypothetical protein B456_009G178900 [Gossypium raimondii]
Length=373

 Score =   334 bits (857),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDAE+Y+KVDDD+HVN+ TLG TLARH KKPRVYIGCMKSGPVL++KGV+YHEPE
Sbjct  187  TAVSLWDAEFYVKVDDDIHVNLATLGVTLARHSKKPRVYIGCMKSGPVLARKGVKYHEPE  246

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAISKDLATYI  NQ+VLHKYANEDVSLGAWFIGLDV HVD
Sbjct  247  YWKFGEVGNKYFRHATGQLYAISKDLATYIFINQNVLHKYANEDVSLGAWFIGLDVEHVD  306

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNIC ASFDW CSGICR+V+RI EVH RCGE +  LW+A F
Sbjct  307  DRRLCCGTPPDCEWKAQAGNICAASFDWRCSGICRSVERIMEVHERCGEDKNALWSANF  365



>ref|NP_001050543.1| Os03g0577500 [Oryza sativa Japonica Group]
 gb|AAT76370.1| putative glycosyltransferase [Oryza sativa Japonica Group]
 gb|ABF97265.1| Galactosyltransferase family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF12457.1| Os03g0577500 [Oryza sativa Japonica Group]
 gb|EAY90748.1| hypothetical protein OsI_12348 [Oryza sativa Indica Group]
 gb|EAZ27579.1| hypothetical protein OsJ_11528 [Oryza sativa Japonica Group]
Length=406

 Score =   335 bits (859),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TA+ +WDAEYYIKVDDDVHVNI TLG  LA+HR KPR YIGCMKSGPVL+QKGVRYHEPE
Sbjct  228  TALSMWDAEYYIKVDDDVHVNIATLGNILAKHRSKPRAYIGCMKSGPVLAQKGVRYHEPE  287

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAISKDLA+YIS NQHVLHKYANEDVSLGAWFIGLDV HVD
Sbjct  288  YWKFGEWGNKYFRHATGQLYAISKDLASYISINQHVLHKYANEDVSLGAWFIGLDVEHVD  347

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGT PDCEWKAQAGN+C ASFDW+CSGIC++ DR+KEVH+RCGE +  +W+A F
Sbjct  348  DRRLCCGTQPDCEWKAQAGNVCAASFDWSCSGICKSADRMKEVHQRCGENDSAIWSAKF  406



>gb|KJB13704.1| hypothetical protein B456_002G089700 [Gossypium raimondii]
Length=368

 Score =   333 bits (855),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 164/179 (92%), Gaps = 1/179 (1%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TA  LWDA++Y+KVDDDVHVNI TLG TLARHR KPRVYIGCMKSGPVL+QKGVRYHEPE
Sbjct  191  TAAALWDADFYVKVDDDVHVNIATLGATLARHRSKPRVYIGCMKSGPVLAQKGVRYHEPE  250

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAISKDLA+YIS NQHVLHKYANEDVSLG+WFIGLDV H+D
Sbjct  251  YWKFGEEGNKYFRHATGQLYAISKDLASYISINQHVLHKYANEDVSLGSWFIGLDVDHID  310

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGT  DCEWKAQAGNICVASFDWTCSGICR+VDR+K+VHRRCGEG+  L  A F
Sbjct  311  DRRLCCGT-TDCEWKAQAGNICVASFDWTCSGICRSVDRMKDVHRRCGEGKNALRTATF  368



>gb|KJB57747.1| hypothetical protein B456_009G178900 [Gossypium raimondii]
Length=406

 Score =   335 bits (858),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDAE+Y+KVDDD+HVN+ TLG TLARH KKPRVYIGCMKSGPVL++KGV+YHEPE
Sbjct  220  TAVSLWDAEFYVKVDDDIHVNLATLGVTLARHSKKPRVYIGCMKSGPVLARKGVKYHEPE  279

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAISKDLATYI  NQ+VLHKYANEDVSLGAWFIGLDV HVD
Sbjct  280  YWKFGEVGNKYFRHATGQLYAISKDLATYIFINQNVLHKYANEDVSLGAWFIGLDVEHVD  339

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNIC ASFDW CSGICR+V+RI EVH RCGE +  LW+A F
Sbjct  340  DRRLCCGTPPDCEWKAQAGNICAASFDWRCSGICRSVERIMEVHERCGEDKNALWSANF  398



>ref|XP_010923856.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 isoform 
X2 [Elaeis guineensis]
Length=412

 Score =   335 bits (859),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV  WDA++Y+KVDDDVHVNI TLG TL RHR K  +YIGCMKSGPVL+QKGVRYHEPE
Sbjct  234  TAVATWDADFYVKVDDDVHVNIATLGTTLGRHRSKHHLYIGCMKSGPVLAQKGVRYHEPE  293

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAISKDLATYIS NQHVLHKYANEDVSLGAWFIGLDV H+D
Sbjct  294  YWKFGEAGNKYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLGAWFIGLDVEHID  353

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGN CVASFDW+CSGIC++ +RI++VHRRCGEGE  LW A F
Sbjct  354  DRRLCCGTPPDCEWKAQAGNTCVASFDWSCSGICKSAERIRDVHRRCGEGENALWGANF  412



>gb|KHG03847.1| putative beta-1,3-galactosyltransferase 2 -like protein [Gossypium 
arboreum]
Length=407

 Score =   335 bits (858),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 151/179 (84%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDAE+Y+KVDDD+HVN+ TLG  LARHRKKPRVYIGCMKSGPVL++KGV+YHEPE
Sbjct  221  TAVSLWDAEFYVKVDDDIHVNLATLGVALARHRKKPRVYIGCMKSGPVLARKGVKYHEPE  280

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAISKDLATYI  NQ+VLHKYANEDVSLGAWFIGLDV HVD
Sbjct  281  YWKFGEVGNKYFRHATGQLYAISKDLATYIFINQNVLHKYANEDVSLGAWFIGLDVEHVD  340

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNIC ASFDW CSGICR+V+RI EVH RCGE +  LW+A F
Sbjct  341  DRRLCCGTPPDCEWKAQAGNICAASFDWRCSGICRSVERIVEVHERCGEDKNALWSANF  399



>ref|XP_006452384.1| hypothetical protein CICLE_v10008439mg [Citrus clementina]
 gb|ESR65624.1| hypothetical protein CICLE_v10008439mg [Citrus clementina]
Length=417

 Score =   335 bits (859),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 149/172 (87%), Positives = 162/172 (94%), Gaps = 0/172 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDA++Y+KVDDDVHVNI TLG TLARHR KPRVYIGCMKSGPVL+QKGVRYHEPE
Sbjct  229  TAVALWDADFYVKVDDDVHVNIATLGATLARHRSKPRVYIGCMKSGPVLAQKGVRYHEPE  288

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAISKDLA+YIS NQHVLHK+ANEDVSLG+WFIGLD  H+D
Sbjct  289  YWKFGEEGNKYFRHATGQLYAISKDLASYISINQHVLHKFANEDVSLGSWFIGLDAEHID  348

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEK  234
            DRRLCCGTPPDCEWKAQAGN+CVASFDW+CSGICR+ +R+KEVHRRCGEG K
Sbjct  349  DRRLCCGTPPDCEWKAQAGNVCVASFDWSCSGICRSAERMKEVHRRCGEGGK  400



>ref|XP_006650268.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Oryza 
brachyantha]
Length=405

 Score =   334 bits (857),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TA+  WDAEYYIKVDDDVHVNI TLG  LA+HR KPR YIGCMKSGPVL+QKGVRYHEPE
Sbjct  227  TALSTWDAEYYIKVDDDVHVNIATLGNILAKHRSKPRAYIGCMKSGPVLAQKGVRYHEPE  286

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAISKDLA+YIS NQHVLHKYANEDVSLGAWFIGLDV HVD
Sbjct  287  YWKFGEWGNKYFRHATGQLYAISKDLASYISINQHVLHKYANEDVSLGAWFIGLDVEHVD  346

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGT PDCEWKAQAGN+C ASFDW+CSGIC++ DR+KEVH+RCGE    +WNA F
Sbjct  347  DRRLCCGTQPDCEWKAQAGNVCAASFDWSCSGICKSADRMKEVHQRCGENGSAIWNAKF  405



>gb|KJB13705.1| hypothetical protein B456_002G089700 [Gossypium raimondii]
Length=373

 Score =   333 bits (853),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 164/179 (92%), Gaps = 1/179 (1%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TA  LWDA++Y+KVDDDVHVNI TLG TLARHR KPRVYIGCMKSGPVL+QKGVRYHEPE
Sbjct  196  TAAALWDADFYVKVDDDVHVNIATLGATLARHRSKPRVYIGCMKSGPVLAQKGVRYHEPE  255

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAISKDLA+YIS NQHVLHKYANEDVSLG+WFIGLDV H+D
Sbjct  256  YWKFGEEGNKYFRHATGQLYAISKDLASYISINQHVLHKYANEDVSLGSWFIGLDVDHID  315

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGT  DCEWKAQAGNICVASFDWTCSGICR+VDR+K+VHRRCGEG+  L  A F
Sbjct  316  DRRLCCGT-TDCEWKAQAGNICVASFDWTCSGICRSVDRMKDVHRRCGEGKNALRTATF  373



>ref|XP_011097870.1| PREDICTED: probable beta-1,3-galactosyltransferase 4 isoform 
X2 [Sesamum indicum]
Length=403

 Score =   334 bits (856),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 164/179 (92%), Gaps = 1/179 (1%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDA++Y+KVDDDVHVNI TLG TLARHR KPRVYIGCMKSGPVL+QKGVRYHEPE
Sbjct  226  TAVTLWDADFYVKVDDDVHVNIATLGGTLARHRLKPRVYIGCMKSGPVLAQKGVRYHEPE  285

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQ+YAISKDLATYIS NQH+LHKYANEDVSLG+WFIGLDV H+D
Sbjct  286  YWKFGEQGNKYFRHATGQIYAISKDLATYISINQHILHKYANEDVSLGSWFIGLDVEHID  345

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGT  DCEWKAQAGN+CVASFDW+CSGIC + DRIKEVHRRCGEGE  LW A F
Sbjct  346  DRRLCCGT-TDCEWKAQAGNMCVASFDWSCSGICNSADRIKEVHRRCGEGEDSLWAADF  403



>ref|XP_010655390.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Vitis vinifera]
 emb|CBI23239.3| unnamed protein product [Vitis vinifera]
Length=408

 Score =   333 bits (855),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 146/179 (82%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDA++Y+KVDDDVHVNIGTL  TLA++R +PRVYIGCMKSGPVL+QKGV+YHEPE
Sbjct  230  TAVALWDADFYVKVDDDVHVNIGTLAMTLAQYRLQPRVYIGCMKSGPVLAQKGVKYHEPE  289

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAISK+LATYIS N+HVLHKYANEDVSLG+WFIGLDV H+D
Sbjct  290  YWKFGEEGNKYFRHATGQLYAISKNLATYISINRHVLHKYANEDVSLGSWFIGLDVEHID  349

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKA+AGN+CVASFDW+CSGICR+ +R+K+VH+RCGEG+  LW+A F
Sbjct  350  DRRLCCGTPPDCEWKAEAGNVCVASFDWSCSGICRSSERMKDVHQRCGEGKNALWSAVF  408



>ref|XP_002518474.1| Beta-1,3-galactosyltransferase sqv-2, putative [Ricinus communis]
 gb|EEF43861.1| Beta-1,3-galactosyltransferase sqv-2, putative [Ricinus communis]
Length=388

 Score =   332 bits (852),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDAE+Y+KVDDDVHVN+ TLG TLA HR KPRVYIGCMKSGPV+++KGVRYHEPE
Sbjct  210  TAVALWDAEFYVKVDDDVHVNLATLGMTLAGHRMKPRVYIGCMKSGPVIARKGVRYHEPE  269

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GN+YFRHATGQLYAISKDLATYIS NQHVLHKYANEDVSLG+WFIGLDV HVD
Sbjct  270  YWKFGEVGNRYFRHATGQLYAISKDLATYISVNQHVLHKYANEDVSLGSWFIGLDVDHVD  329

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWK Q GN+C ASFDW CSGIC++V+RI EVH+RCGE E  LW A F
Sbjct  330  DRRLCCGTPPDCEWKTQLGNVCAASFDWKCSGICKSVERIMEVHKRCGEDENALWTATF  388



>gb|KJB13702.1| hypothetical protein B456_002G089700 [Gossypium raimondii]
Length=406

 Score =   332 bits (852),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 164/179 (92%), Gaps = 1/179 (1%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TA  LWDA++Y+KVDDDVHVNI TLG TLARHR KPRVYIGCMKSGPVL+QKGVRYHEPE
Sbjct  229  TAAALWDADFYVKVDDDVHVNIATLGATLARHRSKPRVYIGCMKSGPVLAQKGVRYHEPE  288

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAISKDLA+YIS NQHVLHKYANEDVSLG+WFIGLDV H+D
Sbjct  289  YWKFGEEGNKYFRHATGQLYAISKDLASYISINQHVLHKYANEDVSLGSWFIGLDVDHID  348

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGT  DCEWKAQAGNICVASFDWTCSGICR+VDR+K+VHRRCGEG+  L  A F
Sbjct  349  DRRLCCGT-TDCEWKAQAGNICVASFDWTCSGICRSVDRMKDVHRRCGEGKNALRTATF  406



>ref|XP_007026088.1| Galactosyltransferase family protein isoform 1 [Theobroma cacao]
 gb|EOY28710.1| Galactosyltransferase family protein isoform 1 [Theobroma cacao]
Length=415

 Score =   333 bits (853),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDAE+Y+KVDDDVHVN+ TLG TLA H  KPRVYIGCMKSGPVL++KGV+YHEPE
Sbjct  229  TAVSLWDAEFYVKVDDDVHVNLATLGSTLAGHSNKPRVYIGCMKSGPVLARKGVKYHEPE  288

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAISKDLATYIS NQ+VLHKYANEDVSLG+WFIGLDV HVD
Sbjct  289  YWKFGEVGNKYFRHATGQLYAISKDLATYISINQNVLHKYANEDVSLGSWFIGLDVEHVD  348

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNICVASFDW CSGICR+V+RI EVH RCGE +  LW+  F
Sbjct  349  DRRLCCGTPPDCEWKAQAGNICVASFDWRCSGICRSVERIIEVHERCGEDKNALWSTNF  407



>ref|XP_003562342.1| PREDICTED: probable beta-1,3-galactosyltransferase 2 [Brachypodium 
distachyon]
Length=405

 Score =   332 bits (850),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 147/179 (82%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV  WDA+YY+KVDDDVHVNI TLG  LARHR KPRVYIGCMKSGPVL+QKGVRYHEPE
Sbjct  227  TAVSTWDADYYVKVDDDVHVNIATLGGILARHRSKPRVYIGCMKSGPVLAQKGVRYHEPE  286

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAISKDLA+YIS N+HVLHKYANEDVSLGAWFIG+D  H+D
Sbjct  287  YWKFGEWGNKYFRHATGQLYAISKDLASYISINKHVLHKYANEDVSLGAWFIGVDAEHID  346

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            +RRLCCGTPPDCEWK QAGN+C ASFDW+CSGIC++ DRIKEVH+RCGE    +WNA F
Sbjct  347  ERRLCCGTPPDCEWKTQAGNVCAASFDWSCSGICKSADRIKEVHQRCGESANAIWNATF  405



>gb|KDO78242.1| hypothetical protein CISIN_1g015962mg [Citrus sinensis]
Length=359

 Score =   330 bits (846),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 146/179 (82%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV +WDAE+YIKVDDDVHVN+ TLG TLA HR KPRVY+GCMKSGPVL++KGV+Y+EPE
Sbjct  181  TAVSMWDAEFYIKVDDDVHVNLATLGMTLAAHRTKPRVYVGCMKSGPVLARKGVKYYEPE  240

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYA+SKDLATYIS NQH+LHKYANEDVSLG+WFIGLDV HVD
Sbjct  241  YWKFGEIGNKYFRHATGQLYALSKDLATYISINQHLLHKYANEDVSLGSWFIGLDVEHVD  300

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQ G  CVA+FDW CSGIC++V+RIKEVH  CGEGE  LW A+F
Sbjct  301  DRRLCCGTPPDCEWKAQLGKTCVATFDWRCSGICKSVERIKEVHELCGEGEDTLWRASF  359



>gb|KJB69212.1| hypothetical protein B456_011G013600 [Gossypium raimondii]
Length=346

 Score =   330 bits (845),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 147/179 (82%), Positives = 158/179 (88%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDAE+Y+KVDDDVHVN+ TLG TL  HRKKPRVYIGCMKSGPVL++KGV+YHEPE
Sbjct  150  TAVSLWDAEFYVKVDDDVHVNLATLGMTLTEHRKKPRVYIGCMKSGPVLARKGVKYHEPE  209

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLY ISKDLATYI  NQ VLHKYANEDVSLG+WFIGLDV HVD
Sbjct  210  YWKFGEVGNKYFRHATGQLYVISKDLATYILINQDVLHKYANEDVSLGSWFIGLDVEHVD  269

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNIC ASFDW CSGICR+V+RI EVH +CGE +  LW   F
Sbjct  270  DRRLCCGTPPDCEWKAQAGNICAASFDWKCSGICRSVERIMEVHEQCGEDKNALWTTNF  328



>gb|KHG30061.1| putative beta-1,3-galactosyltransferase 4 -like protein [Gossypium 
arboreum]
Length=406

 Score =   332 bits (850),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 164/179 (92%), Gaps = 1/179 (1%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TA  LWDA++Y+KVDDDVHVNI TLG TLARHR KPRVYIGCMKSGPVL+QKGVRYHEPE
Sbjct  229  TAAALWDADFYVKVDDDVHVNIATLGATLARHRSKPRVYIGCMKSGPVLAQKGVRYHEPE  288

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAISKDLA+YIS NQHVLHKYANEDVSLG+WFIGLDV H+D
Sbjct  289  YWKFGEEGNKYFRHATGQLYAISKDLASYISINQHVLHKYANEDVSLGSWFIGLDVDHID  348

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGT  DCEWKAQAGNICVASFDWTCSGICR+VDR+++VHRRCGEG+  L  A F
Sbjct  349  DRRLCCGT-TDCEWKAQAGNICVASFDWTCSGICRSVDRMRDVHRRCGEGKNALRTATF  406



>gb|KDO78243.1| hypothetical protein CISIN_1g015962mg [Citrus sinensis]
Length=317

 Score =   328 bits (841),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 146/179 (82%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV +WDAE+YIKVDDDVHVN+ TLG TLA HR KPRVY+GCMKSGPVL++KGV+Y+EPE
Sbjct  139  TAVSMWDAEFYIKVDDDVHVNLATLGMTLAAHRTKPRVYVGCMKSGPVLARKGVKYYEPE  198

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYA+SKDLATYIS NQH+LHKYANEDVSLG+WFIGLDV HVD
Sbjct  199  YWKFGEIGNKYFRHATGQLYALSKDLATYISINQHLLHKYANEDVSLGSWFIGLDVEHVD  258

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQ G  CVA+FDW CSGIC++V+RIKEVH  CGEGE  LW A+F
Sbjct  259  DRRLCCGTPPDCEWKAQLGKTCVATFDWRCSGICKSVERIKEVHELCGEGEDTLWRASF  317



>ref|XP_011097866.1| PREDICTED: probable beta-1,3-galactosyltransferase 4 isoform 
X1 [Sesamum indicum]
 ref|XP_011097867.1| PREDICTED: probable beta-1,3-galactosyltransferase 4 isoform 
X1 [Sesamum indicum]
 ref|XP_011097869.1| PREDICTED: probable beta-1,3-galactosyltransferase 4 isoform 
X1 [Sesamum indicum]
Length=474

 Score =   333 bits (855),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 153/179 (85%), Positives = 164/179 (92%), Gaps = 1/179 (1%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDA++Y+KVDDDVHVNI TLG TLARHR KPRVYIGCMKSGPVL+QKGVRYHEPE
Sbjct  297  TAVTLWDADFYVKVDDDVHVNIATLGGTLARHRLKPRVYIGCMKSGPVLAQKGVRYHEPE  356

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQ+YAISKDLATYIS NQH+LHKYANEDVSLG+WFIGLDV H+D
Sbjct  357  YWKFGEQGNKYFRHATGQIYAISKDLATYISINQHILHKYANEDVSLGSWFIGLDVEHID  416

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGT  DCEWKAQAGN+CVASFDW+CSGIC + DRIKEVHRRCGEGE  LW A F
Sbjct  417  DRRLCCGT-TDCEWKAQAGNMCVASFDWSCSGICNSADRIKEVHRRCGEGEDSLWAADF  474



>ref|XP_010536663.1| PREDICTED: probable beta-1,3-galactosyltransferase 4 isoform 
X2 [Tarenaya hassleriana]
Length=405

 Score =   331 bits (848),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 164/179 (92%), Gaps = 1/179 (1%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TA  LWDAE+Y+KVDDDVHVNI TLG TLA HR KPRVYIGCMKSGPVL+QKGVRYHEPE
Sbjct  228  TAFALWDAEFYVKVDDDVHVNIATLGATLATHRMKPRVYIGCMKSGPVLAQKGVRYHEPE  287

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            +WKFGE GNKYFRHATGQLYAIS+DLA+YIS NQHVLHKYANEDVSLGAWFIGLDV H+D
Sbjct  288  FWKFGEEGNKYFRHATGQLYAISRDLASYISINQHVLHKYANEDVSLGAWFIGLDVEHID  347

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGT  DCEWKAQAGN+CVASFDW+CSGICR+ DR+K+VHRRCGEG   LW+++F
Sbjct  348  DRRLCCGT-TDCEWKAQAGNMCVASFDWSCSGICRSADRMKDVHRRCGEGHNALWSSSF  405



>ref|XP_010536662.1| PREDICTED: probable beta-1,3-galactosyltransferase 4 isoform 
X1 [Tarenaya hassleriana]
Length=428

 Score =   331 bits (848),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 164/179 (92%), Gaps = 1/179 (1%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TA  LWDAE+Y+KVDDDVHVNI TLG TLA HR KPRVYIGCMKSGPVL+QKGVRYHEPE
Sbjct  251  TAFALWDAEFYVKVDDDVHVNIATLGATLATHRMKPRVYIGCMKSGPVLAQKGVRYHEPE  310

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            +WKFGE GNKYFRHATGQLYAIS+DLA+YIS NQHVLHKYANEDVSLGAWFIGLDV H+D
Sbjct  311  FWKFGEEGNKYFRHATGQLYAISRDLASYISINQHVLHKYANEDVSLGAWFIGLDVEHID  370

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGT  DCEWKAQAGN+CVASFDW+CSGICR+ DR+K+VHRRCGEG   LW+++F
Sbjct  371  DRRLCCGT-TDCEWKAQAGNMCVASFDWSCSGICRSADRMKDVHRRCGEGHNALWSSSF  428



>ref|XP_006467430.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X2 [Citrus sinensis]
 gb|KDO78236.1| hypothetical protein CISIN_1g015962mg [Citrus sinensis]
Length=396

 Score =   330 bits (845),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 146/179 (82%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV +WDAE+YIKVDDDVHVN+ TLG TLA HR KPRVY+GCMKSGPVL++KGV+Y+EPE
Sbjct  218  TAVSMWDAEFYIKVDDDVHVNLATLGMTLAAHRTKPRVYVGCMKSGPVLARKGVKYYEPE  277

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYA+SKDLATYIS NQH+LHKYANEDVSLG+WFIGLDV HVD
Sbjct  278  YWKFGEIGNKYFRHATGQLYALSKDLATYISINQHLLHKYANEDVSLGSWFIGLDVEHVD  337

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQ G  CVA+FDW CSGIC++V+RIKEVH  CGEGE  LW A+F
Sbjct  338  DRRLCCGTPPDCEWKAQLGKTCVATFDWRCSGICKSVERIKEVHELCGEGEDTLWRASF  396



>ref|XP_006467429.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like isoform 
X1 [Citrus sinensis]
 gb|KDO78235.1| hypothetical protein CISIN_1g015962mg [Citrus sinensis]
Length=397

 Score =   330 bits (845),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 146/179 (82%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV +WDAE+YIKVDDDVHVN+ TLG TLA HR KPRVY+GCMKSGPVL++KGV+Y+EPE
Sbjct  219  TAVSMWDAEFYIKVDDDVHVNLATLGMTLAAHRTKPRVYVGCMKSGPVLARKGVKYYEPE  278

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYA+SKDLATYIS NQH+LHKYANEDVSLG+WFIGLDV HVD
Sbjct  279  YWKFGEIGNKYFRHATGQLYALSKDLATYISINQHLLHKYANEDVSLGSWFIGLDVEHVD  338

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQ G  CVA+FDW CSGIC++V+RIKEVH  CGEGE  LW A+F
Sbjct  339  DRRLCCGTPPDCEWKAQLGKTCVATFDWRCSGICKSVERIKEVHELCGEGEDTLWRASF  397



>ref|XP_002269415.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X1 [Vitis 
vinifera]
 ref|XP_010652983.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X1 [Vitis 
vinifera]
 emb|CBI21654.3| unnamed protein product [Vitis vinifera]
Length=397

 Score =   330 bits (845),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 144/178 (81%), Positives = 161/178 (90%), Gaps = 0/178 (0%)
 Frame = -3

Query  746  AVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPEY  567
            AV  WDAE+Y+KVDDDVHVN+G L  TLARHR KPRVYIGCMKSGPVLSQK V+YHEPEY
Sbjct  220  AVAQWDAEFYVKVDDDVHVNLGMLASTLARHRSKPRVYIGCMKSGPVLSQKTVKYHEPEY  279

Query  566  WKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVDD  387
            WKFGE GNKYFRHATGQ+YAISKDLATYIS NQ +LHKYANEDVSLGAWFIGL+V H+DD
Sbjct  280  WKFGEEGNKYFRHATGQIYAISKDLATYISVNQPILHKYANEDVSLGAWFIGLEVEHIDD  339

Query  386  RRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            R LCCGTPPDCEWKAQAGN+CVASFDW+CSGIC++V+RIK+VH RCGEG+  +W+  F
Sbjct  340  RNLCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVERIKDVHARCGEGDGAIWSTPF  397



>ref|XP_010652984.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X2 [Vitis 
vinifera]
Length=396

 Score =   329 bits (844),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 144/178 (81%), Positives = 161/178 (90%), Gaps = 0/178 (0%)
 Frame = -3

Query  746  AVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPEY  567
            AV  WDAE+Y+KVDDDVHVN+G L  TLARHR KPRVYIGCMKSGPVLSQK V+YHEPEY
Sbjct  219  AVAQWDAEFYVKVDDDVHVNLGMLASTLARHRSKPRVYIGCMKSGPVLSQKTVKYHEPEY  278

Query  566  WKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVDD  387
            WKFGE GNKYFRHATGQ+YAISKDLATYIS NQ +LHKYANEDVSLGAWFIGL+V H+DD
Sbjct  279  WKFGEEGNKYFRHATGQIYAISKDLATYISVNQPILHKYANEDVSLGAWFIGLEVEHIDD  338

Query  386  RRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            R LCCGTPPDCEWKAQAGN+CVASFDW+CSGIC++V+RIK+VH RCGEG+  +W+  F
Sbjct  339  RNLCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVERIKDVHARCGEGDGAIWSTPF  396



>gb|KCW70545.1| hypothetical protein EUGRSUZ_F03738 [Eucalyptus grandis]
Length=313

 Score =   327 bits (837),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 140/177 (79%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV +WDA++YIKVDDDVHVN+G L  TLARHR KPRVYIGCMKSGPVLS K V+YHEPE
Sbjct  135  TAVAMWDADFYIKVDDDVHVNLGMLATTLARHRSKPRVYIGCMKSGPVLSSKNVKYHEPE  194

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQ+YA+S+DLATYIS NQ +LHKYANEDVSLGAWFIGL+V H+D
Sbjct  195  YWKFGEEGNKYFRHATGQIYALSRDLATYISINQPILHKYANEDVSLGAWFIGLEVEHID  254

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNA  219
            DR +CCGTPPDCEWKAQAGN+C+ASFDW+CSGIC++V++IK+VHRRCGEG+  +W+A
Sbjct  255  DRNMCCGTPPDCEWKAQAGNVCIASFDWSCSGICKSVEKIKDVHRRCGEGDAAVWDA  311



>ref|XP_007039333.1| Galactosyltransferase family protein isoform 2 [Theobroma cacao]
 gb|EOY23834.1| Galactosyltransferase family protein isoform 2 [Theobroma cacao]
Length=402

 Score =   329 bits (844),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 142/179 (79%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV  WDA++YIKVDDDVHVN+G +G TLARHR KPRVYIGCMKSGPVL+QKGV+YHEPE
Sbjct  224  TAVSKWDADFYIKVDDDVHVNLGMVGSTLARHRSKPRVYIGCMKSGPVLAQKGVKYHEPE  283

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQ+YAISKDLATYIS N+H+LH+YANEDVSLG+WFIGLDV H+D
Sbjct  284  YWKFGEEGNKYFRHATGQIYAISKDLATYISVNRHILHRYANEDVSLGSWFIGLDVEHID  343

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DR LCCGTPPDCEWKAQAGN C ASFDW+CSGIC++V+R++EVH+RCGEG++ +W+ +F
Sbjct  344  DRSLCCGTPPDCEWKAQAGNPCAASFDWSCSGICKSVERMEEVHQRCGEGDEAIWHTSF  402



>gb|KJB69210.1| hypothetical protein B456_011G013600 [Gossypium raimondii]
Length=418

 Score =   330 bits (845),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 147/179 (82%), Positives = 158/179 (88%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDAE+Y+KVDDDVHVN+ TLG TL  HRKKPRVYIGCMKSGPVL++KGV+YHEPE
Sbjct  222  TAVSLWDAEFYVKVDDDVHVNLATLGMTLTEHRKKPRVYIGCMKSGPVLARKGVKYHEPE  281

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLY ISKDLATYI  NQ VLHKYANEDVSLG+WFIGLDV HVD
Sbjct  282  YWKFGEVGNKYFRHATGQLYVISKDLATYILINQDVLHKYANEDVSLGSWFIGLDVEHVD  341

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNIC ASFDW CSGICR+V+RI EVH +CGE +  LW   F
Sbjct  342  DRRLCCGTPPDCEWKAQAGNICAASFDWKCSGICRSVERIMEVHEQCGEDKNALWTTNF  400



>gb|KJB69211.1| hypothetical protein B456_011G013600 [Gossypium raimondii]
Length=417

 Score =   330 bits (845),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 147/179 (82%), Positives = 158/179 (88%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDAE+Y+KVDDDVHVN+ TLG TL  HRKKPRVYIGCMKSGPVL++KGV+YHEPE
Sbjct  221  TAVSLWDAEFYVKVDDDVHVNLATLGMTLTEHRKKPRVYIGCMKSGPVLARKGVKYHEPE  280

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLY ISKDLATYI  NQ VLHKYANEDVSLG+WFIGLDV HVD
Sbjct  281  YWKFGEVGNKYFRHATGQLYVISKDLATYILINQDVLHKYANEDVSLGSWFIGLDVEHVD  340

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGNIC ASFDW CSGICR+V+RI EVH +CGE +  LW   F
Sbjct  341  DRRLCCGTPPDCEWKAQAGNICAASFDWKCSGICRSVERIMEVHEQCGEDKNALWTTNF  399



>gb|EYU23928.1| hypothetical protein MIMGU_mgv1a007764mg [Erythranthe guttata]
Length=396

 Score =   329 bits (843),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 141/177 (80%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV  WDA++Y+KVDDDVHVN+GTL  TLARHR KPRVYIGCMKSGPVLSQK V+YHEPE
Sbjct  218  TAVAKWDADFYVKVDDDVHVNLGTLAATLARHRPKPRVYIGCMKSGPVLSQKNVKYHEPE  277

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQ+YA+SKDLATYIS NQH+LHKYANEDVSLGAWFIGL+V H+D
Sbjct  278  YWKFGEDGNKYFRHATGQIYALSKDLATYISINQHILHKYANEDVSLGAWFIGLEVEHID  337

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNA  219
            +R +CCGTPPDCEWK+QAGN+C+ASFDW+CSGIC++V+++K VH +CGEGE+ LWNA
Sbjct  338  ERNMCCGTPPDCEWKSQAGNVCIASFDWSCSGICKSVEKMKFVHEQCGEGEEALWNA  394



>gb|KDP20741.1| hypothetical protein JCGZ_21212 [Jatropha curcas]
Length=386

 Score =   328 bits (842),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 147/179 (82%), Positives = 159/179 (89%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TA+ LWDAE+Y+KVDDDVHVN+ TLG  L  HR KPRVYIGCMKSGPVL+++GVRYHEPE
Sbjct  208  TALNLWDAEFYVKVDDDVHVNLATLGMALVGHRTKPRVYIGCMKSGPVLARRGVRYHEPE  267

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAISKDLATYIS NQ VLHKYANEDVSLG+WFIGLDV HVD
Sbjct  268  YWKFGEVGNKYFRHATGQLYAISKDLATYISINQRVLHKYANEDVSLGSWFIGLDVEHVD  327

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQ GNIC ASFDW CSGIC++V+RI EVH+RCGE E  LW A F
Sbjct  328  DRRLCCGTPPDCEWKAQLGNICAASFDWKCSGICKSVERIMEVHKRCGEDENALWTARF  386



>ref|XP_007039332.1| Galactosyltransferase family protein isoform 1 [Theobroma cacao]
 gb|EOY23833.1| Galactosyltransferase family protein isoform 1 [Theobroma cacao]
Length=397

 Score =   328 bits (842),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 142/179 (79%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV  WDA++YIKVDDDVHVN+G +G TLARHR KPRVYIGCMKSGPVL+QKGV+YHEPE
Sbjct  219  TAVSKWDADFYIKVDDDVHVNLGMVGSTLARHRSKPRVYIGCMKSGPVLAQKGVKYHEPE  278

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQ+YAISKDLATYIS N+H+LH+YANEDVSLG+WFIGLDV H+D
Sbjct  279  YWKFGEEGNKYFRHATGQIYAISKDLATYISVNRHILHRYANEDVSLGSWFIGLDVEHID  338

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DR LCCGTPPDCEWKAQAGN C ASFDW+CSGIC++V+R++EVH+RCGEG++ +W+ +F
Sbjct  339  DRSLCCGTPPDCEWKAQAGNPCAASFDWSCSGICKSVERMEEVHQRCGEGDEAIWHTSF  397



>ref|XP_010092200.1| putative beta-1,3-galactosyltransferase 2 [Morus notabilis]
 gb|EXB50426.1| putative beta-1,3-galactosyltransferase 2 [Morus notabilis]
Length=407

 Score =   328 bits (842),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 145/179 (81%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDA++Y+KVDDDVHVN+ TLG TL+R R KPRVYIGCMKSGPVL++KGVRYHEPE
Sbjct  229  TAVALWDAQFYVKVDDDVHVNLATLGVTLSRLRMKPRVYIGCMKSGPVLARKGVRYHEPE  288

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFG  GNKYFRHATGQLYA+SK+LATYIS NQHVLHKYANEDVS+G+WFIGLDV HVD
Sbjct  289  YWKFGTAGNKYFRHATGQLYAVSKELATYISINQHVLHKYANEDVSVGSWFIGLDVEHVD  348

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGN+CVASFDW CSGIC +V+R+ EVHRRC E E  LW+ +F
Sbjct  349  DRRLCCGTPPDCEWKAQAGNMCVASFDWRCSGICSSVERMAEVHRRCSEDENTLWSESF  407



>gb|KCW70544.1| hypothetical protein EUGRSUZ_F03738 [Eucalyptus grandis]
Length=356

 Score =   327 bits (837),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 140/177 (79%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV +WDA++YIKVDDDVHVN+G L  TLARHR KPRVYIGCMKSGPVLS K V+YHEPE
Sbjct  178  TAVAMWDADFYIKVDDDVHVNLGMLATTLARHRSKPRVYIGCMKSGPVLSSKNVKYHEPE  237

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQ+YA+S+DLATYIS NQ +LHKYANEDVSLGAWFIGL+V H+D
Sbjct  238  YWKFGEEGNKYFRHATGQIYALSRDLATYISINQPILHKYANEDVSLGAWFIGLEVEHID  297

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNA  219
            DR +CCGTPPDCEWKAQAGN+C+ASFDW+CSGIC++V++IK+VHRRCGEG+  +W+A
Sbjct  298  DRNMCCGTPPDCEWKAQAGNVCIASFDWSCSGICKSVEKIKDVHRRCGEGDAAVWDA  354



>ref|XP_002518935.1| Beta-1,3-galactosyltransferase sqv-2, putative [Ricinus communis]
 gb|EEF43468.1| Beta-1,3-galactosyltransferase sqv-2, putative [Ricinus communis]
Length=403

 Score =   328 bits (841),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV  WDA++YIKVDDDVH+N+G +G TLARHR KPRVYIGCMKSGPVLSQKGV+YHEPE
Sbjct  225  TAVSRWDADFYIKVDDDVHINLGMIGSTLARHRSKPRVYIGCMKSGPVLSQKGVKYHEPE  284

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQ+YAISK+LATYIS N+H+LH+YANEDVS+G+WFIGLDV H+D
Sbjct  285  YWKFGEEGNKYFRHATGQIYAISKNLATYISVNRHILHRYANEDVSMGSWFIGLDVEHID  344

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DR LCCGTPPDCEWKAQAGN C ASFDWTCSGIC++V+R++EVH+RCGEG+  +W+ +F
Sbjct  345  DRSLCCGTPPDCEWKAQAGNPCAASFDWTCSGICKSVERMEEVHQRCGEGDGAIWHTSF  403



>ref|XP_007045661.1| Galactosyltransferase family protein [Theobroma cacao]
 gb|EOY01493.1| Galactosyltransferase family protein [Theobroma cacao]
Length=435

 Score =   329 bits (843),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 147/164 (90%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDA++Y+KVDDDVHVNI TLGETL RHRKKPR+YIGCMKSGPVLSQKGVRYHEPE
Sbjct  226  TAVALWDADFYVKVDDDVHVNIATLGETLVRHRKKPRIYIGCMKSGPVLSQKGVRYHEPE  285

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            +WKFGE GNKYFRHATGQLYAISKDLATYIS NQHVLHKYANEDVSLG+WFIGLD  H+D
Sbjct  286  HWKFGEAGNKYFRHATGQLYAISKDLATYISINQHVLHKYANEDVSLGSWFIGLDAEHID  345

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVH  258
            DRRLCCGTPPDCEWKAQAGNICVASFDW+CSGICR+ DRIKEVH
Sbjct  346  DRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSADRIKEVH  389



>ref|XP_007039335.1| Beta-1,3-galactosyltransferase 6 isoform 4 [Theobroma cacao]
 gb|EOY23836.1| Beta-1,3-galactosyltransferase 6 isoform 4 [Theobroma cacao]
Length=429

 Score =   329 bits (843),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 142/179 (79%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV  WDA++YIKVDDDVHVN+G +G TLARHR KPRVYIGCMKSGPVL+QKGV+YHEPE
Sbjct  251  TAVSKWDADFYIKVDDDVHVNLGMVGSTLARHRSKPRVYIGCMKSGPVLAQKGVKYHEPE  310

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQ+YAISKDLATYIS N+H+LH+YANEDVSLG+WFIGLDV H+D
Sbjct  311  YWKFGEEGNKYFRHATGQIYAISKDLATYISVNRHILHRYANEDVSLGSWFIGLDVEHID  370

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DR LCCGTPPDCEWKAQAGN C ASFDW+CSGIC++V+R++EVH+RCGEG++ +W+ +F
Sbjct  371  DRSLCCGTPPDCEWKAQAGNPCAASFDWSCSGICKSVERMEEVHQRCGEGDEAIWHTSF  429



>ref|XP_001758882.1| predicted protein [Physcomitrella patens]
 gb|EDQ76388.1| predicted protein [Physcomitrella patens]
Length=398

 Score =   328 bits (840),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 146/179 (82%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAVK WDA++Y+KVDDDVHVN+G LG TLARHR KPRVYIGCMKSGPVL+QKGV+YHEPE
Sbjct  219  TAVKKWDADFYVKVDDDVHVNLGVLGTTLARHRSKPRVYIGCMKSGPVLNQKGVKYHEPE  278

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQ+YA+SKDLA YI+ NQ +LHKYANEDVSLGAW IGLDV HVD
Sbjct  279  YWKFGEEGNKYFRHATGQIYALSKDLANYIAVNQLLLHKYANEDVSLGAWIIGLDVSHVD  338

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DR +CCGTPPDCEWKA AGNICVASFDWTCSGIC++V+RIKEVH+RCGEG+  +W+A F
Sbjct  339  DRNMCCGTPPDCEWKALAGNICVASFDWTCSGICKSVERIKEVHQRCGEGDDAVWSAVF  397



>ref|XP_010916559.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Elaeis guineensis]
Length=398

 Score =   327 bits (839),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TA+ LWDAE+Y+KVDDDVHVN+G L  TLARHR KPR YIGCMKSGPVLSQK V+YHEPE
Sbjct  220  TAIALWDAEFYVKVDDDVHVNLGMLAATLARHRSKPRTYIGCMKSGPVLSQKNVKYHEPE  279

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQ+YAISKDLATYIS NQ +LHKYANEDVSLG+WFIGL+V H+D
Sbjct  280  YWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGSWFIGLEVEHID  339

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            +R +CCGTPPDCEWKAQAGN+C+ASFDW+CSGIC++V+R+KEVH RCGEG+  +W+A F
Sbjct  340  ERNMCCGTPPDCEWKAQAGNVCIASFDWSCSGICKSVERMKEVHARCGEGDDGVWSALF  398



>gb|KDP25226.1| hypothetical protein JCGZ_20382 [Jatropha curcas]
Length=403

 Score =   327 bits (839),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 142/179 (79%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV  WDA++YIKVDDDVHVN+G +G TLARHR KPRVYIGCMKSGPVLSQKGV+YHEPE
Sbjct  225  TAVAKWDADFYIKVDDDVHVNLGMVGSTLARHRSKPRVYIGCMKSGPVLSQKGVKYHEPE  284

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQ+YAISKDLATYIS N+H+LH+Y+NEDVSLG+WFIGLDV H+D
Sbjct  285  YWKFGEEGNKYFRHATGQIYAISKDLATYISVNRHILHRYSNEDVSLGSWFIGLDVEHID  344

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            +R LCCGTPPDCEWKAQAGN C ASFDWTCSGIC++V+R+ EVH+RCGEG+  +W+ +F
Sbjct  345  ERSLCCGTPPDCEWKAQAGNPCAASFDWTCSGICKSVERMVEVHQRCGEGDGAIWHTSF  403



>ref|XP_004507687.1| PREDICTED: probable beta-1,3-galactosyltransferase 2-like [Cicer 
arietinum]
Length=378

 Score =   327 bits (837),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 145/179 (81%), Positives = 160/179 (89%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDAE+Y+KVDDDVHVN+ TL   L  HR KPRVYIGCMKSGPVL+QKGV+YHEPE
Sbjct  199  TAVALWDAEFYVKVDDDVHVNLATLALILTMHRLKPRVYIGCMKSGPVLAQKGVKYHEPE  258

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAIS+DLATYIS NQ VLHKYANEDVSLG+WFIGLDV HVD
Sbjct  259  YWKFGEVGNKYFRHATGQLYAISQDLATYISTNQDVLHKYANEDVSLGSWFIGLDVDHVD  318

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRR+CCGTPPDCEWKAQAGNIC ASFDW CSGICR+V+R+++VH RCGE E  LW++ F
Sbjct  319  DRRMCCGTPPDCEWKAQAGNICAASFDWKCSGICRSVERMQDVHLRCGEDENALWSSTF  377



>gb|EYU22897.1| hypothetical protein MIMGU_mgv1a007777mg [Erythranthe guttata]
Length=395

 Score =   327 bits (838),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 142/177 (80%), Positives = 162/177 (92%), Gaps = 0/177 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV  WDA++Y+KVDDDVHVN+GTL   LARHR KPRVYIGCMKSGPVL+QK V+YHEPE
Sbjct  217  TAVAKWDADFYVKVDDDVHVNLGTLAANLARHRSKPRVYIGCMKSGPVLAQKNVKYHEPE  276

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQ+YAISKDLATYIS NQ +LHKYANEDVSLGAWFIGL+V H+D
Sbjct  277  YWKFGEEGNKYFRHATGQIYAISKDLATYISINQPLLHKYANEDVSLGAWFIGLEVEHID  336

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNA  219
            DR +CCGTPPDCEWKAQAGN+CVASFDW+CSGIC++V+++K VH +CGEGE+ LWNA
Sbjct  337  DRSMCCGTPPDCEWKAQAGNVCVASFDWSCSGICKSVEKLKFVHEQCGEGEEALWNA  393



>ref|XP_001781844.1| predicted protein [Physcomitrella patens]
 gb|EDQ53299.1| predicted protein [Physcomitrella patens]
Length=371

 Score =   326 bits (836),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 143/179 (80%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAVK W+A++Y+KVDDDVHVN+G LG TLARHR KPRVYIGCMKSGPVL+QKGV+YHEPE
Sbjct  192  TAVKKWNADFYVKVDDDVHVNLGVLGTTLARHRSKPRVYIGCMKSGPVLAQKGVKYHEPE  251

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQ+YAIS+DLA YIS NQ +LHK+ANEDVSLGAW IGLDV H+D
Sbjct  252  YWKFGEEGNKYFRHATGQIYAISRDLANYISVNQPLLHKFANEDVSLGAWIIGLDVDHID  311

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DR +CCGTPPDCEWKAQAGN+CVASFDWTCSGIC++V+RI+EVH+RCGEG+  +W+A F
Sbjct  312  DRSMCCGTPPDCEWKAQAGNVCVASFDWTCSGICKSVERIQEVHQRCGEGDGAVWSAVF  370



>gb|EPS64555.1| hypothetical protein M569_10226 [Genlisea aurea]
Length=393

 Score =   327 bits (837),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 143/177 (81%), Positives = 162/177 (92%), Gaps = 0/177 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV  WDA++Y+KVDDDVHVN+GTL  TLAR R  PRVYIGCMKSGPVLSQK V+YHEPE
Sbjct  215  TAVAKWDADFYVKVDDDVHVNLGTLAATLARRRATPRVYIGCMKSGPVLSQKNVKYHEPE  274

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQ+YAISKDLATYIS NQH+LHKYANEDVSLG+WFIGL+V H+D
Sbjct  275  YWKFGEEGNKYFRHATGQIYAISKDLATYISINQHILHKYANEDVSLGSWFIGLEVEHID  334

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNA  219
            DR +CCGTPPDCEWKAQAGN+CVASFDW+CSGIC++VD+I+ VH++CGEGE  LWNA
Sbjct  335  DRDMCCGTPPDCEWKAQAGNLCVASFDWSCSGICKSVDKIQFVHQQCGEGEDALWNA  391



>ref|XP_011074895.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Sesamum indicum]
Length=372

 Score =   326 bits (835),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 140/177 (79%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TA+  WDA++Y+KVDDDVHVN+GTL  TLARHR KPRVYIGCMKSGPVLSQK V+YHEPE
Sbjct  194  TAIAKWDADFYVKVDDDVHVNLGTLAATLARHRSKPRVYIGCMKSGPVLSQKNVKYHEPE  253

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQ+YAISKDLATYIS NQ +LHKYANEDVSLG+WFIGL+V H+D
Sbjct  254  YWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGSWFIGLEVEHID  313

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNA  219
            +R +CCGTPPDCEWKAQAGN+C+ASFDW+CSGIC++V+++K VH +CGEGE+ LWNA
Sbjct  314  ERNMCCGTPPDCEWKAQAGNVCIASFDWSCSGICKSVEKMKFVHDQCGEGEEALWNA  370



>gb|KJB62839.1| hypothetical protein B456_009G440200 [Gossypium raimondii]
Length=368

 Score =   325 bits (834),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 147/178 (83%), Positives = 163/178 (92%), Gaps = 1/178 (1%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TA  LWDA++Y+KVDDDVHVNI TLG TLARHR KPRVYIGCMKSGPVL+QKGVRYHEPE
Sbjct  192  TAAALWDADFYVKVDDDVHVNIATLGATLARHRTKPRVYIGCMKSGPVLAQKGVRYHEPE  251

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            +WKFGE GNKYFRHATGQLYAIS+DLA+YIS NQHVLHKYANEDVSLG+WFIGLDV H+D
Sbjct  252  HWKFGEEGNKYFRHATGQLYAISRDLASYISINQHVLHKYANEDVSLGSWFIGLDVDHID  311

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAA  216
            DR LCCGT  DCEWKAQAGN+CVASFDWTCSGIC++V+R+K+VHRRCGEG+  LW  A
Sbjct  312  DRSLCCGT-TDCEWKAQAGNVCVASFDWTCSGICKSVERMKDVHRRCGEGKNALWTEA  368



>gb|KDP32735.1| hypothetical protein JCGZ_12027 [Jatropha curcas]
Length=398

 Score =   327 bits (837),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 143/179 (80%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV  WDAEYY+KVDDDVHVN+G L  TLARHR KPRVYIGCMKSGPVLSQK V+YHEPE
Sbjct  220  TAVAKWDAEYYVKVDDDVHVNLGMLAATLARHRSKPRVYIGCMKSGPVLSQKNVKYHEPE  279

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQ+YAISKDLATYIS NQ +LHKYANEDVSLG+WFIGL+V H+D
Sbjct  280  YWKFGEEGNKYFRHATGQIYAISKDLATYISINQPLLHKYANEDVSLGSWFIGLEVEHID  339

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DR +CCGTPPDCEWKAQAGN+C+ASFDW+CSGIC++V++IK VH RCGEG+  +W+A F
Sbjct  340  DRNMCCGTPPDCEWKAQAGNVCIASFDWSCSGICKSVEKIKFVHERCGEGDGAVWSALF  398



>ref|XP_011040606.1| PREDICTED: probable beta-1,3-galactosyltransferase 6 [Populus 
euphratica]
Length=403

 Score =   327 bits (837),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 140/179 (78%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV +WDA++YIKVDDDVH+N+G +G TLARHR KPRVYIGCMKSGPVL+QKGVRYHEPE
Sbjct  225  TAVAMWDADFYIKVDDDVHINLGMVGSTLARHRSKPRVYIGCMKSGPVLAQKGVRYHEPE  284

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQ+YAISKDLATYIS N+H+LH+YANEDVSLG+WFIGLDV H+D
Sbjct  285  YWKFGEEGNKYFRHATGQIYAISKDLATYISVNRHILHRYANEDVSLGSWFIGLDVEHID  344

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DR LCCGT PDCEWK QAGN C ASFDW+CSGIC++V+R++EVH+RCGEG++ +W+ +F
Sbjct  345  DRSLCCGTAPDCEWKTQAGNPCAASFDWSCSGICKSVERMEEVHQRCGEGDEAIWHTSF  403



>gb|KJB62840.1| hypothetical protein B456_009G440200 [Gossypium raimondii]
Length=367

 Score =   325 bits (834),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 147/178 (83%), Positives = 163/178 (92%), Gaps = 1/178 (1%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TA  LWDA++Y+KVDDDVHVNI TLG TLARHR KPRVYIGCMKSGPVL+QKGVRYHEPE
Sbjct  191  TAAALWDADFYVKVDDDVHVNIATLGATLARHRTKPRVYIGCMKSGPVLAQKGVRYHEPE  250

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            +WKFGE GNKYFRHATGQLYAIS+DLA+YIS NQHVLHKYANEDVSLG+WFIGLDV H+D
Sbjct  251  HWKFGEEGNKYFRHATGQLYAISRDLASYISINQHVLHKYANEDVSLGSWFIGLDVDHID  310

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAA  216
            DR LCCGT  DCEWKAQAGN+CVASFDWTCSGIC++V+R+K+VHRRCGEG+  LW  A
Sbjct  311  DRSLCCGT-TDCEWKAQAGNVCVASFDWTCSGICKSVERMKDVHRRCGEGKNALWTEA  367



>ref|XP_010063328.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X3 [Eucalyptus 
grandis]
 gb|KCW70542.1| hypothetical protein EUGRSUZ_F03738 [Eucalyptus grandis]
Length=389

 Score =   326 bits (836),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 140/177 (79%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV +WDA++YIKVDDDVHVN+G L  TLARHR KPRVYIGCMKSGPVLS K V+YHEPE
Sbjct  211  TAVAMWDADFYIKVDDDVHVNLGMLATTLARHRSKPRVYIGCMKSGPVLSSKNVKYHEPE  270

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQ+YA+S+DLATYIS NQ +LHKYANEDVSLGAWFIGL+V H+D
Sbjct  271  YWKFGEEGNKYFRHATGQIYALSRDLATYISINQPILHKYANEDVSLGAWFIGLEVEHID  330

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNA  219
            DR +CCGTPPDCEWKAQAGN+C+ASFDW+CSGIC++V++IK+VHRRCGEG+  +W+A
Sbjct  331  DRNMCCGTPPDCEWKAQAGNVCIASFDWSCSGICKSVEKIKDVHRRCGEGDAAVWDA  387



>ref|XP_010063326.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X1 [Eucalyptus 
grandis]
 gb|KCW70541.1| hypothetical protein EUGRSUZ_F03738 [Eucalyptus grandis]
Length=392

 Score =   326 bits (836),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 140/177 (79%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV +WDA++YIKVDDDVHVN+G L  TLARHR KPRVYIGCMKSGPVLS K V+YHEPE
Sbjct  214  TAVAMWDADFYIKVDDDVHVNLGMLATTLARHRSKPRVYIGCMKSGPVLSSKNVKYHEPE  273

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQ+YA+S+DLATYIS NQ +LHKYANEDVSLGAWFIGL+V H+D
Sbjct  274  YWKFGEEGNKYFRHATGQIYALSRDLATYISINQPILHKYANEDVSLGAWFIGLEVEHID  333

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNA  219
            DR +CCGTPPDCEWKAQAGN+C+ASFDW+CSGIC++V++IK+VHRRCGEG+  +W+A
Sbjct  334  DRNMCCGTPPDCEWKAQAGNVCIASFDWSCSGICKSVEKIKDVHRRCGEGDAAVWDA  390



>ref|XP_010063329.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X4 [Eucalyptus 
grandis]
 gb|KCW70543.1| hypothetical protein EUGRSUZ_F03738 [Eucalyptus grandis]
Length=388

 Score =   326 bits (835),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 140/177 (79%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV +WDA++YIKVDDDVHVN+G L  TLARHR KPRVYIGCMKSGPVLS K V+YHEPE
Sbjct  210  TAVAMWDADFYIKVDDDVHVNLGMLATTLARHRSKPRVYIGCMKSGPVLSSKNVKYHEPE  269

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQ+YA+S+DLATYIS NQ +LHKYANEDVSLGAWFIGL+V H+D
Sbjct  270  YWKFGEEGNKYFRHATGQIYALSRDLATYISINQPILHKYANEDVSLGAWFIGLEVEHID  329

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNA  219
            DR +CCGTPPDCEWKAQAGN+C+ASFDW+CSGIC++V++IK+VHRRCGEG+  +W+A
Sbjct  330  DRNMCCGTPPDCEWKAQAGNVCIASFDWSCSGICKSVEKIKDVHRRCGEGDAAVWDA  386



>ref|XP_010245068.1| PREDICTED: beta-1,3-galactosyltransferase 7 [Nelumbo nucifera]
Length=396

 Score =   326 bits (836),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV  WDAE+Y+KVDDDVHVN+G L  TLARHR KPRVY+GCMKSGPVLSQK V+YHEPE
Sbjct  218  TAVAKWDAEFYVKVDDDVHVNLGMLAATLARHRSKPRVYMGCMKSGPVLSQKNVKYHEPE  277

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQ+YAISKDLATYIS NQ +LHKYANEDVSLGAWFIGL+V H+D
Sbjct  278  YWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVEHID  337

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            +R +CCGTPPDCEWKAQAGN+C+ASFDW+CSGIC++V++IK+VH RCGEG+  +W+A F
Sbjct  338  ERNMCCGTPPDCEWKAQAGNVCIASFDWSCSGICKSVEKIKDVHERCGEGDGAVWSALF  396



>ref|XP_010063327.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X2 [Eucalyptus 
grandis]
Length=391

 Score =   326 bits (835),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 140/177 (79%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV +WDA++YIKVDDDVHVN+G L  TLARHR KPRVYIGCMKSGPVLS K V+YHEPE
Sbjct  213  TAVAMWDADFYIKVDDDVHVNLGMLATTLARHRSKPRVYIGCMKSGPVLSSKNVKYHEPE  272

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQ+YA+S+DLATYIS NQ +LHKYANEDVSLGAWFIGL+V H+D
Sbjct  273  YWKFGEEGNKYFRHATGQIYALSRDLATYISINQPILHKYANEDVSLGAWFIGLEVEHID  332

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNA  219
            DR +CCGTPPDCEWKAQAGN+C+ASFDW+CSGIC++V++IK+VHRRCGEG+  +W+A
Sbjct  333  DRNMCCGTPPDCEWKAQAGNVCIASFDWSCSGICKSVEKIKDVHRRCGEGDAAVWDA  389



>ref|XP_009601250.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X2 [Nicotiana 
tomentosiformis]
Length=320

 Score =   323 bits (828),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 139/179 (78%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV  WDA++Y+KVDDDVHVN+G L  TLARHR KPR+YIGCMKSGPVL+QK V+YHEPE
Sbjct  142  TAVAKWDADFYVKVDDDVHVNLGMLAATLARHRSKPRIYIGCMKSGPVLAQKTVKYHEPE  201

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQ+YAISKDLATYIS NQ +LHKYANEDVSLGAWFIGL+V H+D
Sbjct  202  YWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVEHID  261

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            +R +CCGTPPDC+WKA+AGN+CVASFDW+CSGIC++V+++K VH +CGEGE+ LWNA F
Sbjct  262  ERTMCCGTPPDCDWKAEAGNVCVASFDWSCSGICKSVEKLKYVHEKCGEGEEALWNALF  320



>ref|XP_006439187.1| hypothetical protein CICLE_v10020627mg [Citrus clementina]
 gb|ESR52427.1| hypothetical protein CICLE_v10020627mg [Citrus clementina]
Length=314

 Score =   323 bits (827),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 140/179 (78%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV  WDA++YIKVDDDVHVN+G +G TLARHR KPRVYIGCMKSGPVL QKGV+YHEPE
Sbjct  136  TAVAKWDADFYIKVDDDVHVNLGMVGSTLARHRSKPRVYIGCMKSGPVLGQKGVKYHEPE  195

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQ+YAISKDLATYIS N+H+LH+YANEDVSLG+WFIGLDV H+D
Sbjct  196  YWKFGEEGNKYFRHATGQIYAISKDLATYISVNRHILHRYANEDVSLGSWFIGLDVEHID  255

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DR LCCGT PDCEWKAQAGN C ASFDW+CSG+C++V+R+ EVH+RCGEG++ +W+ +F
Sbjct  256  DRSLCCGTAPDCEWKAQAGNPCAASFDWSCSGVCKSVERMGEVHQRCGEGDEAIWHTSF  314



>gb|KDO76779.1| hypothetical protein CISIN_1g021312mg [Citrus sinensis]
Length=314

 Score =   323 bits (827),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 140/179 (78%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV  WDA++YIKVDDDVHVN+G +G TLARHR KPRVYIGCMKSGPVL QKGV+YHEPE
Sbjct  136  TAVAKWDADFYIKVDDDVHVNLGMVGSTLARHRSKPRVYIGCMKSGPVLGQKGVKYHEPE  195

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQ+YAISKDLATYIS N+H+LH+YANEDVSLG+WFIGLDV H+D
Sbjct  196  YWKFGEEGNKYFRHATGQIYAISKDLATYISVNRHILHRYANEDVSLGSWFIGLDVEHID  255

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DR LCCGT PDCEWKAQAGN C ASFDW+CSG+C++V+R+ EVH+RCGEG++ +W+ +F
Sbjct  256  DRSLCCGTAPDCEWKAQAGNPCAASFDWSCSGVCKSVERMGEVHQRCGEGDEAIWHTSF  314



>gb|EPS60081.1| hypothetical protein M569_14722, partial [Genlisea aurea]
Length=275

 Score =   321 bits (823),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 160/177 (90%), Gaps = 0/177 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TA  LWDAEYY+KVDDDVHVNI TL ETLAR+RKK RVYIGCMKSGPVL+Q+GVRYHEPE
Sbjct  99   TATSLWDAEYYVKVDDDVHVNIATLAETLARYRKKKRVYIGCMKSGPVLAQRGVRYHEPE  158

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFG++GNKYFRHATGQ+YAISKDLA YIS N+H+LHKYANEDVS+G+WFIGLDV HVD
Sbjct  159  YWKFGDSGNKYFRHATGQIYAISKDLAVYISRNRHLLHKYANEDVSVGSWFIGLDVRHVD  218

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNA  219
            DRRLCCGTP DCEWKA+A N+C ASFDWTCSGICR V+RIKEVHRRCGE    +W A
Sbjct  219  DRRLCCGTPSDCEWKARARNMCAASFDWTCSGICRPVERIKEVHRRCGESADAIWKA  275



>ref|XP_009786663.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X2 [Nicotiana 
sylvestris]
Length=320

 Score =   323 bits (827),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 139/179 (78%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV  WDA++Y+KVDDDVHVN+G L  TLARHR KPR+YIGCMKSGPVL+QK V+YHEPE
Sbjct  142  TAVARWDADFYVKVDDDVHVNLGMLAATLARHRSKPRIYIGCMKSGPVLAQKTVKYHEPE  201

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQ+YAISKDLATYIS NQ +LHKYANEDVSLGAWFIGL+V H+D
Sbjct  202  YWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVEHID  261

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            +R +CCGTPPDC+WKA+AGN+CVASFDW+CSGIC++V+++K VH +CGEGE+ LWNA F
Sbjct  262  ERTMCCGTPPDCDWKAEAGNVCVASFDWSCSGICKSVEKLKYVHEKCGEGEEALWNALF  320



>ref|NP_001183433.1| uncharacterized protein LOC100501859 [Zea mays]
 gb|ACR34699.1| unknown [Zea mays]
 gb|ACR36777.1| unknown [Zea mays]
Length=200

 Score =   318 bits (815),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 143/179 (80%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDA++Y+KVDDDVHVNI TLG+ L++H  KPRVYIGCMKSGPVLS+KGVRY+EPE
Sbjct  22   TAVSLWDADFYVKVDDDVHVNIATLGQILSKHALKPRVYIGCMKSGPVLSEKGVRYYEPE  81

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            +WKFGE+GNKYFRHATGQLYA+SKDLATYIS N+H+LHKY NEDVSLG+WFIGLDV H+D
Sbjct  82   HWKFGESGNKYFRHATGQLYAVSKDLATYISINKHILHKYINEDVSLGSWFIGLDVEHID  141

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DRRLCCGTPPDCEWKAQAGN+C ASFDW CSGIC +  RI EVH +C EGEK LWNA F
Sbjct  142  DRRLCCGTPPDCEWKAQAGNVCAASFDWRCSGICNSEGRIWEVHNKCAEGEKALWNATF  200



>ref|XP_003523469.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X1 [Glycine 
max]
Length=394

 Score =   325 bits (833),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV +WDA++Y+KVDDDVHVN+G L  TLARHR KPRVYIGCMKSGPVLS+K V+YHEPE
Sbjct  216  TAVSMWDADFYVKVDDDVHVNLGVLATTLARHRSKPRVYIGCMKSGPVLSRKDVKYHEPE  275

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            +WKFGE GNKYFRHATGQ+YAISKDLATYIS NQ +LHKYANEDVSLGAWFIGL+V H+D
Sbjct  276  FWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVEHID  335

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DR +CCGTPPDCEWKAQAGNICVASFDW+CSGIC++V++IK VH +CGEG   +W+A F
Sbjct  336  DRNMCCGTPPDCEWKAQAGNICVASFDWSCSGICKSVEKIKYVHSKCGEGNGAVWSALF  394



>gb|KHN47065.1| Beta-1,3-galactosyltransferase 7 [Glycine soja]
Length=363

 Score =   324 bits (830),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV +WDA++Y+KVDDDVHVN+G L  TLARHR KPRVYIGCMKSGPVLS+K V+YHEPE
Sbjct  185  TAVSMWDADFYVKVDDDVHVNLGVLATTLARHRSKPRVYIGCMKSGPVLSRKDVKYHEPE  244

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            +WKFGE GNKYFRHATGQ+YAISKDLATYIS NQ +LHKYANEDVSLGAWFIGL+V H+D
Sbjct  245  FWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVEHID  304

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DR +CCGTPPDCEWKAQAGNICVASFDW+CSGIC++V++IK VH +CGEG   +W+A F
Sbjct  305  DRNMCCGTPPDCEWKAQAGNICVASFDWSCSGICKSVEKIKYVHSKCGEGNGAVWSALF  363



>ref|XP_006578989.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X2 [Glycine 
max]
Length=397

 Score =   325 bits (833),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV +WDA++Y+KVDDDVHVN+G L  TLARHR KPRVYIGCMKSGPVLS+K V+YHEPE
Sbjct  219  TAVSMWDADFYVKVDDDVHVNLGVLATTLARHRSKPRVYIGCMKSGPVLSRKDVKYHEPE  278

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            +WKFGE GNKYFRHATGQ+YAISKDLATYIS NQ +LHKYANEDVSLGAWFIGL+V H+D
Sbjct  279  FWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVEHID  338

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DR +CCGTPPDCEWKAQAGNICVASFDW+CSGIC++V++IK VH +CGEG   +W+A F
Sbjct  339  DRNMCCGTPPDCEWKAQAGNICVASFDWSCSGICKSVEKIKYVHSKCGEGNGAVWSALF  397



>ref|XP_006364961.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X2 [Solanum 
tuberosum]
 ref|XP_010312804.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X2 [Solanum 
lycopersicum]
Length=320

 Score =   322 bits (825),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 139/179 (78%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV  WDA++Y+KVDDDVHVN+G L  TLARHR KPR+YIGCMKSGPVL+QK V+YHEPE
Sbjct  142  TAVAKWDADFYVKVDDDVHVNLGMLAATLARHRSKPRIYIGCMKSGPVLAQKTVKYHEPE  201

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQ+YAISKDLATYIS NQ +LHKYANEDVSLGAWFIGL+V H+D
Sbjct  202  YWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVEHID  261

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            +R +CCGTPPDC+WKA+AGN+CVASFDW+CSGIC++V+++K VH +CGEGE+ LWNA F
Sbjct  262  ERTMCCGTPPDCDWKAEAGNVCVASFDWSCSGICKSVEKLKYVHEKCGEGEEALWNALF  320



>ref|XP_006439188.1| hypothetical protein CICLE_v10020627mg [Citrus clementina]
 gb|ESR52428.1| hypothetical protein CICLE_v10020627mg [Citrus clementina]
Length=229

 Score =   318 bits (816),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 140/179 (78%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV  WDA++YIKVDDDVHVN+G +G TLARHR KPRVYIGCMKSGPVL QKGV+YHEPE
Sbjct  51   TAVAKWDADFYIKVDDDVHVNLGMVGSTLARHRSKPRVYIGCMKSGPVLGQKGVKYHEPE  110

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQ+YAISKDLATYIS N+H+LH+YANEDVSLG+WFIGLDV H+D
Sbjct  111  YWKFGEEGNKYFRHATGQIYAISKDLATYISVNRHILHRYANEDVSLGSWFIGLDVEHID  170

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DR LCCGT PDCEWKAQAGN C ASFDW+CSG+C++V+R+ EVH+RCGEG++ +W+ +F
Sbjct  171  DRSLCCGTAPDCEWKAQAGNPCAASFDWSCSGVCKSVERMGEVHQRCGEGDEAIWHTSF  229



>ref|XP_003601132.1| Avr9 elicitor response protein [Medicago truncatula]
 gb|AES71383.1| beta-1,3-galactosyltransferase-like protein [Medicago truncatula]
Length=396

 Score =   325 bits (832),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDA++Y+KVDDDVHVN+G L  TLARHR KPRVYIGCMKSGPVLS+K V+YHEPE
Sbjct  218  TAVGLWDADFYVKVDDDVHVNLGVLAATLARHRSKPRVYIGCMKSGPVLSRKDVKYHEPE  277

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            +WKFGE GNKYFRHATGQ+YAISKDLATYIS NQ +LHKYANEDVSLG+WFIGL+V H+D
Sbjct  278  FWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGSWFIGLEVEHID  337

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DR +CCGTPPDCEWKAQAGNICVASFDW+CSGIC++V++IK VH +CGEG+  +W+A F
Sbjct  338  DRSMCCGTPPDCEWKAQAGNICVASFDWSCSGICKSVEKIKYVHSKCGEGDGAVWSALF  396



>ref|XP_003601133.1| Avr9 elicitor response protein [Medicago truncatula]
 gb|AES71384.1| beta-1,3-galactosyltransferase-like protein [Medicago truncatula]
 gb|AFK45036.1| unknown [Medicago truncatula]
Length=395

 Score =   325 bits (832),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDA++Y+KVDDDVHVN+G L  TLARHR KPRVYIGCMKSGPVLS+K V+YHEPE
Sbjct  217  TAVGLWDADFYVKVDDDVHVNLGVLAATLARHRSKPRVYIGCMKSGPVLSRKDVKYHEPE  276

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            +WKFGE GNKYFRHATGQ+YAISKDLATYIS NQ +LHKYANEDVSLG+WFIGL+V H+D
Sbjct  277  FWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGSWFIGLEVEHID  336

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DR +CCGTPPDCEWKAQAGNICVASFDW+CSGIC++V++IK VH +CGEG+  +W+A F
Sbjct  337  DRSMCCGTPPDCEWKAQAGNICVASFDWSCSGICKSVEKIKYVHSKCGEGDGAVWSALF  395



>ref|XP_010251481.1| PREDICTED: probable beta-1,3-galactosyltransferase 6 [Nelumbo 
nucifera]
Length=402

 Score =   325 bits (832),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 143/179 (80%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV  WDA++YIKVDDDVHVN G +G TLARH+ KPRVYIGCMKSGPVL+QKGV+YHEPE
Sbjct  224  TAVAKWDADFYIKVDDDVHVNPGMVGSTLARHKSKPRVYIGCMKSGPVLAQKGVKYHEPE  283

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQLYAISKDLATYIS N+H+LH+YANEDVSLG+WFIGLDV H+D
Sbjct  284  YWKFGEEGNKYFRHATGQLYAISKDLATYISVNRHILHRYANEDVSLGSWFIGLDVEHID  343

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DR LCCGTPPDCEWKAQAGN C ASFDW+CSGIC++V+R++EVH+RCGEG+  +W+A F
Sbjct  344  DRSLCCGTPPDCEWKAQAGNSCGASFDWSCSGICKSVERMEEVHQRCGEGDGAIWHANF  402



>ref|XP_009601249.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X1 [Nicotiana 
tomentosiformis]
Length=396

 Score =   324 bits (831),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 139/179 (78%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV  WDA++Y+KVDDDVHVN+G L  TLARHR KPR+YIGCMKSGPVL+QK V+YHEPE
Sbjct  218  TAVAKWDADFYVKVDDDVHVNLGMLAATLARHRSKPRIYIGCMKSGPVLAQKTVKYHEPE  277

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQ+YAISKDLATYIS NQ +LHKYANEDVSLGAWFIGL+V H+D
Sbjct  278  YWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVEHID  337

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            +R +CCGTPPDC+WKA+AGN+CVASFDW+CSGIC++V+++K VH +CGEGE+ LWNA F
Sbjct  338  ERTMCCGTPPDCDWKAEAGNVCVASFDWSCSGICKSVEKLKYVHEKCGEGEEALWNALF  396



>ref|XP_006449734.1| hypothetical protein CICLE_v10015441mg [Citrus clementina]
 gb|ESR62974.1| hypothetical protein CICLE_v10015441mg [Citrus clementina]
Length=343

 Score =   323 bits (827),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 147/189 (78%), Positives = 162/189 (86%), Gaps = 10/189 (5%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIG----------TLGETLARHRKKPRVYIGCMKSGPVLS  600
            TAV +WDAE+YIKVDDDVHVN+G          TLG TLA HR KPRVY+GCMKSGPVL+
Sbjct  155  TAVSMWDAEFYIKVDDDVHVNLGKETFYLVLHSTLGMTLAAHRTKPRVYVGCMKSGPVLA  214

Query  599  QKGVRYHEPEYWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAW  420
            +KGV+Y+EPEYWKFGE GNKYFRHATGQLYAIS DLATYIS NQH+LHKYANEDVSLG+W
Sbjct  215  RKGVKYYEPEYWKFGEIGNKYFRHATGQLYAISNDLATYISINQHLLHKYANEDVSLGSW  274

Query  419  FIGLDVHHVDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEG  240
            FIGLDV HVDDRRLCCGTPPDCEWKAQ G  CVA+FDW CSGIC++V+RIKEVH  CGEG
Sbjct  275  FIGLDVEHVDDRRLCCGTPPDCEWKAQLGKTCVATFDWRCSGICKSVERIKEVHELCGEG  334

Query  239  EKVLWNAAF  213
            E  LW A+F
Sbjct  335  EDTLWRASF  343



>gb|KJB62836.1| hypothetical protein B456_009G440200 [Gossypium raimondii]
 gb|KJB62837.1| hypothetical protein B456_009G440200 [Gossypium raimondii]
Length=405

 Score =   325 bits (832),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 147/178 (83%), Positives = 163/178 (92%), Gaps = 1/178 (1%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TA  LWDA++Y+KVDDDVHVNI TLG TLARHR KPRVYIGCMKSGPVL+QKGVRYHEPE
Sbjct  229  TAAALWDADFYVKVDDDVHVNIATLGATLARHRTKPRVYIGCMKSGPVLAQKGVRYHEPE  288

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            +WKFGE GNKYFRHATGQLYAIS+DLA+YIS NQHVLHKYANEDVSLG+WFIGLDV H+D
Sbjct  289  HWKFGEEGNKYFRHATGQLYAISRDLASYISINQHVLHKYANEDVSLGSWFIGLDVDHID  348

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAA  216
            DR LCCGT  DCEWKAQAGN+CVASFDWTCSGIC++V+R+K+VHRRCGEG+  LW  A
Sbjct  349  DRSLCCGT-TDCEWKAQAGNVCVASFDWTCSGICKSVERMKDVHRRCGEGKNALWTEA  405



>ref|XP_009367323.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X1 [Pyrus 
x bretschneideri]
Length=400

 Score =   324 bits (831),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 137/179 (77%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV  WDA++Y+KVDDDVHVN+G LG TLARHR KPRVYIGCMKSGPVL+QK V+YHEPE
Sbjct  222  TAVAQWDADFYVKVDDDVHVNLGMLGTTLARHRSKPRVYIGCMKSGPVLAQKNVKYHEPE  281

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQ+YAIS+DLATY+S NQ +LHKYANEDVSLG+WFIGL+V H+D
Sbjct  282  YWKFGEEGNKYFRHATGQIYAISRDLATYVSINQPILHKYANEDVSLGSWFIGLEVEHID  341

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            +R +CCGTPPDCEWKAQAGN+C+ASFDW+CSGIC++V+RIK VH +CGEG+  +W++ F
Sbjct  342  ERNMCCGTPPDCEWKAQAGNVCIASFDWSCSGICKSVERIKSVHEKCGEGDAAVWSSLF  400



>ref|XP_010943123.1| PREDICTED: beta-1,3-galactosyltransferase 7-like [Elaeis guineensis]
Length=397

 Score =   324 bits (831),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 139/179 (78%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV +WDA++Y+KVDDDVHVN+G L  TLARHR KPR YIGCMKSGPVLS + V+YHEPE
Sbjct  219  TAVAIWDADFYVKVDDDVHVNLGMLATTLARHRSKPRTYIGCMKSGPVLSNQNVKYHEPE  278

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            +WKFGE GNKYFRHATGQLYAISKDLATYIS NQ +LHKYANEDVSLGAWFIGLDV H+D
Sbjct  279  FWKFGEEGNKYFRHATGQLYAISKDLATYISINQPILHKYANEDVSLGAWFIGLDVEHID  338

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            +R +CCGTPPDCEWKAQAGN+C+ASFDW+CSGIC++V+RI++VH +CGEG+  +WNA F
Sbjct  339  ERNMCCGTPPDCEWKAQAGNVCIASFDWSCSGICKSVERIRDVHAKCGEGDGAVWNAFF  397



>ref|XP_004515660.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X1 [Cicer 
arietinum]
Length=393

 Score =   324 bits (830),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDA++Y+KVDDDVHVN+G L  TLARHR KPRVYIGCMKSGPVLS+K V+YHEPE
Sbjct  215  TAVALWDADFYVKVDDDVHVNLGVLAATLARHRLKPRVYIGCMKSGPVLSRKDVKYHEPE  274

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            +WKFGE GNKYFRHATGQ+YAISKDLATYIS NQ +LHKYANEDVSLG+WFIGL+V H+D
Sbjct  275  FWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGSWFIGLEVEHID  334

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DR +CCGTPPDCEWKAQAGNICVASFDW+CSGIC++V++IK VH +CGEG+  +W+A F
Sbjct  335  DRSMCCGTPPDCEWKAQAGNICVASFDWSCSGICKSVEKIKYVHSKCGEGDGAVWSALF  393



>ref|XP_004515661.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X2 [Cicer 
arietinum]
Length=392

 Score =   324 bits (830),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV LWDA++Y+KVDDDVHVN+G L  TLARHR KPRVYIGCMKSGPVLS+K V+YHEPE
Sbjct  214  TAVALWDADFYVKVDDDVHVNLGVLAATLARHRLKPRVYIGCMKSGPVLSRKDVKYHEPE  273

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            +WKFGE GNKYFRHATGQ+YAISKDLATYIS NQ +LHKYANEDVSLG+WFIGL+V H+D
Sbjct  274  FWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGSWFIGLEVEHID  333

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            DR +CCGTPPDCEWKAQAGNICVASFDW+CSGIC++V++IK VH +CGEG+  +W+A F
Sbjct  334  DRSMCCGTPPDCEWKAQAGNICVASFDWSCSGICKSVEKIKYVHSKCGEGDGAVWSALF  392



>ref|XP_009367325.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X3 [Pyrus 
x bretschneideri]
Length=397

 Score =   324 bits (831),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 137/179 (77%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV  WDA++Y+KVDDDVHVN+G LG TLARHR KPRVYIGCMKSGPVL+QK V+YHEPE
Sbjct  219  TAVAQWDADFYVKVDDDVHVNLGMLGTTLARHRSKPRVYIGCMKSGPVLAQKNVKYHEPE  278

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQ+YAIS+DLATY+S NQ +LHKYANEDVSLG+WFIGL+V H+D
Sbjct  279  YWKFGEEGNKYFRHATGQIYAISRDLATYVSINQPILHKYANEDVSLGSWFIGLEVEHID  338

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            +R +CCGTPPDCEWKAQAGN+C+ASFDW+CSGIC++V+RIK VH +CGEG+  +W++ F
Sbjct  339  ERNMCCGTPPDCEWKAQAGNVCIASFDWSCSGICKSVERIKSVHEKCGEGDAAVWSSLF  397



>emb|CAA06925.1| Avr9 elicitor response protein [Nicotiana tabacum]
Length=396

 Score =   324 bits (830),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 139/179 (78%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV  WDA++Y+KVDDDVHVN+G L  TLARHR KPR+YIGCMKSGPVL+QK V+YHEPE
Sbjct  218  TAVARWDADFYVKVDDDVHVNLGMLAATLARHRSKPRIYIGCMKSGPVLAQKTVKYHEPE  277

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQ+YAISKDLATYIS NQ +LHKYANEDVSLGAWFIGL+V H+D
Sbjct  278  YWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVEHID  337

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            +R +CCGTPPDC+WKA+AGN+CVASFDW+CSGIC++V+++K VH +CGEGE+ LWNA F
Sbjct  338  ERTMCCGTPPDCDWKAEAGNVCVASFDWSCSGICKSVEKLKYVHEKCGEGEEALWNALF  396



>dbj|BAJ89822.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ89142.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=399

 Score =   324 bits (831),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 144/178 (81%), Positives = 159/178 (89%), Gaps = 0/178 (0%)
 Frame = -3

Query  746  AVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPEY  567
            AV +WDAEY++KVDDDVHVNI TLG  LARHR KPR YIGCMKSGPVL+Q+GV+YHEPEY
Sbjct  222  AVSMWDAEYFVKVDDDVHVNIATLGGILARHRSKPRAYIGCMKSGPVLAQEGVKYHEPEY  281

Query  566  WKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVDD  387
            WKFGE GNKYFRHATGQLYAISKDLA+YIS NQHVLHKYANEDVS+GAWFIG+D  HVDD
Sbjct  282  WKFGEWGNKYFRHATGQLYAISKDLASYISINQHVLHKYANEDVSIGAWFIGVDAEHVDD  341

Query  386  RRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            RRLCCGT PDCE KAQ+GN+C ASFDW+CSGIC++ DRIKEVHRRCGE    +WNA F
Sbjct  342  RRLCCGTHPDCERKAQSGNVCAASFDWSCSGICKSADRIKEVHRRCGESANAIWNATF  399



>ref|XP_009786662.1| PREDICTED: beta-1,3-galactosyltransferase 7-like isoform X1 [Nicotiana 
sylvestris]
Length=396

 Score =   324 bits (830),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 139/179 (78%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV  WDA++Y+KVDDDVHVN+G L  TLARHR KPR+YIGCMKSGPVL+QK V+YHEPE
Sbjct  218  TAVARWDADFYVKVDDDVHVNLGMLAATLARHRSKPRIYIGCMKSGPVLAQKTVKYHEPE  277

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQ+YAISKDLATYIS NQ +LHKYANEDVSLGAWFIGL+V H+D
Sbjct  278  YWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGAWFIGLEVEHID  337

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            +R +CCGTPPDC+WKA+AGN+CVASFDW+CSGIC++V+++K VH +CGEGE+ LWNA F
Sbjct  338  ERTMCCGTPPDCDWKAEAGNVCVASFDWSCSGICKSVEKLKYVHEKCGEGEEALWNALF  396



>ref|XP_009367326.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X4 [Pyrus 
x bretschneideri]
Length=396

 Score =   324 bits (830),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 137/179 (77%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV  WDA++Y+KVDDDVHVN+G LG TLARHR KPRVYIGCMKSGPVL+QK V+YHEPE
Sbjct  218  TAVAQWDADFYVKVDDDVHVNLGMLGTTLARHRSKPRVYIGCMKSGPVLAQKNVKYHEPE  277

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQ+YAIS+DLATY+S NQ +LHKYANEDVSLG+WFIGL+V H+D
Sbjct  278  YWKFGEEGNKYFRHATGQIYAISRDLATYVSINQPILHKYANEDVSLGSWFIGLEVEHID  337

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            +R +CCGTPPDCEWKAQAGN+C+ASFDW+CSGIC++V+RIK VH +CGEG+  +W++ F
Sbjct  338  ERNMCCGTPPDCEWKAQAGNVCIASFDWSCSGICKSVERIKSVHEKCGEGDAAVWSSLF  396



>ref|XP_009367324.1| PREDICTED: beta-1,3-galactosyltransferase 7 isoform X2 [Pyrus 
x bretschneideri]
Length=399

 Score =   324 bits (830),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 137/179 (77%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV  WDA++Y+KVDDDVHVN+G LG TLARHR KPRVYIGCMKSGPVL+QK V+YHEPE
Sbjct  221  TAVAQWDADFYVKVDDDVHVNLGMLGTTLARHRSKPRVYIGCMKSGPVLAQKNVKYHEPE  280

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQ+YAIS+DLATY+S NQ +LHKYANEDVSLG+WFIGL+V H+D
Sbjct  281  YWKFGEEGNKYFRHATGQIYAISRDLATYVSINQPILHKYANEDVSLGSWFIGLEVEHID  340

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            +R +CCGTPPDCEWKAQAGN+C+ASFDW+CSGIC++V+RIK VH +CGEG+  +W++ F
Sbjct  341  ERNMCCGTPPDCEWKAQAGNVCIASFDWSCSGICKSVERIKSVHEKCGEGDAAVWSSLF  399



>emb|CDP18301.1| unnamed protein product [Coffea canephora]
Length=395

 Score =   323 bits (829),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 139/179 (78%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -3

Query  749  TAVKLWDAEYYIKVDDDVHVNIGTLGETLARHRKKPRVYIGCMKSGPVLSQKGVRYHEPE  570
            TAV  WDA++Y+KVDDDVHVN+G LG TLARHR KPR+YIGCMKSGPVLS K V+YHEPE
Sbjct  217  TAVAKWDADFYVKVDDDVHVNLGVLGATLARHRSKPRIYIGCMKSGPVLSSKNVKYHEPE  276

Query  569  YWKFGETGNKYFRHATGQLYAISKDLATYISANQHVLHKYANEDVSLGAWFIGLDVHHVD  390
            YWKFGE GNKYFRHATGQ+YAISKDLATYIS NQ +LHKYANEDVSLG+WFIGL+V H+D
Sbjct  277  YWKFGEEGNKYFRHATGQIYAISKDLATYISINQPILHKYANEDVSLGSWFIGLEVEHID  336

Query  389  DRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRTVDRIKEVHRRCGEGEKVLWNAAF  213
            +R +CC TPP+CEWKAQAGN+CVASFDW+CSGIC++V++I+ VH RCGEGE+ +WNA F
Sbjct  337  ERSMCCATPPECEWKAQAGNVCVASFDWSCSGICKSVEKIRFVHERCGEGEEAVWNALF  395



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1387667965840