BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF009C01

Length=688
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU33385.1|  hypothetical protein MIMGU_mgv1a008110mg              84.7    8e-16   Erythranthe guttata [common monkey flower]
ref|XP_006355407.1|  PREDICTED: F-box protein At5g46170-like          84.7    1e-15   Solanum tuberosum [potatoes]
ref|XP_011096601.1|  PREDICTED: F-box protein At4g18380-like          84.7    1e-15   Sesamum indicum [beniseed]
ref|XP_009625759.1|  PREDICTED: F-box protein At5g46170-like          84.3    1e-15   Nicotiana tomentosiformis
ref|XP_006352970.1|  PREDICTED: F-box protein At5g46170-like          83.6    2e-15   Solanum tuberosum [potatoes]
ref|XP_004233124.1|  PREDICTED: F-box protein At5g46170-like          82.8    4e-15   Solanum lycopersicum
ref|XP_009758227.1|  PREDICTED: F-box protein At4g18380-like          82.8    4e-15   Nicotiana sylvestris
ref|XP_011085237.1|  PREDICTED: F-box protein At4g18380-like          81.3    1e-14   Sesamum indicum [beniseed]
gb|EPS70457.1|  hypothetical protein M569_04296                       80.1    4e-14   Genlisea aurea
gb|EYU43254.1|  hypothetical protein MIMGU_mgv1a008300mg              79.0    1e-13   Erythranthe guttata [common monkey flower]
ref|XP_004244968.1|  PREDICTED: F-box protein At5g46170-like          77.4    4e-13   Solanum lycopersicum
emb|CDP21114.1|  unnamed protein product                              70.5    8e-11   Coffea canephora [robusta coffee]
ref|XP_009774076.1|  PREDICTED: F-box protein At4g18380-like          70.1    1e-10   Nicotiana sylvestris
ref|XP_009607720.1|  PREDICTED: F-box protein At4g18380-like          69.7    1e-10   Nicotiana tomentosiformis
ref|XP_006283811.1|  hypothetical protein CARUB_v10004910mg           69.7    2e-10   
ref|XP_006449020.1|  hypothetical protein CICLE_v10015378mg           69.7    2e-10   Citrus clementina [clementine]
ref|XP_006468035.1|  PREDICTED: F-box protein At5g46170-like isof...  69.7    2e-10   Citrus sinensis [apfelsine]
emb|CBI30928.3|  unnamed protein product                              69.3    2e-10   Vitis vinifera
ref|XP_010052048.1|  PREDICTED: F-box protein At5g46170               68.9    3e-10   Eucalyptus grandis [rose gum]
ref|XP_002278480.1|  PREDICTED: F-box protein At5g46170               68.9    3e-10   Vitis vinifera
emb|CAN73778.1|  hypothetical protein VITISV_042179                   68.9    3e-10   Vitis vinifera
ref|XP_010052049.1|  PREDICTED: F-box protein At5g46170-like          68.2    5e-10   Eucalyptus grandis [rose gum]
emb|CDX87738.1|  BnaC02g32110D                                        68.2    5e-10   
ref|XP_009128847.1|  PREDICTED: F-box protein At5g46170-like          67.8    6e-10   Brassica rapa
emb|CDY43956.1|  BnaA02g24340D                                        67.8    6e-10   Brassica napus [oilseed rape]
ref|XP_010439863.1|  PREDICTED: F-box protein At4g18380-like          67.8    6e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010086997.1|  hypothetical protein L484_005892                 67.8    7e-10   Morus notabilis
ref|NP_193573.1|  F-box protein                                       67.4    9e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006414111.1|  hypothetical protein EUTSA_v10025383mg           67.0    1e-09   Eutrema salsugineum [saltwater cress]
ref|XP_008371786.1|  PREDICTED: F-box protein At5g46170-like          67.0    1e-09   Malus domestica [apple tree]
ref|XP_010517545.1|  PREDICTED: F-box protein At4g18380               66.6    1e-09   Camelina sativa [gold-of-pleasure]
gb|KJB57216.1|  hypothetical protein B456_009G154000                  66.6    2e-09   Gossypium raimondii
gb|KDP37998.1|  hypothetical protein JCGZ_04641                       66.6    2e-09   Jatropha curcas
ref|XP_009360916.1|  PREDICTED: F-box protein At5g46170-like          66.6    2e-09   Pyrus x bretschneideri [bai li]
gb|KHG20859.1|  hypothetical protein F383_03969                       66.6    2e-09   Gossypium arboreum [tree cotton]
gb|AEX97082.1|  F-box family protein                                  66.6    2e-09   Malus domestica [apple tree]
gb|KJB57218.1|  hypothetical protein B456_009G154000                  66.6    2e-09   Gossypium raimondii
ref|XP_008371620.1|  PREDICTED: F-box protein At5g46170-like          66.6    2e-09   
ref|XP_008225507.1|  PREDICTED: F-box protein At5g46170-like          66.6    2e-09   Prunus mume [ume]
ref|XP_007212265.1|  hypothetical protein PRUPE_ppa006658mg           66.6    2e-09   Prunus persica
ref|XP_011035442.1|  PREDICTED: F-box protein At5g46170-like          66.2    2e-09   Populus euphratica
ref|XP_002305042.1|  hypothetical protein POPTR_0004s06450g           66.2    2e-09   
ref|XP_004163869.1|  PREDICTED: F-box protein At5g46170-like          66.2    3e-09   
ref|XP_011460217.1|  PREDICTED: F-box protein At5g46170               65.9    3e-09   Fragaria vesca subsp. vesca
gb|KJB69848.1|  hypothetical protein B456_011G045900                  65.9    3e-09   Gossypium raimondii
ref|XP_008439618.1|  PREDICTED: F-box protein At5g46170-like          65.9    3e-09   Cucumis melo [Oriental melon]
ref|XP_004134599.1|  PREDICTED: F-box protein At5g46170-like          65.9    3e-09   Cucumis sativus [cucumbers]
ref|XP_007025034.1|  F-box family protein                             65.5    4e-09   
ref|XP_010687117.1|  PREDICTED: F-box protein At4g18380               65.5    4e-09   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010518768.1|  PREDICTED: F-box protein At5g46170               65.5    5e-09   Tarenaya hassleriana [spider flower]
emb|CDX99890.1|  BnaC05g23120D                                        64.3    8e-09   
ref|XP_009115183.1|  PREDICTED: F-box protein At1g30200               64.7    8e-09   Brassica rapa
emb|CDX78848.1|  BnaA01g09150D                                        60.8    9e-09   
ref|XP_002519646.1|  conserved hypothetical protein                   64.7    9e-09   Ricinus communis
ref|XP_006279647.1|  hypothetical protein CARUB_v10026571mg           64.3    9e-09   Capsella rubella
gb|KJB66946.1|  hypothetical protein B456_010G167400                  64.3    1e-08   Gossypium raimondii
ref|XP_010441616.1|  PREDICTED: F-box protein At5g46170-like          64.3    1e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010494785.1|  PREDICTED: F-box protein At5g46170-like          63.9    1e-08   Camelina sativa [gold-of-pleasure]
gb|KJB68311.1|  hypothetical protein B456_010G238100                  63.9    1e-08   Gossypium raimondii
ref|NP_199429.1|  F-box protein                                       63.9    1e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010481487.1|  PREDICTED: F-box protein At5g46170               63.9    1e-08   Camelina sativa [gold-of-pleasure]
gb|KHN06964.1|  F-box protein                                         61.2    2e-08   Glycine soja [wild soybean]
ref|XP_010434544.1|  PREDICTED: F-box protein At4g18380-like          63.5    2e-08   Camelina sativa [gold-of-pleasure]
ref|XP_002863421.1|  F-box family protein                             63.2    2e-08   
gb|KHG27594.1|  hypothetical protein F383_11279                       63.2    2e-08   Gossypium arboreum [tree cotton]
ref|XP_002890858.1|  F-box family protein                             63.2    3e-08   
ref|XP_010478400.1|  PREDICTED: F-box protein At1g30200-like          63.2    3e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010499543.1|  PREDICTED: F-box protein At1g30200-like isof...  63.2    3e-08   Camelina sativa [gold-of-pleasure]
ref|XP_006307474.1|  hypothetical protein CARUB_v10009099mg           63.2    3e-08   
ref|XP_004486009.1|  PREDICTED: F-box protein At5g46170-like          63.2    3e-08   Cicer arietinum [garbanzo]
ref|XP_002870048.1|  F-box family protein                             62.8    3e-08   Arabidopsis lyrata subsp. lyrata
ref|XP_003593894.1|  F-box family protein                             62.4    5e-08   Medicago truncatula
ref|XP_006415502.1|  hypothetical protein EUTSA_v10007915mg           62.4    5e-08   Eutrema salsugineum [saltwater cress]
ref|XP_008444512.1|  PREDICTED: F-box protein At5g46170-like          62.4    5e-08   Cucumis melo [Oriental melon]
ref|XP_010460807.1|  PREDICTED: F-box protein At1g30200               62.0    6e-08   Camelina sativa [gold-of-pleasure]
ref|XP_002317281.1|  F-box family protein                             62.0    6e-08   Populus trichocarpa [western balsam poplar]
ref|XP_011007418.1|  PREDICTED: F-box protein At5g46170-like          62.0    6e-08   Populus euphratica
ref|XP_010923814.1|  PREDICTED: F-box protein At5g46170-like          61.6    7e-08   Elaeis guineensis
gb|KHG06780.1|  hypothetical protein F383_00742                       61.2    9e-08   Gossypium arboreum [tree cotton]
ref|XP_010538543.1|  PREDICTED: F-box protein At5g46170-like          61.2    1e-07   Tarenaya hassleriana [spider flower]
ref|XP_010538256.1|  PREDICTED: F-box protein At1g30200-like          61.2    1e-07   Tarenaya hassleriana [spider flower]
ref|XP_010549497.1|  PREDICTED: F-box protein At1g30200               61.2    1e-07   Tarenaya hassleriana [spider flower]
ref|XP_006398302.1|  hypothetical protein EUTSA_v10000919mg           60.8    1e-07   Eutrema salsugineum [saltwater cress]
ref|XP_004137366.1|  PREDICTED: F-box protein At5g46170-like          60.5    2e-07   Cucumis sativus [cucumbers]
ref|XP_009131656.1|  PREDICTED: F-box protein At4g18380               60.5    2e-07   Brassica rapa
ref|XP_003546077.1|  PREDICTED: F-box protein At5g46170-like          60.5    2e-07   Glycine max [soybeans]
ref|XP_003542943.1|  PREDICTED: F-box protein At5g46170-like isof...  60.5    2e-07   Glycine max [soybeans]
ref|XP_007147928.1|  hypothetical protein PHAVU_006G166500g           60.5    2e-07   Phaseolus vulgaris [French bean]
ref|NP_564350.1|  F-box protein                                       60.5    2e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010247412.1|  PREDICTED: F-box protein At5g46170               60.1    2e-07   Nelumbo nucifera [Indian lotus]
ref|XP_004961549.1|  PREDICTED: F-box protein At5g46170-like          58.2    1e-06   Setaria italica
ref|XP_008794503.1|  PREDICTED: F-box protein At5g46170               57.8    1e-06   Phoenix dactylifera
emb|CDX77641.1|  BnaC07g18950D                                        57.4    2e-06   
ref|XP_009388498.1|  PREDICTED: F-box protein At5g46170-like          57.0    3e-06   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY33458.1|  BnaA06g36150D                                        56.2    6e-06   Brassica napus [oilseed rape]
ref|XP_009101540.1|  PREDICTED: F-box protein At5g46170               56.2    6e-06   Brassica rapa
ref|XP_009397406.1|  PREDICTED: F-box protein At5g46170-like          54.7    2e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010940976.1|  PREDICTED: F-box protein At5g46170-like          54.7    2e-05   Elaeis guineensis
ref|XP_008784858.1|  PREDICTED: F-box protein At5g46170-like          54.3    3e-05   Phoenix dactylifera
ref|XP_009398331.1|  PREDICTED: F-box protein At5g46170-like          54.3    3e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009408533.1|  PREDICTED: F-box protein At5g46170               53.9    3e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006836365.1|  hypothetical protein AMTR_s00092p00114580        53.9    3e-05   Amborella trichopoda
ref|NP_001151107.1|  F-box domain containing protein                  53.5    4e-05   Zea mays [maize]
ref|XP_004970106.1|  PREDICTED: F-box protein At5g46170-like          53.5    4e-05   Setaria italica
ref|XP_002440052.1|  hypothetical protein SORBIDRAFT_09g025120        53.1    5e-05   
ref|XP_008649848.1|  PREDICTED: F-box protein At5g46170-like          53.1    6e-05   Zea mays [maize]
gb|EAY98656.1|  hypothetical protein OsI_20579                        53.1    6e-05   Oryza sativa Indica Group [Indian rice]
ref|XP_002442835.1|  hypothetical protein SORBIDRAFT_08g003610        52.8    7e-05   
ref|XP_009381298.1|  PREDICTED: F-box protein At5g46170-like          52.8    8e-05   
ref|XP_009407719.1|  PREDICTED: F-box protein At5g46170-like          52.8    8e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001146920.1|  F-box domain containing protein                  52.8    9e-05   
ref|XP_006654629.1|  PREDICTED: F-box protein At5g46170-like          52.8    1e-04   
ref|XP_008672792.1|  PREDICTED: F-box domain containing protein i...  52.4    1e-04   
ref|XP_002458563.1|  hypothetical protein SORBIDRAFT_03g035810        52.4    1e-04   Sorghum bicolor [broomcorn]
ref|XP_009399020.1|  PREDICTED: F-box protein At5g46170-like          52.0    2e-04   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEE55450.1|  hypothetical protein OsJ_03607                        52.0    2e-04   Oryza sativa Japonica Group [Japonica rice]
gb|EMT17885.1|  hypothetical protein F775_06795                       50.4    2e-04   
ref|NP_001044377.1|  Os01g0770400                                     51.6    2e-04   
gb|EMT19583.1|  hypothetical protein F775_23480                       48.5    3e-04   
ref|XP_006646370.1|  PREDICTED: F-box protein At5g46170-like          50.8    3e-04   Oryza brachyantha
gb|EEC71551.1|  hypothetical protein OsI_03898                        50.8    4e-04   Oryza sativa Indica Group [Indian rice]
ref|XP_002455973.1|  hypothetical protein SORBIDRAFT_03g028320        50.4    5e-04   Sorghum bicolor [broomcorn]
gb|ABK24885.1|  unknown                                               50.4    5e-04   Picea sitchensis
dbj|BAK06381.1|  predicted protein                                    50.1    6e-04   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003568140.1|  PREDICTED: F-box protein At5g46170-like          50.1    6e-04   Brachypodium distachyon [annual false brome]
ref|XP_003569912.1|  PREDICTED: F-box protein At4g18380-like          50.1    8e-04   Brachypodium distachyon [annual false brome]



>gb|EYU33385.1| hypothetical protein MIMGU_mgv1a008110mg [Erythranthe guttata]
Length=384

 Score = 84.7 bits (208),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 37/43 (86%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = -3

Query  686  EQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            EQ KK+VVGS+GNWVASAF+EP+G AARMLVKRRTYCLEMNSF
Sbjct  342  EQPKKEVVGSEGNWVASAFEEPFGTAARMLVKRRTYCLEMNSF  384



>ref|XP_006355407.1| PREDICTED: F-box protein At5g46170-like [Solanum tuberosum]
Length=389

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/43 (86%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = -3

Query  686  EQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            EQ KK+VVG DGNWVA+AF+EPYG AARMLVKRRTYCLEMNSF
Sbjct  347  EQPKKEVVGPDGNWVAAAFEEPYGTAARMLVKRRTYCLEMNSF  389



>ref|XP_011096601.1| PREDICTED: F-box protein At4g18380-like [Sesamum indicum]
Length=392

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/43 (84%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = -3

Query  686  EQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            EQ KKD+VGS+GNW+ASAF+EP+G AARMLVKRRTYCLEMNSF
Sbjct  350  EQPKKDMVGSEGNWIASAFEEPFGTAARMLVKRRTYCLEMNSF  392



>ref|XP_009625759.1| PREDICTED: F-box protein At5g46170-like [Nicotiana tomentosiformis]
Length=385

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/43 (86%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = -3

Query  686  EQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            EQ KK+VVG DGNWV SAF+EPYG AARMLVKRRTYCLEMNSF
Sbjct  343  EQPKKEVVGPDGNWVGSAFEEPYGTAARMLVKRRTYCLEMNSF  385



>ref|XP_006352970.1| PREDICTED: F-box protein At5g46170-like [Solanum tuberosum]
Length=367

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/43 (86%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = -3

Query  686  EQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            EQ KK+VVG DGNWVA+AF EPYG AARMLVKRRTYCLEMNSF
Sbjct  325  EQPKKEVVGGDGNWVAAAFKEPYGTAARMLVKRRTYCLEMNSF  367



>ref|XP_004233124.1| PREDICTED: F-box protein At5g46170-like [Solanum lycopersicum]
Length=369

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/43 (84%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = -3

Query  686  EQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            EQ KK+VVG+DGNWV +AF EPYG AARMLVKRRTYCLEMNSF
Sbjct  327  EQPKKEVVGADGNWVGAAFKEPYGTAARMLVKRRTYCLEMNSF  369



>ref|XP_009758227.1| PREDICTED: F-box protein At4g18380-like [Nicotiana sylvestris]
Length=396

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/43 (84%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = -3

Query  686  EQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            EQ KK+VVG DGNWV SAF+EPYG AAR+LVKRRTYCLEMNSF
Sbjct  354  EQPKKEVVGPDGNWVGSAFEEPYGTAARILVKRRTYCLEMNSF  396



>ref|XP_011085237.1| PREDICTED: F-box protein At4g18380-like [Sesamum indicum]
Length=388

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/43 (81%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = -3

Query  686  EQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            EQ KK+VVGS+GNW+A+AFDEP+  AARMLVKRRTYCLEMNSF
Sbjct  346  EQPKKEVVGSEGNWIATAFDEPFRTAARMLVKRRTYCLEMNSF  388



>gb|EPS70457.1| hypothetical protein M569_04296 [Genlisea aurea]
Length=381

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/43 (81%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = -3

Query  686  EQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            EQ KK++VGS+ NWVASAF+EP+G AARMLVKRRTYCLEMNSF
Sbjct  339  EQPKKELVGSEMNWVASAFEEPFGTAARMLVKRRTYCLEMNSF  381



>gb|EYU43254.1| hypothetical protein MIMGU_mgv1a008300mg [Erythranthe guttata]
Length=378

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = -3

Query  686  EQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            EQ KK+  GSDGNWVASAF+EP+  A+RMLVKRRTYCLEMNSF
Sbjct  336  EQSKKEATGSDGNWVASAFEEPFRTASRMLVKRRTYCLEMNSF  378



>ref|XP_004244968.1| PREDICTED: F-box protein At5g46170-like [Solanum lycopersicum]
Length=384

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/43 (81%), Positives = 39/43 (91%), Gaps = 1/43 (2%)
 Frame = -3

Query  686  EQHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            EQ K++V G DGNWVA+AF+EPYG AARMLVKRRTYCLEMNSF
Sbjct  343  EQPKREV-GPDGNWVAAAFEEPYGTAARMLVKRRTYCLEMNSF  384



>emb|CDP21114.1| unnamed protein product [Coffea canephora]
Length=420

 Score = 70.5 bits (171),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 1/41 (2%)
 Frame = -3

Query  677  KKDVVGS-DGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            KKDV  + DG+WV +AF+EPYG AARMLVKRRTYCLEMNSF
Sbjct  380  KKDVAAAADGSWVGAAFEEPYGTAARMLVKRRTYCLEMNSF  420



>ref|XP_009774076.1| PREDICTED: F-box protein At4g18380-like [Nicotiana sylvestris]
Length=392

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -3

Query  656  DGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            DGNWVA+AF+EPYG AARML+KRRTYCLEMNSF
Sbjct  360  DGNWVAAAFEEPYGTAARMLLKRRTYCLEMNSF  392



>ref|XP_009607720.1| PREDICTED: F-box protein At4g18380-like [Nicotiana tomentosiformis]
Length=392

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -3

Query  656  DGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            DGNW+A+AF+EPYG AARML+KRRTYCLEMNSF
Sbjct  360  DGNWIAAAFEEPYGTAARMLLKRRTYCLEMNSF  392



>ref|XP_006283811.1| hypothetical protein CARUB_v10004910mg, partial [Capsella rubella]
 gb|EOA16709.1| hypothetical protein CARUB_v10004910mg, partial [Capsella rubella]
Length=418

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 2/42 (5%)
 Frame = -3

Query  683  QHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            + KK+V  SD +WV+SAFDEPYG AA+MLVKRRTYCLEMNSF
Sbjct  379  ESKKEV--SDVSWVSSAFDEPYGVAAKMLVKRRTYCLEMNSF  418



>ref|XP_006449020.1| hypothetical protein CICLE_v10015378mg [Citrus clementina]
 ref|XP_006449021.1| hypothetical protein CICLE_v10015378mg [Citrus clementina]
 gb|ESR62260.1| hypothetical protein CICLE_v10015378mg [Citrus clementina]
 gb|ESR62261.1| hypothetical protein CICLE_v10015378mg [Citrus clementina]
Length=418

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 36/40 (90%), Gaps = 2/40 (5%)
 Frame = -3

Query  677  KKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            KK+V  SDG+WV SAF+EPYG AA+MLVKRRTYCLEMNSF
Sbjct  381  KKEV--SDGSWVGSAFEEPYGTAAKMLVKRRTYCLEMNSF  418



>ref|XP_006468035.1| PREDICTED: F-box protein At5g46170-like isoform X1 [Citrus sinensis]
 ref|XP_006468036.1| PREDICTED: F-box protein At5g46170-like isoform X2 [Citrus sinensis]
 gb|KDO75441.1| hypothetical protein CISIN_1g014846mg [Citrus sinensis]
 gb|KDO75442.1| hypothetical protein CISIN_1g014846mg [Citrus sinensis]
 gb|KDO75443.1| hypothetical protein CISIN_1g014846mg [Citrus sinensis]
Length=417

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 36/40 (90%), Gaps = 2/40 (5%)
 Frame = -3

Query  677  KKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            KK+V  SDG+WV SAF+EPYG AA+MLVKRRTYCLEMNSF
Sbjct  380  KKEV--SDGSWVGSAFEEPYGTAAKMLVKRRTYCLEMNSF  417



>emb|CBI30928.3| unnamed protein product [Vitis vinifera]
Length=398

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 37/40 (93%), Gaps = 2/40 (5%)
 Frame = -3

Query  677  KKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            KK+V  SDG+WV++AF+EPYG AA+MLVKRRTYCLEMNSF
Sbjct  361  KKEV--SDGSWVSAAFEEPYGTAAKMLVKRRTYCLEMNSF  398



>ref|XP_010052048.1| PREDICTED: F-box protein At5g46170 [Eucalyptus grandis]
 gb|KCW75903.1| hypothetical protein EUGRSUZ_D00284 [Eucalyptus grandis]
 gb|KCW75904.1| hypothetical protein EUGRSUZ_D00284 [Eucalyptus grandis]
Length=407

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 36/40 (90%), Gaps = 2/40 (5%)
 Frame = -3

Query  677  KKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            KKD   +DG+W+++AF+EPYG AARMLVKRRTYCLEMNSF
Sbjct  370  KKDT--ADGSWISTAFEEPYGTAARMLVKRRTYCLEMNSF  407



>ref|XP_002278480.1| PREDICTED: F-box protein At5g46170 [Vitis vinifera]
Length=399

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 37/40 (93%), Gaps = 2/40 (5%)
 Frame = -3

Query  677  KKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            KK+V  SDG+WV++AF+EPYG AA+MLVKRRTYCLEMNSF
Sbjct  362  KKEV--SDGSWVSAAFEEPYGTAAKMLVKRRTYCLEMNSF  399



>emb|CAN73778.1| hypothetical protein VITISV_042179 [Vitis vinifera]
Length=399

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 37/40 (93%), Gaps = 2/40 (5%)
 Frame = -3

Query  677  KKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            KK+V  SDG+WV++AF+EPYG AA+MLVKRRTYCLEMNSF
Sbjct  362  KKEV--SDGSWVSAAFEEPYGTAAKMLVKRRTYCLEMNSF  399



>ref|XP_010052049.1| PREDICTED: F-box protein At5g46170-like [Eucalyptus grandis]
 gb|KCW75905.1| hypothetical protein EUGRSUZ_D00286 [Eucalyptus grandis]
Length=384

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = -3

Query  659  SDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            +DG+W+++AF+EPYG AARMLVKRRTYCLEMNSF
Sbjct  351  ADGSWISTAFEEPYGTAARMLVKRRTYCLEMNSF  384



>emb|CDX87738.1| BnaC02g32110D [Brassica napus]
Length=373

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 35/42 (83%), Gaps = 2/42 (5%)
 Frame = -3

Query  683  QHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            + KKDV  SD NWV+S F+EPY  AA+MLVKRRTYCLEMNSF
Sbjct  334  ESKKDV--SDANWVSSVFEEPYETAAKMLVKRRTYCLEMNSF  373



>ref|XP_009128847.1| PREDICTED: F-box protein At5g46170-like [Brassica rapa]
Length=371

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 35/42 (83%), Gaps = 2/42 (5%)
 Frame = -3

Query  683  QHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            +  KDV  SD NWV+SAF+EPY  AA+MLVKRRTYCLEMNSF
Sbjct  332  ESNKDV--SDANWVSSAFEEPYETAAKMLVKRRTYCLEMNSF  371



>emb|CDY43956.1| BnaA02g24340D [Brassica napus]
Length=373

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 35/42 (83%), Gaps = 2/42 (5%)
 Frame = -3

Query  683  QHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            +  KDV  SD NWV+SAF+EPY  AA+MLVKRRTYCLEMNSF
Sbjct  334  ESNKDV--SDANWVSSAFEEPYETAAKMLVKRRTYCLEMNSF  373



>ref|XP_010439863.1| PREDICTED: F-box protein At4g18380-like [Camelina sativa]
Length=419

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 35/42 (83%), Gaps = 2/42 (5%)
 Frame = -3

Query  683  QHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            + KKD    D +WV+SAFDEPYG AA+MLVKRRTYCLEMNSF
Sbjct  380  ESKKD--ACDVSWVSSAFDEPYGVAAKMLVKRRTYCLEMNSF  419



>ref|XP_010086997.1| hypothetical protein L484_005892 [Morus notabilis]
 gb|EXB25437.1| hypothetical protein L484_005892 [Morus notabilis]
Length=410

 Score = 67.8 bits (164),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 37/40 (93%), Gaps = 2/40 (5%)
 Frame = -3

Query  677  KKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            KK+V  SDG+WV++AF+EP+G AA+MLVKRRTYCLEMNSF
Sbjct  373  KKEV--SDGSWVSTAFEEPFGTAAKMLVKRRTYCLEMNSF  410



>ref|NP_193573.1| F-box protein [Arabidopsis thaliana]
 ref|NP_001190761.1| F-box protein [Arabidopsis thaliana]
 sp|O49508.1|FB237_ARATH RecName: Full=F-box protein At4g18380 [Arabidopsis thaliana]
 emb|CAA16718.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB78840.1| hypothetical protein [Arabidopsis thaliana]
 gb|ABL66803.1| At4g18380 [Arabidopsis thaliana]
 gb|AEE84037.1| F-box protein [Arabidopsis thaliana]
 gb|AEE84038.1| F-box protein [Arabidopsis thaliana]
Length=380

 Score = 67.4 bits (163),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 36/42 (86%), Gaps = 2/42 (5%)
 Frame = -3

Query  683  QHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            + KK+V   D +WV+SAFDEPYG AA+MLVKRRTYCLEMNSF
Sbjct  341  ESKKEV--CDVSWVSSAFDEPYGVAAKMLVKRRTYCLEMNSF  380



>ref|XP_006414111.1| hypothetical protein EUTSA_v10025383mg [Eutrema salsugineum]
 gb|ESQ55564.1| hypothetical protein EUTSA_v10025383mg [Eutrema salsugineum]
Length=397

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 36/42 (86%), Gaps = 2/42 (5%)
 Frame = -3

Query  683  QHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            + KK+V   D +WV+SAFDEPYG AA+MLVKRRTYCLEMNSF
Sbjct  358  ESKKEV--CDVSWVSSAFDEPYGIAAKMLVKRRTYCLEMNSF  397



>ref|XP_008371786.1| PREDICTED: F-box protein At5g46170-like [Malus domestica]
Length=402

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -3

Query  674  KDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            K  V SD +WV++AF+EPYG AA+MLVKRRTYCLEMNSF
Sbjct  364  KKEVSSDMSWVSTAFEEPYGTAAKMLVKRRTYCLEMNSF  402



>ref|XP_010517545.1| PREDICTED: F-box protein At4g18380 [Camelina sativa]
Length=391

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -3

Query  656  DGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            D +WV+SAFDEPYG AA+MLVKRRTYCLEMNSF
Sbjct  359  DVSWVSSAFDEPYGVAAKMLVKRRTYCLEMNSF  391



>gb|KJB57216.1| hypothetical protein B456_009G154000 [Gossypium raimondii]
 gb|KJB57217.1| hypothetical protein B456_009G154000 [Gossypium raimondii]
Length=391

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 36/40 (90%), Gaps = 2/40 (5%)
 Frame = -3

Query  677  KKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            KK+V  SD +W++SAF+EPYG AA+MLVKRRTYCLEMNSF
Sbjct  354  KKEV--SDASWLSSAFEEPYGTAAKMLVKRRTYCLEMNSF  391



>gb|KDP37998.1| hypothetical protein JCGZ_04641 [Jatropha curcas]
Length=429

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 36/40 (90%), Gaps = 2/40 (5%)
 Frame = -3

Query  677  KKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            KK+V  SD +WV++AF+EPYG AA+MLVKRRTYCLEMNSF
Sbjct  392  KKEV--SDSSWVSTAFEEPYGTAAKMLVKRRTYCLEMNSF  429



>ref|XP_009360916.1| PREDICTED: F-box protein At5g46170-like [Pyrus x bretschneideri]
 ref|XP_009360917.1| PREDICTED: F-box protein At5g46170-like [Pyrus x bretschneideri]
Length=436

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -3

Query  674  KDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            K  V SD +W+++AF+EPYG AA+MLVKRRTYCLEMNSF
Sbjct  398  KKEVSSDLSWISTAFEEPYGTAAKMLVKRRTYCLEMNSF  436



>gb|KHG20859.1| hypothetical protein F383_03969 [Gossypium arboreum]
Length=391

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 36/40 (90%), Gaps = 2/40 (5%)
 Frame = -3

Query  677  KKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            KK+V  SD +W++SAF+EPYG AA+MLVKRRTYCLEMNSF
Sbjct  354  KKEV--SDASWLSSAFEEPYGTAAKMLVKRRTYCLEMNSF  391



>gb|AEX97082.1| F-box family protein [Malus domestica]
Length=403

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -3

Query  674  KDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            K  V SD +W+++AF+EPYG AA+MLVKRRTYCLEMNSF
Sbjct  365  KKEVSSDLSWISTAFEEPYGTAAKMLVKRRTYCLEMNSF  403



>gb|KJB57218.1| hypothetical protein B456_009G154000 [Gossypium raimondii]
Length=369

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 36/40 (90%), Gaps = 2/40 (5%)
 Frame = -3

Query  677  KKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            KK+V  SD +W++SAF+EPYG AA+MLVKRRTYCLEMNSF
Sbjct  332  KKEV--SDASWLSSAFEEPYGTAAKMLVKRRTYCLEMNSF  369



>ref|XP_008371620.1| PREDICTED: F-box protein At5g46170-like [Malus domestica]
Length=403

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -3

Query  674  KDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            K  V SD +W+++AF+EPYG AA+MLVKRRTYCLEMNSF
Sbjct  365  KKEVSSDLSWISTAFEEPYGTAAKMLVKRRTYCLEMNSF  403



>ref|XP_008225507.1| PREDICTED: F-box protein At5g46170-like [Prunus mume]
Length=402

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -3

Query  674  KDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            K  V SD +WV++AF+EPYG AA+ML+KRRTYCLEMNSF
Sbjct  364  KKEVSSDLSWVSTAFEEPYGTAAKMLIKRRTYCLEMNSF  402



>ref|XP_007212265.1| hypothetical protein PRUPE_ppa006658mg [Prunus persica]
 gb|EMJ13464.1| hypothetical protein PRUPE_ppa006658mg [Prunus persica]
Length=401

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = -3

Query  674  KDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            K  V SD +WV++AF+EPYG AA+ML+KRRTYCLEMNSF
Sbjct  363  KKEVSSDLSWVSTAFEEPYGTAAKMLIKRRTYCLEMNSF  401



>ref|XP_011035442.1| PREDICTED: F-box protein At5g46170-like [Populus euphratica]
 ref|XP_011035443.1| PREDICTED: F-box protein At5g46170-like [Populus euphratica]
Length=394

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 35/40 (88%), Gaps = 2/40 (5%)
 Frame = -3

Query  677  KKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            KKDV  SD +WV++ F+EPYG AA+MLVKRRTYCLEMNSF
Sbjct  357  KKDV--SDVSWVSTTFEEPYGTAAKMLVKRRTYCLEMNSF  394



>ref|XP_002305042.1| hypothetical protein POPTR_0004s06450g [Populus trichocarpa]
 ref|XP_006384083.1| F-box family protein [Populus trichocarpa]
 gb|EEE85553.1| hypothetical protein POPTR_0004s06450g [Populus trichocarpa]
 gb|ERP61880.1| F-box family protein [Populus trichocarpa]
Length=398

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 35/40 (88%), Gaps = 2/40 (5%)
 Frame = -3

Query  677  KKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            KKDV  SD +WV++ F+EPYG AA+MLVKRRTYCLEMNSF
Sbjct  361  KKDV--SDVSWVSTTFEEPYGTAAKMLVKRRTYCLEMNSF  398



>ref|XP_004163869.1| PREDICTED: F-box protein At5g46170-like, partial [Cucumis sativus]
Length=421

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 37/40 (93%), Gaps = 2/40 (5%)
 Frame = -3

Query  677  KKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            KK+V  SDG+W+++AF+EPYG AA++LVKRRTYCLEMNSF
Sbjct  384  KKEV--SDGSWLSNAFEEPYGTAAKILVKRRTYCLEMNSF  421



>ref|XP_011460217.1| PREDICTED: F-box protein At5g46170 [Fragaria vesca subsp. vesca]
Length=402

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 36/40 (90%), Gaps = 2/40 (5%)
 Frame = -3

Query  677  KKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            KK+V  SD +WV++AF+EPYG AA+MLVKRRTYCLEMNSF
Sbjct  365  KKEV--SDLSWVSTAFEEPYGTAAKMLVKRRTYCLEMNSF  402



>gb|KJB69848.1| hypothetical protein B456_011G045900 [Gossypium raimondii]
 gb|KJB69849.1| hypothetical protein B456_011G045900 [Gossypium raimondii]
Length=399

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 36/40 (90%), Gaps = 2/40 (5%)
 Frame = -3

Query  677  KKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            KK+V  SD +W+++AF+EPYG AA+MLVKRRTYCLEMNSF
Sbjct  362  KKEV--SDASWLSTAFEEPYGTAAKMLVKRRTYCLEMNSF  399



>ref|XP_008439618.1| PREDICTED: F-box protein At5g46170-like [Cucumis melo]
Length=407

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 37/40 (93%), Gaps = 2/40 (5%)
 Frame = -3

Query  677  KKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            KK+V  SDG+W+++AF+EPYG AA++LVKRRTYCLEMNSF
Sbjct  370  KKEV--SDGSWLSNAFEEPYGTAAKILVKRRTYCLEMNSF  407



>ref|XP_004134599.1| PREDICTED: F-box protein At5g46170-like [Cucumis sativus]
 gb|KGN49409.1| hypothetical protein Csa_6G523990 [Cucumis sativus]
Length=407

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 37/40 (93%), Gaps = 2/40 (5%)
 Frame = -3

Query  677  KKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            KK+V  SDG+W+++AF+EPYG AA++LVKRRTYCLEMNSF
Sbjct  370  KKEV--SDGSWLSNAFEEPYGTAAKILVKRRTYCLEMNSF  407



>ref|XP_007025034.1| F-box family protein [Theobroma cacao]
 gb|EOY27656.1| F-box family protein [Theobroma cacao]
Length=397

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 36/40 (90%), Gaps = 2/40 (5%)
 Frame = -3

Query  677  KKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            KK+V  SD +W+++AF+EPYG AA+MLVKRRTYCLEMNSF
Sbjct  360  KKEV--SDASWLSTAFEEPYGTAAKMLVKRRTYCLEMNSF  397



>ref|XP_010687117.1| PREDICTED: F-box protein At4g18380 [Beta vulgaris subsp. vulgaris]
 ref|XP_010687118.1| PREDICTED: F-box protein At4g18380 [Beta vulgaris subsp. vulgaris]
Length=408

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 36/40 (90%), Gaps = 2/40 (5%)
 Frame = -3

Query  677  KKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            KK++  SD +WV++AF+EPYG AA+MLVKRRTYCLEMNSF
Sbjct  371  KKEI--SDLSWVSTAFEEPYGTAAKMLVKRRTYCLEMNSF  408



>ref|XP_010518768.1| PREDICTED: F-box protein At5g46170 [Tarenaya hassleriana]
Length=385

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 36/42 (86%), Gaps = 2/42 (5%)
 Frame = -3

Query  683  QHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            + KK+V   D +WV+SAF+EPYG AA+MLVKRRTYCLEMNSF
Sbjct  346  ESKKEVC--DVSWVSSAFEEPYGTAAKMLVKRRTYCLEMNSF  385



>emb|CDX99890.1| BnaC05g23120D [Brassica napus]
Length=367

 Score = 64.3 bits (155),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 35/42 (83%), Gaps = 2/42 (5%)
 Frame = -3

Query  683  QHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            + KK+V   D +W+A AF+EP+G AARML+KRRTYCLEMNSF
Sbjct  328  ESKKEVC--DASWLADAFEEPFGTAARMLIKRRTYCLEMNSF  367



>ref|XP_009115183.1| PREDICTED: F-box protein At1g30200 [Brassica rapa]
 emb|CDY26286.1| BnaA09g26370D [Brassica napus]
Length=374

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 35/42 (83%), Gaps = 2/42 (5%)
 Frame = -3

Query  683  QHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            + KK+V   D +W+A AF+EP+G AARML+KRRTYCLEMNSF
Sbjct  335  ESKKEVC--DASWLADAFEEPFGTAARMLIKRRTYCLEMNSF  374



>emb|CDX78848.1| BnaA01g09150D [Brassica napus]
Length=97

 Score = 60.8 bits (146),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 34/42 (81%), Gaps = 2/42 (5%)
 Frame = -3

Query  683  QHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            + KK+V   D +WV+SAFD  YG AA+MLVKRRTYCLEMNSF
Sbjct  58   ESKKEVC--DVSWVSSAFDGAYGVAAKMLVKRRTYCLEMNSF  97



>ref|XP_002519646.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42619.1| conserved hypothetical protein [Ricinus communis]
Length=414

 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -3

Query  656  DGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            D +WV++AF+EPYG AA+MLVKRRTYCLEMNSF
Sbjct  382  DASWVSTAFEEPYGTAAKMLVKRRTYCLEMNSF  414



>ref|XP_006279647.1| hypothetical protein CARUB_v10026571mg [Capsella rubella]
 gb|EOA12545.1| hypothetical protein CARUB_v10026571mg [Capsella rubella]
Length=388

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 36/42 (86%), Gaps = 2/42 (5%)
 Frame = -3

Query  683  QHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            + KK+V  SD +WV+SAF+EPY  AA+MLVKRRTYCLEMNSF
Sbjct  349  ESKKEV--SDISWVSSAFEEPYETAAKMLVKRRTYCLEMNSF  388



>gb|KJB66946.1| hypothetical protein B456_010G167400 [Gossypium raimondii]
 gb|KJB66947.1| hypothetical protein B456_010G167400 [Gossypium raimondii]
Length=392

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -3

Query  659  SDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            SD +W+++AF+EPYG AA+ML+KRRTYCLEMNSF
Sbjct  359  SDASWLSTAFEEPYGTAAKMLIKRRTYCLEMNSF  392



>ref|XP_010441616.1| PREDICTED: F-box protein At5g46170-like [Camelina sativa]
Length=389

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 36/42 (86%), Gaps = 2/42 (5%)
 Frame = -3

Query  683  QHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            + KK+V  SD +WV+SAF+EPY  AA+MLVKRRTYCLEMNSF
Sbjct  350  ESKKEV--SDISWVSSAFEEPYETAAKMLVKRRTYCLEMNSF  389



>ref|XP_010494785.1| PREDICTED: F-box protein At5g46170-like [Camelina sativa]
Length=389

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 36/42 (86%), Gaps = 2/42 (5%)
 Frame = -3

Query  683  QHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            + KK+V  SD +WV+SAF+EPY  AA+MLVKRRTYCLEMNSF
Sbjct  350  ESKKEV--SDISWVSSAFEEPYETAAKMLVKRRTYCLEMNSF  389



>gb|KJB68311.1| hypothetical protein B456_010G238100 [Gossypium raimondii]
Length=378

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -3

Query  659  SDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            SD +W+++AF+EPYG AA+MLVKRRTYCLEMNSF
Sbjct  345  SDSSWLSNAFEEPYGTAAKMLVKRRTYCLEMNSF  378



>ref|NP_199429.1| F-box protein [Arabidopsis thaliana]
 sp|Q9FNK5.1|FB285_ARATH RecName: Full=F-box protein At5g46170 [Arabidopsis thaliana]
 dbj|BAB08262.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL49842.1| unknown protein [Arabidopsis thaliana]
 gb|AAN13195.1| unknown protein [Arabidopsis thaliana]
 gb|AED95349.1| F-box protein [Arabidopsis thaliana]
Length=395

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 36/42 (86%), Gaps = 2/42 (5%)
 Frame = -3

Query  683  QHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            + KK+V  SD +WV+SAF+EPY  AA+MLVKRRTYCLEMNSF
Sbjct  356  ESKKEV--SDISWVSSAFEEPYETAAKMLVKRRTYCLEMNSF  395



>ref|XP_010481487.1| PREDICTED: F-box protein At5g46170 [Camelina sativa]
Length=388

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 36/42 (86%), Gaps = 2/42 (5%)
 Frame = -3

Query  683  QHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            + KK+V  SD +WV+SAF+EPY  AA+MLVKRRTYCLEMNSF
Sbjct  349  ESKKEV--SDISWVSSAFEEPYETAAKMLVKRRTYCLEMNSF  388



>gb|KHN06964.1| F-box protein [Glycine soja]
Length=166

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -3

Query  662  GSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
             SD +WV++AF+EPY  AA MLVKRRTYCLEMNSF
Sbjct  132  ASDLSWVSTAFEEPYRTAATMLVKRRTYCLEMNSF  166



>ref|XP_010434544.1| PREDICTED: F-box protein At4g18380-like [Camelina sativa]
Length=393

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -3

Query  656  DGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            D +WV+SAFDEPY  AA+MLVKRRTYCLEMNSF
Sbjct  361  DVSWVSSAFDEPYVVAAKMLVKRRTYCLEMNSF  393



>ref|XP_002863421.1| F-box family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39680.1| F-box family protein [Arabidopsis lyrata subsp. lyrata]
Length=392

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 36/42 (86%), Gaps = 2/42 (5%)
 Frame = -3

Query  683  QHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            + K++V  SD +WV+SAF+EPY  AA+MLVKRRTYCLEMNSF
Sbjct  353  ESKREV--SDISWVSSAFEEPYETAAKMLVKRRTYCLEMNSF  392



>gb|KHG27594.1| hypothetical protein F383_11279 [Gossypium arboreum]
Length=411

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 35/39 (90%), Gaps = 2/39 (5%)
 Frame = -3

Query  677  KKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNS  561
            KK+V  SD +W+++AF+EPYG AA+MLVKRRTYCLEMNS
Sbjct  362  KKEV--SDASWLSTAFEEPYGTAAKMLVKRRTYCLEMNS  398



>ref|XP_002890858.1| F-box family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67117.1| F-box family protein [Arabidopsis lyrata subsp. lyrata]
Length=381

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 35/42 (83%), Gaps = 2/42 (5%)
 Frame = -3

Query  683  QHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            + KK+V   D +W++ AF+EPYG AA+ML+KRRTYCLEMNSF
Sbjct  342  ESKKEVC--DASWLSDAFEEPYGTAAKMLIKRRTYCLEMNSF  381



>ref|XP_010478400.1| PREDICTED: F-box protein At1g30200-like [Camelina sativa]
 ref|XP_010478401.1| PREDICTED: F-box protein At1g30200-like [Camelina sativa]
Length=383

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 35/42 (83%), Gaps = 2/42 (5%)
 Frame = -3

Query  683  QHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            + KK+V   D +W++ AF+EPYG AA+ML+KRRTYCLEMNSF
Sbjct  344  ESKKEV--CDASWLSDAFEEPYGTAAKMLIKRRTYCLEMNSF  383



>ref|XP_010499543.1| PREDICTED: F-box protein At1g30200-like isoform X1 [Camelina 
sativa]
 ref|XP_010499544.1| PREDICTED: F-box protein At1g30200-like isoform X2 [Camelina 
sativa]
Length=383

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 35/42 (83%), Gaps = 2/42 (5%)
 Frame = -3

Query  683  QHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            + KK+V   D +W++ AF+EPYG AA+ML+KRRTYCLEMNSF
Sbjct  344  ESKKEV--CDASWLSDAFEEPYGTAAKMLIKRRTYCLEMNSF  383



>ref|XP_006307474.1| hypothetical protein CARUB_v10009099mg [Capsella rubella]
 gb|EOA40372.1| hypothetical protein CARUB_v10009099mg [Capsella rubella]
Length=453

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 35/42 (83%), Gaps = 2/42 (5%)
 Frame = -3

Query  683  QHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            + KK+V   D +W++ AF+EPYG AA+ML+KRRTYCLEMNSF
Sbjct  414  ESKKEVC--DASWLSDAFEEPYGTAAKMLIKRRTYCLEMNSF  453



>ref|XP_004486009.1| PREDICTED: F-box protein At5g46170-like [Cicer arietinum]
Length=402

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -3

Query  662  GSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            GSD +WV++AF+EPY +AA MLVKRRTYCLEMNSF
Sbjct  368  GSDLSWVSTAFEEPYRSAAAMLVKRRTYCLEMNSF  402



>ref|XP_002870048.1| F-box family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46307.1| F-box family protein [Arabidopsis lyrata subsp. lyrata]
Length=386

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 35/42 (83%), Gaps = 2/42 (5%)
 Frame = -3

Query  683  QHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            + KK+V   D +WV++AFDE YG AA+MLVKRRTYCLEMNSF
Sbjct  347  ESKKEV--CDVSWVSAAFDESYGVAAKMLVKRRTYCLEMNSF  386



>ref|XP_003593894.1| F-box family protein [Medicago truncatula]
 gb|AES64145.1| F-box plant-like protein [Medicago truncatula]
Length=389

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -3

Query  662  GSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            GSD +WV++AF+EPY +AA ML+KRRTYCLEMNSF
Sbjct  355  GSDLSWVSTAFEEPYRSAAAMLIKRRTYCLEMNSF  389



>ref|XP_006415502.1| hypothetical protein EUTSA_v10007915mg [Eutrema salsugineum]
 gb|ESQ33855.1| hypothetical protein EUTSA_v10007915mg [Eutrema salsugineum]
Length=382

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 36/42 (86%), Gaps = 2/42 (5%)
 Frame = -3

Query  683  QHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            + KK+V   D +W++ AF+EP+G+AA+ML+KRRTYCLEMNSF
Sbjct  343  ESKKEVC--DASWLSDAFEEPFGSAAKMLIKRRTYCLEMNSF  382



>ref|XP_008444512.1| PREDICTED: F-box protein At5g46170-like [Cucumis melo]
 ref|XP_008444520.1| PREDICTED: F-box protein At5g46170-like [Cucumis melo]
Length=406

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 34/40 (85%), Gaps = 2/40 (5%)
 Frame = -3

Query  677  KKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            KKDV  SD +W ++AF+EPY  AA+MLVKRRTYCLEMNSF
Sbjct  369  KKDV--SDCSWASTAFEEPYRTAAKMLVKRRTYCLEMNSF  406



>ref|XP_010460807.1| PREDICTED: F-box protein At1g30200 [Camelina sativa]
Length=384

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 35/42 (83%), Gaps = 2/42 (5%)
 Frame = -3

Query  683  QHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            + KK+V   D +W++ AF+EPYG AA+ML++RRTYCLEMNSF
Sbjct  345  ESKKEV--CDASWLSDAFEEPYGTAAKMLIRRRTYCLEMNSF  384



>ref|XP_002317281.1| F-box family protein [Populus trichocarpa]
 gb|EEE97893.1| F-box family protein [Populus trichocarpa]
Length=405

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 35/40 (88%), Gaps = 2/40 (5%)
 Frame = -3

Query  677  KKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            KKDV  SD + +++AF+EPYG AA+MLVKRRTYCLEMNSF
Sbjct  368  KKDV--SDISCLSTAFEEPYGTAAKMLVKRRTYCLEMNSF  405



>ref|XP_011007418.1| PREDICTED: F-box protein At5g46170-like [Populus euphratica]
Length=405

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 35/40 (88%), Gaps = 2/40 (5%)
 Frame = -3

Query  677  KKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            KKDV  SD + +++AF+EPYG AA+MLVKRRTYCLEMNSF
Sbjct  368  KKDV--SDISCLSTAFEEPYGTAAKMLVKRRTYCLEMNSF  405



>ref|XP_010923814.1| PREDICTED: F-box protein At5g46170-like [Elaeis guineensis]
Length=401

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -3

Query  659  SDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            SDG WV++AF+EPY  AA+ML+KRRTYCLEMNSF
Sbjct  368  SDGCWVSNAFEEPYRTAAKMLLKRRTYCLEMNSF  401



>gb|KHG06780.1| hypothetical protein F383_00742 [Gossypium arboreum]
Length=378

 Score = 61.2 bits (147),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -3

Query  659  SDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            SD +W+++AF+ PYG AA+MLVKRRTYCLEMNSF
Sbjct  345  SDASWLSNAFEGPYGTAAKMLVKRRTYCLEMNSF  378



>ref|XP_010538543.1| PREDICTED: F-box protein At5g46170-like [Tarenaya hassleriana]
Length=378

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -3

Query  656  DGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            D +WV+SAF+EPY  AA+MLVKRRTYCLEMNSF
Sbjct  346  DVSWVSSAFEEPYRTAAKMLVKRRTYCLEMNSF  378



>ref|XP_010538256.1| PREDICTED: F-box protein At1g30200-like [Tarenaya hassleriana]
Length=384

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 35/42 (83%), Gaps = 2/42 (5%)
 Frame = -3

Query  683  QHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            + KK+V   D +WV+ AF+EP+G AA+ML+KR+TYCLEMNSF
Sbjct  345  ESKKEVC--DTSWVSGAFEEPFGTAAKMLIKRKTYCLEMNSF  384



>ref|XP_010549497.1| PREDICTED: F-box protein At1g30200 [Tarenaya hassleriana]
Length=398

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -3

Query  656  DGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            D +W++ +F+EPYG AA+ML+KRRTYCLEMNSF
Sbjct  366  DASWLSDSFEEPYGTAAKMLIKRRTYCLEMNSF  398



>ref|XP_006398302.1| hypothetical protein EUTSA_v10000919mg [Eutrema salsugineum]
 gb|ESQ39755.1| hypothetical protein EUTSA_v10000919mg [Eutrema salsugineum]
Length=387

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 35/42 (83%), Gaps = 2/42 (5%)
 Frame = -3

Query  683  QHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            + KK+V  SD +WV+ AF+EPY  AA++LVKRRTYCLEMNSF
Sbjct  348  ESKKEV--SDISWVSLAFEEPYETAAKLLVKRRTYCLEMNSF  387



>ref|XP_004137366.1| PREDICTED: F-box protein At5g46170-like [Cucumis sativus]
 ref|XP_004167064.1| PREDICTED: F-box protein At5g46170-like [Cucumis sativus]
 gb|KGN63909.1| hypothetical protein Csa_1G025900 [Cucumis sativus]
Length=406

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 33/40 (83%), Gaps = 2/40 (5%)
 Frame = -3

Query  677  KKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            KKDV  SD  W ++AF+EPY  AA+MLVKRRTYCLEMNSF
Sbjct  369  KKDV--SDCFWASTAFEEPYRTAAKMLVKRRTYCLEMNSF  406



>ref|XP_009131656.1| PREDICTED: F-box protein At4g18380 [Brassica rapa]
Length=377

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 34/42 (81%), Gaps = 2/42 (5%)
 Frame = -3

Query  683  QHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            + KK+V   D +WV+SAFD  YG AA+MLVKRRTYCLEMNSF
Sbjct  338  ESKKEV--CDVSWVSSAFDGAYGVAAKMLVKRRTYCLEMNSF  377



>ref|XP_003546077.1| PREDICTED: F-box protein At5g46170-like [Glycine max]
Length=385

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -3

Query  662  GSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
             SD +WV++AF+EPY  AA MLVKRRTYCLEMNSF
Sbjct  351  ASDLSWVSTAFEEPYRTAATMLVKRRTYCLEMNSF  385



>ref|XP_003542943.1| PREDICTED: F-box protein At5g46170-like isoform X1 [Glycine max]
 ref|XP_006594509.1| PREDICTED: F-box protein At5g46170-like isoform X2 [Glycine max]
Length=387

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -3

Query  662  GSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
             SD +WV++AF+EPY  AA MLVKRRTYCLEMNSF
Sbjct  353  ASDLSWVSTAFEEPYRTAATMLVKRRTYCLEMNSF  387



>ref|XP_007147928.1| hypothetical protein PHAVU_006G166500g [Phaseolus vulgaris]
 gb|ESW19922.1| hypothetical protein PHAVU_006G166500g [Phaseolus vulgaris]
Length=379

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -3

Query  662  GSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
             SD +WV++AF+EPY  AA MLVKRRTYCLEMNSF
Sbjct  345  ASDLSWVSTAFEEPYRTAATMLVKRRTYCLEMNSF  379



>ref|NP_564350.1| F-box protein [Arabidopsis thaliana]
 ref|NP_973940.1| F-box protein [Arabidopsis thaliana]
 sp|Q9C534.1|FB19_ARATH RecName: Full=F-box protein At1g30200 [Arabidopsis thaliana]
 gb|AAG50568.1|AC073506_10 hypothetical protein [Arabidopsis thaliana]
 gb|AAG50853.1|AC074176_2 hypothetical protein [Arabidopsis thaliana]
 gb|AAK59838.1| At1g30200/F12P21_1 [Arabidopsis thaliana]
 gb|AAL24254.1| At1g30200/F12P21_1 [Arabidopsis thaliana]
 gb|AAN18072.1| At1g30200/F12P21_1 [Arabidopsis thaliana]
 gb|AEE31190.1| F-box protein [Arabidopsis thaliana]
 gb|AEE31191.1| F-box protein [Arabidopsis thaliana]
Length=379

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 34/42 (81%), Gaps = 2/42 (5%)
 Frame = -3

Query  683  QHKKDVVGSDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            + KK+V   D +W++ AF+EP+G  A+ML+KRRTYCLEMNSF
Sbjct  340  ESKKEVC--DASWLSDAFEEPFGTVAKMLIKRRTYCLEMNSF  379



>ref|XP_010247412.1| PREDICTED: F-box protein At5g46170 [Nelumbo nucifera]
Length=398

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 36/42 (86%), Gaps = 4/42 (10%)
 Frame = -3

Query  677  KKDVVGSDGNWVASAFDE--PYGAAARMLVKRRTYCLEMNSF  558
            KK++  SD +WV++AF+E  PYG AA++LVKRRTYCLEMNSF
Sbjct  359  KKEI--SDSSWVSTAFEEEEPYGTAAKLLVKRRTYCLEMNSF  398



>ref|XP_004961549.1| PREDICTED: F-box protein At5g46170-like [Setaria italica]
Length=410

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 33/46 (72%), Gaps = 3/46 (7%)
 Frame = -3

Query  686  EQHKKDVVG---SDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            E+  KD+VG   S   WV  AF+EPY  AARML+KRRTY LEMNSF
Sbjct  365  EEATKDMVGNGASVATWVLDAFEEPYRTAARMLLKRRTYTLEMNSF  410



>ref|XP_008794503.1| PREDICTED: F-box protein At5g46170 [Phoenix dactylifera]
Length=396

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  659  SDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            SDG WV+ AF+EPY  A++ML+KR TYCLEMNSF
Sbjct  363  SDGCWVSHAFEEPYRTASKMLLKRTTYCLEMNSF  396



>emb|CDX77641.1| BnaC07g18950D [Brassica napus]
Length=362

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 1/36 (3%)
 Frame = -3

Query  662  GSDGNWVASA-FDEPYGAAARMLVKRRTYCLEMNSF  558
             SD +WV+SA F+EPY AA +MLVKR+TYCLEMNSF
Sbjct  327  ASDVSWVSSAAFEEPYEAAVKMLVKRKTYCLEMNSF  362



>ref|XP_009388498.1| PREDICTED: F-box protein At5g46170-like [Musa acuminata subsp. 
malaccensis]
Length=404

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -3

Query  659  SDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            SD  W+++AF+EPY +AARMLVKRRTY LEMNSF
Sbjct  371  SDRCWISNAFEEPYRSAARMLVKRRTYSLEMNSF  404



>emb|CDY33458.1| BnaA06g36150D [Brassica napus]
Length=360

 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 34/43 (79%), Gaps = 3/43 (7%)
 Frame = -3

Query  683  QHKKDVVGSDGNWVASA-FDEPYGAAARMLVKRRTYCLEMNSF  558
            + KK+V  SD  WV+SA F EPY AA +MLVKR+TYCLEMNSF
Sbjct  320  ESKKEV--SDVLWVSSAAFGEPYKAAVKMLVKRKTYCLEMNSF  360



>ref|XP_009101540.1| PREDICTED: F-box protein At5g46170 [Brassica rapa]
Length=374

 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 34/43 (79%), Gaps = 3/43 (7%)
 Frame = -3

Query  683  QHKKDVVGSDGNWVASA-FDEPYGAAARMLVKRRTYCLEMNSF  558
            + KK+V  SD  WV+SA F EPY AA +MLVKR+TYCLEMNSF
Sbjct  334  ESKKEV--SDVLWVSSAAFGEPYKAAVKMLVKRKTYCLEMNSF  374



>ref|XP_009397406.1| PREDICTED: F-box protein At5g46170-like [Musa acuminata subsp. 
malaccensis]
Length=408

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = -3

Query  656  DGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            DG WV+ AF+EPY  AA ML+KRRTY LEMNSF
Sbjct  376  DGCWVSDAFEEPYRTAATMLMKRRTYSLEMNSF  408



>ref|XP_010940976.1| PREDICTED: F-box protein At5g46170-like [Elaeis guineensis]
Length=412

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -3

Query  647  WVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            WV++AF+EPY  AA++LVKRR YCLEMNSF
Sbjct  383  WVSNAFEEPYRTAAKLLVKRRNYCLEMNSF  412



>ref|XP_008784858.1| PREDICTED: F-box protein At5g46170-like [Phoenix dactylifera]
 ref|XP_008784859.1| PREDICTED: F-box protein At5g46170-like [Phoenix dactylifera]
Length=410

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -3

Query  647  WVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            WV +AF+EPY  AA++LVKRR+YCLEMNSF
Sbjct  381  WVLNAFEEPYRTAAKLLVKRRSYCLEMNSF  410



>ref|XP_009398331.1| PREDICTED: F-box protein At5g46170-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009398332.1| PREDICTED: F-box protein At5g46170-like [Musa acuminata subsp. 
malaccensis]
Length=399

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -3

Query  659  SDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            SDG  V+ AF+EPY  AA+ML+ RRTYCLEMNSF
Sbjct  366  SDGCRVSDAFEEPYRTAAKMLMNRRTYCLEMNSF  399



>ref|XP_009408533.1| PREDICTED: F-box protein At5g46170 [Musa acuminata subsp. malaccensis]
Length=402

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -3

Query  659  SDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            SD  WV+ AF+EPY +A   L+KRRTYCLEMNSF
Sbjct  369  SDNCWVSDAFEEPYKSATSTLMKRRTYCLEMNSF  402



>ref|XP_006836365.1| hypothetical protein AMTR_s00092p00114580 [Amborella trichopoda]
 gb|ERM99218.1| hypothetical protein AMTR_s00092p00114580 [Amborella trichopoda]
Length=393

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 28/33 (85%), Gaps = 1/33 (3%)
 Frame = -3

Query  656  DGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            DG WV+ AF+EP+  AA +LVKRRTYCLEMNSF
Sbjct  362  DG-WVSLAFEEPFRTAASLLVKRRTYCLEMNSF  393



>ref|NP_001151107.1| F-box domain containing protein [Zea mays]
 gb|ACG41645.1| F-box domain containing protein [Zea mays]
Length=406

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 30/40 (75%), Gaps = 1/40 (3%)
 Frame = -3

Query  674  KDVVGSDGN-WVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            + V G  G  W++ AF+EPY  AA++L+KRR YCLEMNSF
Sbjct  367  QGVAGPAGTCWISEAFEEPYRTAAKVLLKRRAYCLEMNSF  406



>ref|XP_004970106.1| PREDICTED: F-box protein At5g46170-like [Setaria italica]
Length=411

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 4/40 (10%)
 Frame = -3

Query  665  VGSDGN----WVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            VG+ G+    WV+ AF+EPY  AA++L+KRR YCLEMNSF
Sbjct  372  VGTAGSVGTCWVSEAFEEPYRTAAKVLLKRRPYCLEMNSF  411



>ref|XP_002440052.1| hypothetical protein SORBIDRAFT_09g025120 [Sorghum bicolor]
 gb|EES18482.1| hypothetical protein SORBIDRAFT_09g025120 [Sorghum bicolor]
Length=398

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 32/46 (70%), Gaps = 3/46 (7%)
 Frame = -3

Query  686  EQHKKDVV--GSDGN-WVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            E+   D V  G+DG  WV  AF+EPY  A RML+KRRTY LEMNSF
Sbjct  353  EEGTGDTVWNGADGAAWVLDAFEEPYRTAVRMLLKRRTYSLEMNSF  398



>ref|XP_008649848.1| PREDICTED: F-box protein At5g46170-like [Zea mays]
 gb|AFW78643.1| hypothetical protein ZEAMMB73_212566 [Zea mays]
Length=412

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -3

Query  659  SDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            +D  WV  AF+EPY  AA+ML+KRRTY LEMNSF
Sbjct  379  ADAAWVLDAFEEPYRTAAKMLLKRRTYSLEMNSF  412



>gb|EAY98656.1| hypothetical protein OsI_20579 [Oryza sativa Indica Group]
Length=412

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 32/49 (65%), Gaps = 6/49 (12%)
 Frame = -3

Query  686  EQHKKDVVGSD------GNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            E+  +D VG+       G WV+ AF+EPY  A  ML+KRRTY LEMNSF
Sbjct  364  EEATRDTVGTGIAGSAGGCWVSDAFEEPYRTAVGMLLKRRTYSLEMNSF  412



>ref|XP_002442835.1| hypothetical protein SORBIDRAFT_08g003610 [Sorghum bicolor]
 gb|EES16673.1| hypothetical protein SORBIDRAFT_08g003610 [Sorghum bicolor]
Length=300

 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -3

Query  647  WVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            W++ AF+EPY  AA++L+KRR YCLEMNSF
Sbjct  271  WISEAFEEPYRTAAKVLLKRRAYCLEMNSF  300



>ref|XP_009381298.1| PREDICTED: F-box protein At5g46170-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009381299.1| PREDICTED: F-box protein At5g46170-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009381300.1| PREDICTED: F-box protein At5g46170-like [Musa acuminata subsp. 
malaccensis]
Length=406

 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = -3

Query  656  DGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            D  W++ AF+EPY +AA MLVK RTYCLEMNSF
Sbjct  374  DRCWISGAFEEPYRSAAGMLVKGRTYCLEMNSF  406



>ref|XP_009407719.1| PREDICTED: F-box protein At5g46170-like [Musa acuminata subsp. 
malaccensis]
Length=406

 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  659  SDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            SD   ++SAF+EPY +AA ML+KRRTYCLEMNSF
Sbjct  373  SDRCSISSAFEEPYRSAAGMLMKRRTYCLEMNSF  406



>ref|NP_001146920.1| F-box domain containing protein [Zea mays]
 gb|ACG24418.1| F-box domain containing protein [Zea mays]
Length=406

 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -3

Query  647  WVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            W++ AF+EPY  AA++L+KRR YCLEMNSF
Sbjct  377  WISEAFEEPYRTAAKVLLKRRAYCLEMNSF  406



>ref|XP_006654629.1| PREDICTED: F-box protein At5g46170-like [Oryza brachyantha]
Length=420

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -3

Query  647  WVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            WV+ AF+EPY +A RML+KRRTY LEMNSF
Sbjct  391  WVSDAFEEPYRSAVRMLLKRRTYSLEMNSF  420



>ref|XP_008672792.1| PREDICTED: F-box domain containing protein isoform X1 [Zea mays]
 tpg|DAA57445.1| TPA: F-box domain containing protein [Zea mays]
Length=401

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -3

Query  647  WVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            W++ AF+EPY  AA++L+KRR YCLEMNSF
Sbjct  372  WISEAFEEPYRTAAKVLLKRRAYCLEMNSF  401



>ref|XP_002458563.1| hypothetical protein SORBIDRAFT_03g035810 [Sorghum bicolor]
 gb|EES03683.1| hypothetical protein SORBIDRAFT_03g035810 [Sorghum bicolor]
Length=418

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -3

Query  647  WVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            W++ AF+EPY  AA++L+KRR YCLEMNSF
Sbjct  389  WISEAFEEPYRTAAKVLLKRRAYCLEMNSF  418



>ref|XP_009399020.1| PREDICTED: F-box protein At5g46170-like [Musa acuminata subsp. 
malaccensis]
Length=397

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -3

Query  659  SDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            SDG WV+  F+EPY  A RML+KR+T+ LEMNSF
Sbjct  364  SDGCWVSDTFEEPYRTAIRMLMKRKTHSLEMNSF  397



>gb|EEE55450.1| hypothetical protein OsJ_03607 [Oryza sativa Japonica Group]
Length=851

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/39 (59%), Positives = 30/39 (77%), Gaps = 1/39 (3%)
 Frame = -3

Query  671  DVVGSDG-NWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            +V G  G +W+  AF+EPY  AA++L+KRRTY LEMNSF
Sbjct  813  EVAGPTGASWILDAFEEPYRTAAQVLLKRRTYSLEMNSF  851



>gb|EMT17885.1| hypothetical protein F775_06795 [Aegilops tauschii]
Length=188

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -3

Query  650  NWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            +W++ AF+EPY  AA++L KRRTY LEMNSF
Sbjct  158  SWISDAFEEPYRTAAKVLFKRRTYSLEMNSF  188



>ref|NP_001044377.1| Os01g0770400 [Oryza sativa Japonica Group]
 dbj|BAB56069.1| F-box family protein-like [Oryza sativa Japonica Group]
 dbj|BAF06291.1| Os01g0770400 [Oryza sativa Japonica Group]
 dbj|BAG88022.1| unnamed protein product [Oryza sativa Japonica Group]
Length=396

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 30/39 (77%), Gaps = 1/39 (3%)
 Frame = -3

Query  671  DVVGSDG-NWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            +V G  G +W+  AF+EPY  AA++L+KRRTY LEMNSF
Sbjct  358  EVAGPTGASWILDAFEEPYRTAAQVLLKRRTYSLEMNSF  396



>gb|EMT19583.1| hypothetical protein F775_23480 [Aegilops tauschii]
Length=106

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 31/49 (63%), Gaps = 6/49 (12%)
 Frame = -3

Query  686  EQHKKDVVG------SDGNWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            E+   D VG      + G+WV+ AF+EPY  A  +L+KRR Y LEMNSF
Sbjct  58   EEAMMDAVGNATAGSAGGSWVSDAFEEPYRTAVGVLLKRRMYSLEMNSF  106



>ref|XP_006646370.1| PREDICTED: F-box protein At5g46170-like, partial [Oryza brachyantha]
Length=275

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -3

Query  650  NWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            +W+  AF+EPY  AA++L+KRRTY LEMNSF
Sbjct  245  SWIVDAFEEPYRTAAQVLLKRRTYSLEMNSF  275



>gb|EEC71551.1| hypothetical protein OsI_03898 [Oryza sativa Indica Group]
Length=396

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 30/39 (77%), Gaps = 1/39 (3%)
 Frame = -3

Query  671  DVVGSDG-NWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            +V G  G +W+  AF+EPY  AA++L+KRRTY LEMNSF
Sbjct  358  EVAGLTGASWILDAFEEPYRTAAQVLLKRRTYSLEMNSF  396



>ref|XP_002455973.1| hypothetical protein SORBIDRAFT_03g028320 [Sorghum bicolor]
 gb|EES01093.1| hypothetical protein SORBIDRAFT_03g028320 [Sorghum bicolor]
Length=418

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = -3

Query  647  WVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            W++ A +EPY  AA++L+KRR YCLEMNSF
Sbjct  389  WISEALEEPYRTAAKVLLKRRAYCLEMNSF  418



>gb|ABK24885.1| unknown [Picea sitchensis]
 gb|ABR16398.1| unknown [Picea sitchensis]
Length=361

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -3

Query  647  WVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            ++A AFDEP+GAAA+ +VK+RTY LEMNSF
Sbjct  332  FLAGAFDEPFGAAAKEMVKKRTYLLEMNSF  361



>dbj|BAK06381.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99725.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97479.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=397

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -3

Query  650  NWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            +W++ AF+EPY  AA++L KRRTY LEMNSF
Sbjct  367  SWISDAFEEPYRTAAKVLFKRRTYSLEMNSF  397



>ref|XP_003568140.1| PREDICTED: F-box protein At5g46170-like [Brachypodium distachyon]
Length=420

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = -3

Query  647  WVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            WV+ AF+EPY  A RML+KRR Y LEMNSF
Sbjct  391  WVSDAFEEPYRTAVRMLLKRRMYSLEMNSF  420



>ref|XP_003569912.1| PREDICTED: F-box protein At4g18380-like [Brachypodium distachyon]
 ref|XP_003569913.1| PREDICTED: F-box protein At4g18380-like [Brachypodium distachyon]
Length=396

 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -3

Query  650  NWVASAFDEPYGAAARMLVKRRTYCLEMNSF  558
            +W++ AF+EPY  AA++L KRRTY LEMNSF
Sbjct  366  SWISDAFEEPYRTAAKVLFKRRTYSLEMNSF  396



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1144913349700