BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF008P23

Length=778
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009787408.1|  PREDICTED: probable glycerophosphoryl dieste...    188   4e-51   Nicotiana sylvestris
ref|XP_009625976.1|  PREDICTED: probable glycerophosphoryl dieste...    187   1e-50   Nicotiana tomentosiformis
ref|XP_009364630.1|  PREDICTED: probable glycerophosphoryl dieste...    176   6e-50   
ref|XP_009794308.1|  PREDICTED: probable glycerophosphoryl dieste...    176   1e-49   Nicotiana sylvestris
ref|XP_008345027.1|  PREDICTED: probable glycerophosphoryl dieste...    169   6e-47   
ref|XP_009588257.1|  PREDICTED: probable glycerophosphoryl dieste...    175   2e-46   
ref|XP_009335427.1|  PREDICTED: probable glycerophosphoryl dieste...    174   3e-46   Pyrus x bretschneideri [bai li]
ref|XP_009361078.1|  PREDICTED: probable glycerophosphoryl dieste...    172   2e-45   Pyrus x bretschneideri [bai li]
ref|XP_009348463.1|  PREDICTED: probable glycerophosphoryl dieste...    172   2e-45   Pyrus x bretschneideri [bai li]
ref|XP_004294052.1|  PREDICTED: glycerophosphodiester phosphodies...    170   1e-44   Fragaria vesca subsp. vesca
ref|XP_008366428.1|  PREDICTED: probable glycerophosphoryl dieste...    169   2e-44   
ref|XP_006344880.1|  PREDICTED: probable glycerophosphoryl dieste...    169   2e-44   Solanum tuberosum [potatoes]
emb|CDP13760.1|  unnamed protein product                                168   5e-44   Coffea canephora [robusta coffee]
ref|XP_006346174.1|  PREDICTED: probable glycerophosphoryl dieste...    167   1e-43   Solanum tuberosum [potatoes]
ref|XP_010324292.1|  PREDICTED: glycerophosphodiester phosphodies...    167   2e-43   Solanum lycopersicum
ref|XP_011097815.1|  PREDICTED: glycerophosphodiester phosphodies...    166   4e-43   Sesamum indicum [beniseed]
ref|XP_006387051.1|  hypothetical protein POPTR_2051s00200g             156   5e-43   
gb|KJB13799.1|  hypothetical protein B456_002G094900                    164   1e-42   Gossypium raimondii
gb|KHG12016.1|  putative glycerophosphoryl diester phosphodiester...    164   2e-42   Gossypium arboreum [tree cotton]
ref|XP_004251903.1|  PREDICTED: glycerophosphodiester phosphodies...    163   3e-42   Solanum lycopersicum
ref|XP_010099974.1|  putative glycerophosphoryl diester phosphodi...    162   8e-42   
ref|XP_010470589.1|  PREDICTED: glycerophosphodiester phosphodies...    161   1e-41   Camelina sativa [gold-of-pleasure]
ref|XP_008447692.1|  PREDICTED: probable glycerophosphoryl dieste...    161   2e-41   Cucumis melo [Oriental melon]
gb|EYU33686.1|  hypothetical protein MIMGU_mgv1a001772mg                161   2e-41   Erythranthe guttata [common monkey flower]
emb|CDY46687.1|  BnaA03g48210D                                          160   3e-41   Brassica napus [oilseed rape]
ref|XP_009137609.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    160   4e-41   Brassica rapa
gb|KHG08046.1|  putative glycerophosphoryl diester phosphodiester...    160   5e-41   Gossypium arboreum [tree cotton]
ref|XP_002529027.1|  glycerophosphoryl diester phosphodiesterase,...    159   1e-40   Ricinus communis
gb|KHN43860.1|  Putative glycerophosphoryl diester phosphodiester...    159   1e-40   Glycine soja [wild soybean]
ref|XP_003519608.1|  PREDICTED: probable glycerophosphoryl dieste...    158   2e-40   Glycine max [soybeans]
emb|CDX86807.1|  BnaA09g21970D                                          150   2e-40   
ref|NP_176869.2|  putative glycerophosphoryl diester phosphodiest...    158   2e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002300352.2|  hypothetical protein POPTR_0001s371702g            151   2e-40   
ref|XP_010513618.1|  PREDICTED: glycerophosphodiester phosphodies...    157   3e-40   Camelina sativa [gold-of-pleasure]
ref|NP_001185333.1|  putative glycerophosphoryl diester phosphodi...    158   3e-40   Arabidopsis thaliana [mouse-ear cress]
emb|CDX92806.1|  BnaC07g40640D                                          157   4e-40   
ref|XP_002276757.1|  PREDICTED: glycerophosphodiester phosphodies...    157   6e-40   Vitis vinifera
gb|KFK29182.1|  hypothetical protein AALP_AA7G100300                    157   6e-40   Arabis alpina [alpine rockcress]
ref|XP_010252665.1|  PREDICTED: glycerophosphodiester phosphodies...    157   7e-40   Nelumbo nucifera [Indian lotus]
ref|XP_008227060.1|  PREDICTED: probable glycerophosphoryl dieste...    157   7e-40   Prunus mume [ume]
ref|XP_010511612.1|  PREDICTED: glycerophosphodiester phosphodies...    156   1e-39   Camelina sativa [gold-of-pleasure]
gb|KCW70259.1|  hypothetical protein EUGRSUZ_F03515                     155   1e-39   Eucalyptus grandis [rose gum]
ref|XP_006279180.1|  hypothetical protein CARUB_v10007932mg             154   2e-39   
ref|XP_004150252.1|  PREDICTED: probable glycerophosphoryl dieste...    155   2e-39   Cucumis sativus [cucumbers]
ref|XP_007020652.1|  PLC-like phosphodiesterase family protein, p...    155   2e-39   
ref|XP_004293798.1|  PREDICTED: glycerophosphodiester phosphodies...    155   2e-39   Fragaria vesca subsp. vesca
ref|XP_010064948.1|  PREDICTED: probable glycerophosphoryl dieste...    155   3e-39   
emb|CDY45656.1|  BnaC09g31980D                                          154   3e-39   Brassica napus [oilseed rape]
emb|CDY13237.1|  BnaC09g24190D                                          154   4e-39   Brassica napus [oilseed rape]
ref|XP_007214645.1|  hypothetical protein PRUPE_ppa001847mg             154   7e-39   Prunus persica
ref|XP_006279182.1|  hypothetical protein CARUB_v10007932mg             153   1e-38   Capsella rubella
ref|XP_010496108.1|  PREDICTED: glycerophosphodiester phosphodies...    153   1e-38   Camelina sativa [gold-of-pleasure]
gb|EYU27402.1|  hypothetical protein MIMGU_mgv1a001806mg                153   1e-38   Erythranthe guttata [common monkey flower]
gb|AAP40466.1|  unknown protein                                         153   2e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009120058.1|  PREDICTED: probable glycerophosphoryl dieste...    153   2e-38   Brassica rapa
emb|CDY17323.1|  BnaA10g09570D                                          153   2e-38   Brassica napus [oilseed rape]
ref|XP_006401453.1|  hypothetical protein EUTSA_v10012748mg             152   2e-38   Eutrema salsugineum [saltwater cress]
ref|XP_011014752.1|  PREDICTED: glycerophosphodiester phosphodies...    152   2e-38   Populus euphratica
ref|XP_010433459.1|  PREDICTED: glycerophosphodiester phosphodies...    144   4e-38   
ref|XP_002888566.1|  kinase family protein                              153   4e-38   
ref|XP_009142640.1|  PREDICTED: probable glycerophosphoryl dieste...    151   6e-38   Brassica rapa
emb|CDX89312.1|  BnaA01g15810D                                          151   6e-38   
gb|EPS69135.1|  glycerophosphodiesterase-like protein                   150   7e-38   Genlisea aurea
ref|XP_011095489.1|  PREDICTED: glycerophosphodiester phosphodies...    151   8e-38   Sesamum indicum [beniseed]
ref|XP_010545263.1|  PREDICTED: glycerophosphodiester phosphodies...    151   8e-38   Tarenaya hassleriana [spider flower]
ref|XP_011014930.1|  PREDICTED: glycerophosphodiester phosphodies...    150   9e-38   Populus euphratica
emb|CDX94294.1|  BnaC01g18900D                                          150   1e-37   
gb|KFK27133.1|  hypothetical protein AALP_AA8G339300                    150   1e-37   Arabis alpina [alpine rockcress]
ref|XP_006391459.1|  hypothetical protein EUTSA_v10018170mg             150   1e-37   Eutrema salsugineum [saltwater cress]
ref|XP_006280047.1|  hypothetical protein CARUB_v10025925mg             150   1e-37   
ref|XP_009108190.1|  PREDICTED: probable glycerophosphoryl dieste...    150   1e-37   Brassica rapa
ref|XP_002867546.1|  MRH5/SHV3                                          150   2e-37   
ref|NP_567755.1|  glycerophosphoryl diester phosphodiesterase-like 3    150   2e-37   Arabidopsis thaliana [mouse-ear cress]
gb|AAL07129.1|  unknown protein                                         150   2e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010449676.1|  PREDICTED: glycerophosphodiester phosphodies...    150   2e-37   Camelina sativa [gold-of-pleasure]
ref|XP_006413151.1|  hypothetical protein EUTSA_v10024494mg             150   2e-37   Eutrema salsugineum [saltwater cress]
ref|XP_009127510.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    150   2e-37   Brassica rapa
ref|NP_176870.2|  suppressor of npr1-1 constitutive 4                   151   2e-37   Arabidopsis thaliana [mouse-ear cress]
gb|AAF98210.1|AC007152_6  Unknown protein                               151   2e-37   Arabidopsis thaliana [mouse-ear cress]
emb|CAB36515.1|  putative protein                                       150   2e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010415240.1|  PREDICTED: glycerophosphodiester phosphodies...    150   2e-37   Camelina sativa [gold-of-pleasure]
ref|XP_010443178.1|  PREDICTED: glycerophosphodiester phosphodies...    150   2e-37   Camelina sativa [gold-of-pleasure]
ref|XP_006280048.1|  hypothetical protein CARUB_v10025925mg             150   2e-37   Capsella rubella
ref|XP_010253010.1|  PREDICTED: glycerophosphodiester phosphodies...    149   2e-37   Nelumbo nucifera [Indian lotus]
emb|CDY42328.1|  BnaC02g17050D                                          143   3e-37   Brassica napus [oilseed rape]
ref|XP_010482994.1|  PREDICTED: glycerophosphodiester phosphodies...    149   4e-37   Camelina sativa [gold-of-pleasure]
ref|NP_200359.1|  putative glycerophosphoryl diester phosphodiest...    149   5e-37   Arabidopsis thaliana [mouse-ear cress]
emb|CDY11996.1|  BnaC03g14220D                                          149   5e-37   Brassica napus [oilseed rape]
emb|CDY12605.1|  BnaA02g12730D                                          148   6e-37   Brassica napus [oilseed rape]
ref|XP_010511610.1|  PREDICTED: LOW QUALITY PROTEIN: glycerophosp...    148   1e-36   Camelina sativa [gold-of-pleasure]
ref|XP_006300773.1|  hypothetical protein CARUB_v10019847mg             148   1e-36   
ref|XP_006283180.1|  hypothetical protein CARUB_v10004210mg             147   1e-36   Capsella rubella
ref|XP_009132384.1|  PREDICTED: probable glycerophosphoryl dieste...    147   1e-36   Brassica rapa
emb|CDY36746.1|  BnaA03g11400D                                          147   1e-36   Brassica napus [oilseed rape]
ref|XP_010270134.1|  PREDICTED: glycerophosphodiester phosphodies...    147   2e-36   Nelumbo nucifera [Indian lotus]
ref|XP_010496105.1|  PREDICTED: glycerophosphodiester phosphodies...    138   2e-36   Camelina sativa [gold-of-pleasure]
ref|XP_002300351.2|  hypothetical protein POPTR_0001s37160g             146   3e-36   Populus trichocarpa [western balsam poplar]
ref|XP_002864395.1|  glycerophosphoryl diester phosphodiesterase ...    146   3e-36   
ref|XP_004491450.1|  PREDICTED: probable glycerophosphoryl dieste...    145   1e-35   Cicer arietinum [garbanzo]
ref|XP_007146557.1|  hypothetical protein PHAVU_006G050600g             144   2e-35   Phaseolus vulgaris [French bean]
ref|XP_007142366.1|  hypothetical protein PHAVU_008G274200g             144   2e-35   Phaseolus vulgaris [French bean]
ref|XP_010448228.1|  PREDICTED: glycerophosphodiester phosphodies...    144   2e-35   Camelina sativa [gold-of-pleasure]
ref|XP_009105134.1|  PREDICTED: probable glycerophosphoryl dieste...    144   2e-35   Brassica rapa
ref|XP_010252664.1|  PREDICTED: glycerophosphodiester phosphodies...    144   3e-35   Nelumbo nucifera [Indian lotus]
ref|XP_007020653.1|  PLC-like phosphodiesterase family protein, p...    144   3e-35   
emb|CDX92782.1|  BnaC07g40400D                                          145   3e-35   
ref|XP_007146558.1|  hypothetical protein PHAVU_006G050600g             144   3e-35   Phaseolus vulgaris [French bean]
emb|CDY61647.1|  BnaCnng38120D                                          143   7e-35   Brassica napus [oilseed rape]
ref|XP_010536709.1|  PREDICTED: glycerophosphodiester phosphodies...    142   8e-35   Tarenaya hassleriana [spider flower]
ref|XP_009137635.1|  PREDICTED: probable glycerophosphoryl dieste...    144   1e-34   Brassica rapa
ref|XP_010438711.1|  PREDICTED: glycerophosphodiester phosphodies...    142   2e-34   Camelina sativa [gold-of-pleasure]
gb|KDP39221.1|  hypothetical protein JCGZ_00978                         141   2e-34   Jatropha curcas
ref|XP_010511611.1|  PREDICTED: LOW QUALITY PROTEIN: glycerophosp...    142   2e-34   
ref|XP_009415406.1|  PREDICTED: probable glycerophosphoryl dieste...    141   3e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006474966.1|  PREDICTED: probable glycerophosphoryl dieste...    141   3e-34   Citrus sinensis [apfelsine]
ref|XP_006452490.1|  hypothetical protein CICLE_v10007536mg             141   3e-34   Citrus clementina [clementine]
gb|KDO62174.1|  hypothetical protein CISIN_1g003550mg                   141   4e-34   Citrus sinensis [apfelsine]
ref|XP_010474164.1|  PREDICTED: glycerophosphodiester phosphodies...    138   1e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010496109.1|  PREDICTED: glycerophosphodiester phosphodies...    139   3e-33   
ref|XP_003544723.1|  PREDICTED: probable glycerophosphoryl dieste...    136   1e-32   Glycine max [soybeans]
gb|KHN23877.1|  Putative glycerophosphoryl diester phosphodiester...    136   1e-32   Glycine soja [wild soybean]
ref|XP_010419030.1|  PREDICTED: glycerophosphodiester phosphodies...    136   1e-32   
emb|CDY46667.1|  BnaA03g48410D                                          137   2e-32   Brassica napus [oilseed rape]
ref|XP_010675853.1|  PREDICTED: glycerophosphodiester phosphodies...    135   2e-32   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006603452.1|  PREDICTED: probable glycerophosphoryl dieste...    132   3e-32   Glycine max [soybeans]
ref|XP_004500131.1|  PREDICTED: probable glycerophosphoryl dieste...    134   8e-32   Cicer arietinum [garbanzo]
ref|XP_002888565.1|  glycerophosphoryl diester phosphodiesterase ...    134   9e-32   
ref|XP_010913957.1|  PREDICTED: glycerophosphodiester phosphodies...    133   1e-31   
ref|XP_010913956.1|  PREDICTED: glycerophosphodiester phosphodies...    133   2e-31   Elaeis guineensis
ref|XP_007142367.1|  hypothetical protein PHAVU_008G274300g             132   4e-31   Phaseolus vulgaris [French bean]
ref|XP_004491451.1|  PREDICTED: probable glycerophosphoryl dieste...    131   6e-31   Cicer arietinum [garbanzo]
ref|XP_010928867.1|  PREDICTED: glycerophosphodiester phosphodies...    131   7e-31   Elaeis guineensis
ref|XP_003617676.1|  Glycerophosphodiesterase-like protein              130   1e-30   Medicago truncatula
ref|XP_008782908.1|  PREDICTED: probable glycerophosphoryl dieste...    130   1e-30   Phoenix dactylifera
gb|KJB62956.1|  hypothetical protein B456_009G445400                    129   1e-30   Gossypium raimondii
ref|XP_007146559.1|  hypothetical protein PHAVU_006G050800g             130   2e-30   Phaseolus vulgaris [French bean]
ref|XP_008798764.1|  PREDICTED: probable glycerophosphoryl dieste...    129   2e-30   Phoenix dactylifera
ref|XP_009399679.1|  PREDICTED: probable glycerophosphoryl dieste...    130   2e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008798763.1|  PREDICTED: probable glycerophosphoryl dieste...    129   4e-30   Phoenix dactylifera
ref|XP_009390640.1|  PREDICTED: probable glycerophosphoryl dieste...    129   4e-30   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB62955.1|  hypothetical protein B456_009G445400                    129   4e-30   Gossypium raimondii
ref|XP_007146552.1|  hypothetical protein PHAVU_006G050300g             127   1e-29   Phaseolus vulgaris [French bean]
ref|XP_011013351.1|  PREDICTED: glycerophosphodiester phosphodies...    128   1e-29   Populus euphratica
ref|XP_010913178.1|  PREDICTED: glycerophosphodiester phosphodies...    127   2e-29   
ref|XP_010913177.1|  PREDICTED: glycerophosphodiester phosphodies...    127   3e-29   Elaeis guineensis
ref|XP_004499801.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    126   5e-29   
gb|KHN28413.1|  Putative glycerophosphoryl diester phosphodiester...    125   1e-28   Glycine soja [wild soybean]
emb|CDY14478.1|  BnaC03g21170D                                          125   3e-28   Brassica napus [oilseed rape]
gb|KHM99500.1|  Putative glycerophosphoryl diester phosphodiester...    123   4e-28   Glycine soja [wild soybean]
ref|XP_003553031.1|  PREDICTED: probable glycerophosphoryl dieste...    122   8e-28   
gb|KHN28414.1|  Putative glycerophosphoryl diester phosphodiester...    122   8e-28   Glycine soja [wild soybean]
ref|XP_002862842.1|  glycerophosphoryl diester phosphodiesterase ...    122   1e-27   
emb|CDX86766.1|  BnaA09g21560D                                          121   1e-27   
ref|XP_006300798.1|  hypothetical protein CARUB_v10019878mg             121   1e-27   
gb|AES70468.2|  glycerophosphoryl diester phosphodiesterase famil...    121   2e-27   Medicago truncatula
ref|XP_006300799.1|  hypothetical protein CARUB_v10019878mg             121   2e-27   
ref|XP_003530777.1|  PREDICTED: probable glycerophosphoryl dieste...    121   2e-27   Glycine max [soybeans]
emb|CDX82242.1|  BnaA03g35790D                                          119   2e-27   
ref|XP_003600217.1|  Glycerophosphodiesterase-like protein              121   2e-27   
gb|ACF74306.1|  putative glycerophosphoryl diesterphosphodiestera...    114   5e-27   Arachis hypogaea [goober]
ref|XP_010545539.1|  PREDICTED: glycerophosphodiester phosphodies...    120   7e-27   Tarenaya hassleriana [spider flower]
emb|CDY58867.1|  BnaC09g52640D                                          119   1e-26   Brassica napus [oilseed rape]
gb|KHM99502.1|  Putative glycerophosphoryl diester phosphodiester...    119   1e-26   Glycine soja [wild soybean]
ref|XP_003530776.1|  PREDICTED: probable glycerophosphoryl dieste...    119   1e-26   Glycine max [soybeans]
ref|XP_006586115.1|  PREDICTED: probable glycerophosphoryl dieste...    118   2e-26   Glycine max [soybeans]
ref|XP_008806340.1|  PREDICTED: probable glycerophosphoryl dieste...    119   2e-26   Phoenix dactylifera
ref|XP_003530778.1|  PREDICTED: probable glycerophosphoryl dieste...    118   2e-26   Glycine max [soybeans]
emb|CDY29432.1|  BnaC05g32380D                                          117   2e-26   Brassica napus [oilseed rape]
gb|EMS66577.1|  putative glycerophosphoryl diester phosphodiester...    119   3e-26   Triticum urartu
ref|XP_002523503.1|  glycerophosphoryl diester phosphodiesterase,...    118   4e-26   Ricinus communis
ref|XP_006297062.1|  hypothetical protein CARUB_v10013062mg             116   9e-26   Capsella rubella
ref|XP_002883252.1|  glycerophosphoryl diester phosphodiesterase ...    116   1e-25   
ref|XP_010675854.1|  PREDICTED: glycerophosphodiester phosphodies...    115   2e-25   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001053060.1|  Os04g0472300                                       115   2e-25   
emb|CAH67272.1|  B0806H07.1                                             115   2e-25   Oryza sativa [red rice]
ref|XP_004975931.1|  PREDICTED: probable glycerophosphoryl dieste...    115   2e-25   Setaria italica
emb|CDY02788.1|  BnaC02g11010D                                          114   7e-25   
ref|XP_008242952.1|  PREDICTED: probable glycerophosphoryl dieste...    114   7e-25   Prunus mume [ume]
gb|ACF79780.1|  unknown                                                 111   8e-25   Zea mays [maize]
ref|XP_006652401.1|  PREDICTED: probable glycerophosphoryl dieste...    114   9e-25   Oryza brachyantha
ref|XP_007201937.1|  hypothetical protein PRUPE_ppa001673mg             114   1e-24   Prunus persica
gb|AAO42211.1|  unknown protein                                         113   1e-24   Arabidopsis thaliana [mouse-ear cress]
emb|CDY32730.1|  BnaA02g07920D                                          113   1e-24   Brassica napus [oilseed rape]
ref|NP_188688.1|  glycerophosphodiester phosphodiesterase-like pr...    113   1e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009126795.1|  PREDICTED: probable glycerophosphoryl dieste...    113   1e-24   Brassica rapa
ref|XP_010483370.1|  PREDICTED: glycerophosphodiester phosphodies...    113   1e-24   Camelina sativa [gold-of-pleasure]
ref|XP_006282081.1|  hypothetical protein CARUB_v10028327mg             113   2e-24   Capsella rubella
ref|NP_001062173.1|  Os08g0503200                                       113   2e-24   
ref|XP_010483369.1|  PREDICTED: glycerophosphodiester phosphodies...    111   2e-24   Camelina sativa [gold-of-pleasure]
ref|XP_010446175.1|  PREDICTED: glycerophosphodiester phosphodies...    112   2e-24   
ref|XP_003572357.1|  PREDICTED: glycerophosphodiester phosphodies...    112   2e-24   
ref|XP_010453288.1|  PREDICTED: glycerophosphodiester phosphodies...    112   3e-24   Camelina sativa [gold-of-pleasure]
emb|CDY36036.1|  BnaC03g41620D                                          112   3e-24   Brassica napus [oilseed rape]
gb|KHN41389.1|  Putative glycerophosphoryl diester phosphodiester...    107   3e-24   Glycine soja [wild soybean]
ref|XP_002866252.1|  glycerophosphoryl diester phosphodiesterase ...    112   4e-24   Arabidopsis lyrata subsp. lyrata
ref|XP_002866246.1|  glycerophosphoryl diester phosphodiesterase ...    112   5e-24   Arabidopsis lyrata subsp. lyrata
ref|XP_006401135.1|  hypothetical protein EUTSA_v10012762mg             112   5e-24   
ref|XP_009366150.1|  PREDICTED: probable glycerophosphoryl dieste...    111   6e-24   Pyrus x bretschneideri [bai li]
ref|XP_009132086.1|  PREDICTED: probable glycerophosphoryl dieste...    111   6e-24   Brassica rapa
emb|CDX88656.1|  BnaA03g09930D                                          111   7e-24   
gb|EMT29224.1|  Putative glycerophosphoryl diester phosphodiester...    111   8e-24   
emb|CDY02800.1|  BnaC02g10890D                                          111   9e-24   
ref|XP_008645878.1|  PREDICTED: probable glycerophosphoryl dieste...    110   1e-23   Zea mays [maize]
ref|XP_009417318.1|  PREDICTED: probable glycerophosphoryl dieste...    110   1e-23   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAC42822.1|  GPI-anchored protein                                   107   1e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009120321.1|  PREDICTED: probable glycerophosphoryl dieste...    110   1e-23   Brassica rapa
dbj|BAJ85772.1|  predicted protein                                      110   2e-23   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS58329.1|  putative glycerophosphoryl diester phosphodiester...    109   2e-23   Triticum urartu
ref|XP_006660255.1|  PREDICTED: probable glycerophosphoryl dieste...    109   3e-23   
ref|XP_010453117.1|  PREDICTED: glycerophosphodiester phosphodies...    109   4e-23   Camelina sativa [gold-of-pleasure]
ref|XP_009358473.1|  PREDICTED: probable glycerophosphoryl dieste...    108   4e-23   Pyrus x bretschneideri [bai li]
ref|XP_008384576.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    108   5e-23   
ref|XP_008343908.1|  PREDICTED: probable glycerophosphoryl dieste...    108   5e-23   
emb|CDY19634.1|  BnaA05g20420D                                          108   5e-23   Brassica napus [oilseed rape]
ref|XP_009126782.1|  PREDICTED: probable glycerophosphoryl dieste...    108   6e-23   
ref|XP_009145621.1|  PREDICTED: probable glycerophosphoryl dieste...    108   6e-23   Brassica rapa
ref|XP_009126781.1|  PREDICTED: probable glycerophosphoryl dieste...    108   6e-23   
emb|CDY12599.1|  BnaA02g12670D                                          105   7e-23   Brassica napus [oilseed rape]
dbj|BAJ93663.1|  predicted protein                                      108   9e-23   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAD94535.1|  Glycerophosphodiesterase-like                          105   1e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010536984.1|  PREDICTED: glycerophosphodiester phosphodies...    107   1e-22   Tarenaya hassleriana [spider flower]
gb|KFK39359.1|  hypothetical protein AALP_AA3G234500                    107   1e-22   Arabis alpina [alpine rockcress]
emb|CDY11832.1|  BnaC03g12580D                                          100   1e-22   Brassica napus [oilseed rape]
emb|CDY32720.1|  BnaA02g07820D                                          107   1e-22   Brassica napus [oilseed rape]
ref|XP_003579951.1|  PREDICTED: glycerophosphodiester phosphodies...    107   2e-22   Brachypodium distachyon [annual false brome]
dbj|BAJ87963.1|  predicted protein                                      107   2e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_200625.1|  glycerophosphodiester phosphodiesterase like 7        106   3e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008361197.1|  PREDICTED: probable glycerophosphoryl dieste...    106   3e-22   
gb|EMT33222.1|  Putative glycerophosphoryl diester phosphodiester...    105   7e-22   
ref|XP_010241663.1|  PREDICTED: glycerophosphodiester phosphodies...    105   8e-22   Nelumbo nucifera [Indian lotus]
ref|XP_002437331.1|  hypothetical protein SORBIDRAFT_10g025000          104   1e-21   
ref|XP_009127505.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    105   1e-21   
ref|XP_002453429.1|  hypothetical protein SORBIDRAFT_04g005910          101   1e-21   
gb|AFW58562.1|  hypothetical protein ZEAMMB73_533189                    100   2e-21   
ref|NP_200613.2|  glycerophosphodiester phosphodiesterase like 6        103   2e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004952935.1|  PREDICTED: probable glycerophosphoryl dieste...    103   4e-21   
ref|XP_008336911.1|  PREDICTED: probable glycerophosphoryl dieste...  96.3    1e-20   
emb|CDY60415.1|  BnaC02g45340D                                          101   2e-20   Brassica napus [oilseed rape]
ref|XP_002325146.2|  hypothetical protein POPTR_0018s11890g             101   2e-20   Populus trichocarpa [western balsam poplar]
ref|XP_007011972.1|  SHV3-like 5                                        100   2e-20   
ref|XP_004973844.1|  PREDICTED: probable glycerophosphoryl dieste...    100   2e-20   Setaria italica
ref|NP_001159159.1|  uncharacterized protein LOC100304242             94.7    4e-20   
ref|XP_002446646.1|  hypothetical protein SORBIDRAFT_06g019730          100   4e-20   Sorghum bicolor [broomcorn]
gb|KCW70260.1|  hypothetical protein EUGRSUZ_F03515                   99.4    5e-20   Eucalyptus grandis [rose gum]
ref|XP_002308389.2|  hypothetical protein POPTR_0006s20170g           99.8    6e-20   
emb|CDY59886.1|  BnaC02g47600D                                        94.7    6e-20   Brassica napus [oilseed rape]
ref|XP_010235616.1|  PREDICTED: glycerophosphodiester phosphodies...  99.4    6e-20   
ref|XP_006406374.1|  hypothetical protein EUTSA_v10020151mg           99.4    7e-20   
ref|XP_003575252.1|  PREDICTED: glycerophosphodiester phosphodies...  99.8    7e-20   
ref|XP_011033465.1|  PREDICTED: glycerophosphodiester phosphodies...  99.4    8e-20   Populus euphratica
ref|NP_001170117.1|  hypothetical protein                             99.4    8e-20   Zea mays [maize]
ref|NP_001168748.1|  uncharacterized protein LOC100382543 precursor   99.0    1e-19   Zea mays [maize]
ref|XP_011017989.1|  PREDICTED: glycerophosphodiester phosphodies...  99.0    1e-19   Populus euphratica
ref|XP_008645839.1|  PREDICTED: uncharacterized protein LOC100384...  99.0    1e-19   
emb|CDY43885.1|  BnaC09g33580D                                        98.2    2e-19   Brassica napus [oilseed rape]
ref|XP_010656583.1|  PREDICTED: glycerophosphodiester phosphodies...  98.2    2e-19   Vitis vinifera
emb|CBI18678.3|  unnamed protein product                              97.8    2e-19   Vitis vinifera
ref|XP_004965787.1|  PREDICTED: probable glycerophosphoryl dieste...  95.9    9e-19   
ref|XP_008345038.1|  PREDICTED: probable glycerophosphoryl dieste...  93.2    1e-18   
ref|XP_002452366.1|  hypothetical protein SORBIDRAFT_04g024440        95.9    1e-18   Sorghum bicolor [broomcorn]
ref|NP_001141559.1|  hypothetical protein                             92.4    1e-18   
ref|XP_004965786.1|  PREDICTED: probable glycerophosphoryl dieste...  95.5    2e-18   
ref|XP_010687738.1|  PREDICTED: glycerophosphodiester phosphodies...  95.5    2e-18   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009385529.1|  PREDICTED: probable glycerophosphoryl dieste...  94.7    2e-18   
ref|XP_006647435.1|  PREDICTED: probable glycerophosphoryl dieste...  94.7    3e-18   Oryza brachyantha
gb|AFW66254.1|  hypothetical protein ZEAMMB73_246886                  94.4    4e-18   
gb|KDP38642.1|  hypothetical protein JCGZ_03995                       94.0    4e-18   Jatropha curcas
ref|XP_008677441.1|  PREDICTED: uncharacterized protein LOC100304...  94.0    6e-18   
ref|XP_008677439.1|  PREDICTED: uncharacterized protein LOC100304...  94.0    7e-18   
ref|XP_008677440.1|  PREDICTED: uncharacterized protein LOC100304...  94.0    8e-18   
ref|XP_004979884.1|  PREDICTED: probable glycerophosphoryl dieste...  94.0    8e-18   Setaria italica
ref|XP_008799657.1|  PREDICTED: probable glycerophosphoryl dieste...  93.2    9e-18   Phoenix dactylifera
ref|XP_010928375.1|  PREDICTED: LOW QUALITY PROTEIN: glycerophosp...  92.8    1e-17   Elaeis guineensis
dbj|BAD94065.1|  Glycerophosphodiesterase-like                        86.7    1e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008811209.1|  PREDICTED: probable glycerophosphoryl dieste...  91.7    3e-17   Phoenix dactylifera
ref|XP_002461022.1|  hypothetical protein SORBIDRAFT_02g039350        91.3    3e-17   
ref|XP_010109457.1|  putative glycerophosphoryl diester phosphodi...  91.7    3e-17   Morus notabilis
ref|XP_006829998.1|  hypothetical protein AMTR_s00252p00015420        91.3    4e-17   Amborella trichopoda
gb|AES92567.2|  glycerophosphoryl diester phosphodiesterase famil...  91.3    4e-17   Medicago truncatula
ref|XP_003610370.1|  GPI-anchored protein                             91.3    5e-17   
ref|XP_010050300.1|  PREDICTED: probable glycerophosphoryl dieste...  90.9    6e-17   
gb|EMT15515.1|  Putative glycerophosphoryl diester phosphodiester...  90.9    7e-17   
gb|KCW78936.1|  hypothetical protein EUGRSUZ_C00368                   90.5    7e-17   
gb|KJB13801.1|  hypothetical protein B456_002G094900                  90.1    7e-17   
gb|EAY86479.1|  hypothetical protein OsI_07859                        89.7    1e-16   
ref|NP_001047275.1|  Os02g0588500                                     89.7    1e-16   
ref|XP_009129031.1|  PREDICTED: probable glycerophosphoryl dieste...  86.3    2e-16   
gb|KJB13800.1|  hypothetical protein B456_002G094900                  88.6    3e-16   
gb|EYU43134.1|  hypothetical protein MIMGU_mgv11b015422mg             81.3    5e-16   
gb|ABG22015.1|  Glycerophosphoryl diester phosphodiesterase famil...  85.5    6e-16   
ref|XP_002445920.1|  hypothetical protein SORBIDRAFT_07g028050        87.4    7e-16   
dbj|BAD94573.1|  Glycerophosphodiesterase-like                        81.6    9e-16   
ref|XP_010943202.1|  PREDICTED: glycerophosphodiester phosphodies...  87.0    1e-15   
ref|NP_001066731.1|  Os12g0456700                                     85.9    1e-15   
gb|KEH28442.1|  glycerophosphoryl diester phosphodiesterase famil...  85.9    2e-15   
gb|KDO59429.1|  hypothetical protein CISIN_1g005894mg                 85.5    3e-15   
ref|XP_006474608.1|  PREDICTED: probable glycerophosphoryl dieste...  85.1    4e-15   
gb|KDO62175.1|  hypothetical protein CISIN_1g003550mg                 85.1    4e-15   
ref|NP_001169682.1|  hypothetical protein precursor                   85.1    4e-15   
gb|EEE53168.1|  hypothetical protein OsJ_36008                        85.1    5e-15   
emb|CDP10204.1|  unnamed protein product                              84.3    7e-15   
gb|KEH37864.1|  glycerophosphoryl diester phosphodiesterase famil...  84.3    9e-15   
gb|KHN22089.1|  Putative glycerophosphoryl diester phosphodiester...  84.0    1e-14   
ref|XP_003541467.2|  PREDICTED: probable glycerophosphoryl dieste...  83.6    1e-14   
ref|XP_009396661.1|  PREDICTED: probable glycerophosphoryl dieste...  83.6    1e-14   
ref|XP_006856834.1|  hypothetical protein AMTR_s00055p00174750        83.6    1e-14   
ref|XP_006300797.1|  hypothetical protein CARUB_v10019878mg           82.4    3e-14   
ref|XP_008679540.1|  PREDICTED: probable glycerophosphoryl dieste...  82.0    4e-14   
gb|KHG04342.1|  putative glycerophosphoryl diester phosphodiester...  80.5    9e-14   
gb|KJB54927.1|  hypothetical protein B456_009G054700                  80.9    9e-14   
ref|XP_006279181.1|  hypothetical protein CARUB_v10007932mg           80.1    2e-13   
gb|KHN18329.1|  Putative glycerophosphoryl diester phosphodiester...  79.0    4e-13   
ref|XP_006600556.1|  PREDICTED: probable glycerophosphoryl dieste...  79.0    4e-13   
gb|EMS62136.1|  putative glycerophosphoryl diester phosphodiester...  79.0    4e-13   
gb|AFW70514.1|  hypothetical protein ZEAMMB73_076757                  77.4    1e-12   
ref|XP_008645346.1|  PREDICTED: probable glycerophosphoryl dieste...  77.4    1e-12   
ref|XP_006301866.1|  hypothetical protein CARUB_v10022337mg           73.6    2e-12   
ref|XP_011084009.1|  PREDICTED: glycerophosphodiester phosphodies...  76.6    2e-12   
ref|XP_010433460.1|  PREDICTED: glycerophosphodiester phosphodies...  75.9    3e-12   
gb|EMT03737.1|  Putative glycerophosphoryl diester phosphodiester...  76.3    4e-12   
dbj|BAD15424.1|  glycerophosphoryl diester phosphodiesterase 2 pr...  75.5    6e-12   
gb|EMT22700.1|  Putative glycerophosphoryl diester phosphodiester...  75.5    6e-12   
gb|EPS68532.1|  hypothetical protein M569_06231                       73.2    2e-11   
ref|XP_003570935.1|  PREDICTED: glycerophosphodiester phosphodies...  72.4    6e-11   
ref|XP_010315575.1|  PREDICTED: glycerophosphodiester phosphodies...  72.0    6e-11   
ref|XP_004951679.1|  PREDICTED: probable glycerophosphoryl dieste...  71.6    8e-11   
ref|XP_010315562.1|  PREDICTED: glycerophosphodiester phosphodies...  71.6    8e-11   
ref|XP_007154910.1|  hypothetical protein PHAVU_003G158000g           71.6    1e-10   
gb|EYU25341.1|  hypothetical protein MIMGU_mgv1a001922mg              71.2    1e-10   
ref|XP_006340583.1|  PREDICTED: probable glycerophosphoryl dieste...  70.9    1e-10   
ref|XP_004160165.1|  PREDICTED: probable glycerophosphoryl dieste...  70.9    2e-10   
ref|XP_004143578.1|  PREDICTED: probable glycerophosphoryl dieste...  70.9    2e-10   
ref|XP_008440682.1|  PREDICTED: probable glycerophosphoryl dieste...  70.9    2e-10   
ref|XP_010489971.1|  PREDICTED: glycerophosphodiester phosphodies...  69.3    3e-10   
ref|XP_006340538.1|  PREDICTED: probable glycerophosphoryl dieste...  68.2    1e-09   
ref|XP_011460616.1|  PREDICTED: glycerophosphodiester phosphodies...  67.4    2e-09   
ref|XP_009594117.1|  PREDICTED: probable glycerophosphoryl dieste...  66.2    6e-09   
emb|CAN61355.1|  hypothetical protein VITISV_027762                   65.9    7e-09   
ref|XP_009803612.1|  PREDICTED: probable glycerophosphoryl dieste...  65.1    1e-08   
ref|XP_007020655.1|  SHV3-like 2, putative isoform 4                  65.1    1e-08   
ref|XP_010231120.1|  PREDICTED: glycerophosphodiester phosphodies...  64.3    2e-08   
ref|XP_003566003.1|  PREDICTED: glycerophosphodiester phosphodies...  63.9    3e-08   
ref|XP_010231119.1|  PREDICTED: glycerophosphodiester phosphodies...  63.9    3e-08   
ref|XP_006602095.1|  PREDICTED: uncharacterized protein LOC100782575  58.9    1e-07   
ref|XP_004973845.1|  PREDICTED: probable glycerophosphoryl dieste...  60.8    3e-07   
dbj|BAK08209.1|  predicted protein                                    60.5    4e-07   
ref|XP_007146555.1|  hypothetical protein PHAVU_006G0504000g          57.0    7e-07   
gb|EEC72640.1|  hypothetical protein OsI_06154                        59.7    8e-07   
ref|NP_001046128.1|  Os02g0187400                                     58.5    2e-06   
ref|XP_006344951.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...  58.2    2e-06   
ref|XP_002983605.1|  hypothetical protein SELMODRAFT_118548           58.2    2e-06   
gb|AAD10252.1|  S222                                                  57.4    4e-06   
ref|XP_002973791.1|  hypothetical protein SELMODRAFT_100702           55.8    2e-05   
emb|CDY28913.1|  BnaA02g25630D                                        52.0    5e-05   
gb|EMS54688.1|  putative glycerophosphoryl diester phosphodiester...  52.8    1e-04   
ref|XP_009803613.1|  PREDICTED: probable glycerophosphoryl dieste...  50.8    6e-04   



>ref|XP_009787408.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Nicotiana sylvestris]
Length=752

 Score =   188 bits (477),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 103/122 (84%), Gaps = 3/122 (2%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            TNVV KLQ+S + VYVQLF+NEFVSQAWDFFSD  +ELN+Y  GA     DGVIT +PAT
Sbjct  594  TNVVQKLQSSNLTVYVQLFNNEFVSQAWDFFSDSSLELNNYAVGAG---IDGVITEYPAT  650

Query  592  ANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  413
            A RYRRNRCLG K++PPYM PV PGSLL L++PQ+LPPAEAP PVLTESDVVEPPLPPVA
Sbjct  651  AARYRRNRCLGLKDLPPYMSPVQPGSLLGLIAPQFLPPAEAPNPVLTESDVVEPPLPPVA  710

Query  412  KI  407
            KI
Sbjct  711  KI  712



>ref|XP_009625976.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Nicotiana tomentosiformis]
 dbj|BAE53680.1| putative glycerophosphoryl diester phosphodiesterase family protein 
[Nicotiana tabacum]
 dbj|BAF34116.1| glycerophosphodiesterase-like protein [Nicotiana tabacum]
Length=752

 Score =   187 bits (474),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 102/122 (84%), Gaps = 3/122 (2%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            TNVV KLQ+S + VYVQL +NEFVSQ+WDFFSD  VELN+Y  GA     DGVIT +PAT
Sbjct  594  TNVVQKLQSSNLTVYVQLLNNEFVSQSWDFFSDSSVELNNYAVGAG---IDGVITEYPAT  650

Query  592  ANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  413
            A RYRRNRCLG+K+ PPYM  V PGSLL+LM+PQ+LPPAEAP PVLTESDVVEPPLPPVA
Sbjct  651  AARYRRNRCLGFKDSPPYMTSVQPGSLLELMAPQFLPPAEAPNPVLTESDVVEPPLPPVA  710

Query  412  KI  407
            KI
Sbjct  711  KI  712



>ref|XP_009364630.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Pyrus x bretschneideri]
 ref|XP_009364651.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Pyrus x bretschneideri]
Length=242

 Score =   176 bits (445),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 102/124 (82%), Gaps = 3/124 (2%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            GVT+VV+KLQA+K+ VYV+LFSNEFV+QAWDFFSDP VE+NS+V GA+    DGVIT FP
Sbjct  81   GVTDVVSKLQAAKLPVYVELFSNEFVTQAWDFFSDPTVEINSFVSGAN---IDGVITDFP  137

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
             TA RY++N CL  KEIP YM PV P SL+Q+++P YLPPAEAP PVLTESDV+EPPLP 
Sbjct  138  KTAARYKKNLCLRQKEIPSYMSPVQPASLVQVITPSYLPPAEAPNPVLTESDVIEPPLPS  197

Query  418  VAKI  407
            V  +
Sbjct  198  VTAL  201



>ref|XP_009794308.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2, partial [Nicotiana sylvestris]
Length=305

 Score =   176 bits (447),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 99/124 (80%), Gaps = 3/124 (2%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G T+VV KLQ+S + VY +LF+NEFVSQAWDFFSD  VE+N+Y+ GA     DGVIT FP
Sbjct  145  GQTDVVQKLQSSNLPVYARLFNNEFVSQAWDFFSDSSVEINNYISGAG---IDGVITEFP  201

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
             TA RYRRNRCLGYK+ P Y+ PV PG LLQ M+PQ LP AEAP P+LT+SDVVEPPLPP
Sbjct  202  GTAARYRRNRCLGYKDRPLYLSPVEPGGLLQFMAPQLLPAAEAPNPILTDSDVVEPPLPP  261

Query  418  VAKI  407
            VAKI
Sbjct  262  VAKI  265



>ref|XP_008345027.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Malus domestica]
Length=299

 Score =   169 bits (429),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 98/121 (81%), Gaps = 3/121 (2%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            GVT+VV+KLQ +K+ VYV+LFSNEFVSQ WDFFSDP VE+NS+V G +    DGVIT FP
Sbjct  138  GVTDVVSKLQDAKLPVYVELFSNEFVSQPWDFFSDPTVEINSFVSGVN---IDGVITDFP  194

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
             TA RY++NRCLG KE+P YM P+ P SL+Q+++P YLPPAEAP P L ESDV+EPPLP 
Sbjct  195  KTAARYKKNRCLGRKEVPNYMSPIQPASLIQVVTPSYLPPAEAPNPTLRESDVIEPPLPS  254

Query  418  V  416
            V
Sbjct  255  V  255



>ref|XP_009588257.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Nicotiana tomentosiformis]
Length=741

 Score =   175 bits (443),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 99/124 (80%), Gaps = 3/124 (2%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G T+VV KLQ+S + VY +LF+NEFVSQAWDFFSD  VE+N+Y+ GA     DG+IT FP
Sbjct  580  GQTDVVQKLQSSNLPVYARLFNNEFVSQAWDFFSDSSVEINNYISGAG---IDGIITEFP  636

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
             TA RYRRNRCLGYK+ P Y+ PV PG LLQ M+PQ LP AEAP P+LT+SDVVEPPLPP
Sbjct  637  GTAARYRRNRCLGYKDRPLYLSPVEPGGLLQFMAPQLLPAAEAPNPILTDSDVVEPPLPP  696

Query  418  VAKI  407
            VAKI
Sbjct  697  VAKI  700



>ref|XP_009335427.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Pyrus x bretschneideri]
Length=752

 Score =   174 bits (441),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 102/124 (82%), Gaps = 3/124 (2%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            GVT+VV+KLQA+K+ VYV+LFSNEFV+QAWDFFSDP VE+NS+V GA+    DGVIT FP
Sbjct  591  GVTDVVSKLQAAKLPVYVELFSNEFVTQAWDFFSDPTVEINSFVSGAN---IDGVITDFP  647

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
             TA RY++N CL  KEIP YM PV P SL+Q+++P YLPPAEAP PVLTESDV+EPPLP 
Sbjct  648  KTAARYKKNLCLRQKEIPSYMSPVQPASLVQVITPSYLPPAEAPNPVLTESDVIEPPLPS  707

Query  418  VAKI  407
            V  +
Sbjct  708  VTAL  711



>ref|XP_009361078.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Pyrus x bretschneideri]
Length=752

 Score =   172 bits (435),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 100/121 (83%), Gaps = 3/121 (2%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            GVT+VV+KLQA+K+ VYV+LFSNEFVSQAWDFFSDP VE+NS+V GA+    DGVIT FP
Sbjct  591  GVTDVVSKLQAAKLPVYVELFSNEFVSQAWDFFSDPTVEINSFVSGAN---IDGVITDFP  647

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
             TA RY++NRCLG KEIP YM P+ P SL+Q+++  YLPPAEAP P L ESDV+EPPLP 
Sbjct  648  KTAARYKKNRCLGKKEIPNYMSPIQPASLIQVVTSAYLPPAEAPNPPLRESDVIEPPLPS  707

Query  418  V  416
            V
Sbjct  708  V  708



>ref|XP_009348463.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Pyrus x bretschneideri]
Length=752

 Score =   172 bits (435),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 84/121 (69%), Positives = 100/121 (83%), Gaps = 3/121 (2%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            GVT+VV+KLQA+K+ VYV+LFSNEFVSQAWDFFSDP VE+NS+V GA+    DGVIT FP
Sbjct  591  GVTDVVSKLQAAKLPVYVELFSNEFVSQAWDFFSDPTVEINSFVSGAN---IDGVITDFP  647

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
             TA RY++NRCLG KEIP YM P+ P SL+Q+++  YLPPAEAP P L ESDV+EPPLP 
Sbjct  648  KTAARYKKNRCLGKKEIPNYMSPIQPASLIQVVTSAYLPPAEAPNPPLRESDVIEPPLPS  707

Query  418  V  416
            V
Sbjct  708  V  708



>ref|XP_004294052.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Fragaria vesca subsp. vesca]
Length=753

 Score =   170 bits (430),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 95/119 (80%), Gaps = 3/119 (3%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            GVT+VV KLQ  K+ +YV+LFSNEFVSQAWDFFSDP VE+NS+V G      DGVIT FP
Sbjct  592  GVTDVVTKLQGFKIPIYVELFSNEFVSQAWDFFSDPSVEINSFVTGPV---IDGVITDFP  648

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  422
             TA RY+RNRCL YKE P YM PV PGSL+Q++S  Y+PPAEAP P LTESDV+EPPLP
Sbjct  649  KTAARYKRNRCLSYKETPAYMSPVQPGSLIQVISSVYMPPAEAPKPYLTESDVIEPPLP  707



>ref|XP_008366428.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Malus domestica]
Length=752

 Score =   169 bits (429),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 101/124 (81%), Gaps = 3/124 (2%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            GVT+VV+KLQA+K+ VYV+LFSNEFV+QAWDFFSDP VE+N +V GA+    DGVIT FP
Sbjct  591  GVTDVVSKLQAAKLPVYVELFSNEFVTQAWDFFSDPTVEINLFVSGANV---DGVITDFP  647

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
             TA RY++N CL  KEIP YM P+ P SL+Q+++P YLPPAEAP PVLTESDV+EPPLP 
Sbjct  648  KTAARYKKNPCLRQKEIPSYMSPIPPASLVQVITPSYLPPAEAPNPVLTESDVIEPPLPS  707

Query  418  VAKI  407
            V  +
Sbjct  708  VTAV  711



>ref|XP_006344880.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Solanum tuberosum]
Length=753

 Score =   169 bits (428),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 93/124 (75%), Gaps = 3/124 (2%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G TNVV KL +S + VYVQ F+NEFVSQAWDFFSD  VE+N+Y  GA     DGVIT FP
Sbjct  591  GKTNVVEKLHSSNLSVYVQRFNNEFVSQAWDFFSDSSVEINNYFIGAG---IDGVITDFP  647

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
             TA RYRRNRCL YK  P Y   V PG LLQ MS Q LPPAEAP P+LTESDVVEPPLPP
Sbjct  648  RTAARYRRNRCLRYKVPPLYFSLVSPGVLLQFMSRQSLPPAEAPSPILTESDVVEPPLPP  707

Query  418  VAKI  407
            VAKI
Sbjct  708  VAKI  711



>emb|CDP13760.1| unnamed protein product [Coffea canephora]
Length=745

 Score =   168 bits (425),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 95/121 (79%), Gaps = 3/121 (2%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            GVT VV K+QA  ++VYVQLFSNEFVSQAWDFFSDPYVE+N+Y+   + N   G++T +P
Sbjct  588  GVTKVVPKVQALGLRVYVQLFSNEFVSQAWDFFSDPYVEINTYISNMTIN---GLVTDYP  644

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
            ATA RYR+NRCLGYK+ P YMLPV PGSL+ +M    LPP EAP PVL E+DV EPPLP 
Sbjct  645  ATAARYRKNRCLGYKQAPSYMLPVQPGSLISVMDRSLLPPTEAPKPVLKENDVTEPPLPH  704

Query  418  V  416
            V
Sbjct  705  V  705



>ref|XP_006346174.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Solanum tuberosum]
Length=753

 Score =   167 bits (422),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 95/124 (77%), Gaps = 3/124 (2%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G TNVV KLQ++ + VYV+LF+NEFVSQAWDFFSD   ELN+YV GA     DG++T +P
Sbjct  591  GQTNVVQKLQSANLPVYVRLFNNEFVSQAWDFFSDSSTELNNYVLGAGV---DGLVTEYP  647

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
             TA RYRRNRCL YK++P YM PV PGSLL LM+ Q +PP E P PVL  SDV EPPLPP
Sbjct  648  GTAARYRRNRCLAYKDLPSYMSPVQPGSLLGLMTVQSMPPVEPPNPVLDVSDVTEPPLPP  707

Query  418  VAKI  407
            VAKI
Sbjct  708  VAKI  711



>ref|XP_010324292.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4 [Solanum 
lycopersicum]
Length=753

 Score =   167 bits (422),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/124 (65%), Positives = 95/124 (77%), Gaps = 3/124 (2%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G TN+V KLQ++ + VYV+LF+NEF+SQAWDFFSD   E+N+YV GA     DG++T +P
Sbjct  591  GQTNIVQKLQSANLPVYVRLFNNEFISQAWDFFSDSSTEINNYVLGAGV---DGLVTEYP  647

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
             TA RYRRNRCL YK +PPYM PV PGSLL LM+ Q +PP E P PVL  SDV EPPLPP
Sbjct  648  GTAARYRRNRCLAYKNLPPYMSPVQPGSLLGLMTVQSMPPVEPPSPVLDVSDVTEPPLPP  707

Query  418  VAKI  407
            VAKI
Sbjct  708  VAKI  711



>ref|XP_011097815.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Sesamum indicum]
Length=760

 Score =   166 bits (419),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 96/123 (78%), Gaps = 3/123 (2%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G TNVV KLQA  + VYVQ F NEFV+Q WDFFSD YVE+N++V   S    +GV+T FP
Sbjct  597  GETNVVPKLQAFNLTVYVQYFRNEFVAQPWDFFSDAYVEINTHV---SYMGINGVVTDFP  653

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
            ATA +YRRNRCLGYKE+P YM PV P  L+ LM+P++LPPAEAP PVLTE+DV EPPLPP
Sbjct  654  ATAAKYRRNRCLGYKEVPLYMTPVQPAGLISLMAPKFLPPAEAPNPVLTENDVTEPPLPP  713

Query  418  VAK  410
            V +
Sbjct  714  VVE  716



>ref|XP_006387051.1| hypothetical protein POPTR_2051s00200g, partial [Populus trichocarpa]
 gb|ERP45965.1| hypothetical protein POPTR_2051s00200g, partial [Populus trichocarpa]
Length=194

 Score =   156 bits (394),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 90/119 (76%), Gaps = 3/119 (3%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            GVTNVV KLQ+  + VYV+ F+NEFVSQAWDFFSD  VE+NSYV GA+     GVIT FP
Sbjct  33   GVTNVVPKLQSHGLSVYVETFNNEFVSQAWDFFSDSTVEINSYVMGAN---ISGVITEFP  89

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  422
             T+ RY+RNRCLGY  +PPYM P  PG L+QL+SP  LPPAE P PVLT  DVVE PLP
Sbjct  90   LTSARYKRNRCLGYNVLPPYMSPAQPGGLIQLISPFALPPAEPPNPVLTAPDVVEGPLP  148



>gb|KJB13799.1| hypothetical protein B456_002G094900 [Gossypium raimondii]
Length=762

 Score =   164 bits (415),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 95/124 (77%), Gaps = 4/124 (3%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G T+VV++LQA+ + V VQ FSNEF SQAWDFFSD  VE+NS+  GAS N   GVIT FP
Sbjct  598  GATDVVSRLQAANLSVLVQTFSNEFTSQAWDFFSDATVEINSFCAGASIN---GVITDFP  654

Query  598  ATANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  422
             T++RYRRNRCL    + P YM PV PGSLL L++  YLPPAEAP P LTESDVVEPPLP
Sbjct  655  KTSDRYRRNRCLKRGNKTPTYMSPVQPGSLLSLVTTDYLPPAEAPKPYLTESDVVEPPLP  714

Query  421  PVAK  410
            PVAK
Sbjct  715  PVAK  718



>gb|KHG12016.1| putative glycerophosphoryl diester phosphodiesterase 1 -like 
protein [Gossypium arboreum]
Length=762

 Score =   164 bits (414),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 95/124 (77%), Gaps = 4/124 (3%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G T+VV++LQA+ + V VQ F NEF SQAWDFFSD  VE+NS+  GA  N   GVIT FP
Sbjct  598  GATDVVSRLQAANLSVLVQTFRNEFTSQAWDFFSDATVEINSFYVGAGIN---GVITDFP  654

Query  598  ATANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  422
             T++RYRRNRCL    +IP YM PV PGSLLQL++  YLPPAEAP P LTESDVVEPPLP
Sbjct  655  KTSDRYRRNRCLKRGNKIPTYMSPVPPGSLLQLVTTDYLPPAEAPKPYLTESDVVEPPLP  714

Query  421  PVAK  410
            PVAK
Sbjct  715  PVAK  718



>ref|XP_004251903.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Solanum lycopersicum]
Length=751

 Score =   163 bits (412),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 84/124 (68%), Positives = 91/124 (73%), Gaps = 3/124 (2%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G TNVV KL +S + VYVQ F+NEFVSQ WDFFSD  VE+N+Y  GA     DG+IT FP
Sbjct  589  GKTNVVEKLHSSNLSVYVQHFNNEFVSQPWDFFSDSSVEINNYFVGAG---IDGIITDFP  645

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
             TA RYRRNRCL YK  P Y   V PG L Q MS Q LPPAEAP P+LTESDVVEPPLPP
Sbjct  646  RTAARYRRNRCLHYKVPPMYFSLVSPGVLQQFMSRQSLPPAEAPSPILTESDVVEPPLPP  705

Query  418  VAKI  407
            VAKI
Sbjct  706  VAKI  709



>ref|XP_010099974.1| putative glycerophosphoryl diester phosphodiesterase 2 [Morus 
notabilis]
 gb|EXB81079.1| putative glycerophosphoryl diester phosphodiesterase 2 [Morus 
notabilis]
Length=748

 Score =   162 bits (409),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 94/123 (76%), Gaps = 4/123 (3%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G T+VV KLQ+ K+ VYV+ FSNEFVSQAWDFFSD  VE+NSYV GA+    DGVIT FP
Sbjct  580  GSTDVVKKLQSYKLHVYVETFSNEFVSQAWDFFSDATVEVNSYVTGANV---DGVITEFP  636

Query  598  ATANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  422
            ATA RY+ NRCLG     P YM PV PGSL++L++  YLPPAEAP PVLTE DV EPPLP
Sbjct  637  ATAARYKINRCLGLGNNTPAYMSPVQPGSLVELITTDYLPPAEAPNPVLTEDDVSEPPLP  696

Query  421  PVA  413
            P A
Sbjct  697  PAA  699



>ref|XP_010470589.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like 
[Camelina sativa]
Length=765

 Score =   161 bits (408),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 95/123 (77%), Gaps = 4/123 (3%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G  NVV +LQ SK+ VYV+LF NEFVSQA+DFFSD  VELNSY+ GA  N   G IT FP
Sbjct  610  GKPNVVERLQKSKLSVYVELFRNEFVSQAYDFFSDATVELNSYISGAGIN---GTITEFP  666

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQ-LMSPQYLPPAEAPYPVLTESDVVEPPLP  422
             TA RYRRNRCLG KEIPPYMLP+ PG LL  ++SP  LPPAEAP  ++T++D++EPPLP
Sbjct  667  FTAARYRRNRCLGRKEIPPYMLPIQPGDLLHDVVSPLSLPPAEAPNLIITDADLIEPPLP  726

Query  421  PVA  413
            PV 
Sbjct  727  PVT  729



>ref|XP_008447692.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Cucumis melo]
 ref|XP_008447693.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Cucumis melo]
Length=764

 Score =   161 bits (408),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/122 (65%), Positives = 90/122 (74%), Gaps = 3/122 (2%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G TNVV KL+A  + VYV  FSNEFVSQAWDFFSD  VE+NS+V GA     DGVIT FP
Sbjct  598  GATNVVKKLKALNLSVYVDTFSNEFVSQAWDFFSDATVEINSFVLGAE---IDGVITDFP  654

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
             T+ RY++NRCL  KE P YM PV PGSLLQL++P YLPP   P PVL + DV EPPLPP
Sbjct  655  KTSARYKKNRCLAMKETPNYMSPVQPGSLLQLVTPNYLPPKTPPSPVLDDKDVAEPPLPP  714

Query  418  VA  413
            V+
Sbjct  715  VS  716



>gb|EYU33686.1| hypothetical protein MIMGU_mgv1a001772mg [Erythranthe guttata]
Length=761

 Score =   161 bits (407),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 92/121 (76%), Gaps = 3/121 (2%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G T VV KLQA  + VYVQ F NE+VSQ WDFFSD YVE+N++V   S    +GVIT +P
Sbjct  597  GETPVVPKLQAFNLTVYVQFFRNEYVSQPWDFFSDAYVEINTHV---SYMEINGVITDYP  653

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
            ATA RY+RNRCLGYK+IP YM PV PG LL LM+ Q+LPPAEAP PVLTE DV EPPLP 
Sbjct  654  ATAARYKRNRCLGYKDIPLYMTPVQPGGLLTLMTSQFLPPAEAPSPVLTEDDVAEPPLPA  713

Query  418  V  416
            V
Sbjct  714  V  714



>emb|CDY46687.1| BnaA03g48210D [Brassica napus]
Length=717

 Score =   160 bits (405),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 92/122 (75%), Gaps = 3/122 (2%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G TNVV +LQ S++ VYV+LF NEFVSQ +DFFSD  VE+NSYV GA  N   G +T FP
Sbjct  552  GQTNVVERLQKSQLPVYVELFQNEFVSQPYDFFSDANVEINSYVTGAGVN---GTVTEFP  608

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
             TA RYRRNRCLG KE PPYM PV PG LLQ+++   LPPAEAP PV T++DV EPPLPP
Sbjct  609  FTAARYRRNRCLGSKETPPYMAPVQPGGLLQVVNHASLPPAEAPNPVFTDADVTEPPLPP  668

Query  418  VA  413
            V 
Sbjct  669  VT  670



>ref|XP_009137609.1| PREDICTED: LOW QUALITY PROTEIN: probable glycerophosphoryl diester 
phosphodiesterase 2 [Brassica rapa]
Length=759

 Score =   160 bits (404),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 92/122 (75%), Gaps = 3/122 (2%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G TNVV +LQ S++ VYV+LF NEFVSQ +DFFSD  VE+NSYV GA  N   G +T FP
Sbjct  594  GQTNVVERLQKSQLPVYVELFQNEFVSQPYDFFSDANVEINSYVTGAGVN---GTVTEFP  650

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
             TA RYRRNRCLG KE PPYM PV PG LLQ+++   LPPAEAP PV T++DV EPPLPP
Sbjct  651  FTAARYRRNRCLGSKETPPYMAPVQPGGLLQVVNHASLPPAEAPNPVFTDADVTEPPLPP  710

Query  418  VA  413
            V 
Sbjct  711  VT  712



>gb|KHG08046.1| putative glycerophosphoryl diester phosphodiesterase 2 -like 
protein [Gossypium arboreum]
Length=775

 Score =   160 bits (404),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 92/121 (76%), Gaps = 4/121 (3%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            TNVV +L+A+ + VYVQ FSNEF SQAWDFFSDP VE+NS+  G   N   GVIT FP T
Sbjct  615  TNVVPRLKAANLSVYVQTFSNEFTSQAWDFFSDPTVEINSFYLGGGIN---GVITDFPKT  671

Query  592  ANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
            +NRYRRNRCL    +IP YM PV PGSL QL++  YLPPAEAP P LTE+DV EPPLPPV
Sbjct  672  SNRYRRNRCLNRGNQIPGYMSPVQPGSLYQLITAPYLPPAEAPNPFLTEADVNEPPLPPV  731

Query  415  A  413
            A
Sbjct  732  A  732



>ref|XP_002529027.1| glycerophosphoryl diester phosphodiesterase, putative [Ricinus 
communis]
 gb|EEF33338.1| glycerophosphoryl diester phosphodiesterase, putative [Ricinus 
communis]
Length=768

 Score =   159 bits (401),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 81/122 (66%), Positives = 94/122 (77%), Gaps = 4/122 (3%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G T+VV KLQ++ + VYV+LFSNEFVSQAWDFFSD  VE+NSYV GA+ +   GVIT FP
Sbjct  604  GATDVVPKLQSAGLPVYVELFSNEFVSQAWDFFSDANVEINSYVIGANVS---GVITDFP  660

Query  598  ATANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  422
             TA RY+RN+CL      P YM PV PGSLLQL++  YLPPAEAP PVLTE+DV E PLP
Sbjct  661  KTAARYKRNKCLNMGNSTPAYMAPVQPGSLLQLITQDYLPPAEAPNPVLTEADVAEAPLP  720

Query  421  PV  416
            PV
Sbjct  721  PV  722



>gb|KHN43860.1| Putative glycerophosphoryl diester phosphodiesterase 3 [Glycine 
soja]
Length=753

 Score =   159 bits (401),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 96/123 (78%), Gaps = 4/123 (3%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            TN+V KL+ + + V+V+ FSNEFVSQAWDFFSD  VE+N+Y+ GA     DG+IT FP T
Sbjct  595  TNIVPKLKNANLSVFVETFSNEFVSQAWDFFSDATVEINTYITGAQ---IDGIITDFPKT  651

Query  592  ANRYRRNRCLGYKE-IPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
            A+RYRRN+CLG  +  P YM PV PGSL  L++ ++LPPAEAP+P LTES+V EPPLPPV
Sbjct  652  ADRYRRNKCLGLGDNKPTYMEPVQPGSLFGLITKEFLPPAEAPFPPLTESEVAEPPLPPV  711

Query  415  AKI  407
            AKI
Sbjct  712  AKI  714



>ref|XP_003519608.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
3-like [Glycine max]
Length=753

 Score =   158 bits (400),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 96/123 (78%), Gaps = 4/123 (3%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            TN+V KL+ + + V+V+ FSNEFVSQAWDFFSD  VE+N+Y+ GA     DG+IT FP T
Sbjct  595  TNIVPKLKNASLSVFVETFSNEFVSQAWDFFSDATVEINTYITGAQ---IDGIITDFPKT  651

Query  592  ANRYRRNRCLGYKE-IPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
            A+RYRRN+CLG  +  P YM PV PGSL  L++ ++LPPAEAP+P LTES+V EPPLPPV
Sbjct  652  ADRYRRNKCLGLGDNKPTYMEPVQPGSLFGLITKEFLPPAEAPFPPLTESEVAEPPLPPV  711

Query  415  AKI  407
            AKI
Sbjct  712  AKI  714



>emb|CDX86807.1| BnaA09g21970D [Brassica napus]
Length=230

 Score =   150 bits (380),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/121 (64%), Positives = 91/121 (75%), Gaps = 6/121 (5%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            TNVV KLQ SK+ VYV+LF NEFVSQ +DFFSDP VE+NSY+ GA  N   G IT FP T
Sbjct  66   TNVVEKLQKSKLPVYVELFQNEFVSQPYDFFSDPTVEINSYILGAGIN---GTITEFPFT  122

Query  592  ANRYRRNRCLGYKE-IPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
            A RY+RNRCLG +E +PPYM P  PGSLLQ ++   +PPA+AP PV T+ DV EPPLPPV
Sbjct  123  AARYKRNRCLGTQETLPPYMAPFKPGSLLQAVNA--IPPAQAPNPVFTDDDVTEPPLPPV  180

Query  415  A  413
             
Sbjct  181  T  181



>ref|NP_176869.2| putative glycerophosphoryl diester phosphodiesterase 3 [Arabidopsis 
thaliana]
 sp|Q7Y208.2|GPDL1_ARATH RecName: Full=Glycerophosphodiester phosphodiesterase GDPDL1; 
AltName: Full=Glycerophosphodiester phosphodiesterase-like 
1; Short=ATGDPDL1; AltName: Full=Glycerophosphodiesterase-like 
3; AltName: Full=Protein SHV3-LIKE 2; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF98209.1|AC007152_5 Unknown protein [Arabidopsis thaliana]
 gb|AEE34579.1| putative glycerophosphoryl diester phosphodiesterase 3 [Arabidopsis 
thaliana]
Length=763

 Score =   158 bits (399),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 92/121 (76%), Gaps = 3/121 (2%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G TNVV +LQ S++ VYV+LF NEFVSQA+DFFSD  VE+N+Y++GA  N   G IT FP
Sbjct  605  GQTNVVERLQKSQLPVYVELFRNEFVSQAYDFFSDATVEINAYIYGAGIN---GTITEFP  661

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
             TA RY+RNRCLG +E+PPYMLPV PG LL +MSP  LPPA+AP     E+DV EPPL P
Sbjct  662  FTAARYKRNRCLGREEVPPYMLPVNPGGLLNVMSPLSLPPAQAPNQDFIEADVTEPPLSP  721

Query  418  V  416
            V
Sbjct  722  V  722



>ref|XP_002300352.2| hypothetical protein POPTR_0001s371702g, partial [Populus trichocarpa]
 gb|EEE85157.2| hypothetical protein POPTR_0001s371702g, partial [Populus trichocarpa]
Length=259

 Score =   151 bits (381),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 89/119 (75%), Gaps = 4/119 (3%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            GVTNVV KLQ+  + VYV+ FSNEFVSQAWDFFSD  VE+NSYV G +     GVIT FP
Sbjct  98   GVTNVVPKLQSHGLSVYVETFSNEFVSQAWDFFSDSTVEINSYVMGVN---ISGVITEFP  154

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  422
             T+ RY+RNRCLG KE+P YM P  PG L+QL+SP  LPPAE P PVLT  DVVE PLP
Sbjct  155  LTSARYKRNRCLG-KELPSYMSPAQPGGLMQLISPFALPPAEPPNPVLTAPDVVEGPLP  212



>ref|XP_010513618.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like, 
partial [Camelina sativa]
Length=647

 Score =   157 bits (396),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 95/123 (77%), Gaps = 3/123 (2%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G TNVV +LQ S++ VYV+LF NEFVSQ +DFFSD  +E+N+Y+  A  N   G+IT FP
Sbjct  474  GQTNVVERLQKSQLPVYVELFQNEFVSQPYDFFSDATIEINTYISLAGIN---GIITEFP  530

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
             TA RY+RNRC+G KE PPYM PV PG+LL  MSPQ LPPAEAP  ++T++DV+EPPLPP
Sbjct  531  FTAARYKRNRCMGRKETPPYMEPVKPGALLAYMSPQSLPPAEAPNLIITDADVIEPPLPP  590

Query  418  VAK  410
            V +
Sbjct  591  VTE  593



>ref|NP_001185333.1| putative glycerophosphoryl diester phosphodiesterase 3 [Arabidopsis 
thaliana]
 gb|AEE34580.1| putative glycerophosphoryl diester phosphodiesterase 3 [Arabidopsis 
thaliana]
Length=785

 Score =   158 bits (399),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 92/121 (76%), Gaps = 3/121 (2%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G TNVV +LQ S++ VYV+LF NEFVSQA+DFFSD  VE+N+Y++GA  N   G IT FP
Sbjct  627  GQTNVVERLQKSQLPVYVELFRNEFVSQAYDFFSDATVEINAYIYGAGIN---GTITEFP  683

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
             TA RY+RNRCLG +E+PPYMLPV PG LL +MSP  LPPA+AP     E+DV EPPL P
Sbjct  684  FTAARYKRNRCLGREEVPPYMLPVNPGGLLNVMSPLSLPPAQAPNQDFIEADVTEPPLSP  743

Query  418  V  416
            V
Sbjct  744  V  744



>emb|CDX92806.1| BnaC07g40640D [Brassica napus]
Length=716

 Score =   157 bits (396),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 91/120 (76%), Gaps = 3/120 (3%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            TNVV +LQ S++ VYV+LF NEFVSQ +DFFSD  VE+NSYV GA  N   G +T FP T
Sbjct  554  TNVVERLQKSQLPVYVELFQNEFVSQPYDFFSDANVEINSYVTGAGVN---GTVTEFPYT  610

Query  592  ANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  413
            A R+RRNRCLG KE PPYM PV PG LLQ+++   LPPAEAP PV T++DV EPPLPPV 
Sbjct  611  AARFRRNRCLGSKETPPYMAPVQPGGLLQVVNHASLPPAEAPNPVFTDADVTEPPLPPVT  670



>ref|XP_002276757.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4 [Vitis 
vinifera]
 emb|CBI26719.3| unnamed protein product [Vitis vinifera]
Length=757

 Score =   157 bits (396),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 75/122 (61%), Positives = 91/122 (75%), Gaps = 3/122 (2%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G T++V++L+ + + VYVQ F NEF+SQAWDFFSD  VE+NS+V GA     DGVIT FP
Sbjct  594  GATDIVSRLKKNNLPVYVQRFDNEFISQAWDFFSDATVEINSFVTGAG---IDGVITSFP  650

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
             TA  YR+NRCL YK  P YM PV PGSL+Q+++   +PPA APYPVLTESDV EPPL  
Sbjct  651  QTAASYRKNRCLKYKNAPSYMSPVQPGSLMQVITSDDMPPALAPYPVLTESDVAEPPLQE  710

Query  418  VA  413
            VA
Sbjct  711  VA  712



>gb|KFK29182.1| hypothetical protein AALP_AA7G100300 [Arabis alpina]
Length=758

 Score =   157 bits (396),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 93/121 (77%), Gaps = 3/121 (2%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G TNVV KLQ S++ VYV+LF NEFVSQ++DFFSD  VE+NS++ GA  N   G IT FP
Sbjct  597  GQTNVVEKLQKSQLPVYVELFQNEFVSQSYDFFSDATVEINSFISGAGIN---GTITEFP  653

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
             TA R++RNRCLG KE P YM+PV PG LL+++SP   PPA+AP PV T++DV EPPLPP
Sbjct  654  FTAARFKRNRCLGAKETPNYMIPVEPGGLLKIVSPTSFPPAQAPNPVFTDADVTEPPLPP  713

Query  418  V  416
            V
Sbjct  714  V  714



>ref|XP_010252665.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Nelumbo nucifera]
Length=754

 Score =   157 bits (396),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 76/124 (61%), Positives = 93/124 (75%), Gaps = 4/124 (3%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G TN+V+KLQ+S + VYV LF NEFVSQAWDFFSDP VE+NS+V GA     DG+IT FP
Sbjct  593  GATNIVSKLQSSNLTVYVYLFRNEFVSQAWDFFSDPVVEINSFVMGAG---IDGIITDFP  649

Query  598  ATANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  422
             TA  YR N+CL   K  P YM PV PG+L+Q+++ ++LPPAE+P PVLTESDV EPPL 
Sbjct  650  GTATAYRNNKCLKMGKNKPYYMNPVEPGALMQVITAEFLPPAESPNPVLTESDVAEPPLA  709

Query  421  PVAK  410
             + K
Sbjct  710  SITK  713



>ref|XP_008227060.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Prunus mume]
Length=755

 Score =   157 bits (396),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 94/120 (78%), Gaps = 3/120 (3%)
 Frame = -1

Query  775  VTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPA  596
            VT+VV +LQA+K++VYV+LFSNEFVSQAWDFFSDP VE+NS+  G +    DGVIT FP 
Sbjct  594  VTHVVPELQAAKLQVYVELFSNEFVSQAWDFFSDPTVEINSFATGVN---IDGVITDFPK  650

Query  595  TANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
            TA RY+RNRCL  K +P YM P+   SL+Q+++  YLPPAEAP P LT SDV+EPPLP V
Sbjct  651  TAARYKRNRCLSEKVLPNYMSPIQGASLIQVVTSDYLPPAEAPNPPLTASDVIEPPLPSV  710



>ref|XP_010511612.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like 
[Camelina sativa]
Length=761

 Score =   156 bits (394),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 97/123 (79%), Gaps = 4/123 (3%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G TNVV +LQ S++ VYV+LF NEF+SQA+DFFSD  VE+N+Y++GA  N   G IT FP
Sbjct  606  GQTNVVERLQKSQLPVYVELFRNEFISQAYDFFSDATVEINTYIYGAGIN---GTITEFP  662

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQ-LMSPQYLPPAEAPYPVLTESDVVEPPLP  422
             TA RY+RNRCLG KEIPPYM P+  G+LL+ L++P  LPPAEAP  ++T++D++EPPLP
Sbjct  663  FTAARYKRNRCLGRKEIPPYMSPIQAGTLLKNLVTPLSLPPAEAPKLIITDADLIEPPLP  722

Query  421  PVA  413
            PV 
Sbjct  723  PVT  725



>gb|KCW70259.1| hypothetical protein EUGRSUZ_F03515 [Eucalyptus grandis]
Length=640

 Score =   155 bits (391),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 78/121 (64%), Positives = 91/121 (75%), Gaps = 4/121 (3%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G+T+VV KL A K+ VYVQ FSNEFVSQAWDFFSD  VE+NS+V G      DGVIT FP
Sbjct  478  GITDVVTKLHAFKLPVYVQTFSNEFVSQAWDFFSDATVEVNSFVVGGDV---DGVITDFP  534

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
             T+  Y+RN+CLG    PPYM PV PGSL+Q+++   LPPA+APYPVL ESDV EPPLP 
Sbjct  535  KTSASYKRNKCLG-SAAPPYMSPVQPGSLMQVITTPMLPPAQAPYPVLIESDVDEPPLPA  593

Query  418  V  416
            V
Sbjct  594  V  594



>ref|XP_006279180.1| hypothetical protein CARUB_v10007932mg [Capsella rubella]
 gb|EOA12078.1| hypothetical protein CARUB_v10007932mg [Capsella rubella]
Length=538

 Score =   154 bits (389),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 91/120 (76%), Gaps = 3/120 (3%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            TNVV +LQ S++ VYV++F NEFVSQ  DFFSDP VE+N+Y +G   N   G IT FP T
Sbjct  388  TNVVERLQKSQLLVYVEIFQNEFVSQKRDFFSDPTVEINTYTYGVGIN---GTITEFPFT  444

Query  592  ANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  413
            A RY+RNRCLG +EIP YMLP+ PGSLL ++SP  LPPAEAP  + T++DV EP LPPV+
Sbjct  445  AARYKRNRCLGREEIPQYMLPIQPGSLLGVVSPLSLPPAEAPSLIFTDADVTEPHLPPVS  504



>ref|XP_004150252.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Cucumis sativus]
 ref|XP_004163282.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Cucumis sativus]
 gb|KGN59083.1| Glycerophosphoryl diester phosphodiesterase [Cucumis sativus]
Length=764

 Score =   155 bits (393),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/122 (63%), Positives = 90/122 (74%), Gaps = 3/122 (2%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G T+VV KL+A  + VYV+ FSNEFVSQAWDFFSD  VE+NS+V GA     DGVIT FP
Sbjct  598  GATDVVKKLKALNLSVYVESFSNEFVSQAWDFFSDATVEINSFVLGAE---IDGVITDFP  654

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
             T+ RY++NRCL  KE P YM PV PGSLLQL++  YLPP   P PVL + DV EPPLPP
Sbjct  655  KTSARYKKNRCLTMKETPTYMSPVQPGSLLQLITQPYLPPKTPPSPVLDDKDVAEPPLPP  714

Query  418  VA  413
            V+
Sbjct  715  VS  716



>ref|XP_007020652.1| PLC-like phosphodiesterase family protein, putative isoform 1 
[Theobroma cacao]
 gb|EOY12177.1| PLC-like phosphodiesterase family protein, putative isoform 1 
[Theobroma cacao]
Length=760

 Score =   155 bits (393),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 92/123 (75%), Gaps = 4/123 (3%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            GVT+VV +LQA+ + VYV  FSNEF SQAWDFFSD  VE+NS+  G   N   GVIT FP
Sbjct  598  GVTDVVPRLQAANLSVYVHTFSNEFTSQAWDFFSDATVEVNSFHVGGLIN---GVITDFP  654

Query  598  ATANRYRRNRCLGYKE-IPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  422
             T++RYRRNRCL   +  P YM PV PGSLLQL++ +YLPPAEAP P LTE+D+ E PLP
Sbjct  655  ETSDRYRRNRCLNKGDNTPGYMSPVQPGSLLQLVTAEYLPPAEAPNPYLTEADIAESPLP  714

Query  421  PVA  413
            PVA
Sbjct  715  PVA  717



>ref|XP_004293798.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Fragaria vesca subsp. vesca]
Length=751

 Score =   155 bits (392),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 89/119 (75%), Gaps = 3/119 (3%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G T+VV KL A  + VYV+LFSNE++SQAWDFFSDP VE+NS+V G +    DG+IT FP
Sbjct  588  GATDVVTKLHAFDLHVYVELFSNEYLSQAWDFFSDPTVEINSFVSGVNV---DGIITDFP  644

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  422
             TA RY+RN+CL Y+E P YM P+ PG L   +SP  LPP EAP PVLTESDV EPPLP
Sbjct  645  KTAVRYKRNKCLFYRERPSYMKPIQPGVLFTAISPAQLPPVEAPNPVLTESDVTEPPLP  703



>ref|XP_010064948.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Eucalyptus grandis]
Length=746

 Score =   155 bits (391),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 78/121 (64%), Positives = 91/121 (75%), Gaps = 4/121 (3%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G+T+VV KL A K+ VYVQ FSNEFVSQAWDFFSD  VE+NS+V G      DGVIT FP
Sbjct  584  GITDVVTKLHAFKLPVYVQTFSNEFVSQAWDFFSDATVEVNSFVVGGDV---DGVITDFP  640

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
             T+  Y+RN+CLG    PPYM PV PGSL+Q+++   LPPA+APYPVL ESDV EPPLP 
Sbjct  641  KTSASYKRNKCLG-SAAPPYMSPVQPGSLMQVITTPMLPPAQAPYPVLIESDVDEPPLPA  699

Query  418  V  416
            V
Sbjct  700  V  700



>emb|CDY45656.1| BnaC09g31980D [Brassica napus]
Length=653

 Score =   154 bits (388),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 89/121 (74%), Gaps = 3/121 (2%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G TN+V +LQ  ++ VYV+LF NEFVSQ WDF SD  VE+NS+V GA  N   G IT FP
Sbjct  492  GQTNLVERLQRFQLPVYVELFRNEFVSQPWDFLSDATVEINSHVTGAGIN---GTITEFP  548

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
             TA RY+RNRCL  K++PPYM PV P  LL +MSP  LPPAEAP PV T++DV EPPLPP
Sbjct  549  LTAARYKRNRCLTRKDLPPYMSPVQPAGLLSIMSPTSLPPAEAPNPVFTDADVTEPPLPP  608

Query  418  V  416
            V
Sbjct  609  V  609



>emb|CDY13237.1| BnaC09g24190D [Brassica napus]
Length=759

 Score =   154 bits (390),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 93/121 (77%), Gaps = 6/121 (5%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            TNVV KLQ SK+ VYV+LF NEFVSQ +DFFSDP VE+NSY+ GA  N   G IT FP T
Sbjct  595  TNVVEKLQKSKLPVYVELFQNEFVSQPYDFFSDPTVEINSYILGAGIN---GTITEFPFT  651

Query  592  ANRYRRNRCLGYKE-IPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
            A RYRRNRCLG +E +PPYM PV PGSLLQ ++   +PPA+AP PV T+ DV EPPLPPV
Sbjct  652  AARYRRNRCLGTQETLPPYMAPVEPGSLLQAVNA--IPPAQAPNPVFTDDDVTEPPLPPV  709

Query  415  A  413
            A
Sbjct  710  A  710



>ref|XP_007214645.1| hypothetical protein PRUPE_ppa001847mg [Prunus persica]
 gb|EMJ15844.1| hypothetical protein PRUPE_ppa001847mg [Prunus persica]
Length=756

 Score =   154 bits (388),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 92/120 (77%), Gaps = 3/120 (3%)
 Frame = -1

Query  775  VTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPA  596
            VT+VV KL+A+K+ VYV+LFSNEFVSQAWDFFSDP VE+NS+V   +    DGVIT FP 
Sbjct  595  VTDVVPKLKAAKLPVYVELFSNEFVSQAWDFFSDPTVEINSFVLAVN---IDGVITDFPK  651

Query  595  TANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
            TA RY+RNRCL  K  P YM PV   SL+Q+++  YLPPAEAP P LT +DV+EPPLP V
Sbjct  652  TAARYKRNRCLSEKVPPSYMTPVQAASLIQVVTADYLPPAEAPNPPLTATDVIEPPLPSV  711



>ref|XP_006279182.1| hypothetical protein CARUB_v10007932mg [Capsella rubella]
 gb|EOA12080.1| hypothetical protein CARUB_v10007932mg [Capsella rubella]
Length=760

 Score =   153 bits (387),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 91/120 (76%), Gaps = 3/120 (3%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            TNVV +LQ S++ VYV++F NEFVSQ  DFFSDP VE+N+Y +G   N   G IT FP T
Sbjct  610  TNVVERLQKSQLLVYVEIFQNEFVSQKRDFFSDPTVEINTYTYGVGIN---GTITEFPFT  666

Query  592  ANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  413
            A RY+RNRCLG +EIP YMLP+ PGSLL ++SP  LPPAEAP  + T++DV EP LPPV+
Sbjct  667  AARYKRNRCLGREEIPQYMLPIQPGSLLGVVSPLSLPPAEAPSLIFTDADVTEPHLPPVS  726



>ref|XP_010496108.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like 
[Camelina sativa]
Length=764

 Score =   153 bits (387),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/122 (64%), Positives = 91/122 (75%), Gaps = 4/122 (3%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G TNVV +LQ S++ VYV+LF NEFVSQA+DFF+D  VE+NSY+ GA  N   G IT FP
Sbjct  605  GQTNVVERLQKSQLLVYVELFRNEFVSQAYDFFTDATVEINSYISGAGIN---GTITEFP  661

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQ-LMSPQYLPPAEAPYPVLTESDVVEPPLP  422
             TA RY+RNRCLG K IPPYM  + PG LL  L+SP  LPPA+AP PV T+ DV EPPLP
Sbjct  662  YTAARYKRNRCLGRKVIPPYMSAIQPGDLLNTLVSPLSLPPAQAPNPVFTDGDVTEPPLP  721

Query  421  PV  416
            PV
Sbjct  722  PV  723



>gb|EYU27402.1| hypothetical protein MIMGU_mgv1a001806mg [Erythranthe guttata]
Length=757

 Score =   153 bits (386),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 91/121 (75%), Gaps = 3/121 (2%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G T+VV K+QA  + VYVQ+F NEFV+QAWDFFSD Y+E+ +YV    A   +GV+T +P
Sbjct  598  GQTSVVPKIQAFNLPVYVQIFQNEFVAQAWDFFSDAYLEMLNYV---DAMNINGVVTDYP  654

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
            ATA +++RNRCLGYK  PPYM PV PG L+ LM+P  L PAEAPYPVLT  DV EPPLP 
Sbjct  655  ATAAKFKRNRCLGYKNRPPYMTPVRPGGLISLMAPGSLTPAEAPYPVLTGDDVAEPPLPA  714

Query  418  V  416
            V
Sbjct  715  V  715



>gb|AAP40466.1| unknown protein [Arabidopsis thaliana]
Length=763

 Score =   153 bits (386),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 91/121 (75%), Gaps = 3/121 (2%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G TNVV +LQ S++ VYV+LF NEFVSQA+DFFSD  VE+N+Y++GA  N   G IT FP
Sbjct  605  GQTNVVERLQKSQLPVYVELFRNEFVSQAYDFFSDATVEINAYIYGAGIN---GTITEFP  661

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
             TA RY+RNR LG +E+PPYMLPV PG LL +MSP  LPPA+AP     E+DV EPPL P
Sbjct  662  FTAARYKRNRYLGREEVPPYMLPVNPGGLLNVMSPLSLPPAQAPNQDFIEADVTEPPLSP  721

Query  418  V  416
            V
Sbjct  722  V  722



>ref|XP_009120058.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Brassica rapa]
Length=768

 Score =   153 bits (386),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 89/121 (74%), Gaps = 3/121 (2%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G TN+V +LQ  ++ VYV+LF NEFVSQ WDF SD  VE+NS+V GA  N   G IT FP
Sbjct  607  GQTNLVERLQRFQLPVYVELFRNEFVSQPWDFLSDATVEINSHVTGAGIN---GTITEFP  663

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
             TA RY+RN+CL  K++PPYM PV P  LL +MSP  LPPAEAP PV T++DV EPPLPP
Sbjct  664  LTAARYKRNKCLTRKDLPPYMSPVQPAGLLSIMSPTSLPPAEAPNPVFTDADVTEPPLPP  723

Query  418  V  416
            V
Sbjct  724  V  724



>emb|CDY17323.1| BnaA10g09570D [Brassica napus]
Length=768

 Score =   153 bits (386),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 89/121 (74%), Gaps = 3/121 (2%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G TN+V +LQ  ++ VYV+LF NEFVSQ WDF SD  VE+NS+V GA  N   G IT FP
Sbjct  607  GQTNLVERLQRFQLPVYVELFRNEFVSQPWDFLSDATVEINSHVTGAGIN---GTITEFP  663

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
             TA RY+RN+CL  K++PPYM PV P  LL +MSP  LPPAEAP PV T++DV EPPLPP
Sbjct  664  LTAARYKRNKCLTRKDLPPYMSPVQPAGLLSIMSPTSLPPAEAPNPVFTDADVTEPPLPP  723

Query  418  V  416
            V
Sbjct  724  V  724



>ref|XP_006401453.1| hypothetical protein EUTSA_v10012748mg [Eutrema salsugineum]
 gb|ESQ42906.1| hypothetical protein EUTSA_v10012748mg [Eutrema salsugineum]
Length=768

 Score =   152 bits (385),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/122 (62%), Positives = 91/122 (75%), Gaps = 3/122 (2%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G TN+VA+LQ  ++ VYV++F NEFVSQ WDFFSD  VE+NS+V GA  N   G IT FP
Sbjct  607  GQTNLVARLQKVQLPVYVEVFRNEFVSQPWDFFSDATVEINSHVSGAGIN---GTITEFP  663

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
             TA RY+RNRCL  K+ P YM+PV P  LL ++SP  LPPAEAP PV+TE+DV EPPLPP
Sbjct  664  LTAARYKRNRCLTRKDPPTYMIPVLPAGLLSIVSPTSLPPAEAPNPVITEADVTEPPLPP  723

Query  418  VA  413
            V 
Sbjct  724  VT  725



>ref|XP_011014752.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Populus euphratica]
 ref|XP_011014753.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Populus euphratica]
Length=753

 Score =   152 bits (384),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 90/119 (76%), Gaps = 4/119 (3%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            GVTNVV KLQ+  + VYV+ FSNEFVSQAWDFFSD  VE+NSYV G +     GVIT FP
Sbjct  593  GVTNVVPKLQSHGLSVYVETFSNEFVSQAWDFFSDSTVEINSYVMGVN---ISGVITEFP  649

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  422
             T+ RY+RNRCLG  ++PPYM P  PG L+QL+SP  LPPAE P PVLT +DVVE PLP
Sbjct  650  LTSARYKRNRCLG-SDLPPYMSPAQPGGLMQLISPYALPPAEPPNPVLTATDVVEGPLP  707



>ref|XP_010433459.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Camelina sativa]
Length=225

 Score =   144 bits (364),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 86/120 (72%), Gaps = 3/120 (3%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            TNVV KLQ S++ VYV+LF NEFVSQ +DFFSD  VE+NSY+ G   N   G IT FP T
Sbjct  66   TNVVEKLQKSQLPVYVELFQNEFVSQPYDFFSDATVEINSYITGPGIN---GTITEFPFT  122

Query  592  ANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  413
            A RY+RN CL  KE  PYM PV PG LL L+S   LPPA+AP  V T++DV+EPPLPPV 
Sbjct  123  AARYKRNLCLASKENIPYMAPVQPGELLTLVSSTSLPPAQAPTQVFTDADVIEPPLPPVT  182



>ref|XP_002888566.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64825.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=1089

 Score =   153 bits (387),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 90/121 (74%), Gaps = 3/121 (2%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G TNVV +LQ S++ VY++LF NEFVSQ +DFF D  VE+N+Y+ G   N   G IT FP
Sbjct  587  GQTNVVERLQKSQLPVYMELFRNEFVSQPYDFFDDATVEINTYISGHGIN---GTITEFP  643

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
             TA RY+RNRCLG KEIPPYMLP+ PG LL +M+P  LPPA+AP P+ T  DV EPP+PP
Sbjct  644  FTAARYKRNRCLGRKEIPPYMLPIQPGGLLAIMNPLALPPAQAPNPIFTYDDVTEPPVPP  703

Query  418  V  416
            V
Sbjct  704  V  704



>ref|XP_009142640.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=757

 Score =   151 bits (382),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 78/122 (64%), Positives = 89/122 (73%), Gaps = 3/122 (2%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G TNVV +LQ S++ VYV+LF NEFVSQ +DFFSD  VE+NSYV G   N   G IT FP
Sbjct  596  GQTNVVERLQKSQLPVYVELFQNEFVSQPFDFFSDATVEINSYVTGPGIN---GTITEFP  652

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
             TA RYRRNRCL  KE   YM PV PG LL+++SP  LPPAEAP PV T++DV EPPLPP
Sbjct  653  FTAARYRRNRCLASKETLSYMAPVQPGGLLEVVSPGSLPPAEAPNPVFTDADVTEPPLPP  712

Query  418  VA  413
            V 
Sbjct  713  VT  714



>emb|CDX89312.1| BnaA01g15810D [Brassica napus]
Length=757

 Score =   151 bits (382),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 78/122 (64%), Positives = 89/122 (73%), Gaps = 3/122 (2%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G TNVV +LQ S++ VYV+LF NEFVSQ +DFFSD  VE+NSYV G   N   G IT FP
Sbjct  596  GQTNVVERLQKSQLPVYVELFQNEFVSQPFDFFSDATVEINSYVTGPGIN---GTITEFP  652

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
             TA RYRRNRCL  KE   YM PV PG LL+++SP  LPPAEAP PV T++DV EPPLPP
Sbjct  653  FTAARYRRNRCLASKETLSYMAPVQPGGLLEVVSPGSLPPAEAPNPVFTDADVTEPPLPP  712

Query  418  VA  413
            V 
Sbjct  713  VT  714



>gb|EPS69135.1| glycerophosphodiesterase-like protein, partial [Genlisea aurea]
Length=689

 Score =   150 bits (379),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 84/121 (69%), Gaps = 3/121 (2%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G T VV  LQ   + VYVQ F NEF SQ WDF+SD  VE+NSYV G   N   GV+T +P
Sbjct  557  GQTTVVGFLQGYNLSVYVQDFQNEFFSQPWDFYSDATVEINSYVSGVGIN---GVVTDYP  613

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
             TANRYRR RCLGYK  P YMLPV PGSL+ L+    LPPA AP PVLTE DV+E PLPP
Sbjct  614  GTANRYRRRRCLGYKNTPNYMLPVQPGSLITLLVKNQLPPAPAPSPVLTEGDVIEAPLPP  673

Query  418  V  416
            V
Sbjct  674  V  674



>ref|XP_011095489.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Sesamum indicum]
 ref|XP_011095490.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Sesamum indicum]
Length=767

 Score =   151 bits (381),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 93/122 (76%), Gaps = 4/122 (3%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G T+++ K++A  + VYV+LF NEF SQ +DFFSD YVE+N++ F       DGVIT +P
Sbjct  594  GKTSIIPKIKAFDLPVYVKLFRNEFRSQPYDFFSDAYVEINAHYFAG----IDGVITDYP  649

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
            ATA R++RNRCLGYK+ PPYM+P+    L+ L+SP YLPPAEAP P+LT++DV EPPLPP
Sbjct  650  ATAARFKRNRCLGYKDTPPYMMPLQARLLIDLISPTYLPPAEAPSPILTDNDVAEPPLPP  709

Query  418  VA  413
            V 
Sbjct  710  VT  711



>ref|XP_010545263.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Tarenaya hassleriana]
Length=764

 Score =   151 bits (381),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 79/122 (65%), Positives = 91/122 (75%), Gaps = 5/122 (4%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G T+VV KLQ  +V VYV+LF NEFVSQ +DFFSDP VE+NSYV GA  N   G IT FP
Sbjct  603  GQTDVVTKLQKLQVPVYVELFRNEFVSQPFDFFSDPTVEINSYVNGAGVN---GTITEFP  659

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
             TA RY+RNRCLG++E P Y  PV PGSLL L +   LPPAEAP PV +++DV EPPLPP
Sbjct  660  LTAARYKRNRCLGFRETPSYSSPVQPGSLLTLATA--LPPAEAPNPVFSDADVTEPPLPP  717

Query  418  VA  413
            VA
Sbjct  718  VA  719



>ref|XP_011014930.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Populus euphratica]
 ref|XP_011014931.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Populus euphratica]
Length=753

 Score =   150 bits (380),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 89/119 (75%), Gaps = 4/119 (3%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            GVTNVV KLQ+  + VYV+ F NEFVSQAWDFFSD  VE+NSYV G +     GVIT FP
Sbjct  593  GVTNVVPKLQSHGLSVYVETFRNEFVSQAWDFFSDSTVEINSYVMGVN---ISGVITEFP  649

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  422
             T+ RY+RNRCLG  ++PPYM P  PG L+QL+SP  LPPAE P PVLT +DVVE PLP
Sbjct  650  LTSARYKRNRCLG-SDLPPYMSPAQPGGLMQLISPYALPPAEPPNPVLTATDVVEGPLP  707



>emb|CDX94294.1| BnaC01g18900D [Brassica napus]
Length=757

 Score =   150 bits (380),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 77/122 (63%), Positives = 89/122 (73%), Gaps = 3/122 (2%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G TNVV +LQ S++ VYV+LF NEFVSQ +DFFSD  VE+NSYV G   N   G IT FP
Sbjct  596  GQTNVVERLQKSQLPVYVELFQNEFVSQPFDFFSDATVEINSYVTGPGIN---GTITEFP  652

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
             TA RYRRNRCL  KE   YM PV PG LL+++SP  +PPAEAP PV T++DV EPPLPP
Sbjct  653  FTAARYRRNRCLASKETLSYMAPVQPGGLLEVVSPGSIPPAEAPNPVFTDADVTEPPLPP  712

Query  418  VA  413
            V 
Sbjct  713  VT  714



>gb|KFK27133.1| hypothetical protein AALP_AA8G339300 [Arabis alpina]
Length=764

 Score =   150 bits (380),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 90/121 (74%), Gaps = 3/121 (2%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G TN+V +LQ  ++ VYV+LF NEFVSQ WDFFSD  VE+NS+V GA  N   G IT FP
Sbjct  603  GQTNLVERLQKFQLPVYVELFRNEFVSQPWDFFSDITVEINSHVTGAGIN---GTITEFP  659

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
             TA RY+RN+CL  K+ PPYM+PV P  LL ++SP  LPPAEAP PV T++DV EPPLPP
Sbjct  660  LTAARYKRNQCLTRKDPPPYMIPVQPAGLLTIVSPNSLPPAEAPNPVFTDADVTEPPLPP  719

Query  418  V  416
            V
Sbjct  720  V  720



>ref|XP_006391459.1| hypothetical protein EUTSA_v10018170mg [Eutrema salsugineum]
 gb|ESQ28745.1| hypothetical protein EUTSA_v10018170mg [Eutrema salsugineum]
Length=763

 Score =   150 bits (380),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 87/120 (73%), Gaps = 3/120 (3%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            TNVV +L  S++ VYV+LF NEFVSQ +DF SDP VE+NSY+ G   N   G IT FP T
Sbjct  604  TNVVERLHKSQLSVYVELFQNEFVSQPYDFLSDPTVEINSYISGVGIN---GTITEFPLT  660

Query  592  ANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  413
            A RY+RNRCLG KE PPYM  V PG LL ++SP  LPPA+ P PV T++DV EPPLPPV 
Sbjct  661  AARYKRNRCLGSKETPPYMAHVDPGGLLTVVSPSSLPPAKPPNPVFTDADVTEPPLPPVT  720



>ref|XP_006280047.1| hypothetical protein CARUB_v10025925mg [Capsella rubella]
 gb|EOA12945.1| hypothetical protein CARUB_v10025925mg [Capsella rubella]
Length=682

 Score =   150 bits (378),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 88/120 (73%), Gaps = 3/120 (3%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            TN+VA+LQ  ++ VYV+LF NEFVSQ WDFFSD  VE+NS+V GA      G IT FP T
Sbjct  523  TNLVARLQKVQLPVYVELFQNEFVSQPWDFFSDATVEINSHVTGAG---ISGTITEFPLT  579

Query  592  ANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  413
            A RY++N CL  K++PPYM PV P  LL ++SP  LPPAEAP PV T++DV EPPLPPV 
Sbjct  580  AARYKKNSCLNRKDLPPYMTPVQPAGLLTIVSPTSLPPAEAPNPVFTDADVTEPPLPPVT  639



>ref|XP_009108190.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=758

 Score =   150 bits (379),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 78/121 (64%), Positives = 91/121 (75%), Gaps = 6/121 (5%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            TNVV KLQ SK+ VYV+LF NEFVSQ +DFFSDP VE+NSY+ GA  N   G IT FP T
Sbjct  594  TNVVEKLQKSKLPVYVELFQNEFVSQPYDFFSDPTVEINSYILGAGIN---GTITEFPFT  650

Query  592  ANRYRRNRCLGYKE-IPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
            A RY+RNRCLG +E +PPYM P  PGSLLQ ++   +PPA+AP PV T+ DV EPPLPPV
Sbjct  651  AARYKRNRCLGTQETLPPYMAPFKPGSLLQAVNA--IPPAQAPNPVFTDDDVTEPPLPPV  708

Query  415  A  413
             
Sbjct  709  T  709



>ref|XP_002867546.1| MRH5/SHV3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43805.1| MRH5/SHV3 [Arabidopsis lyrata subsp. lyrata]
Length=756

 Score =   150 bits (379),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 89/120 (74%), Gaps = 3/120 (3%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            TNVV KLQ S++ VYV+LF NEF+SQ +DFF+D  VE+NSY+ GA  N   G IT FP T
Sbjct  597  TNVVEKLQKSQLPVYVELFQNEFLSQPYDFFADATVEINSYITGAGIN---GTITEFPFT  653

Query  592  ANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  413
            A RY+RN CLG KE  PYM P  PG+LL L+SP  LPPA+AP PV T++DV EPPLPPV 
Sbjct  654  AARYKRNLCLGRKETIPYMAPAQPGALLTLVSPTSLPPAQAPNPVFTDADVTEPPLPPVT  713



>ref|NP_567755.1| glycerophosphoryl diester phosphodiesterase-like 3 [Arabidopsis 
thaliana]
 sp|Q9SZ11.3|GPDL3_ARATH RecName: Full=Glycerophosphodiester phosphodiesterase GDPDL3; 
AltName: Full=Glycerophosphodiester phosphodiesterase-like 
3; Short=ATGDPDL3; AltName: Full=Glycerophosphodiesterase-like 
2; AltName: Full=Protein MUTANT ROOT HAIR 5; AltName: Full=Protein 
SHAVEN 3; Flags: Precursor [Arabidopsis thaliana]
 gb|AEE85238.1| glycerophosphoryl diester phosphodiesterase-like 3 [Arabidopsis 
thaliana]
Length=759

 Score =   150 bits (379),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 88/120 (73%), Gaps = 3/120 (3%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            TNVV KLQ S++ VYV+LF NEF+SQ +DFF+D  VE+NSY+ GA  N   G IT FP T
Sbjct  600  TNVVEKLQKSQLPVYVELFQNEFLSQPYDFFADATVEINSYITGAGIN---GTITEFPFT  656

Query  592  ANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  413
            A RY+RN CLG KE  PYM P  PG+LL L+SP   PPAEAP PV T++DV EPPLPPV 
Sbjct  657  AARYKRNLCLGRKETIPYMAPAQPGALLTLVSPTAFPPAEAPNPVFTDADVTEPPLPPVT  716



>gb|AAL07129.1| unknown protein [Arabidopsis thaliana]
Length=759

 Score =   150 bits (379),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 88/120 (73%), Gaps = 3/120 (3%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            TNVV KLQ S++ VYV+LF NEF+SQ +DFF+D  VE+NSY+ GA  N   G IT FP T
Sbjct  600  TNVVEKLQKSQLPVYVELFQNEFLSQPYDFFADATVEINSYITGAGIN---GTITEFPFT  656

Query  592  ANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  413
            A RY+RN CLG KE  PYM P  PG+LL L+SP   PPAEAP PV T++DV EPPLPPV 
Sbjct  657  AARYKRNLCLGRKETIPYMAPAQPGALLTLVSPTAFPPAEAPNPVFTDADVTEPPLPPVT  716



>ref|XP_010449676.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4-like 
isoform X1 [Camelina sativa]
 ref|XP_010449685.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4-like 
isoform X2 [Camelina sativa]
Length=767

 Score =   150 bits (379),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/122 (61%), Positives = 91/122 (75%), Gaps = 3/122 (2%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G TN+V +LQ  K+ VYV++F NEFVSQ +DFFSD  VE+NS+V GA  N   G IT FP
Sbjct  606  GQTNLVERLQKLKLPVYVEVFRNEFVSQPYDFFSDATVEINSHVTGAGVN---GAITEFP  662

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
             TA RY+RN CL  K+ PPYM+PV PG LL ++SP  LPPAEAP PV T++DV+EPPLPP
Sbjct  663  LTAARYKRNTCLTRKDPPPYMIPVQPGGLLTIVSPASLPPAEAPNPVFTDADVIEPPLPP  722

Query  418  VA  413
            V 
Sbjct  723  VT  724



>ref|XP_006413151.1| hypothetical protein EUTSA_v10024494mg [Eutrema salsugineum]
 gb|ESQ54604.1| hypothetical protein EUTSA_v10024494mg [Eutrema salsugineum]
Length=757

 Score =   150 bits (378),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 78/122 (64%), Positives = 90/122 (74%), Gaps = 3/122 (2%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G T VV +LQ S++ VYV+LF NEFVSQ +DFFSD  VE+NSYV G   N   G IT FP
Sbjct  596  GQTKVVERLQKSQLPVYVELFQNEFVSQPYDFFSDATVEINSYVTGVGIN---GTITEFP  652

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
             TA RY+RN CLG KEIP YM PV PG LL+++SP  LPPAEAP PV T++DV EPPLPP
Sbjct  653  FTAARYKRNPCLGSKEIPFYMAPVPPGGLLEVVSPGSLPPAEAPKPVFTDADVTEPPLPP  712

Query  418  VA  413
            V 
Sbjct  713  VT  714



>ref|XP_009127510.1| PREDICTED: LOW QUALITY PROTEIN: probable glycerophosphoryl diester 
phosphodiesterase 2 [Brassica rapa]
Length=749

 Score =   150 bits (378),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 88/120 (73%), Gaps = 3/120 (3%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G TNVV +L+ SK+ VYV+LF NEFVSQ +DF SD  VE+N+Y+ GA  N   G IT FP
Sbjct  595  GQTNVVERLRKSKLPVYVELFQNEFVSQPYDFCSDATVEINTYITGAGIN---GTITEFP  651

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
             TA+RY+RN+CLG KE P YM P+ PG LL L +P+ LPPAEAPYPV TE DV E P PP
Sbjct  652  LTASRYKRNQCLGRKETPSYMSPIKPGILLSLANPRSLPPAEAPYPVFTEDDVTESPQPP  711



>ref|NP_176870.2| suppressor of npr1-1 constitutive 4 [Arabidopsis thaliana]
 sp|D7SFH9.1|GPDL2_ARATH RecName: Full=Glycerophosphodiester phosphodiesterase protein 
kinase domain-containing GDPDL2; AltName: Full=Glycerophosphodiester 
phosphodiesterase-like 2; Short=ATGDPDL2; AltName: 
Full=Protein SUPPRESSOR OF NPR1-1 CONSTITUTIVE 4; Flags: Precursor 
[Arabidopsis thaliana]
 gb|ADI71282.1| SNC4 [Arabidopsis thaliana]
 gb|AEE34581.1| suppressor of npr1-1 constitutive 4 [Arabidopsis thaliana]
Length=1118

 Score =   151 bits (382),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 89/120 (74%), Gaps = 3/120 (3%)
 Frame = -1

Query  775  VTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPA  596
             TNV+ +LQ  ++ VYV+LF NEFVSQ +DFF+D  VE+N+Y+FGA  N   G IT FP 
Sbjct  608  TTNVLERLQKFQLPVYVELFQNEFVSQPFDFFADETVEINAYIFGAGIN---GTITEFPY  664

Query  595  TANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
            TA RY+RNRCLG +E+PPYMLPV PG +L L+S   LPPA+ P P+ T  DV EPPLPPV
Sbjct  665  TAARYKRNRCLGREEVPPYMLPVNPGGVLTLISTSSLPPAQDPNPIFTHDDVTEPPLPPV  724



>gb|AAF98210.1|AC007152_6 Unknown protein [Arabidopsis thaliana]
Length=1111

 Score =   151 bits (382),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 89/120 (74%), Gaps = 3/120 (3%)
 Frame = -1

Query  775  VTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPA  596
             TNV+ +LQ  ++ VYV+LF NEFVSQ +DFF+D  VE+N+Y+FGA  N   G IT FP 
Sbjct  610  TTNVLERLQKFQLPVYVELFQNEFVSQPFDFFADETVEINAYIFGAGIN---GTITEFPY  666

Query  595  TANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
            TA RY+RNRCLG +E+PPYMLPV PG +L L+S   LPPA+ P P+ T  DV EPPLPPV
Sbjct  667  TAARYKRNRCLGREEVPPYMLPVNPGGVLTLISTSSLPPAQDPNPIFTHDDVTEPPLPPV  726



>emb|CAB36515.1| putative protein [Arabidopsis thaliana]
 emb|CAB79524.1| putative protein [Arabidopsis thaliana]
Length=770

 Score =   150 bits (379),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 88/120 (73%), Gaps = 3/120 (3%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            TNVV KLQ S++ VYV+LF NEF+SQ +DFF+D  VE+NSY+ GA  N   G IT FP T
Sbjct  611  TNVVEKLQKSQLPVYVELFQNEFLSQPYDFFADATVEINSYITGAGIN---GTITEFPFT  667

Query  592  ANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  413
            A RY+RN CLG KE  PYM P  PG+LL L+SP   PPAEAP PV T++DV EPPLPPV 
Sbjct  668  AARYKRNLCLGRKETIPYMAPAQPGALLTLVSPTAFPPAEAPNPVFTDADVTEPPLPPVT  727



>ref|XP_010415240.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like 
[Camelina sativa]
Length=780

 Score =   150 bits (378),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 92/123 (75%), Gaps = 3/123 (2%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G TNVV +LQ SK+ VYV LF NEFVSQ +DFF+D  VE+N+Y+   S    +G+IT FP
Sbjct  607  GQTNVVERLQKSKLPVYVGLFQNEFVSQPYDFFADATVEINTYI---SLVGINGIITEFP  663

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
             TA RY+ NRCLG KE PPYM PV P +LL  MSPQ LPPAEAP  ++T++DV+EPPLPP
Sbjct  664  FTAARYKTNRCLGRKETPPYMEPVKPRALLAFMSPQSLPPAEAPNLIITDADVIEPPLPP  723

Query  418  VAK  410
            + +
Sbjct  724  ITE  726



>ref|XP_010443178.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4-like 
[Camelina sativa]
Length=767

 Score =   150 bits (378),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/122 (61%), Positives = 90/122 (74%), Gaps = 3/122 (2%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G TN+V +LQ  K+ VYV +F NEFVSQ +DFFSD  VE+NS+V GA     DG IT FP
Sbjct  606  GQTNLVERLQKLKLPVYVDVFQNEFVSQPYDFFSDATVEINSHVTGAG---IDGAITEFP  662

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
             TA RY+RN CL  K+ PPYM+PV PG LL ++SP  LPPAEAP PV T++DV+EPPLPP
Sbjct  663  LTAARYKRNTCLTRKDPPPYMIPVQPGGLLTIVSPASLPPAEAPNPVFTDADVIEPPLPP  722

Query  418  VA  413
            V 
Sbjct  723  VT  724



>ref|XP_006280048.1| hypothetical protein CARUB_v10025925mg [Capsella rubella]
 gb|EOA12946.1| hypothetical protein CARUB_v10025925mg [Capsella rubella]
Length=767

 Score =   150 bits (378),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 88/120 (73%), Gaps = 3/120 (3%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            TN+VA+LQ  ++ VYV+LF NEFVSQ WDFFSD  VE+NS+V GA      G IT FP T
Sbjct  608  TNLVARLQKVQLPVYVELFQNEFVSQPWDFFSDATVEINSHVTGAG---ISGTITEFPLT  664

Query  592  ANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  413
            A RY++N CL  K++PPYM PV P  LL ++SP  LPPAEAP PV T++DV EPPLPPV 
Sbjct  665  AARYKKNSCLNRKDLPPYMTPVQPAGLLTIVSPTSLPPAEAPNPVFTDADVTEPPLPPVT  724



>ref|XP_010253010.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4-like 
[Nelumbo nucifera]
Length=734

 Score =   149 bits (377),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 89/124 (72%), Gaps = 4/124 (3%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            GVT +V+KL +  + VY  +F NEFVS AWDF+SDP VE+NS+V GA     DGVIT FP
Sbjct  588  GVTKIVSKLHSFNLTVYTSVFRNEFVSSAWDFYSDPVVEINSFVMGAG---IDGVITDFP  644

Query  598  ATANRYRRNRCLGYKE-IPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  422
             TA  YR+NRCL   + IP YM PV PG+L Q +S +YLP AEAP PVLT+SDV EPPLP
Sbjct  645  GTAIMYRKNRCLNRGDNIPSYMRPVQPGNLFQAISAEYLPLAEAPSPVLTDSDVAEPPLP  704

Query  421  PVAK  410
             V K
Sbjct  705  HVIK  708



>emb|CDY42328.1| BnaC02g17050D [Brassica napus]
Length=258

 Score =   143 bits (360),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 86/123 (70%), Gaps = 3/123 (2%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G TNVV +LQ SK+ VYV+LF NEFVSQ +DFF D  VE+N+Y+ GA  N   G IT FP
Sbjct  104  GQTNVVERLQKSKLLVYVKLFHNEFVSQPYDFFCDATVEINTYITGAGLN---GTITEFP  160

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
             TA RY+RN+CLG K+ P YM P+ PG LL +++P+ LPPAE PY V T  DV E P PP
Sbjct  161  LTAARYKRNQCLGRKQTPSYMSPLKPGGLLSIVNPKSLPPAEPPYLVFTADDVTESPQPP  220

Query  418  VAK  410
              +
Sbjct  221  ATE  223



>ref|XP_010482994.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4 [Camelina 
sativa]
Length=769

 Score =   149 bits (376),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 75/122 (61%), Positives = 90/122 (74%), Gaps = 3/122 (2%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G TN+V +LQ  K+ VYV++F NEFVSQ +DFFSD  VE+NS+V GA  N   G IT FP
Sbjct  608  GQTNLVERLQKLKLPVYVEVFRNEFVSQPYDFFSDATVEINSHVTGAGVN---GAITEFP  664

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
             TA RY+RN CL  K+ PPYM+PV PG LL ++SP  LPPAEAP PV T++DV EPPLPP
Sbjct  665  LTAARYKRNTCLTRKDPPPYMIPVQPGGLLTIVSPASLPPAEAPNPVFTDADVTEPPLPP  724

Query  418  VA  413
            V 
Sbjct  725  VT  726



>ref|NP_200359.1| putative glycerophosphoryl diester phosphodiesterase 1 [Arabidopsis 
thaliana]
 sp|Q9FJ62.1|GPDL4_ARATH RecName: Full=Glycerophosphodiester phosphodiesterase GDPDL4; 
AltName: Full=Glycerophosphodiester phosphodiesterase-like 
4; Short=ATGDPDL4; AltName: Full=Glycerophosphodiesterase-like 
1; AltName: Full=Protein SHV3-LIKE 1; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB08565.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAU94382.1| At5g55480 [Arabidopsis thaliana]
 gb|AAV59273.1| At5g55480 [Arabidopsis thaliana]
 gb|AED96633.1| putative glycerophosphoryl diester phosphodiesterase 1 [Arabidopsis 
thaliana]
Length=766

 Score =   149 bits (376),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 90/122 (74%), Gaps = 3/122 (2%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G T +V +LQ  ++ VYV++F NEFVSQ WDFF+D  VE+NS+V GA  N   G IT FP
Sbjct  605  GQTKLVERLQKFQLPVYVEVFRNEFVSQPWDFFADATVEINSHVTGAGIN---GTITEFP  661

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
             TA RY+RN CL  K++PPYM+PV P  LL ++SP  LPPAEAP PV T++DV EPPLPP
Sbjct  662  LTAARYKRNSCLTRKDVPPYMIPVQPAGLLTIVSPASLPPAEAPSPVFTDADVTEPPLPP  721

Query  418  VA  413
            V+
Sbjct  722  VS  723



>emb|CDY11996.1| BnaC03g14220D [Brassica napus]
Length=773

 Score =   149 bits (375),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 91/122 (75%), Gaps = 3/122 (2%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G TN+V +LQ  K+ VYV+ F NEFVSQA+DFFSD  VE+N++V GA  +   G IT FP
Sbjct  605  GQTNLVERLQKFKLPVYVETFRNEFVSQAYDFFSDATVEINTHVTGAGVS---GTITEFP  661

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
             TA RY+RNRC+  K+ P YM+PV P  LL+++SP +LPPAEAP PV T++D+ EPPLPP
Sbjct  662  LTAARYKRNRCVARKDTPVYMIPVRPAGLLEIVSPTFLPPAEAPNPVFTDADITEPPLPP  721

Query  418  VA  413
            V 
Sbjct  722  VT  723



>emb|CDY12605.1| BnaA02g12730D [Brassica napus]
Length=716

 Score =   148 bits (374),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 88/120 (73%), Gaps = 3/120 (3%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G TNVV +L+ SK+ VYV+LF NEFVSQ +DF SD  VE+N+Y+ GA  N   G IT FP
Sbjct  562  GQTNVVERLRKSKLPVYVELFQNEFVSQPYDFCSDATVEINTYITGAGIN---GTITEFP  618

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
             TA+RY+RN+CLG K+ P YM P+ PG LL L +P+ LPPAEAPYPV TE DV E P PP
Sbjct  619  LTASRYKRNQCLGRKKTPSYMSPIKPGILLSLANPRSLPPAEAPYPVFTEDDVTESPQPP  678



>ref|XP_010511610.1| PREDICTED: LOW QUALITY PROTEIN: glycerophosphodiester phosphodiesterase 
GDPDL1-like [Camelina sativa]
Length=764

 Score =   148 bits (373),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/122 (63%), Positives = 89/122 (73%), Gaps = 4/122 (3%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G TNVV KLQ SK+ VYV+LF NEFVSQ +DFFSD  VE+N+Y +G   N   G IT FP
Sbjct  605  GQTNVVEKLQKSKLPVYVELFQNEFVSQPFDFFSDATVEINTYTYGFGIN---GTITEFP  661

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQ-LMSPQYLPPAEAPYPVLTESDVVEPPLP  422
             TA RY+RNRCLG K IPPYM P+  G LL+ L+SP  LPP +AP PV T+ DV EPPLP
Sbjct  662  FTAARYKRNRCLGRKVIPPYMSPIQAGILLKNLVSPLSLPPTQAPSPVFTDGDVTEPPLP  721

Query  421  PV  416
            PV
Sbjct  722  PV  723



>ref|XP_006300773.1| hypothetical protein CARUB_v10019847mg [Capsella rubella]
 gb|EOA33671.1| hypothetical protein CARUB_v10019847mg [Capsella rubella]
Length=766

 Score =   148 bits (373),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 89/122 (73%), Gaps = 3/122 (2%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G TNVV +L  S++ VYV+LF NEFVSQ +DFF+D  VE+NSY+ GA  N   G IT FP
Sbjct  608  GQTNVVERLHKSQLPVYVELFQNEFVSQPYDFFTDATVEINSYINGAGIN---GTITEFP  664

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
             TA RY+RNRCL  K+ PPYMLP+ PGSLL + +   LPPAEAP  + T++DV EPPLPP
Sbjct  665  FTAARYKRNRCLARKDTPPYMLPIKPGSLLGVANRYLLPPAEAPSLIFTDADVSEPPLPP  724

Query  418  VA  413
            V 
Sbjct  725  VT  726



>ref|XP_006283180.1| hypothetical protein CARUB_v10004210mg [Capsella rubella]
 gb|EOA16078.1| hypothetical protein CARUB_v10004210mg [Capsella rubella]
Length=757

 Score =   147 bits (372),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 88/120 (73%), Gaps = 3/120 (3%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            TNVV KLQ S++ VYV+LF NEFVSQ +DFFSD  VE+NSY+FG   N   G IT FP T
Sbjct  598  TNVVEKLQKSQLPVYVELFQNEFVSQPYDFFSDATVEINSYIFGPGIN---GTITEFPFT  654

Query  592  ANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  413
            A RY+RN CL  K+  PYM PV PG+LL L+S   LPPAEAP PV T++DV EPPLPPV 
Sbjct  655  AARYKRNLCLSSKDNVPYMAPVQPGALLALVSSASLPPAEAPNPVFTDADVTEPPLPPVT  714



>ref|XP_009132384.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Brassica rapa]
Length=766

 Score =   147 bits (372),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 91/122 (75%), Gaps = 3/122 (2%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G TN+V +LQ  K+ VYV+ F NEFVSQA+DF SD  VE+N++V GA  +   G IT FP
Sbjct  605  GQTNLVERLQKFKLPVYVETFRNEFVSQAYDFLSDATVEINTHVTGAGVS---GTITEFP  661

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
             TA RY+RNRC+  K+ P YM+PV P  LL+++SP +LPPAEAP PV+T++DV EPPLPP
Sbjct  662  LTAARYKRNRCVARKDTPVYMIPVRPAGLLEIVSPTFLPPAEAPNPVITDADVTEPPLPP  721

Query  418  VA  413
            V 
Sbjct  722  VT  723



>emb|CDY36746.1| BnaA03g11400D [Brassica napus]
Length=766

 Score =   147 bits (372),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 90/122 (74%), Gaps = 3/122 (2%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G TN+V +LQ  K+ VYV+ F NEFVSQA+DF SD  VE+N++V GA  +   G IT FP
Sbjct  605  GQTNLVERLQKFKLPVYVETFRNEFVSQAYDFLSDATVEINTHVTGAGVS---GTITEFP  661

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
             TA RY+RNRC+  K+ P YM+PV P  LL+++SP +LPPAEAP PV T++DV EPPLPP
Sbjct  662  LTAARYKRNRCMARKDTPVYMIPVRPAGLLEIVSPTFLPPAEAPNPVFTDADVTEPPLPP  721

Query  418  VA  413
            V 
Sbjct  722  VT  723



>ref|XP_010270134.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4 [Nelumbo 
nucifera]
Length=751

 Score =   147 bits (371),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 89/120 (74%), Gaps = 4/120 (3%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G+T VV+KLQA  +  YV LF NEFVSQAWD FSDP VE+N++V   +    DG+I+ FP
Sbjct  590  GMTKVVSKLQAFNLTAYVYLFRNEFVSQAWDVFSDPTVEINTFV---TLGKIDGIISDFP  646

Query  598  ATANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  422
             TA  YR+NRCLG  K IP YM PV PGSL+Q+++P +LPPAEAP PVL +S+V EPP P
Sbjct  647  GTAAAYRKNRCLGMGKNIPIYMTPVQPGSLMQVITPDFLPPAEAPNPVLEDSNVAEPPFP  706



>ref|XP_010496105.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like, 
partial [Camelina sativa]
Length=177

 Score =   138 bits (347),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 87/124 (70%), Gaps = 4/124 (3%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G T VV +LQ S+++VYV+LF NEFVSQ  D F D  +E+N+Y +G   N   G IT +P
Sbjct  26   GQTAVVERLQKSQLQVYVELFQNEFVSQKLDSFYDATIEINTYTYGLGIN---GTITEYP  82

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQ-LMSPQYLPPAEAPYPVLTESDVVEPPLP  422
             TA RY+RNRCLG K IPPYM  + PG LL  L+SP  LPPAEAP  V T +DV EPPLP
Sbjct  83   FTAARYKRNRCLGRKVIPPYMSAIEPGGLLNYLVSPLSLPPAEAPNLVFTNADVSEPPLP  142

Query  421  PVAK  410
            PVAK
Sbjct  143  PVAK  146



>ref|XP_002300351.2| hypothetical protein POPTR_0001s37160g [Populus trichocarpa]
 gb|EEE85156.2| hypothetical protein POPTR_0001s37160g [Populus trichocarpa]
Length=754

 Score =   146 bits (369),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 86/119 (72%), Gaps = 3/119 (3%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            GVTNVV KLQ+  + VYV+ FSNEFVSQAWDFFSD  VE+NSYV G +     GVIT FP
Sbjct  593  GVTNVVPKLQSHGLSVYVETFSNEFVSQAWDFFSDSTVEINSYVMGVN---ISGVITEFP  649

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  422
             T+ RY+RNRCLGY  +P YM P  PG L+ L+ P  LPPAE P PVLT  DVVE PLP
Sbjct  650  LTSARYKRNRCLGYNVLPHYMSPAQPGGLMPLIPPFALPPAEPPNPVLTAPDVVEGPLP  708



>ref|XP_002864395.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH40654.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=757

 Score =   146 bits (369),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 89/122 (73%), Gaps = 3/122 (2%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G T +V +LQ  ++ VYV++F NEFVSQ WDFF+D  VE+NS+V GA  N   G IT FP
Sbjct  596  GQTKLVERLQKFQLPVYVEVFRNEFVSQPWDFFADATVEINSHVTGAGIN---GTITDFP  652

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
             TA RY+RN CL  K+ PPYM+PV P  LL ++SP  LPPAEAP PV+T++DV EPPLPP
Sbjct  653  LTAARYKRNSCLTRKDPPPYMIPVQPAGLLTIVSPASLPPAEAPNPVITDADVTEPPLPP  712

Query  418  VA  413
            V 
Sbjct  713  VT  714



>ref|XP_004491450.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2-like [Cicer arietinum]
Length=755

 Score =   145 bits (366),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 90/124 (73%), Gaps = 4/124 (3%)
 Frame = -1

Query  775  VTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPA  596
            +T  V KL+AS + V+V+ FSNEFVSQAWDFFSDP VE+NS++  A     DGVIT FP 
Sbjct  594  LTRTVPKLKASNLSVFVETFSNEFVSQAWDFFSDPIVEINSFIQEAG---IDGVITDFPK  650

Query  595  TANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
            TANRY RN+CL    ++PPYM PV  GSL  ++  + LPPA AP P LT S+VVEPPLPP
Sbjct  651  TANRYSRNKCLNLGDKVPPYMQPVQAGSLYGIIPSESLPPALAPLPSLTNSEVVEPPLPP  710

Query  418  VAKI  407
            V KI
Sbjct  711  VTKI  714



>ref|XP_007146557.1| hypothetical protein PHAVU_006G050600g [Phaseolus vulgaris]
 gb|ESW18551.1| hypothetical protein PHAVU_006G050600g [Phaseolus vulgaris]
Length=667

 Score =   144 bits (362),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 85/125 (68%), Gaps = 4/125 (3%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G T  V+K ++  + VYVQ F NEFVSQAWDF SD  V++N++V  A     DGVITGFP
Sbjct  505  GSTKTVSKFKSVNLSVYVQTFHNEFVSQAWDFLSDATVQINTFVQDAG---IDGVITGFP  561

Query  598  ATANRYRRNRCLGYKE-IPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  422
             TANRYRRNRCL   +  PPYM PV  G L QL+    LPPA AP P LTE+DV EPPL 
Sbjct  562  QTANRYRRNRCLNLGDSTPPYMRPVEIGGLFQLVDKSSLPPAMAPAPSLTEADVTEPPLA  621

Query  421  PVAKI  407
            P +KI
Sbjct  622  PFSKI  626



>ref|XP_007142366.1| hypothetical protein PHAVU_008G274200g [Phaseolus vulgaris]
 gb|ESW14360.1| hypothetical protein PHAVU_008G274200g [Phaseolus vulgaris]
Length=758

 Score =   144 bits (363),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 88/124 (71%), Gaps = 2/124 (2%)
 Frame = -1

Query  775  VTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPA  596
             T +V KL A+ + V+V+ FSNEFVSQ+WDFFSD  VE+NSY+  A     DG+IT FP 
Sbjct  596  TTKIVPKLNAANLSVFVETFSNEFVSQSWDFFSDATVEINSYL-NAEGVKIDGIITDFPK  654

Query  595  TANRYRRNRCLGYKEIPP-YMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
            TA+RYRRN+CL   +  P YM PV PG L  L++P +LPP EAP P LTES+V EP LPP
Sbjct  655  TADRYRRNKCLNLGDKKPTYMDPVQPGGLFGLITPGFLPPTEAPLPPLTESEVAEPALPP  714

Query  418  VAKI  407
            V KI
Sbjct  715  VVKI  718



>ref|XP_010448228.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Camelina sativa]
Length=757

 Score =   144 bits (363),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 88/121 (73%), Gaps = 3/121 (2%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            TNVV KLQ S++ VYV+LF NEFVSQ +DFFSDP VE+NSY+ G   N   G IT FP T
Sbjct  598  TNVVEKLQKSQLPVYVELFQNEFVSQPYDFFSDPTVEINSYITGPGIN---GTITEFPFT  654

Query  592  ANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  413
            A RY++N CL  KE  PYM P  PG+LL L+S   LPPA+AP P+ T++DV EPPLPPV 
Sbjct  655  AARYKKNLCLASKENVPYMAPAQPGALLTLVSSTSLPPAQAPNPLFTDADVTEPPLPPVT  714

Query  412  K  410
            +
Sbjct  715  E  715



>ref|XP_009105134.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=756

 Score =   144 bits (363),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 77/122 (63%), Positives = 88/122 (72%), Gaps = 7/122 (6%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            TNVV KL  SK+ VYV++F NEFVSQ +DFFSDP VE+NSYV GA     DG IT FP T
Sbjct  599  TNVVEKLHKSKLPVYVEVFQNEFVSQPFDFFSDPTVEINSYVSGAG---IDGTITEFPFT  655

Query  592  ANRYRRNRCLGYKE--IPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
            A RY+RNRCLG KE   PPYM PV PG  L L++   +PPA+AP PV T+ DV EPPLPP
Sbjct  656  AARYKRNRCLGTKESLAPPYMSPVRPGFFLNLVNA--IPPAQAPNPVFTDDDVTEPPLPP  713

Query  418  VA  413
            V 
Sbjct  714  VT  715



>ref|XP_010252664.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Nelumbo nucifera]
Length=756

 Score =   144 bits (362),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 85/124 (69%), Gaps = 4/124 (3%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G TN+V+KL +S + VYV +F NE++SQAWDF+SDP  E+N++V GA     DG+IT FP
Sbjct  593  GATNIVSKLHSSNLTVYVHVFHNEYLSQAWDFWSDPNFEINNFVMGAR---IDGIITDFP  649

Query  598  ATANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  422
             TAN YR NRCL      P YM PV P  LL L +P  LP  EAP PVLTESDV EPPLP
Sbjct  650  GTANAYRNNRCLKMGNRKPRYMNPVLPNGLLSLGNPALLPSVEAPNPVLTESDVAEPPLP  709

Query  421  PVAK  410
             V K
Sbjct  710  SVTK  713



>ref|XP_007020653.1| PLC-like phosphodiesterase family protein, putative isoform 2 
[Theobroma cacao]
 gb|EOY12178.1| PLC-like phosphodiesterase family protein, putative isoform 2 
[Theobroma cacao]
Length=758

 Score =   144 bits (362),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 90/123 (73%), Gaps = 6/123 (5%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            GVT+VV +LQA+ + VYV  FSNEF SQAWDFFSD  VE+NS+  G   N   GVIT FP
Sbjct  598  GVTDVVPRLQAANLSVYVHTFSNEFTSQAWDFFSDATVEVNSFHVGGLIN---GVITDFP  654

Query  598  ATANRYRRNRCLGYKE-IPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  422
             T++R+  NRCL   +  P YM PV PGSLLQL++ +YLPPAEAP P LTE+D+ E PLP
Sbjct  655  ETSDRW--NRCLNKGDNTPGYMSPVQPGSLLQLVTAEYLPPAEAPNPYLTEADIAESPLP  712

Query  421  PVA  413
            PVA
Sbjct  713  PVA  715



>emb|CDX92782.1| BnaC07g40400D [Brassica napus]
Length=1322

 Score =   145 bits (366),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 86/113 (76%), Gaps = 3/113 (3%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G TNVV +LQ S++ VYV+LF NEFVSQ +DF SD  VE+NSYV GA  N   G IT FP
Sbjct  594  GQTNVVERLQKSQLPVYVELFQNEFVSQPYDFLSDATVEINSYVTGAGVN---GTITEFP  650

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDV  440
             TA RYR+NRCLG KE PPYM PV PG+LLQ+++P  LPPAEAP PV T++DV
Sbjct  651  FTAARYRKNRCLGSKETPPYMAPVQPGALLQVVNPASLPPAEAPNPVFTDADV  703



>ref|XP_007146558.1| hypothetical protein PHAVU_006G050600g [Phaseolus vulgaris]
 gb|ESW18552.1| hypothetical protein PHAVU_006G050600g [Phaseolus vulgaris]
Length=762

 Score =   144 bits (362),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 85/125 (68%), Gaps = 4/125 (3%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G T  V+K ++  + VYVQ F NEFVSQAWDF SD  V++N++V  A     DGVITGFP
Sbjct  600  GSTKTVSKFKSVNLSVYVQTFHNEFVSQAWDFLSDATVQINTFVQDAG---IDGVITGFP  656

Query  598  ATANRYRRNRCLGYKE-IPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  422
             TANRYRRNRCL   +  PPYM PV  G L QL+    LPPA AP P LTE+DV EPPL 
Sbjct  657  QTANRYRRNRCLNLGDSTPPYMRPVEIGGLFQLVDKSSLPPAMAPAPSLTEADVTEPPLA  716

Query  421  PVAKI  407
            P +KI
Sbjct  717  PFSKI  721



>emb|CDY61647.1| BnaCnng38120D [Brassica napus]
Length=755

 Score =   143 bits (360),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 79/122 (65%), Positives = 89/122 (73%), Gaps = 7/122 (6%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            TNVV KL  SK+ VYV+LF NEFVSQ +DFFSDP VE+NSYV GA     DG IT FP T
Sbjct  598  TNVVEKLHKSKLPVYVELFQNEFVSQPFDFFSDPTVEINSYVSGAG---IDGTITEFPFT  654

Query  592  ANRYRRNRCLGYKE-IPP-YMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
            A RY+RNRCLG KE IPP YM PV PG  L L++   +PPA+AP PV T+ DV EPPLPP
Sbjct  655  AARYKRNRCLGTKETIPPQYMSPVPPGLFLNLVNA--IPPAQAPNPVFTDDDVTEPPLPP  712

Query  418  VA  413
            V 
Sbjct  713  VT  714



>ref|XP_010536709.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Tarenaya hassleriana]
Length=752

 Score =   142 bits (359),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 76/122 (62%), Positives = 88/122 (72%), Gaps = 5/122 (4%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G T+VV KLQ S + VYV+LF NEFVSQ +DFFSD  VE+NSYV GA  N   G IT FP
Sbjct  593  GQTDVVTKLQKSLLPVYVELFQNEFVSQPYDFFSDATVEINSYVRGAGVN---GTITEFP  649

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
             TA RY++NRCLG KE PPY  PV  G+L+ L +   LPPAEAP PV T++DV EPPLPP
Sbjct  650  LTAARYKKNRCLGLKEPPPYSSPVQAGALVSLATA--LPPAEAPNPVFTDADVTEPPLPP  707

Query  418  VA  413
            V 
Sbjct  708  VT  709



>ref|XP_009137635.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=1321

 Score =   144 bits (362),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 85/113 (75%), Gaps = 3/113 (3%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G TNVV +LQ S++ VYV+LF NEFVSQ +DFFSD  VE+NSYV GA  N   G IT FP
Sbjct  593  GQTNVVERLQKSQLPVYVELFQNEFVSQPYDFFSDATVEINSYVTGAGVN---GTITEFP  649

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDV  440
             TA RYRRN+CLG KE  PYM PV PG LL+++SP  LPPAEAP PV T++DV
Sbjct  650  FTAARYRRNKCLGSKETLPYMAPVQPGGLLEVVSPASLPPAEAPNPVFTDADV  702



>ref|XP_010438711.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Camelina sativa]
Length=757

 Score =   142 bits (357),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 87/121 (72%), Gaps = 3/121 (2%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            TNVV KLQ S++ VYV+LF NEFVSQ +DFFSD  VE+NSY+ G   N   G IT FP T
Sbjct  598  TNVVEKLQKSQLPVYVELFQNEFVSQPYDFFSDATVEINSYITGPGIN---GTITEFPFT  654

Query  592  ANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  413
            A RY++N CL  KE  PYM P  PG+LL L+S   LPPA+AP P+ T++DV EPPLPPV 
Sbjct  655  AARYKKNLCLASKENVPYMAPAQPGALLTLVSSTSLPPAQAPNPLFTDADVTEPPLPPVT  714

Query  412  K  410
            +
Sbjct  715  E  715



>gb|KDP39221.1| hypothetical protein JCGZ_00978 [Jatropha curcas]
Length=767

 Score =   141 bits (356),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 91/123 (74%), Gaps = 6/123 (5%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G+T+VV +L  S + VYV+ FSNEFVSQAWDFFSD  VE+N++V  A+ +   G+IT FP
Sbjct  596  GITDVVPRLTKSGLPVYVETFSNEFVSQAWDFFSDATVEINTFVVEANVS---GIITDFP  652

Query  598  ATANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  422
             TA RY+RNRCL   K +P YM PV  G L+QL++   LPPAEAP PVLTESDV+EPPLP
Sbjct  653  KTAARYKRNRCLNLGKNMPSYMRPVEAGGLMQLIAN--LPPAEAPNPVLTESDVMEPPLP  710

Query  421  PVA  413
             V 
Sbjct  711  SVT  713



>ref|XP_010511611.1| PREDICTED: LOW QUALITY PROTEIN: glycerophosphodiester phosphodiesterase 
protein kinase domain-containing GDPDL2-like [Camelina 
sativa]
Length=1150

 Score =   142 bits (359),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 89/122 (73%), Gaps = 4/122 (3%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G TNVV KLQ S++ VYV+LF NEFVSQ +DFF+D  VE+NSY+ GA  N   G IT FP
Sbjct  642  GQTNVVEKLQKSQLPVYVELFQNEFVSQPFDFFTDATVEINSYISGAGIN---GTITEFP  698

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMS-PQYLPPAEAPYPVLTESDVVEPPLP  422
             TA RY++NRCL  ++IPPYM P  PG +L+L+S    LPPA+AP PV T+ DV E PLP
Sbjct  699  XTAARYKKNRCLRRQDIPPYMSPFEPGGVLKLVSRSNSLPPAQAPSPVFTDGDVTESPLP  758

Query  421  PV  416
            PV
Sbjct  759  PV  760



>ref|XP_009415406.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Musa acuminata subsp. malaccensis]
Length=760

 Score =   141 bits (355),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 87/121 (72%), Gaps = 4/121 (3%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            T++V+KLQ + + VYV LF NEFV+Q WDFFSD  VE+N+YV GA     DG+IT FPAT
Sbjct  600  TDIVSKLQNAGLAVYVYLFQNEFVAQPWDFFSDATVEINTYVQGAGV---DGIITDFPAT  656

Query  592  ANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
            A+ Y+RN C    K  P YM P   G LLQL+SPQ LPPA +P PVL  SDVVEPPLPPV
Sbjct  657  ASTYKRNSCRKMGKNAPSYMSPAQGGGLLQLISPQSLPPALSPMPVLDVSDVVEPPLPPV  716

Query  415  A  413
            A
Sbjct  717  A  717



>ref|XP_006474966.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2-like [Citrus sinensis]
Length=764

 Score =   141 bits (355),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 85/114 (75%), Gaps = 4/114 (4%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            T++V +LQ+ K+ VYV+ FSNEFVSQAWDFFSDP VE+N+Y  GA     DGVIT FP T
Sbjct  601  TDIVQRLQSFKLPVYVETFSNEFVSQAWDFFSDPTVEINTYYEGAG---IDGVITEFPMT  657

Query  592  ANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVE  434
            A RYRRNRCL    + PPYM PV PG LL L++  YLPPAEAP P+LTE+ V E
Sbjct  658  AARYRRNRCLKRGDKTPPYMNPVQPGGLLPLITSDYLPPAEAPNPILTEAAVTE  711



>ref|XP_006452490.1| hypothetical protein CICLE_v10007536mg [Citrus clementina]
 gb|ESR65730.1| hypothetical protein CICLE_v10007536mg [Citrus clementina]
Length=764

 Score =   141 bits (355),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 85/114 (75%), Gaps = 4/114 (4%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            T++V +LQ+ K+ VYV+ FSNEFVSQAWDFFSDP VE+N+Y  GA     DGVIT FP T
Sbjct  601  TDIVQRLQSFKLPVYVETFSNEFVSQAWDFFSDPTVEINTYYEGAG---IDGVITEFPMT  657

Query  592  ANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVE  434
            A RYRRNRCL    + PPYM PV PG LL L++  YLPPAEAP P+LTE+ V E
Sbjct  658  AARYRRNRCLKRGDKTPPYMNPVQPGGLLPLITSDYLPPAEAPNPILTEAAVTE  711



>gb|KDO62174.1| hypothetical protein CISIN_1g003550mg [Citrus sinensis]
Length=811

 Score =   141 bits (355),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 85/114 (75%), Gaps = 4/114 (4%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            T++V +LQ+ K+ VYV+ FSNEFVSQAWDFFSDP VE+N+Y  GA     DGVIT FP T
Sbjct  648  TDIVQRLQSFKLPVYVETFSNEFVSQAWDFFSDPTVEINTYYEGAG---IDGVITEFPMT  704

Query  592  ANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVE  434
            A RYRRNRCL    + PPYM PV PG LL L++  YLPPAEAP P+LTE+ V E
Sbjct  705  AARYRRNRCLKRGDKTPPYMNPVQPGGLLPLITSDYLPPAEAPNPILTEAAVTE  758



>ref|XP_010474164.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like 
[Camelina sativa]
Length=654

 Score =   138 bits (348),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 86/124 (69%), Gaps = 4/124 (3%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G T VV +LQ S+++VYV+LF NEFVSQ  D F D  +E+N+Y +G   N   G IT +P
Sbjct  503  GQTAVVERLQKSQLQVYVELFENEFVSQKLDSFYDATIEINTYTYGFGIN---GTITEYP  559

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQ-LMSPQYLPPAEAPYPVLTESDVVEPPLP  422
             TA RY+RNRCLG K IPPYM  + PG LL  L+SP  LPPAEAP  V T  DV EPPLP
Sbjct  560  FTAARYKRNRCLGRKVIPPYMSAIQPGDLLNTLVSPLSLPPAEAPNLVFTNVDVSEPPLP  619

Query  421  PVAK  410
            PVAK
Sbjct  620  PVAK  623



>ref|XP_010496109.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Camelina sativa]
Length=1128

 Score =   139 bits (350),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 88/122 (72%), Gaps = 4/122 (3%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G TNVV +LQ S++ VYV+LF NEFVSQA+DFF+D  VE+NSY+ GA  N   G IT FP
Sbjct  623  GQTNVVERLQKSQLLVYVELFRNEFVSQAYDFFTDATVEINSYISGAGIN---GTITEFP  679

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMS-PQYLPPAEAPYPVLTESDVVEPPLP  422
             TA RY++NRCL  + IPPYM P  PG +L+L++    LPPA+AP  V T+SDV E PL 
Sbjct  680  YTAARYKKNRCLRRQHIPPYMSPFEPGGVLKLVNRSNSLPPAQAPSSVFTDSDVTESPLS  739

Query  421  PV  416
            PV
Sbjct  740  PV  741



>ref|XP_003544723.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
3-like [Glycine max]
Length=754

 Score =   136 bits (343),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 94/123 (76%), Gaps = 4/123 (3%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            TN+V KL+ + + V+V+ FSNEFVSQAWDFFSDP VE+NSY+ GA     DG+IT FP T
Sbjct  595  TNIVPKLKNANLSVFVETFSNEFVSQAWDFFSDPTVEINSYIEGAQ---IDGIITDFPKT  651

Query  592  ANRYRRNRCLGYKE-IPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
            A+RYRRN+CLG  +  P YM PV PG L  L++ ++LPPAEAP P LTES+V E PLPPV
Sbjct  652  ADRYRRNKCLGLGDNKPTYMEPVQPGGLFGLITKEFLPPAEAPLPPLTESEVAESPLPPV  711

Query  415  AKI  407
            AKI
Sbjct  712  AKI  714



>gb|KHN23877.1| Putative glycerophosphoryl diester phosphodiesterase 3 [Glycine 
soja]
Length=754

 Score =   136 bits (343),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 94/123 (76%), Gaps = 4/123 (3%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            TN+V KL+ + + V+V+ FSNEFVSQAWDFFSDP VE+NSY+ GA     DG+IT FP T
Sbjct  595  TNIVPKLKNANLSVFVETFSNEFVSQAWDFFSDPTVEINSYIEGAQ---IDGIITDFPKT  651

Query  592  ANRYRRNRCLGYKE-IPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
            A+RYRRN+CLG  +  P YM PV PG L  L++ ++LPPAEAP P LTES+V E PLPPV
Sbjct  652  ADRYRRNKCLGLGDNKPTYMEPVQPGGLFGLITKEFLPPAEAPLPPLTESEVAESPLPPV  711

Query  415  AKI  407
            AKI
Sbjct  712  AKI  714



>ref|XP_010419030.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like 
[Camelina sativa]
Length=772

 Score =   136 bits (343),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 89/125 (71%), Gaps = 6/125 (5%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G T VV +LQ S+++VYV+LF NEFVSQ  D+F D  VELN+Y +GA  N   G IT FP
Sbjct  609  GQTAVVERLQKSQLQVYVELFQNEFVSQKLDWFYDATVELNTYTYGAGIN---GTITEFP  665

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLM--SPQYLPPAEAPYPVLTESDVVEPPL  425
             TA +Y+RNRCLG K IPPYM  + PG+LL ++  SP + PPA+AP  V T +DV E PL
Sbjct  666  FTAAKYKRNRCLGRKVIPPYMSAIQPGNLLNILVSSPAF-PPAQAPNLVFTNADVSEAPL  724

Query  424  PPVAK  410
            PPVAK
Sbjct  725  PPVAK  729



>emb|CDY46667.1| BnaA03g48410D [Brassica napus]
Length=1323

 Score =   137 bits (345),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 83/113 (73%), Gaps = 3/113 (3%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G TNVV +LQ S++ VYV+LF NEFVSQ +DFFSD  VE+NSYV GA  N   G IT FP
Sbjct  595  GQTNVVERLQKSQLPVYVELFQNEFVSQPYDFFSDATVEINSYVTGAGVN---GTITEFP  651

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDV  440
             TA RYRRN+CLG  E  PYM PV PG LL++++P  LPPAEAP  V T++DV
Sbjct  652  FTAARYRRNKCLGSIETLPYMAPVQPGGLLEVVNPASLPPAEAPNSVFTDADV  704



>ref|XP_010675853.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Beta vulgaris subsp. vulgaris]
Length=752

 Score =   135 bits (341),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 82/119 (69%), Gaps = 3/119 (3%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
              T+VV +  + K+ VYV++  NEF+SQA+DFFSDP VE+NSYV GA     DGVIT FP
Sbjct  592  AATDVVKQFHSHKLPVYVRVLRNEFISQAYDFFSDPIVEINSYVMGAEV---DGVITDFP  648

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  422
             TA +Y+RN CL  K IP YM PV P  L+ LM+P  +PPA AP P+L  SDV E PLP
Sbjct  649  KTAAQYKRNSCLKMKNIPAYMSPVQPNQLMALMNPALMPPASAPQPLLDVSDVSESPLP  707



>ref|XP_006603452.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
3-like [Glycine max]
Length=425

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 85/123 (69%), Gaps = 4/123 (3%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            TN+V KL+ + + V+V+ FS+EFVS AWDFF+D  VE+N+Y+ GA     DG+IT FP  
Sbjct  267  TNIVPKLKIANLLVFVETFSSEFVSPAWDFFADATVEINTYIEGAQ---IDGIITNFPKI  323

Query  592  ANRYRRNRCLGYKE-IPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
             +RYRRN+CLG  +  P YM PV  G +  L++ +  PP EA +P L ES V EPPLPPV
Sbjct  324  VDRYRRNKCLGLGDNKPTYMEPVQSGGIFGLITKELFPPVEATFPPLIESKVAEPPLPPV  383

Query  415  AKI  407
            AKI
Sbjct  384  AKI  386



>ref|XP_004500131.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2-like [Cicer arietinum]
Length=704

 Score =   134 bits (336),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 85/121 (70%), Gaps = 3/121 (2%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            TN V + Q+ K+ VYV+ FSNEFVSQAWD++SD +VE+NS+V GA  N   G+IT FP T
Sbjct  587  TNTVERFQSFKLSVYVETFSNEFVSQAWDYYSDAFVEINSFVIGAKVN---GIITDFPKT  643

Query  592  ANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  413
            A RY +N+CL ++   PY  P+ PG LL+ ++  YLP    P P+L +++V EPPLP V+
Sbjct  644  AARYTKNKCLKHRNKAPYTRPIEPGKLLKQITQLYLPAPVPPLPILNDNNVTEPPLPSVS  703

Query  412  K  410
            +
Sbjct  704  R  704



>ref|XP_002888565.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH64824.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=708

 Score =   134 bits (336),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 80/104 (77%), Gaps = 3/104 (3%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            TNVV +L+ S++ VYV+LF NEFVSQ +DFF+D  VE+N+Y+ GA  +   G IT FP T
Sbjct  608  TNVVERLKKSQLTVYVELFRNEFVSQPYDFFADATVEINTYISGAGVS---GTITEFPFT  664

Query  592  ANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYP  461
            A RY+RNRCLG KEIPPYMLP+ PG LL +M+P  LPPA+AP P
Sbjct  665  AARYKRNRCLGRKEIPPYMLPIQPGGLLAIMNPLALPPAQAPNP  708



>ref|XP_010913957.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4-like 
isoform X2 [Elaeis guineensis]
Length=728

 Score =   133 bits (335),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 85/125 (68%), Gaps = 6/125 (5%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G T +V  L+++ + VYV L  NEFVSQ WDF SDP VE+N YV GA     DG+IT FP
Sbjct  568  GQTELVKTLKSAGLNVYVYLLRNEFVSQPWDFLSDPTVEINQYVQGAGV---DGIITDFP  624

Query  598  ATANRYRRNRC--LGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPL  425
             TA  Y+RN C  LG K  P YMLPV  G LL LM+P+ LPPA AP PVL  SDVVEPPL
Sbjct  625  GTATVYKRNACSKLGDKA-PTYMLPVQVGDLLGLMAPEALPPALAPMPVLEVSDVVEPPL  683

Query  424  PPVAK  410
            PP ++
Sbjct  684  PPASQ  688



>ref|XP_010913956.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4-like 
isoform X1 [Elaeis guineensis]
Length=763

 Score =   133 bits (335),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 85/125 (68%), Gaps = 6/125 (5%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G T +V  L+++ + VYV L  NEFVSQ WDF SDP VE+N YV GA     DG+IT FP
Sbjct  603  GQTELVKTLKSAGLNVYVYLLRNEFVSQPWDFLSDPTVEINQYVQGAGV---DGIITDFP  659

Query  598  ATANRYRRNRC--LGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPL  425
             TA  Y+RN C  LG K  P YMLPV  G LL LM+P+ LPPA AP PVL  SDVVEPPL
Sbjct  660  GTATVYKRNACSKLGDKA-PTYMLPVQVGDLLGLMAPEALPPALAPMPVLEVSDVVEPPL  718

Query  424  PPVAK  410
            PP ++
Sbjct  719  PPASQ  723



>ref|XP_007142367.1| hypothetical protein PHAVU_008G274300g [Phaseolus vulgaris]
 gb|ESW14361.1| hypothetical protein PHAVU_008G274300g [Phaseolus vulgaris]
Length=753

 Score =   132 bits (332),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 90/125 (72%), Gaps = 2/125 (2%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G T  V KL A+K+ V+V+ FSNEFVSQAWDF SD  VE+NSY+  A     DG+IT FP
Sbjct  590  GTTKTVPKLNAAKLSVFVETFSNEFVSQAWDFLSDATVEINSYL-NAEGIKIDGIITDFP  648

Query  598  ATANRYRRNRCLGYKEIPP-YMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  422
             TA+RYRRN+CL   +  P YM PV PG L  L+SP +LPPAEAP P LTES+V EP LP
Sbjct  649  KTADRYRRNKCLNLGDKKPTYMDPVQPGGLFGLISPDFLPPAEAPLPPLTESEVAEPALP  708

Query  421  PVAKI  407
            PVAKI
Sbjct  709  PVAKI  713



>ref|XP_004491451.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Cicer arietinum]
Length=762

 Score =   131 bits (330),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 77/122 (63%), Positives = 88/122 (72%), Gaps = 4/122 (3%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G TN V KLQAS + V+V+ FSNEFVSQAWDFFSD  VE+NSY+ GA     DGVIT FP
Sbjct  600  GATNTVPKLQASNLSVFVETFSNEFVSQAWDFFSDSTVEINSYIQGAG---IDGVITDFP  656

Query  598  ATANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  422
             TA+RY RN+CL   K  PPYM  V  G L  ++SPQ LPPA AP P LT+S+VVEPPLP
Sbjct  657  KTASRYSRNKCLNLGKNTPPYMEAVETGGLYSIISPQSLPPALAPIPPLTKSEVVEPPLP  716

Query  421  PV  416
             V
Sbjct  717  SV  718



>ref|XP_010928867.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Elaeis guineensis]
Length=767

 Score =   131 bits (330),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 84/124 (68%), Gaps = 6/124 (5%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G T +V  L+++ + V+V L  NEFVSQ WDFFSDP VE+N YV GA A   DG+IT FP
Sbjct  604  GQTELVKNLKSAGLNVHVYLLMNEFVSQPWDFFSDPIVEINQYVQGAGA---DGIITDFP  660

Query  598  ATANRYRRNRC--LGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPL  425
             TA  YRRN C  LG K  P YMLPV  G LL+LM P  LPPA +P PVL  SDVVEPPL
Sbjct  661  GTATAYRRNACSKLGDKA-PNYMLPVQVGGLLELMVPDALPPALSPMPVLEVSDVVEPPL  719

Query  424  PPVA  413
             P +
Sbjct  720  MPAS  723



>ref|XP_003617676.1| Glycerophosphodiesterase-like protein [Medicago truncatula]
 gb|AET00635.1| glycerophosphoryl diester phosphodiesterase family protein [Medicago 
truncatula]
Length=754

 Score =   130 bits (328),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 91/123 (74%), Gaps = 4/123 (3%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            TN+V KLQASK+ V+V+ FSNEFVSQA+DFFSD  VE+NS++ GA  N   GVIT FP T
Sbjct  595  TNIVEKLQASKLSVFVETFSNEFVSQAFDFFSDSTVEINSFIQGAGIN---GVITDFPKT  651

Query  592  ANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
            A+RY RN+CL      PPYM PV  GSL  ++S   LPPA AP P LT+ +VVEPPLPPV
Sbjct  652  AHRYSRNKCLNLGNSTPPYMQPVEAGSLFGVISNTSLPPAMAPLPPLTKDEVVEPPLPPV  711

Query  415  AKI  407
            AKI
Sbjct  712  AKI  714



>ref|XP_008782908.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Phoenix dactylifera]
Length=767

 Score =   130 bits (328),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 84/122 (69%), Gaps = 6/122 (5%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            T +V KL+++ + VYV L  NEFVSQ WDFFSDP VE+N YV GA     DG+IT FP T
Sbjct  606  TELVNKLKSAGLNVYVYLLMNEFVSQPWDFFSDPIVEINQYVQGAYV---DGIITDFPGT  662

Query  592  ANRYRRNRC--LGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
            A  Y+RN C  LG K  P YMLPV  G LL LM+P+ LPPA AP PVL  SDVVEPPL P
Sbjct  663  AAAYKRNACSKLGDKA-PNYMLPVQVGGLLGLMTPEALPPALAPMPVLEASDVVEPPLMP  721

Query  418  VA  413
             +
Sbjct  722  AS  723



>gb|KJB62956.1| hypothetical protein B456_009G445400 [Gossypium raimondii]
Length=604

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 83/121 (69%), Gaps = 4/121 (3%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            TNVV +L+A+ + VYVQ FSNEF SQAWDFFSDP VE+NS+  G   N   GVIT FP T
Sbjct  444  TNVVPRLKAANLSVYVQTFSNEFTSQAWDFFSDPTVEINSFYLGGGIN---GVITDFPKT  500

Query  592  A-NRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
            +    R        +IP YM PV PGSL  L++  YLPPAEAP P LTE+DV EPPLPPV
Sbjct  501  SNRYRRNRCLNRRNQIPGYMSPVQPGSLYGLITAPYLPPAEAPNPFLTEADVNEPPLPPV  560

Query  415  A  413
            A
Sbjct  561  A  561



>ref|XP_007146559.1| hypothetical protein PHAVU_006G050800g [Phaseolus vulgaris]
 gb|ESW18553.1| hypothetical protein PHAVU_006G050800g [Phaseolus vulgaris]
Length=765

 Score =   130 bits (327),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 87/125 (70%), Gaps = 4/125 (3%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G T +V+K ++S + VYV+ FSNEFVSQ WDF SD YVE+N++V  A     DGVIT FP
Sbjct  603  GSTKIVSKFKSSNLSVYVETFSNEFVSQDWDFMSDAYVEINTFVQDA---EIDGVITDFP  659

Query  598  ATANRYRRNRCLGYKE-IPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  422
             TANRYRRN+CL   E  P YM PV  G LLQ M    LPPA AP P LTE +V EPPLP
Sbjct  660  KTANRYRRNKCLNLGEKTPAYMEPVAVGGLLQAMDKSLLPPAMAPAPPLTEDEVTEPPLP  719

Query  421  PVAKI  407
            P++KI
Sbjct  720  PLSKI  724



>ref|XP_008798764.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 isoform X2 [Phoenix dactylifera]
Length=651

 Score =   129 bits (325),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 83/125 (66%), Gaps = 6/125 (5%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G T +V KL+++ + VYV L  NEFVSQ WDF SDP  E+N YV  A     DG+IT FP
Sbjct  493  GQTELVKKLKSAGLNVYVYLLRNEFVSQPWDFLSDPTAEINQYVQDAGV---DGIITDFP  549

Query  598  ATANRYRRNRC--LGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPL  425
             TA  Y+RN C  LG K  P YM+PV  G LL LM+P+ LPPA AP PVL  SDV EPPL
Sbjct  550  GTATAYKRNACSKLGDKA-PKYMVPVHVGDLLGLMAPESLPPALAPMPVLEVSDVAEPPL  608

Query  424  PPVAK  410
            PP ++
Sbjct  609  PPASR  613



>ref|XP_009399679.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Musa acuminata subsp. malaccensis]
Length=772

 Score =   130 bits (327),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 83/124 (67%), Gaps = 6/124 (5%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G T +V KLQ++   VYV LF NEFVSQ WDF SDP VE+N YV GA+    DG+IT +P
Sbjct  611  GQTKLVQKLQSAGFAVYVYLFRNEFVSQPWDFLSDPTVEINMYVQGAAV---DGIITEYP  667

Query  598  ATANRYRRNRC--LGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPL  425
             TA  YRRN C  LG  + P YM PV  G LLQ+M PQ LPP  AP P L  +DVVEPPL
Sbjct  668  GTAAAYRRNTCSKLG-DQAPSYMSPVPIGGLLQIMDPQALPPTLAPMPSLHAADVVEPPL  726

Query  424  PPVA  413
            P V+
Sbjct  727  PAVS  730



>ref|XP_008798763.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 isoform X1 [Phoenix dactylifera]
Length=763

 Score =   129 bits (325),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 83/125 (66%), Gaps = 6/125 (5%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G T +V KL+++ + VYV L  NEFVSQ WDF SDP  E+N YV  A     DG+IT FP
Sbjct  605  GQTELVKKLKSAGLNVYVYLLRNEFVSQPWDFLSDPTAEINQYVQDAGV---DGIITDFP  661

Query  598  ATANRYRRNRC--LGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPL  425
             TA  Y+RN C  LG K  P YM+PV  G LL LM+P+ LPPA AP PVL  SDV EPPL
Sbjct  662  GTATAYKRNACSKLGDKA-PKYMVPVHVGDLLGLMAPESLPPALAPMPVLEVSDVAEPPL  720

Query  424  PPVAK  410
            PP ++
Sbjct  721  PPASR  725



>ref|XP_009390640.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Musa acuminata subsp. malaccensis]
Length=755

 Score =   129 bits (325),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 83/122 (68%), Gaps = 6/122 (5%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            T +V KLQA+ + VYV +  NEFVSQ WDF SD  VE+N+YV GA     DG+IT FP T
Sbjct  595  TGLVPKLQAAGLDVYVYVLLNEFVSQPWDFLSDATVEINAYVVGAGV---DGIITDFPRT  651

Query  592  ANRYRRNRC--LGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
            A+RY+RN C  LG K+ P YMLP+  G LL LM+P   PPA AP PVL  SDVVEPP P 
Sbjct  652  ASRYKRNSCSKLGSKK-PNYMLPIEAGQLLPLMAPAVQPPALAPMPVLNASDVVEPPFPQ  710

Query  418  VA  413
            V 
Sbjct  711  VT  712



>gb|KJB62955.1| hypothetical protein B456_009G445400 [Gossypium raimondii]
Length=760

 Score =   129 bits (324),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 83/121 (69%), Gaps = 4/121 (3%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            TNVV +L+A+ + VYVQ FSNEF SQAWDFFSDP VE+NS+  G   N   GVIT FP T
Sbjct  600  TNVVPRLKAANLSVYVQTFSNEFTSQAWDFFSDPTVEINSFYLGGGIN---GVITDFPKT  656

Query  592  A-NRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
            +    R        +IP YM PV PGSL  L++  YLPPAEAP P LTE+DV EPPLPPV
Sbjct  657  SNRYRRNRCLNRRNQIPGYMSPVQPGSLYGLITAPYLPPAEAPNPFLTEADVNEPPLPPV  716

Query  415  A  413
            A
Sbjct  717  A  717



>ref|XP_007146552.1| hypothetical protein PHAVU_006G050300g [Phaseolus vulgaris]
 gb|ESW18546.1| hypothetical protein PHAVU_006G050300g [Phaseolus vulgaris]
Length=714

 Score =   127 bits (320),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 85/120 (71%), Gaps = 3/120 (3%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            TN+VAKL++ K++VYV+ FSNEFVSQAWD++SD  +E+NS+V G   N   G+IT FP T
Sbjct  592  TNIVAKLKSFKLRVYVETFSNEFVSQAWDYYSDASIEINSFVIGTKVN---GIITDFPKT  648

Query  592  ANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  413
            ANRYRRN CL      PYM P+ PG L Q +S  +LPP   P PVL +S+V E PLP V+
Sbjct  649  ANRYRRNLCLKNVNKAPYMSPIEPGKLYQQISDFFLPPLPPPPPVLIDSNVTEAPLPSVS  708



>ref|XP_011013351.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Populus euphratica]
Length=753

 Score =   128 bits (321),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 87/118 (74%), Gaps = 4/118 (3%)
 Frame = -1

Query  775  VTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPA  596
            VTNVV KL    + VYV+ FSNEFVSQAWDFFSD  VE+NSYV G +     GVIT FP 
Sbjct  594  VTNVVPKLILHGLSVYVETFSNEFVSQAWDFFSDSTVEINSYVMGVN---ISGVITEFPL  650

Query  595  TANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  422
            T+ RY+RNRCLG  ++PPYM P  PGSL++L+SP  +PPAE P PVLT SDV E PLP
Sbjct  651  TSARYKRNRCLG-SDLPPYMSPAQPGSLMELISPAAMPPAEPPNPVLTASDVTEGPLP  707



>ref|XP_010913178.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4 isoform 
X2 [Elaeis guineensis]
Length=674

 Score =   127 bits (319),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/122 (57%), Positives = 82/122 (67%), Gaps = 6/122 (5%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            T++V KL    + VYV L  NEFVSQ WDFFSD  V++NS+  GA     DG+IT FP T
Sbjct  515  TDIVNKLHKHNLSVYVYLLQNEFVSQPWDFFSDATVQINSFFKGAEV---DGIITDFPGT  571

Query  592  ANRYRRNRC--LGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
            A  Y+RN C  LG + +P +M PV PG+LLQL+     PPA AP PVL  SDVVEPPLPP
Sbjct  572  ARTYKRNSCRNLGSR-MPVFMEPVEPGALLQLIPAASQPPALAPMPVLNVSDVVEPPLPP  630

Query  418  VA  413
            VA
Sbjct  631  VA  632



>ref|XP_010913177.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3 isoform 
X1 [Elaeis guineensis]
Length=759

 Score =   127 bits (318),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 69/122 (57%), Positives = 82/122 (67%), Gaps = 6/122 (5%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            T++V KL    + VYV L  NEFVSQ WDFFSD  V++NS+  GA     DG+IT FP T
Sbjct  600  TDIVNKLHKHNLSVYVYLLQNEFVSQPWDFFSDATVQINSFFKGAEV---DGIITDFPGT  656

Query  592  ANRYRRNRC--LGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
            A  Y+RN C  LG + +P +M PV PG+LLQL+     PPA AP PVL  SDVVEPPLPP
Sbjct  657  ARTYKRNSCRNLGSR-MPVFMEPVEPGALLQLIPAASQPPALAPMPVLNVSDVVEPPLPP  715

Query  418  VA  413
            VA
Sbjct  716  VA  717



>ref|XP_004499801.1| PREDICTED: LOW QUALITY PROTEIN: probable glycerophosphoryl diester 
phosphodiesterase 3-like [Cicer arietinum]
Length=763

 Score =   126 bits (316),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 89/123 (72%), Gaps = 6/123 (5%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G TN V KL+AS + V+V+ FSNEFVSQAWDFFSD  VE+NS++ GA     DGVIT FP
Sbjct  601  GATNTVPKLKASNLSVFVETFSNEFVSQAWDFFSDSTVEINSFIQGAG---IDGVITDFP  657

Query  598  ATANRYRRNRC--LGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPL  425
             TA+RY RN+C  LG K  PPYM  V  G L  ++SPQ LPPA AP P LT+S+VVEPPL
Sbjct  658  KTASRYSRNKCXNLG-KNTPPYMEAVETGGLYSIISPQSLPPALAPIPPLTKSEVVEPPL  716

Query  424  PPV  416
            P V
Sbjct  717  PSV  719



>gb|KHN28413.1| Putative glycerophosphoryl diester phosphodiesterase 1 [Glycine 
soja]
Length=761

 Score =   125 bits (313),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 85/125 (68%), Gaps = 4/125 (3%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G T +V K ++S + VYV+ FSNEFVS AWDF SD  VE+N++V  A     DGVIT FP
Sbjct  599  GSTKIVPKFKSSNISVYVETFSNEFVSSAWDFLSDSTVEINTFVQDAE---IDGVITDFP  655

Query  598  ATANRYRRNRCLGYKE-IPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  422
             TANRYRRN+CL   E  PPYM PV  G L + ++   LPPA AP P LTE +V EPPLP
Sbjct  656  KTANRYRRNKCLNLGENTPPYMKPVQVGGLFKQIAKYSLPPAVAPAPALTEDEVTEPPLP  715

Query  421  PVAKI  407
             V+KI
Sbjct  716  SVSKI  720



>emb|CDY14478.1| BnaC03g21170D [Brassica napus]
Length=1314

 Score =   125 bits (313),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 80/112 (71%), Gaps = 6/112 (5%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            TNVV KLQ S + VYV+LF NEFVSQ +DFF+DP VE+NSY+ GA      G I  FP T
Sbjct  633  TNVVKKLQKSWLPVYVELFQNEFVSQPYDFFADPTVEINSYITGAG---ISGTIIEFPFT  689

Query  592  ANRYRRNRCLGYKE-IPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDV  440
            A RY+RNRCLG KE +PPYM PV PG LL  ++ +  PPA+AP PV TE DV
Sbjct  690  AARYKRNRCLGTKEPLPPYMSPVLPGGLLPFLNAK--PPAQAPNPVFTEEDV  739



>gb|KHM99500.1| Putative glycerophosphoryl diester phosphodiesterase 1 [Glycine 
soja]
Length=761

 Score =   123 bits (309),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 86/125 (69%), Gaps = 4/125 (3%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G T +V K ++S + VYV+ F NEFVSQAWDF SD  VE+N++V  A     DGVIT FP
Sbjct  599  GSTKIVPKFKSSNLSVYVETFRNEFVSQAWDFMSDATVEINTFVQDAE---IDGVITDFP  655

Query  598  ATANRYRRNRCLGYKEI-PPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  422
             TANRYRRNRCL   +  PPYM PV  GSLL  M    LPPA AP P LTE+ V EPPLP
Sbjct  656  KTANRYRRNRCLSLGDSKPPYMEPVRVGSLLLAMDKYSLPPALAPAPPLTEAKVTEPPLP  715

Query  421  PVAKI  407
            P++KI
Sbjct  716  PLSKI  720



>ref|XP_003553031.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2-like [Glycine max]
Length=722

 Score =   122 bits (307),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 87/120 (73%), Gaps = 3/120 (3%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            TN+VA+L++ K+ V+V+ FSNEFVSQAWD++SDP +E+NS+V G   N   G+IT FP T
Sbjct  589  TNIVARLKSFKLPVFVETFSNEFVSQAWDYYSDPSIEINSFVIGTKVN---GIITDFPKT  645

Query  592  ANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  413
            ANRYRRN CL +    PYM P+ PG L + +S  YLPP   P P+LT+S+V E PLP V+
Sbjct  646  ANRYRRNLCLKHGNEAPYMSPIEPGKLFKQISNLYLPPLPPPLPILTDSNVTEAPLPGVS  705



>gb|KHN28414.1| Putative glycerophosphoryl diester phosphodiesterase 2 [Glycine 
soja]
Length=709

 Score =   122 bits (307),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 87/120 (73%), Gaps = 3/120 (3%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            TN+VA+L++ K+ V+V+ FSNEFVSQAWD++SDP +E+NS+V G   N   G+IT FP T
Sbjct  576  TNIVARLKSFKLPVFVETFSNEFVSQAWDYYSDPSIEINSFVIGTKVN---GIITDFPKT  632

Query  592  ANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  413
            ANRYRRN CL +    PYM P+ PG L + +S  YLPP   P P+LT+S+V E PLP V+
Sbjct  633  ANRYRRNLCLKHGNEAPYMSPIEPGKLFKQISNLYLPPLPPPLPILTDSNVTEAPLPGVS  692



>ref|XP_002862842.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH39100.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=719

 Score =   122 bits (305),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 84/119 (71%), Gaps = 9/119 (8%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            TNVV+KL++S ++VYV+ FSNEFV+QA+DF+ DP +E++S+V        DG+IT FPAT
Sbjct  584  TNVVSKLKSSGLRVYVERFSNEFVTQAFDFYEDPTLEIDSFVRDIQ---IDGIITDFPAT  640

Query  592  ANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
              RYR+N+C G      ++LP   G L    +P  LPPAEAPYP+L +SDV EPPLP V
Sbjct  641  TARYRKNQCYG-----KFVLP-ETGELRTFGNPLLLPPAEAPYPLLGDSDVTEPPLPEV  693



>emb|CDX86766.1| BnaA09g21560D [Brassica napus]
Length=633

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 77/122 (63%), Gaps = 9/122 (7%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G T++V KL    + VYV+ F NEFVSQ WDFFSD  VE+N+YV GA  N   G IT FP
Sbjct  472  GQTHLVEKLHKFNLPVYVKTFRNEFVSQPWDFFSDATVEINTYVAGAGVN---GTITEFP  528

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
             TA RY+RNRCL  K+ PPYM  V P  LL  ++       ++P+P  T  DV EPPLPP
Sbjct  529  LTAARYKRNRCLTRKDHPPYMPLVKPAGLLGFVN------HDSPHPAFTADDVTEPPLPP  582

Query  418  VA  413
            V 
Sbjct  583  VT  584



>ref|XP_006300798.1| hypothetical protein CARUB_v10019878mg [Capsella rubella]
 gb|EOA33696.1| hypothetical protein CARUB_v10019878mg [Capsella rubella]
Length=678

 Score =   121 bits (304),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 73/95 (77%), Gaps = 3/95 (3%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            TNVV +LQ S++ VYV+LF NEFV+QA+DFF+D  VE+N+Y +GAS N   G IT FP T
Sbjct  587  TNVVERLQKSQLPVYVELFQNEFVAQAYDFFADATVEINTYTYGASIN---GTITEFPFT  643

Query  592  ANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQY  488
            A RY+RNRCLG  +IP YMLP+ PG LL ++SP +
Sbjct  644  AARYKRNRCLGRDKIPQYMLPIQPGGLLDIVSPLF  678



>gb|AES70468.2| glycerophosphoryl diester phosphodiesterase family protein [Medicago 
truncatula]
Length=717

 Score =   121 bits (304),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 86/120 (72%), Gaps = 3/120 (3%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            TN VA+LQ+ K+ VYV+ FSNEFVSQAWD++SDP VE+NS+V GA  N   G+IT FP T
Sbjct  591  TNTVARLQSFKLPVYVETFSNEFVSQAWDYYSDPSVEINSFVVGAKVN---GIITDFPKT  647

Query  592  ANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  413
            A RY +NRCL + +  PY+ P+ PG LL+ +    LPP   P PVL +S+V EPPLP V+
Sbjct  648  AVRYTKNRCLKHAKKAPYISPIPPGKLLKHIPKLDLPPPTPPLPVLNDSNVTEPPLPSVS  707



>ref|XP_006300799.1| hypothetical protein CARUB_v10019878mg [Capsella rubella]
 gb|EOA33697.1| hypothetical protein CARUB_v10019878mg [Capsella rubella]
Length=701

 Score =   121 bits (304),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 73/95 (77%), Gaps = 3/95 (3%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            TNVV +LQ S++ VYV+LF NEFV+QA+DFF+D  VE+N+Y +GAS N   G IT FP T
Sbjct  610  TNVVERLQKSQLPVYVELFQNEFVAQAYDFFADATVEINTYTYGASIN---GTITEFPFT  666

Query  592  ANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQY  488
            A RY+RNRCLG  +IP YMLP+ PG LL ++SP +
Sbjct  667  AARYKRNRCLGRDKIPQYMLPIQPGGLLDIVSPLF  701



>ref|XP_003530777.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Glycine max]
Length=761

 Score =   121 bits (304),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 85/124 (69%), Gaps = 4/124 (3%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G T +V K ++S + VYV+ F NEFVSQAWDF SD  VE+N++V  A     DGVIT FP
Sbjct  599  GSTKIVPKFKSSNLSVYVETFRNEFVSQAWDFMSDATVEINTFVQDAE---IDGVITDFP  655

Query  598  ATANRYRRNRCLGYKEI-PPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  422
             TANRYRRNRCL   +  PPYM PV  GSLL  M    LPPA AP P LTE+ V EPPLP
Sbjct  656  KTANRYRRNRCLSLGDSKPPYMEPVRVGSLLLAMDKYSLPPALAPAPPLTEAKVTEPPLP  715

Query  421  PVAK  410
            P++K
Sbjct  716  PLSK  719



>emb|CDX82242.1| BnaA03g35790D [Brassica napus]
Length=443

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 83/119 (70%), Gaps = 9/119 (8%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            T+VVA+L+AS  +VYV+ FSNEFV+Q +D FSD  VE+N +V G      DG+IT FPAT
Sbjct  300  TDVVARLKASGFRVYVETFSNEFVTQPFDLFSDSTVEINFFVQGV---KIDGIITDFPAT  356

Query  592  ANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
              RYR+++C  Y+E+  +      G LL   +P+ L PA+APYP+L ESDV+EPPLP V
Sbjct  357  TARYRKSQC--YREMGMFR----TGELLPFANPRLLSPAQAPYPLLVESDVMEPPLPDV  409



>ref|XP_003600217.1| Glycerophosphodiesterase-like protein [Medicago truncatula]
Length=740

 Score =   121 bits (304),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 86/120 (72%), Gaps = 3/120 (3%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            TN VA+LQ+ K+ VYV+ FSNEFVSQAWD++SDP VE+NS+V GA  N   G+IT FP T
Sbjct  614  TNTVARLQSFKLPVYVETFSNEFVSQAWDYYSDPSVEINSFVVGAKVN---GIITDFPKT  670

Query  592  ANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  413
            A RY +NRCL + +  PY+ P+ PG LL+ +    LPP   P PVL +S+V EPPLP V+
Sbjct  671  AVRYTKNRCLKHAKKAPYISPIPPGKLLKHIPKLDLPPPTPPLPVLNDSNVTEPPLPSVS  730



>gb|ACF74306.1| putative glycerophosphoryl diesterphosphodiesterase 2 precursor 
[Arachis hypogaea]
Length=191

 Score =   114 bits (284),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 79/114 (69%), Gaps = 4/114 (4%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            TN+V  L  + + VY Q FSNEFVSQAWDFFSDP VE+N++V        DGVIT FP T
Sbjct  30   TNIVTTLHHANLSVYAQTFSNEFVSQAWDFFSDPTVEINTFV---QEGLVDGVITDFPKT  86

Query  592  ANRYRRNRCLGYKE-IPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVE  434
            A+RYRRN+CL   + +P YMLPV  G LLQ ++  YLPPA AP P L ES+V E
Sbjct  87   ADRYRRNKCLTMGDNMPVYMLPVQIGGLLQAVTKDYLPPASAPLPPLKESEVKE  140



>ref|XP_010545539.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL5 [Tarenaya 
hassleriana]
Length=732

 Score =   120 bits (300),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 80/119 (67%), Gaps = 9/119 (8%)
 Frame = -1

Query  766  VVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATAN  587
            VV  L++ K++VYV+ FSNEFVSQA DFFSD  VE+NS+V   +    DG+IT FPATA 
Sbjct  593  VVKMLKSHKLRVYVETFSNEFVSQAQDFFSDTTVEINSFV---NEMGIDGLITDFPATAA  649

Query  586  RYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAK  410
            R+RR RC         ++P G   LL L + + LPPA+APYP L ESD+ EPPLP V +
Sbjct  650  RFRRKRC------DMSLVPTGREKLLDLANEKSLPPAQAPYPSLKESDIDEPPLPDVIQ  702



>emb|CDY58867.1| BnaC09g52640D [Brassica napus]
Length=722

 Score =   119 bits (298),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 63/122 (52%), Positives = 77/122 (63%), Gaps = 9/122 (7%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G T++V KL    + VYV+ F NEFVSQ WDFFSD  VE+N+YV GA  +   G IT FP
Sbjct  561  GQTHLVEKLHKFNLPVYVKTFRNEFVSQPWDFFSDATVEINTYVAGAGVS---GTITEFP  617

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
             TA RY+RNRCL  K+ PPYM  V P  LL  ++       ++P+P  T  DV EPPLPP
Sbjct  618  LTAARYKRNRCLTRKDHPPYMPLVKPAGLLGFVN------HDSPHPAFTADDVTEPPLPP  671

Query  418  VA  413
            V 
Sbjct  672  VT  673



>gb|KHM99502.1| Putative glycerophosphoryl diester phosphodiesterase 2 [Glycine 
soja]
Length=727

 Score =   119 bits (297),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 84/120 (70%), Gaps = 3/120 (3%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            TN VA+L++ K+ VYV+ FSNEFVSQAWD++SDP +E+NS+V G   N   G+IT FP T
Sbjct  589  TNTVARLKSFKLPVYVETFSNEFVSQAWDYYSDPSIEINSFVIGTKVN---GIITDFPKT  645

Query  592  ANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  413
            ANRYRRN CL      PY  P+ PG L + +S  YLPP   P PVLT+S+V E PLP V+
Sbjct  646  ANRYRRNLCLKNGNKEPYRSPIEPGKLFKQISNLYLPPLPPPLPVLTDSNVTEAPLPGVS  705



>ref|XP_003530776.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2-like [Glycine max]
Length=727

 Score =   119 bits (297),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 84/120 (70%), Gaps = 3/120 (3%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            TN VA+L++ K+ VYV+ FSNEFVSQAWD++SDP +E+NS+V G   N   G+IT FP T
Sbjct  589  TNTVARLKSFKLPVYVETFSNEFVSQAWDYYSDPSIEINSFVIGTKVN---GIITDFPKT  645

Query  592  ANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  413
            ANRYRRN CL      PY  P+ PG L + +S  YLPP   P PVLT+S+V E PLP V+
Sbjct  646  ANRYRRNLCLKNGNKEPYRSPIEPGKLFKQISNLYLPPLPPPLPVLTDSNVTEAPLPGVS  705



>ref|XP_006586115.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like isoform X2 [Glycine max]
Length=666

 Score =   118 bits (296),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 86/125 (69%), Gaps = 4/125 (3%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G T +V K ++S + VYV+ FSNEFVSQAWDF SD  VE+N++V  A     DGVIT FP
Sbjct  503  GSTKIVPKFKSSNLTVYVETFSNEFVSQAWDFMSDATVEINTFVKDAG---IDGVITDFP  559

Query  598  ATANRYRRNRCLGYKE-IPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  422
             TANRYRRNRCL   +  PPYM PV    LL  +    LPPA AP P LTE++V EPPLP
Sbjct  560  KTANRYRRNRCLNLGDRKPPYMKPVQLPGLLSKIDNFSLPPALAPVPPLTEAEVTEPPLP  619

Query  421  PVAKI  407
            P++KI
Sbjct  620  PLSKI  624



>ref|XP_008806340.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Phoenix dactylifera]
Length=808

 Score =   119 bits (297),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 80/122 (66%), Gaps = 6/122 (5%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            T++V K     + VYV L  NEFVSQ WD+FSDP V++NS+V GA     DG+IT FP T
Sbjct  648  TDIVNKFHRYNLSVYVYLLQNEFVSQPWDYFSDPIVQINSFVEGAKV---DGIITDFPRT  704

Query  592  ANRYRRNRC--LGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
            A  Y+RN C  LG K  P +M PV  G LLQL+     PPA AP PVL  S+VVEPPLPP
Sbjct  705  ARAYKRNSCRNLGPKA-PVFMEPVEAGDLLQLIPFAAQPPALAPMPVLNVSNVVEPPLPP  763

Query  418  VA  413
            VA
Sbjct  764  VA  765



>ref|XP_003530778.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like isoform X1 [Glycine max]
Length=761

 Score =   118 bits (296),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 86/125 (69%), Gaps = 4/125 (3%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G T +V K ++S + VYV+ FSNEFVSQAWDF SD  VE+N++V  A     DGVIT FP
Sbjct  598  GSTKIVPKFKSSNLTVYVETFSNEFVSQAWDFMSDATVEINTFVKDAG---IDGVITDFP  654

Query  598  ATANRYRRNRCLGYKE-IPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  422
             TANRYRRNRCL   +  PPYM PV    LL  +    LPPA AP P LTE++V EPPLP
Sbjct  655  KTANRYRRNRCLNLGDRKPPYMKPVQLPGLLSKIDNFSLPPALAPVPPLTEAEVTEPPLP  714

Query  421  PVAKI  407
            P++KI
Sbjct  715  PLSKI  719



>emb|CDY29432.1| BnaC05g32380D, partial [Brassica napus]
Length=596

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/119 (49%), Positives = 83/119 (70%), Gaps = 8/119 (7%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            T+VV +L++S ++VYV+ FSNEF++Q +DFFSDP VE++ +V   + N  DG+IT FPAT
Sbjct  444  TDVVPRLRSSGLRVYVETFSNEFITQPYDFFSDPTVEIDYFV--RADNEIDGIITDFPAT  501

Query  592  ANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
             +RY +N+C    E       +  G L+ L +P+ L PAEAPYP+L +S+V EPPLP V
Sbjct  502  TSRYIKNQCYSKME------QIRTGELVSLANPEILSPAEAPYPLLLDSNVTEPPLPEV  554



>gb|EMS66577.1| putative glycerophosphoryl diester phosphodiesterase 1 [Triticum 
urartu]
Length=1368

 Score =   119 bits (297),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 61/124 (49%), Positives = 82/124 (66%), Gaps = 8/124 (6%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            T++V  L+++ + VY Q+F NEF+SQ WDFFSD  VE+NSY   A +   DG+IT FP T
Sbjct  611  TSLVKDLRSAGLTVYAQVFRNEFLSQPWDFFSDETVEINSY---AQSLKVDGLITDFPKT  667

Query  592  ANRYRRNRCLGYKEIPPYMLPVGPGSLLQLM----SPQYLPPAEAPYPVLTESDVVEPPL  425
              RY+RN C G K+ P YM  V  G L+QL+    +P+  PPA AP   L E++V++PP 
Sbjct  668  VRRYKRNSCTG-KDKPAYMETVDVGGLVQLLQRNAAPEAQPPAVAPMRELNETEVLQPPF  726

Query  424  PPVA  413
            PPVA
Sbjct  727  PPVA  730



>ref|XP_002523503.1| glycerophosphoryl diester phosphodiesterase, putative [Ricinus 
communis]
 gb|EEF38842.1| glycerophosphoryl diester phosphodiesterase, putative [Ricinus 
communis]
Length=753

 Score =   118 bits (295),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 85/124 (69%), Gaps = 6/124 (5%)
 Frame = -1

Query  775  VTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPA  596
             TNVV ++ A+ + VYV L  NEF +  +DFFSDP VE+ +Y+ G  A   DG+IT +PA
Sbjct  590  TTNVVHEMHAANLTVYVSLLRNEFATLPFDFFSDPTVEIATYIAGLEA---DGIITEYPA  646

Query  595  TANRYRRNRC--LGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  422
            TA+RY RN C  L Y ++P  +LP+ P  LLQ ++ + LPPA AP PVL  +DVV+PPLP
Sbjct  647  TASRYLRNVCSNLNY-DLPFTVLPIEPPLLLQFINSEMLPPAAAPSPVLDVADVVDPPLP  705

Query  421  PVAK  410
             VAK
Sbjct  706  AVAK  709



>ref|XP_006297062.1| hypothetical protein CARUB_v10013062mg [Capsella rubella]
 gb|EOA29960.1| hypothetical protein CARUB_v10013062mg [Capsella rubella]
Length=729

 Score =   116 bits (291),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 58/118 (49%), Positives = 80/118 (68%), Gaps = 9/118 (8%)
 Frame = -1

Query  769  NVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATA  590
            +V  +L+ S ++VYV+ FSNEF+SQ +DFFSDP +E++ +V G      DG+IT FPAT 
Sbjct  585  DVTQRLKNSGLRVYVETFSNEFISQPFDFFSDPTLEIDCFVKGI---KIDGIITDFPATT  641

Query  589  NRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
             RYR+N+C  Y ++ P    VG G L+   +P +  PA+APYP L +SDV EPPLP V
Sbjct  642  ARYRKNQC--YSKLNP----VGTGELITFGNPMFFGPAKAPYPFLNDSDVTEPPLPEV  693



>ref|XP_002883252.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH59511.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=731

 Score =   116 bits (290),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 79/118 (67%), Gaps = 9/118 (8%)
 Frame = -1

Query  769  NVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATA  590
            NVV+KL++S ++VYV+ FSNEFV+Q +DF+ DP +E++ +V        DG+IT FPAT 
Sbjct  587  NVVSKLKSSGLRVYVETFSNEFVTQEYDFYEDPTLEIDCFVRDIQV---DGIITDFPATT  643

Query  589  NRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
             RYR+N+C G  ++P        G L  L +P  L PAEAPYP+L  SDV EPPLP V
Sbjct  644  ARYRKNQCYGKFDLP------DTGELRTLGNPMILAPAEAPYPLLRISDVTEPPLPEV  695



>ref|XP_010675854.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Beta vulgaris subsp. vulgaris]
Length=764

 Score =   115 bits (289),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 80/120 (67%), Gaps = 3/120 (3%)
 Frame = -1

Query  775  VTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPA  596
            +TNVV++ QA ++ VYVQ+ SNEF S  +D FSDP V++N++V  A+     GVIT FP 
Sbjct  606  LTNVVSQFQAFELPVYVQVLSNEFSSIPFDAFSDPVVQINTFVHAANVT---GVITDFPR  662

Query  595  TANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
            TA+ YRRN CL     P YM+P  PG+L+ ++ P   PPA +P PVLT  DV +PPL  V
Sbjct  663  TADAYRRNVCLNMNNTPAYMMPAQPGALIGILPPGASPPAGSPTPVLTVDDVSQPPLTSV  722



>ref|NP_001053060.1| Os04g0472300 [Oryza sativa Japonica Group]
 emb|CAE02867.2| OSJNBb0022F23.4 [Oryza sativa Japonica Group]
 dbj|BAF14974.1| Os04g0472300 [Oryza sativa Japonica Group]
 dbj|BAG91894.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE61172.1| hypothetical protein OsJ_15144 [Oryza sativa Japonica Group]
Length=740

 Score =   115 bits (289),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 76/119 (64%), Gaps = 4/119 (3%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            TN+V  LQ + + VYV    NEF SQ +DFFSD   ++N+YV GA  N   GVIT FPAT
Sbjct  592  TNLVESLQNAGLPVYVYTLMNEFASQPYDFFSDATAQINAYVQGAGVN---GVITDFPAT  648

Query  592  ANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
            A RY+ N C+      P +M P  PG LLQ++S    PPA +P P+LT SDV EPPLPP
Sbjct  649  ARRYKLNTCMHMGNNTPSFMAPARPGDLLQIISKPAQPPAMSPMPLLTGSDVAEPPLPP  707



>emb|CAH67272.1| B0806H07.1 [Oryza sativa Indica Group]
 gb|EEC77457.1| hypothetical protein OsI_16271 [Oryza sativa Indica Group]
Length=740

 Score =   115 bits (289),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 76/119 (64%), Gaps = 4/119 (3%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            TN+V  LQ + + VYV    NEF SQ +DFFSD   ++N+YV GA  N   GVIT FPAT
Sbjct  592  TNLVESLQNAGLPVYVYTLMNEFASQPYDFFSDATAQINAYVQGAGVN---GVITDFPAT  648

Query  592  ANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
            A RY+ N C+      P +M P  PG LLQ++S    PPA +P P+LT SDV EPPLPP
Sbjct  649  ARRYKLNTCMHMGNNTPSFMAPARPGDLLQIISKPAQPPAMSPMPLLTGSDVAEPPLPP  707



>ref|XP_004975931.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Setaria italica]
Length=747

 Score =   115 bits (288),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 78/119 (66%), Gaps = 4/119 (3%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            TN+V  LQ + + VYV    NEFVSQ +DFF+D  V++N+YV GA     DG+IT FPAT
Sbjct  592  TNLVQTLQTAGLSVYVYTLMNEFVSQPYDFFADATVQINAYVKGAGV---DGLITDFPAT  648

Query  592  ANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
            A RY+ N C+      P +M P   G L+Q++S    PPA AP P+LT+SDV EPPLPP
Sbjct  649  ARRYKVNSCMNMGNSAPIFMAPPRAGDLMQIISKLAQPPALAPMPLLTDSDVAEPPLPP  707



>emb|CDY02788.1| BnaC02g11010D [Brassica napus]
Length=745

 Score =   114 bits (285),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 81/125 (65%), Gaps = 4/125 (3%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G TNVV ++    + VYV +  NE++S A+D+FSDP VEL +++ G   N  DGVIT FP
Sbjct  583  GKTNVVEEMHKGNISVYVSVLRNEYISIAFDYFSDPTVELATFIAG---NGVDGVITEFP  639

Query  598  ATANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  422
            ATA RY R+ C    +  PY +LP   G+LL + + +  PPA AP P L   DV++PPLP
Sbjct  640  ATATRYLRSPCSDLNKDQPYAILPAEAGALLSVAAKEAQPPAIAPSPPLNAKDVIDPPLP  699

Query  421  PVAKI  407
            PVAK+
Sbjct  700  PVAKM  704



>ref|XP_008242952.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Prunus mume]
Length=782

 Score =   114 bits (285),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 82/126 (65%), Gaps = 6/126 (5%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G TNVV +++A+ + VYV    NEFVS  +D+FSDP +E+ SY         DG++T FP
Sbjct  604  GKTNVVKEMKAANISVYVHWLKNEFVSLMFDYFSDPIIEIASYALEFQV---DGIVTDFP  660

Query  598  ATANRYRRNRC--LGYKEIPPY-MLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPP  428
            ATAN+Y R  C  +  K   PY +LPV PGSLL L+ P+ L PA+AP P L  S+VV+PP
Sbjct  661  ATANKYMRCPCNDMDPKATIPYPILPVEPGSLLGLVVPEALSPAQAPSPALQASNVVDPP  720

Query  427  LPPVAK  410
            LP V K
Sbjct  721  LPEVVK  726



>gb|ACF79780.1| unknown [Zea mays]
Length=379

 Score =   111 bits (277),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 77/120 (64%), Gaps = 4/120 (3%)
 Frame = -1

Query  769  NVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATA  590
             +V  LQ++ ++VYV +  NEF SQ  DFF+D   ++N+YV GA     DG+IT FP TA
Sbjct  229  KLVTSLQSAGLQVYVYVLMNEFASQPNDFFADATSQINAYVQGAK---VDGIITDFPGTA  285

Query  589  NRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVA  413
            +RY+ N C       P +M P  PGSLL  M+P   PPA AP P+LT++DV EP LPPV+
Sbjct  286  HRYKLNSCTSMGNSAPLFMQPPQPGSLLLTMAPDVQPPAAAPMPLLTDADVAEPALPPVS  345



>ref|XP_006652401.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Oryza brachyantha]
Length=745

 Score =   114 bits (284),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 74/119 (62%), Gaps = 4/119 (3%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            TN+V  L  + + VYV    NEF SQ +DFFSD   ++N+YV GA     DGVIT FPAT
Sbjct  593  TNLVESLHKAGLPVYVYTLMNEFASQPYDFFSDATAQINAYVQGAGV---DGVITDFPAT  649

Query  592  ANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
            A RY+ N C+      P +M P  PG L+Q++S    PP  AP P+LT SDV EPPLPP
Sbjct  650  ARRYKLNTCMNMGNNTPSFMAPAHPGDLMQIISKPAQPPEMAPMPLLTGSDVAEPPLPP  708



>ref|XP_007201937.1| hypothetical protein PRUPE_ppa001673mg [Prunus persica]
 gb|EMJ03136.1| hypothetical protein PRUPE_ppa001673mg [Prunus persica]
Length=782

 Score =   114 bits (284),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 62/126 (49%), Positives = 80/126 (63%), Gaps = 6/126 (5%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G TNVV +++A+ + VYV    NEFVS  +D+FSDP +E+ SYV        DG++T FP
Sbjct  604  GKTNVVKEMKAANISVYVHWLKNEFVSLMFDYFSDPIIEIASYVLDYQV---DGIVTDFP  660

Query  598  ATANRYRRNRCLGYK---EIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPP  428
            ATAN+Y R  C        IP  +LPV PGSLL L+ P+ L PA+AP P L  S+V +PP
Sbjct  661  ATANKYMRCPCNDMDPKANIPYPILPVEPGSLLGLVVPEALSPAQAPSPALQASNVADPP  720

Query  427  LPPVAK  410
            LP V K
Sbjct  721  LPEVVK  726



>gb|AAO42211.1| unknown protein [Arabidopsis thaliana]
Length=729

 Score =   113 bits (282),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 77/117 (66%), Gaps = 9/117 (8%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            TN+ +KL+++ ++VYV+ FSNE V+ A+DF+ DP +E++S+V        DG+IT FPAT
Sbjct  584  TNIASKLKSNGLRVYVERFSNECVTHAFDFYDDPTLEIDSFVRDVQ---IDGIITDFPAT  640

Query  592  ANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  422
              RYR+N+C G   +         G L+   +P  LPPAEAPYP L +SDV EPPLP
Sbjct  641  TARYRKNKCYGEFGLAT------TGELITFANPMLLPPAEAPYPALLDSDVTEPPLP  691



>emb|CDY32730.1| BnaA02g07920D [Brassica napus]
Length=745

 Score =   113 bits (283),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 80/125 (64%), Gaps = 4/125 (3%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G TNVV ++    + VYV +  NE++S A+D+FSDP VEL +++ G   N  DGVIT FP
Sbjct  583  GKTNVVEEMHKGNISVYVSVLRNEYISIAFDYFSDPTVELATFIAG---NGVDGVITEFP  639

Query  598  ATANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  422
            ATA RY R+ C    +  PY +LP   G+LL + + +  PPA AP P L   DV++PPLP
Sbjct  640  ATATRYLRSPCSDLNKDQPYAILPAEAGALLSVAAKEAQPPAIAPSPPLDAKDVIDPPLP  699

Query  421  PVAKI  407
            PVA I
Sbjct  700  PVANI  704



>ref|NP_188688.1| glycerophosphodiester phosphodiesterase-like protein [Arabidopsis 
thaliana]
 sp|F4JEQ1.1|GPDL5_ARATH RecName: Full=Glycerophosphodiester phosphodiesterase GDPDL5; 
AltName: Full=Glycerophosphodiester phosphodiesterase-like 
5; Short=ATGDPDL5; AltName: Full=Glycerophosphodiesterase-like 
4; AltName: Full=Protein SHV3-LIKE 3; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AEE76390.1| glycerophosphodiester phosphodiesterase-like protein [Arabidopsis 
thaliana]
Length=729

 Score =   113 bits (282),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 77/117 (66%), Gaps = 9/117 (8%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            TN+ +KL+++ ++VYV+ FSNE V+ A+DF+ DP +E++S+V        DG+IT FPAT
Sbjct  584  TNIASKLKSNGLRVYVERFSNECVTHAFDFYDDPTLEIDSFVRDVQ---IDGIITDFPAT  640

Query  592  ANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  422
              RYR+N+C G   +         G L+   +P  LPPAEAPYP L +SDV EPPLP
Sbjct  641  TARYRKNKCYGEFGL------TTTGELITFANPMLLPPAEAPYPALLDSDVTEPPLP  691



>ref|XP_009126795.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
3 [Brassica rapa]
Length=751

 Score =   113 bits (282),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 80/125 (64%), Gaps = 4/125 (3%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G TNVV ++    + VYV +  NE++S A+D+FSDP VEL +++ G   N  DGVIT FP
Sbjct  589  GKTNVVEEMHKGNISVYVSVLRNEYISIAFDYFSDPTVELATFIAG---NGVDGVITEFP  645

Query  598  ATANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  422
            ATA RY R+ C    +  PY +LP   G+LL + + +  PPA AP P L   DV++PPLP
Sbjct  646  ATATRYLRSPCSDLNKDQPYAILPAEAGALLSVAAKEAQPPAIAPSPPLDAKDVIDPPLP  705

Query  421  PVAKI  407
            PVA I
Sbjct  706  PVANI  710



>ref|XP_010483370.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7 [Camelina 
sativa]
Length=753

 Score =   113 bits (282),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 80/125 (64%), Gaps = 4/125 (3%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G TNVV ++    + VYV +  NE++S A+D+FSDP VEL +++ G+     DGVIT FP
Sbjct  591  GKTNVVEEMHKGNISVYVSVLRNEYISVAFDYFSDPTVELATFIAGSGV---DGVITEFP  647

Query  598  ATANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  422
            ATA RY R+ C    +  PY +LP   G+LL +   +  PPA AP P L   DV++PPLP
Sbjct  648  ATATRYLRSPCSDLNKDQPYAILPAEAGALLAVADKEAQPPASAPNPPLDAKDVIDPPLP  707

Query  421  PVAKI  407
            PVAK+
Sbjct  708  PVAKL  712



>ref|XP_006282081.1| hypothetical protein CARUB_v10028327mg [Capsella rubella]
 gb|EOA14979.1| hypothetical protein CARUB_v10028327mg [Capsella rubella]
Length=752

 Score =   113 bits (282),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 80/125 (64%), Gaps = 4/125 (3%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G TNVV ++  S + VYV +  NE++S A+D+FSDP VEL +++ G+     DGVIT FP
Sbjct  589  GKTNVVEEMHKSNISVYVSVLRNEYISIAFDYFSDPTVELATFIAGSG---VDGVITEFP  645

Query  598  ATANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  422
            ATA RY R+ C    +  PY +LP   G+LL +   +  PPA AP P L   DV++PPLP
Sbjct  646  ATATRYLRSPCSDLNKDQPYAILPAEAGALLAVADKEAQPPASAPNPPLDAKDVIDPPLP  705

Query  421  PVAKI  407
            PVA +
Sbjct  706  PVANM  710



>ref|NP_001062173.1| Os08g0503200 [Oryza sativa Japonica Group]
 dbj|BAD09276.1| putative glycerophosphoryl diester phosphodiesterase 2 precursor 
[Oryza sativa Japonica Group]
 dbj|BAF24087.1| Os08g0503200 [Oryza sativa Japonica Group]
 dbj|BAG89421.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89557.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC83836.1| hypothetical protein OsI_29787 [Oryza sativa Indica Group]
 gb|EEE68959.1| hypothetical protein OsJ_27854 [Oryza sativa Japonica Group]
Length=778

 Score =   113 bits (282),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/122 (52%), Positives = 76/122 (62%), Gaps = 5/122 (4%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            TN+V  L+++ + +Y Q+F NEFVS  WDFFSD  VE+NSYV   S N  DG+IT FP T
Sbjct  614  TNLVKDLRSAGLAIYAQVFRNEFVSPPWDFFSDVTVEINSYV--QSVN-IDGIITDFPKT  670

Query  592  ANRYRRNRCLGYK-EIPPYMLPVGPGSLLQLMS-PQYLPPAEAPYPVLTESDVVEPPLPP  419
              RY+ N C G    +P YM P   G L QL++  Q  PPA AP PVL  SDV EPP P 
Sbjct  671  VRRYKMNSCTGLGVNMPSYMNPAEIGGLAQLLNGSQAQPPALAPMPVLNSSDVTEPPFPS  730

Query  418  VA  413
             A
Sbjct  731  AA  732



>ref|XP_010483369.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL6-like 
[Camelina sativa]
Length=542

 Score =   111 bits (278),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 80/125 (64%), Gaps = 4/125 (3%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G TNVV ++  + + VYV +  NE++S A+D+FSDP VEL +++ G+     DGVIT FP
Sbjct  379  GKTNVVEEMHKANISVYVSVLRNEYISIAFDYFSDPTVELATFIAGSG---VDGVITEFP  435

Query  598  ATANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  422
            ATA RY R+ C    +  PY +LP   G+L+ +   +  PPA AP P L   DV++PPLP
Sbjct  436  ATATRYLRSPCSDLNKDQPYAILPAEAGALMAVADKEAQPPASAPNPPLDAKDVIDPPLP  495

Query  421  PVAKI  407
            PVA +
Sbjct  496  PVANM  500



>ref|XP_010446175.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL6-like, 
partial [Camelina sativa]
Length=630

 Score =   112 bits (280),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/125 (46%), Positives = 80/125 (64%), Gaps = 4/125 (3%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G TNVV ++  + + VYV +  NE++S A+D+FSDP VEL +++ G+     DGVIT FP
Sbjct  467  GKTNVVEEMHKANISVYVSVLRNEYISIAFDYFSDPTVELATFIAGSGV---DGVITEFP  523

Query  598  ATANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  422
            ATA RY R+ C    +  PY +LP   G+L+ +   +  PPA AP P L   DV++PPLP
Sbjct  524  ATATRYLRSPCSDLNKDQPYAILPAEAGALMAVADKEAQPPASAPNPPLDAKDVIDPPLP  583

Query  421  PVAKI  407
            PVA I
Sbjct  584  PVANI  588



>ref|XP_003572357.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3 [Brachypodium 
distachyon]
Length=777

 Score =   112 bits (281),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 77/125 (62%), Gaps = 8/125 (6%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            T++V  LQ++ + VYVQ+F NEFVSQ WDFFSD  VE+++YV    +   DG+IT FP T
Sbjct  617  TSLVKDLQSAGLAVYVQVFRNEFVSQPWDFFSDETVEISNYV---QSVKVDGLITDFPKT  673

Query  592  ANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMSP----QYLPPAEAPYPVLTESDVVEPP  428
              RY+RN C G   +IP YM PV  G L QL+         PPA AP P L  S VV+ P
Sbjct  674  VRRYKRNSCTGLGNDIPSYMKPVSVGDLAQLIKKYAGTNAQPPALAPMPELNSSSVVQAP  733

Query  427  LPPVA  413
             PPV 
Sbjct  734  FPPVT  738



>ref|XP_010453288.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Camelina sativa]
Length=753

 Score =   112 bits (280),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 80/125 (64%), Gaps = 4/125 (3%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G TNVV ++    + VYV +  NE++S A+D+FSDP VEL +++ G+     DGVIT FP
Sbjct  591  GKTNVVEEMHKGNISVYVSVLRNEYISVAFDYFSDPTVELATFIAGSGV---DGVITEFP  647

Query  598  ATANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  422
            ATA RY R+ C    +  PY +LP   G+LL +   +  PPA AP P L   DV++PPLP
Sbjct  648  ATATRYLRSPCSDLNKDQPYAILPAEAGALLAVADKEAQPPAGAPNPPLDAKDVIDPPLP  707

Query  421  PVAKI  407
            PVAK+
Sbjct  708  PVAKL  712



>emb|CDY36036.1| BnaC03g41620D [Brassica napus]
Length=849

 Score =   112 bits (281),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 82/119 (69%), Gaps = 9/119 (8%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            T+VVA+L+AS  +VYV+ FSNEFV+Q +D FSD  VE++ +V    A   DG+IT FPAT
Sbjct  706  TDVVARLKASGFRVYVETFSNEFVTQPFDLFSDSTVEIDFFV---QAVKIDGIITDFPAT  762

Query  592  ANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
              RYR+++C  Y+E+  +      G LL   +P+ L PA+APYP+L ESDV+EPPL  V
Sbjct  763  TARYRKSQC--YREMSMFR----TGELLPFGNPRLLSPAQAPYPLLVESDVMEPPLLDV  815



>gb|KHN41389.1| Putative glycerophosphoryl diester phosphodiesterase 3, partial 
[Glycine soja]
Length=245

 Score =   107 bits (268),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 70/102 (69%), Gaps = 4/102 (4%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            TN+V KL+ + + V+V+ FS+EFVS AWDFF+D  VE+N+Y+ GA     DG+IT FP  
Sbjct  146  TNIVPKLKIANLLVFVETFSSEFVSPAWDFFADEIVEINTYIEGAQ---IDGIITNFPKI  202

Query  592  ANRYRRNRCLGYKE-IPPYMLPVGPGSLLQLMSPQYLPPAEA  470
             +RYRRN+CLG  +  P YM PV PG +  L++ +  PP EA
Sbjct  203  VDRYRRNKCLGLGDNKPTYMEPVQPGGIFGLITKELFPPVEA  244



>ref|XP_002866252.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH42511.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=754

 Score =   112 bits (279),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 58/125 (46%), Positives = 80/125 (64%), Gaps = 4/125 (3%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G TNVV ++  + + VYV +  NE++S A+D+FSDP VEL +++ G+     DGVIT FP
Sbjct  591  GKTNVVEEMHKANISVYVSVLRNEYISIAFDYFSDPTVELATFIAGSG---VDGVITEFP  647

Query  598  ATANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  422
            ATA RY R+ C    +  PY +LP   G+LL +   +  PPA AP P L   DV++PPLP
Sbjct  648  ATATRYLRSPCSDLNKDQPYAILPAEAGALLSVADKEAQPPASAPNPPLDAKDVIDPPLP  707

Query  421  PVAKI  407
            PVA +
Sbjct  708  PVANL  712



>ref|XP_002866246.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH42505.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=754

 Score =   112 bits (279),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 58/125 (46%), Positives = 80/125 (64%), Gaps = 4/125 (3%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G TNVV ++  + + VYV +  NE++S A+D+FSDP VEL +++ G+     DGVIT FP
Sbjct  591  GKTNVVEEMHKANISVYVSVLRNEYISIAFDYFSDPTVELATFIAGSGV---DGVITEFP  647

Query  598  ATANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  422
            ATA RY R+ C    +  PY +LP   G+LL +   +  PPA AP P L   DV++PPLP
Sbjct  648  ATATRYLRSPCSDLNKDQPYAILPAEAGALLSVADKEAQPPASAPNPPLDAKDVIDPPLP  707

Query  421  PVAKI  407
            PVA +
Sbjct  708  PVANM  712



>ref|XP_006401135.1| hypothetical protein EUTSA_v10012762mg [Eutrema salsugineum]
 gb|ESQ42588.1| hypothetical protein EUTSA_v10012762mg [Eutrema salsugineum]
Length=753

 Score =   112 bits (279),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 78/125 (62%), Gaps = 4/125 (3%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G TNVV ++    + VYV +  NEFVS  +D+FSDP VEL +++ G   N  DGVIT FP
Sbjct  592  GKTNVVEEMHKGNISVYVSVLRNEFVSIVFDYFSDPTVELATFIAG---NGVDGVITEFP  648

Query  598  ATANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  422
            ATA RY R+ C    +  PY +LP   G+LL + + +  PP  AP P L   DV++PPLP
Sbjct  649  ATATRYLRSPCSDLNKDQPYAILPAEAGALLSVAAKEAQPPTSAPNPPLDAKDVIDPPLP  708

Query  421  PVAKI  407
            PVA +
Sbjct  709  PVANM  713



>ref|XP_009366150.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Pyrus x bretschneideri]
Length=777

 Score =   111 bits (278),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 60/126 (48%), Positives = 80/126 (63%), Gaps = 6/126 (5%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G TNVV +++A+ + VY     NEFVS  +D+FSDP  E+ SYV G      DG++T FP
Sbjct  600  GTTNVVKEMKAANITVYAHWLRNEFVSLMFDYFSDPITEIASYVQGFEV---DGIVTDFP  656

Query  598  ATANRYRRNRCLGYK---EIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPP  428
             TA++Y R+ C        +P  +LPV PG+L  L+ P+ L PAEAP P L  S+VV+PP
Sbjct  657  GTASKYMRSPCSDTDPKASVPYAILPVEPGALSGLIGPEALSPAEAPSPALQVSNVVDPP  716

Query  427  LPPVAK  410
            LP VAK
Sbjct  717  LPGVAK  722



>ref|XP_009132086.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=752

 Score =   111 bits (278),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 58/125 (46%), Positives = 80/125 (64%), Gaps = 4/125 (3%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G TNVV ++    V VYV +  NE++S A+D+FSDP VE+ +++ G   N  DGV+T FP
Sbjct  592  GKTNVVEEMHKGNVSVYVSVLRNEYLSIAFDYFSDPTVEIATFIAG---NSVDGVVTEFP  648

Query  598  ATANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  422
             TA RY R+ C    +  PY +LPV  G+LL + + +  PPA AP P L   DV++PPLP
Sbjct  649  VTATRYLRSPCSDLNKEQPYAILPVEAGALLSVAAKEAQPPASAPNPPLDARDVIDPPLP  708

Query  421  PVAKI  407
            P+A I
Sbjct  709  PIANI  713



>emb|CDX88656.1| BnaA03g09930D [Brassica napus]
Length=775

 Score =   111 bits (277),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 58/125 (46%), Positives = 80/125 (64%), Gaps = 4/125 (3%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G TNVV ++    V VYV +  NE++S A+D+FSDP VE+ +++ G   N  DGV+T FP
Sbjct  615  GKTNVVEEMHKGNVSVYVSVLRNEYLSIAFDYFSDPTVEIATFIAG---NSVDGVVTEFP  671

Query  598  ATANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  422
             TA RY R+ C    +  PY +LPV  G+LL + + +  PPA AP P L   DV++PPLP
Sbjct  672  VTATRYLRSPCSDLNKEQPYAILPVEAGALLSVAAKEAQPPASAPNPPLDARDVIDPPLP  731

Query  421  PVAKI  407
            P+A I
Sbjct  732  PIANI  736



>gb|EMT29224.1| Putative glycerophosphoryl diester phosphodiesterase 1 [Aegilops 
tauschii]
Length=849

 Score =   111 bits (277),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 76/119 (64%), Gaps = 4/119 (3%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            T++V  LQ + + VY     NEFV+Q +DFFSD   E+ +YV GA     DG+IT FPAT
Sbjct  697  TDLVESLQTAGLSVYAYTLMNEFVAQPYDFFSDATAEIIAYVQGAGV---DGLITDFPAT  753

Query  592  ANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
            A RY+ N C+    + P +M P  PG LLQL+S    PPA AP P+L +SDV EPPLPP
Sbjct  754  ARRYKSNTCMNMGNKTPSFMAPPRPGDLLQLISKPAQPPALAPMPLLMDSDVSEPPLPP  812



>emb|CDY02800.1| BnaC02g10890D [Brassica napus]
Length=748

 Score =   111 bits (277),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 58/125 (46%), Positives = 79/125 (63%), Gaps = 4/125 (3%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G T VV  +    + VYV +  NE++S  +D+FSDP VEL +++ G   N  DGVIT FP
Sbjct  584  GKTKVVEAMHKGNISVYVSVLRNEYLSITFDYFSDPTVELATFIAG---NGVDGVITEFP  640

Query  598  ATANRYRRNRCLG-YKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  422
            ATA RY R+ C   Y+E+P  +LP   G+L+ + S +  PPA AP P L   DV++PPLP
Sbjct  641  ATATRYLRSPCSDLYRELPFAILPAKAGTLVSVASKEAQPPASAPNPPLDAKDVIDPPLP  700

Query  421  PVAKI  407
            PVA +
Sbjct  701  PVANL  705



>ref|XP_008645878.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Zea mays]
 gb|AFW72077.1| hypothetical protein ZEAMMB73_869244 [Zea mays]
Length=750

 Score =   110 bits (276),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 77/120 (64%), Gaps = 4/120 (3%)
 Frame = -1

Query  766  VVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATAN  587
            +V  LQ++ ++VYV +  NEF SQ  DFF+D   ++N+YV GA     DG+IT FP TA+
Sbjct  601  LVTSLQSAGLQVYVYVLMNEFASQPNDFFADATSQINAYVQGAKV---DGIITDFPGTAH  657

Query  586  RYRRNRCLGY-KEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAK  410
            RY+ N C       P +M P  PGSLL  M+P   PPA AP P+LT++DV EP LPPV+ 
Sbjct  658  RYKLNSCTSMGNSAPLFMQPPQPGSLLLTMAPDVQPPAAAPMPLLTDADVAEPALPPVSN  717



>ref|XP_009417318.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Musa acuminata subsp. malaccensis]
Length=753

 Score =   110 bits (275),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 81/121 (67%), Gaps = 6/121 (5%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G T +V+KL  + + VYV +F NEFVSQ WDFFSD  VE+N++V GA     DG+IT FP
Sbjct  591  GETGLVSKLHDAGIDVYVYVFQNEFVSQPWDFFSDATVEINAHVLGARV---DGIITDFP  647

Query  598  ATANRYRRNRC--LGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPL  425
             TA RY+RN C  LG   +P YM PV  G L+ LM+   LPPA AP P L  SDVVEPPL
Sbjct  648  ETARRYKRNSCRNLG-NSMPNYMQPVLAGGLISLMNSDSLPPALAPIPPLDVSDVVEPPL  706

Query  424  P  422
            P
Sbjct  707  P  707



>dbj|BAC42822.1| GPI-anchored protein [Arabidopsis thaliana]
Length=359

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 78/125 (62%), Gaps = 4/125 (3%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G TNVV ++    + VYV +  NE++S A+D+FSDP +EL +++ G+     DGVIT FP
Sbjct  200  GKTNVVEEMHKGNISVYVSVLRNEYISVAFDYFSDPTIELATFISGSG---VDGVITEFP  256

Query  598  ATANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  422
            ATA RY ++ C    +  PY +LP   G L+ +   +  PPA AP P L   DV++PPLP
Sbjct  257  ATATRYLKSPCSDLNKEQPYAILPAEAGGLVVVADKEAQPPASAPNPPLEAKDVIDPPLP  316

Query  421  PVAKI  407
            PVA +
Sbjct  317  PVANL  321



>ref|XP_009120321.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=755

 Score =   110 bits (275),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 80/125 (64%), Gaps = 4/125 (3%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G TNVV ++    + VYV +  NE++S A+D+FSDP VE  +++ G   N  DGVIT FP
Sbjct  592  GKTNVVEEMHKGNISVYVSVLRNEYISIAFDYFSDPTVEFATFIAG---NGVDGVITEFP  648

Query  598  ATANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  422
            ATA+RY R+ C    +  PY +LP   G+L+ + + +  PPA AP P L   DV++PPLP
Sbjct  649  ATASRYLRSPCSDLNKEQPYAILPAEAGALISVANKEAQPPASAPNPPLDAKDVIDPPLP  708

Query  421  PVAKI  407
            PVA +
Sbjct  709  PVANM  713



>dbj|BAJ85772.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=744

 Score =   110 bits (274),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 76/119 (64%), Gaps = 4/119 (3%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            T++V  LQ + + VY     NEFVSQ +DFFSD   ++ +YV GA     DG+IT FPAT
Sbjct  592  TDLVESLQTAGLSVYAYNLMNEFVSQPYDFFSDATAQIIAYVQGAGV---DGLITDFPAT  648

Query  592  ANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
            A RY+ N C+    + P +M P  PG LLQL+S    PPA AP P+L +SDV EPPLPP
Sbjct  649  ARRYKSNTCMNMGNKTPSFMAPPRPGDLLQLISKPAQPPALAPMPLLLDSDVSEPPLPP  707



>gb|EMS58329.1| putative glycerophosphoryl diester phosphodiesterase 1 [Triticum 
urartu]
Length=744

 Score =   109 bits (273),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 76/119 (64%), Gaps = 4/119 (3%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            T++V  LQ + + VY     NEFVSQ +DFFSD   ++ +YV GA     DG+IT FPAT
Sbjct  592  TDLVESLQTAGLSVYAYNLMNEFVSQPYDFFSDATAQIIAYVQGAGV---DGLITDFPAT  648

Query  592  ANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
            A RY+ N C+    + P +M P  PG LLQL+S    PPA AP P+L +SDV EPPLPP
Sbjct  649  ARRYKSNTCVNMGNKTPSFMAPPRPGDLLQLISKPAQPPALAPMPLLMDSDVSEPPLPP  707



>ref|XP_006660255.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2-like [Oryza brachyantha]
Length=785

 Score =   109 bits (272),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 78/119 (66%), Gaps = 5/119 (4%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            TN++  L+++ + +Y Q+F NEFVS  WDFFSD  VE+N+YV    +   DG IT FP T
Sbjct  619  TNLMKDLRSAGLAIYAQVFRNEFVSPPWDFFSDVTVEINTYV---QSVKIDGFITDFPKT  675

Query  592  ANRYRRNRCLGYKE-IPPYMLPVGPGSLLQLMSPQYL-PPAEAPYPVLTESDVVEPPLP  422
              RY+ N C+G  + +P YMLPV    L QL++   + PPA +P PVL+ S+V EPPLP
Sbjct  676  VKRYKMNSCMGLGDNMPQYMLPVEIAGLAQLLNGSTVQPPALSPMPVLSSSNVTEPPLP  734



>ref|XP_010453117.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL6 [Camelina 
sativa]
Length=754

 Score =   109 bits (272),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 56/125 (45%), Positives = 80/125 (64%), Gaps = 4/125 (3%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G T+VV ++  + + VYV +  NE++S A+D+FSDP VEL +++ G+     DGVIT FP
Sbjct  591  GNTSVVEEMHKANISVYVSVLRNEYISIAFDYFSDPTVELATFIAGSGV---DGVITEFP  647

Query  598  ATANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  422
            ATA RY R+ C    +  PY +LP   G+L+ +   +  PPA AP P L   DV++PPLP
Sbjct  648  ATATRYLRSPCSDLNKDQPYAILPAEAGALMAVADKEAQPPASAPNPPLDAKDVIDPPLP  707

Query  421  PVAKI  407
            PVA +
Sbjct  708  PVANV  712



>ref|XP_009358473.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Pyrus x bretschneideri]
Length=777

 Score =   108 bits (271),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 77/124 (62%), Gaps = 6/124 (5%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G TNVV +++A+ + VY     NEFVS  +D+FSDP  E+ SY  G      DG++T FP
Sbjct  600  GTTNVVDEMKAANISVYAHWMKNEFVSLMFDYFSDPITEIASYAQGFQV---DGIVTDFP  656

Query  598  ATANRYRRNRCLGYK---EIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPP  428
             TA++Y R+ C        IP  +LPV PGSL  L++P+ + PA+AP P L  S VV+PP
Sbjct  657  GTASKYMRSPCTDMDPKANIPYAILPVEPGSLSSLIAPEAMSPAQAPSPALQTSQVVDPP  716

Query  427  LPPV  416
            LP V
Sbjct  717  LPEV  720



>ref|XP_008384576.1| PREDICTED: LOW QUALITY PROTEIN: probable glycerophosphoryl diester 
phosphodiesterase 2 [Malus domestica]
Length=770

 Score =   108 bits (271),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 80/126 (63%), Gaps = 6/126 (5%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G TNVV +++A+ + VY     NEFVS  +D+FSDP  E+ SY  G      DG++T FP
Sbjct  600  GTTNVVKEMKAANITVYAHWLRNEFVSLMFDYFSDPITEIASYAQGFKV---DGIVTDFP  656

Query  598  ATANRYRRNRCLGY--KEIPPY-MLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPP  428
             TA++Y R+ C     K   PY +LPV PG+L  L+ P+ L PAEAP P L  S+VV+PP
Sbjct  657  GTASKYMRSPCSDTDPKANVPYPILPVEPGALSGLIGPEALSPAEAPSPALQVSNVVDPP  716

Query  427  LPPVAK  410
            LP VAK
Sbjct  717  LPGVAK  722



>ref|XP_008343908.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Malus domestica]
 ref|XP_008343909.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Malus domestica]
Length=781

 Score =   108 bits (271),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 80/126 (63%), Gaps = 6/126 (5%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G TNVV +++A+ + VY     NEFVS  +D+FSDP  E+ SY  G      DG++T FP
Sbjct  600  GTTNVVKEMKAANITVYAHWLRNEFVSLMFDYFSDPITEIASYAQGFKV---DGIVTDFP  656

Query  598  ATANRYRRNRCLGY--KEIPPY-MLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPP  428
             TA++Y R+ C     K   PY +LPV PG+L  L+ P+ L PAEAP P L  S+VV+PP
Sbjct  657  GTASKYMRSPCSDTDPKANVPYPILPVEPGALSGLIGPEALSPAEAPSPALQVSNVVDPP  716

Query  427  LPPVAK  410
            LP VAK
Sbjct  717  LPGVAK  722



>emb|CDY19634.1| BnaA05g20420D [Brassica napus]
Length=726

 Score =   108 bits (271),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 81/120 (68%), Gaps = 10/120 (8%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANP-FDGVITGFPA  596
            T+VV +L++S ++VYV+ FSNEF++Q +DFFSDP VE++ +V G   +P  DG+IT FPA
Sbjct  576  TDVVPRLRSSGLRVYVETFSNEFITQPYDFFSDPTVEIDYFVRG---DPEVDGIITDFPA  632

Query  595  TANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
            T +RY +N C    E       +  G L+ L + + L PAEAPYP L +S+V EPPLP V
Sbjct  633  TTSRYTKNPCYSKME------QIRTGELVSLANREMLSPAEAPYPQLLDSNVTEPPLPEV  686



>ref|XP_009126782.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 isoform X2 [Brassica rapa]
Length=756

 Score =   108 bits (270),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 78/125 (62%), Gaps = 4/125 (3%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G T VV  +    + VYV +  NE++S  +D+FSDP VEL +++ G   N  DGVIT FP
Sbjct  592  GKTKVVEAMHKGNISVYVSVLRNEYLSITFDYFSDPTVELATFIAG---NGVDGVITEFP  648

Query  598  ATANRYRRNRCLG-YKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  422
            ATA RY R+ C   Y+E+   +LP   G+L+ + S +  PPA AP P L   DV++PPLP
Sbjct  649  ATATRYLRSPCSDLYRELSFAILPAKAGTLVSVASKEAQPPASAPNPPLDAKDVIDPPLP  708

Query  421  PVAKI  407
            PVA +
Sbjct  709  PVANL  713



>ref|XP_009145621.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=726

 Score =   108 bits (270),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 81/120 (68%), Gaps = 10/120 (8%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANP-FDGVITGFPA  596
            T++V +L++S ++VYV+ FSNEF++Q +DFFSDP VE++ +V G   +P  DG+IT FPA
Sbjct  576  TDIVPRLRSSGLRVYVETFSNEFITQPYDFFSDPTVEIDYFVRG---DPEVDGIITDFPA  632

Query  595  TANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
            T +RY +N C    E       +  G L+ L + + L PAEAPYP L +S+V EPPLP V
Sbjct  633  TTSRYTKNPCYSKME------QIRTGELVSLANREMLSPAEAPYPQLLDSNVTEPPLPEV  686



>ref|XP_009126781.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 isoform X1 [Brassica rapa]
Length=738

 Score =   108 bits (270),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 78/125 (62%), Gaps = 4/125 (3%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G T VV  +    + VYV +  NE++S  +D+FSDP VEL +++ G   N  DGVIT FP
Sbjct  574  GKTKVVEAMHKGNISVYVSVLRNEYLSITFDYFSDPTVELATFIAG---NGVDGVITEFP  630

Query  598  ATANRYRRNRCLG-YKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  422
            ATA RY R+ C   Y+E+   +LP   G+L+ + S +  PPA AP P L   DV++PPLP
Sbjct  631  ATATRYLRSPCSDLYRELSFAILPAKAGTLVSVASKEAQPPASAPNPPLDAKDVIDPPLP  690

Query  421  PVAKI  407
            PVA +
Sbjct  691  PVANL  695



>emb|CDY12599.1| BnaA02g12670D [Brassica napus]
Length=408

 Score =   105 bits (263),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 78/122 (64%), Gaps = 12/122 (10%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G TNVV +LQ SK+ VYV+LF NEFVS       D  VE+NSY+ GA  N   G IT FP
Sbjct  273  GKTNVVERLQKSKLLVYVELFQNEFVS-------DATVEINSYITGAGIN---GTITEFP  322

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP--QYLPPAEAPYPVLTESDVVEPPL  425
             TA++Y+RNRCLG KE  PYM PV P  LLQ ++P      P+ AP PV T+  V  PPL
Sbjct  323  LTASKYKRNRCLGTKETLPYMAPVIPRGLLQTVNPLSPAPAPSPAPSPVFTDDYVAGPPL  382

Query  424  PP  419
            PP
Sbjct  383  PP  384



>dbj|BAJ93663.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=768

 Score =   108 bits (269),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 76/124 (61%), Gaps = 8/124 (6%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            T++V  LQ++ + VY Q+F NEF+SQ WDFFSD  VE+NSY   A +   DG+IT FP T
Sbjct  610  TSLVKDLQSAGLTVYAQVFRNEFLSQPWDFFSDETVEINSY---AQSLKVDGLITDFPKT  666

Query  592  ANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMS----PQYLPPAEAPYPVLTESDVVEPPL  425
              RY+RN C   K  P YM  V  G L QL+     PQ  PP  +P P L  ++V +PP 
Sbjct  667  VRRYKRNSCTE-KVKPAYMETVEVGGLAQLLERNAVPQAQPPTVSPMPGLNATEVQQPPF  725

Query  424  PPVA  413
            PPVA
Sbjct  726  PPVA  729



>dbj|BAD94535.1| Glycerophosphodiesterase-like [Arabidopsis thaliana]
Length=378

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 78/125 (62%), Gaps = 4/125 (3%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G TNVV ++  + + VYV +  NE+++ A+D+FSDP +EL +++ G      DGVIT FP
Sbjct  216  GKTNVVEEMHKANISVYVSVLRNEYIAIAFDYFSDPTIELATFIAGRG---VDGVITEFP  272

Query  598  ATANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  422
            ATA RY R+ C    +  PY +LP   G+LL +   +   PA  P P L   DV++PPLP
Sbjct  273  ATATRYLRSPCSDLNKDQPYAILPADAGALLTVADKEAQLPAIPPNPPLDAKDVIDPPLP  332

Query  421  PVAKI  407
            PVAK+
Sbjct  333  PVAKL  337



>ref|XP_010536984.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Tarenaya hassleriana]
Length=745

 Score =   107 bits (267),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 77/121 (64%), Gaps = 4/121 (3%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            TNVV ++    + VYV +  NE++S A+D+FSDP VEL +++ G   N  DGV+T FPAT
Sbjct  589  TNVVEEMHKGNISVYVSVLRNEYISIAFDYFSDPTVELATFIAG---NGVDGVVTEFPAT  645

Query  592  ANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
            A+RY R  C    +  PY +LP  PG+LL + + +  PP  A  P L   DVV+PPLPPV
Sbjct  646  ASRYLRTPCADLNKDQPYAILPAEPGALLSVAAKEAQPPVGALNPPLEAKDVVDPPLPPV  705

Query  415  A  413
            A
Sbjct  706  A  706



>gb|KFK39359.1| hypothetical protein AALP_AA3G234500 [Arabis alpina]
Length=752

 Score =   107 bits (267),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 78/119 (66%), Gaps = 9/119 (8%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            T+VV +LQ++ ++V+V+ F NEF +Q +DF++DP VE++S+V        DG+IT FPAT
Sbjct  606  TDVVPRLQSNGLRVFVETFHNEFTTQQFDFYADPTVEIHSFVLDI---KIDGIITDFPAT  662

Query  592  ANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
              RYR+N C    ++ P       G L+ L +  +L PAEAPYP L ++DV+EPPL  V
Sbjct  663  TTRYRKNHCYRKLDLVP------TGVLITLPNLVHLGPAEAPYPTLVDADVIEPPLTEV  715



>emb|CDY11832.1| BnaC03g12580D [Brassica napus]
Length=153

 Score =   100 bits (250),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 73/117 (62%), Gaps = 4/117 (3%)
 Frame = -1

Query  754  LQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRR  575
            +    V VYV +  NE++S A+D+FSDP VE+ +++ G   N  DGV+T FP TA RY R
Sbjct  1    MHKGNVSVYVSVLRNEYLSIAFDYFSDPTVEIATFIAG---NGVDGVVTEFPVTATRYLR  57

Query  574  NRCLGYKEIPPY-MLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAKI  407
            + C    +  PY +LP   G+LL + + +  PPA AP P L   DV++PPLPP+A I
Sbjct  58   SPCSDLNKEQPYAILPAEAGALLSVAAKEAQPPASAPNPPLDARDVIDPPLPPIANI  114



>emb|CDY32720.1| BnaA02g07820D [Brassica napus]
Length=752

 Score =   107 bits (267),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/125 (45%), Positives = 78/125 (62%), Gaps = 4/125 (3%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G T +V  +    + VYV +  NE++S  +D+FSDP VEL +++ G   N  DGVIT FP
Sbjct  588  GKTKIVEAMHKGNISVYVSVLRNEYLSITFDYFSDPTVELATFIAG---NGVDGVITEFP  644

Query  598  ATANRYRRNRCLG-YKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  422
            ATA RY R+ C   Y+E+   +LP   G+L+ + S +  PPA AP P L   DV++PPLP
Sbjct  645  ATATRYLRSPCSDLYRELSFAILPAKAGTLVSVASKEAQPPASAPNPPLDAKDVMDPPLP  704

Query  421  PVAKI  407
            PVA +
Sbjct  705  PVANL  709



>ref|XP_003579951.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Brachypodium distachyon]
Length=744

 Score =   107 bits (267),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/118 (47%), Positives = 75/118 (64%), Gaps = 4/118 (3%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            + +V  L+ + + +Y     NEF+SQ +DFFSD   ++N+YV GA     DG+IT +PAT
Sbjct  593  SGLVQSLKTANLSIYAYTLMNEFLSQPYDFFSDATAQINAYVQGAKV---DGLITDYPAT  649

Query  592  ANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  422
            A RY+ N C    K+ P +M P  PG LLQ++S    PPA AP P+L +SDV EPPLP
Sbjct  650  ARRYKLNACKNMGKKAPSFMAPARPGDLLQIISKPAQPPALAPMPLLVDSDVTEPPLP  707



>dbj|BAJ87963.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=744

 Score =   107 bits (266),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 75/119 (63%), Gaps = 4/119 (3%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            T++V  LQ + + VY     NEFVSQ +DFFSD   ++ +YV GA     DG+IT FPAT
Sbjct  592  TDLVESLQTAGLSVYAYNLMNEFVSQPYDFFSDATAQIIAYVQGAGV---DGLITDFPAT  648

Query  592  ANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
            A RY+ N C+    + P +M P  PG LL L+S    PPA AP P+L +SDV EPPLPP
Sbjct  649  ARRYKSNTCMNMGNKTPSFMAPPRPGDLLLLISKPAQPPALAPMPLLLDSDVSEPPLPP  707



>ref|NP_200625.1| glycerophosphodiester phosphodiesterase like 7 [Arabidopsis thaliana]
 sp|Q9LVN0.1|GPDL7_ARATH RecName: Full=Glycerophosphodiester phosphodiesterase GDPDL7; 
AltName: Full=Glycerophosphodiester phosphodiesterase-like 
7; Short=ATGDPDL7; AltName: Full=Glycerophosphodiesterase-like 
6; AltName: Full=Protein SHV3-LIKE 5; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAA96908.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED97007.1| glycerophosphodiester phosphodiesterase like 7 [Arabidopsis thaliana]
Length=750

 Score =   106 bits (265),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 78/125 (62%), Gaps = 4/125 (3%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G TNVV ++    + VYV +  NE++S A+D+FSDP +EL +++ G+     DGVIT FP
Sbjct  591  GKTNVVEEMHKGNISVYVSVLRNEYISVAFDYFSDPTIELATFISGSGV---DGVITEFP  647

Query  598  ATANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  422
            ATA RY ++ C    +  PY +LP   G L+ +   +  PPA AP P L   DV++PPLP
Sbjct  648  ATATRYLKSPCSDLNKEQPYAILPAEAGGLVVVADKEAQPPASAPNPPLEAKDVIDPPLP  707

Query  421  PVAKI  407
            PVA +
Sbjct  708  PVANL  712



>ref|XP_008361197.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Malus domestica]
Length=773

 Score =   106 bits (265),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 56/124 (45%), Positives = 76/124 (61%), Gaps = 6/124 (5%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G TNVV +++A+ + VY     NEFVS  +D+FSDP  E+ SY  G      DG++T FP
Sbjct  600  GTTNVVKEMKAANISVYAHWMKNEFVSLMFDYFSDPMTEIASYAQGFQV---DGIVTDFP  656

Query  598  ATANRYRRNRCLGYK---EIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPP  428
             TA++Y R+ C        +P  +LPV PGSL  L++P+ L PA+AP   L  S VV+PP
Sbjct  657  GTASKYMRSPCTDMDPKANVPYAILPVEPGSLSSLIAPEALSPAQAPSQALQTSKVVDPP  716

Query  427  LPPV  416
            LP V
Sbjct  717  LPEV  720



>gb|EMT33222.1| Putative glycerophosphoryl diester phosphodiesterase 1 [Aegilops 
tauschii]
Length=772

 Score =   105 bits (262),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 58/125 (46%), Positives = 75/125 (60%), Gaps = 8/125 (6%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            T+++  LQ++ + VY Q+F NEFVSQ WDFF D  VE+N+Y   A +   DG+IT FP T
Sbjct  612  TSLLTDLQSAGLTVYAQVFRNEFVSQPWDFFGDETVEINNY---AQSLNVDGLITDFPKT  668

Query  592  ANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLM----SPQYLPPAEAPYPVLTESDVVEPP  428
              RY+RN C G   ++P YM  V  G L QL+    +PQ  PP+ AP P L    V  PP
Sbjct  669  VRRYKRNSCTGLGNDVPSYMGNVTVGGLAQLLKNQAAPQAQPPSVAPMPKLDAPSVQRPP  728

Query  427  LPPVA  413
             P VA
Sbjct  729  FPTVA  733



>ref|XP_010241663.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Nelumbo nucifera]
 ref|XP_010241664.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Nelumbo nucifera]
Length=749

 Score =   105 bits (261),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 58/122 (48%), Positives = 73/122 (60%), Gaps = 4/122 (3%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            T+VV   Q S + V+  +F NEF + A D FSDP VEL ++V G      DGV+T +PAT
Sbjct  590  TDVVDTFQLSNISVFTSVFMNEFPTIAIDMFSDPIVELQTFVAGFG---IDGVVTDYPAT  646

Query  592  ANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
            A  Y R+ C+      PY + P  PG+LL L SP  LPP  AP P LT  DV++PPLPPV
Sbjct  647  ARAYSRSPCIDLNANVPYTIFPAQPGALLALASPDALPPVGAPAPSLTVGDVIDPPLPPV  706

Query  415  AK  410
              
Sbjct  707  GD  708



>ref|XP_002437331.1| hypothetical protein SORBIDRAFT_10g025000 [Sorghum bicolor]
 gb|EER88698.1| hypothetical protein SORBIDRAFT_10g025000 [Sorghum bicolor]
Length=744

 Score =   104 bits (260),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 80/120 (67%), Gaps = 5/120 (4%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            T+V+ K+ A+ + VYV L  NEF++  +DF+++P VE+ +Y    S+   DG++T FPAT
Sbjct  584  TDVIDKMHAANLSVYVGLLRNEFMNLGFDFWANPMVEIVTY----SSLMADGIVTEFPAT  639

Query  592  ANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
            A  Y R+ C  + K +   ++P  PGSLL+L  P  LPPA+ P PVL  +DVV+PPLPPV
Sbjct  640  AAEYFRSPCSDFSKNLTYTIMPAKPGSLLKLTDPSALPPAQGPAPVLKPADVVDPPLPPV  699



>ref|XP_009127505.1| PREDICTED: LOW QUALITY PROTEIN: probable glycerophosphoryl diester 
phosphodiesterase 2 [Brassica rapa]
Length=1313

 Score =   105 bits (262),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 78/122 (64%), Gaps = 12/122 (10%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G TNVV +LQ SK+ VYV+LF NEFVS       D  VE+NSY+ GA  N   G IT FP
Sbjct  588  GKTNVVERLQKSKLLVYVELFQNEFVS-------DATVEINSYITGAGIN---GTITEFP  637

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSP--QYLPPAEAPYPVLTESDVVEPPL  425
             TA++Y+RNRCLG KE  PYM PV P  LLQ ++P      P+ AP PV T+  V  PPL
Sbjct  638  LTASKYKRNRCLGTKETLPYMAPVIPRGLLQTVNPLSPAPAPSPAPSPVFTDDYVAGPPL  697

Query  424  PP  419
            PP
Sbjct  698  PP  699



>ref|XP_002453429.1| hypothetical protein SORBIDRAFT_04g005910 [Sorghum bicolor]
 gb|EES06405.1| hypothetical protein SORBIDRAFT_04g005910 [Sorghum bicolor]
Length=295

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 78/123 (63%), Gaps = 4/123 (3%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            T+ V  LQA+ + V+V +  NEF++  +DFF+DP +E+ +Y +   A   DG++T +PAT
Sbjct  135  TDTVGSLQAANLTVFVGVLKNEFMNLGFDFFADPTIEVATYAYSVVA---DGIVTDYPAT  191

Query  592  ANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
            A  Y R+ C   K    Y +LP  PG+L+ L +P  L PA AP P+L  +DVV+PPLPPV
Sbjct  192  AASYFRSPCSDMKLNLSYSILPAQPGALVNLAAPGMLAPAGAPAPLLQPTDVVDPPLPPV  251

Query  415  AKI  407
              +
Sbjct  252  KAV  254



>gb|AFW58562.1| hypothetical protein ZEAMMB73_533189 [Zea mays]
Length=260

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 75/119 (63%), Gaps = 4/119 (3%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            TN+V  LQ + + VYV    NEF+SQ +DFFSD   ++N+YV GA     DG+IT FPAT
Sbjct  105  TNLVQTLQTAGLSVYVYTLMNEFLSQPYDFFSDATAQINAYVKGA---LVDGLITDFPAT  161

Query  592  ANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
            A RY+ N C+      P +M P  PG L+Q +S    PPA AP P LT SDV EPPLPP
Sbjct  162  ARRYKVNSCMNMGNSTPNFMAPARPGDLMQSISKSAQPPALAPVPPLTGSDVAEPPLPP  220



>ref|NP_200613.2| glycerophosphodiester phosphodiesterase like 6 [Arabidopsis thaliana]
 sp|Q9FGT9.1|GPDL6_ARATH RecName: Full=Glycerophosphodiester phosphodiesterase GDPDL6; 
AltName: Full=Glycerophosphodiester phosphodiesterase-like 
6; Short=ATGDPDL6; AltName: Full=Glycerophosphodiesterase-like 
5; AltName: Full=Protein SHV3-LIKE 4; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB10996.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL66999.1| putative aluminium tolerance associated protein [Arabidopsis 
thaliana]
 gb|AAN71947.1| putative aluminium tolerance associated protein [Arabidopsis 
thaliana]
 gb|AED96991.1| glycerophosphodiester phosphodiesterase like 6 [Arabidopsis thaliana]
Length=753

 Score =   103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 78/125 (62%), Gaps = 4/125 (3%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G TNVV ++  + + VYV +  NE+++ A+D+FSDP +EL +++ G      DGVIT FP
Sbjct  591  GKTNVVEEMHKANISVYVSVLRNEYIAIAFDYFSDPTIELATFIAGRGV---DGVITEFP  647

Query  598  ATANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLP  422
            ATA RY R+ C    +  PY +LP   G+LL +   +   PA  P P L   DV++PPLP
Sbjct  648  ATATRYLRSPCSDLNKDQPYAILPADAGALLTVADKEAQLPAIPPNPPLDAKDVIDPPLP  707

Query  421  PVAKI  407
            PVAK+
Sbjct  708  PVAKL  712



>ref|XP_004952935.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Setaria italica]
Length=745

 Score =   103 bits (256),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 58/119 (49%), Positives = 78/119 (66%), Gaps = 4/119 (3%)
 Frame = -1

Query  766  VVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATAN  587
            +V  LQ++ + VY  +  NEF SQ +DFFSD   ++N+YV  A     DG+IT FP TA+
Sbjct  598  LVPTLQSAGLSVYAYVLMNEFTSQPYDFFSDATAQINAYVQSAKV---DGIITDFPGTAH  654

Query  586  RYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPVAK  410
            RY+ N C+G K  P +M P  PG L+ +M  +  PPA AP P+LT+SDV EPPLPPV+ 
Sbjct  655  RYKLNSCMG-KNAPDFMRPAQPGGLISVMDQRAQPPAAAPMPLLTDSDVAEPPLPPVSN  712



>ref|XP_008336911.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
3 [Malus domestica]
Length=166

 Score = 96.3 bits (238),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 70/116 (60%), Gaps = 6/116 (5%)
 Frame = -1

Query  754  LQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATANRYRR  575
            ++A+ + VY     NEFVS  +D+FSDP  E+ SY  G      DG++T FP TA++Y R
Sbjct  1    MKAANISVYAHWMKNEFVSLMFDYFSDPMTEIASYAQGFQ---VDGIVTDFPGTASKYMR  57

Query  574  NRCLGYK---EIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
            + C        +P  +LPV PGSL  L++P+ L PA+AP   L  S VV+PPLP V
Sbjct  58   SPCTDMDPKANVPYAILPVEPGSLSSLIAPEALSPAQAPSQALQTSKVVDPPLPEV  113



>emb|CDY60415.1| BnaC02g45340D [Brassica napus]
Length=1186

 Score =   101 bits (252),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 69/104 (66%), Gaps = 12/104 (12%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G TNVV +LQ SK+ +YV+L  NEFVS       D  VE+NSY+ GA  N   G IT FP
Sbjct  555  GKTNVVERLQKSKLLIYVELLQNEFVS-------DATVEINSYITGAGIN---GTITEFP  604

Query  598  ATANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAP  467
             TA++Y+RNRCLG KE  PYM PV P  LLQ+++P  L PA AP
Sbjct  605  FTASKYKRNRCLGTKETLPYMAPVIPRGLLQMVNP--LSPAPAP  646



>ref|XP_002325146.2| hypothetical protein POPTR_0018s11890g [Populus trichocarpa]
 gb|EEF03711.2| hypothetical protein POPTR_0018s11890g [Populus trichocarpa]
Length=751

 Score =   101 bits (251),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 77/126 (61%), Gaps = 7/126 (6%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G T VV ++QA+ + VYV +  NEF++  +D+FSDP +E+ +Y  G      DG+IT +P
Sbjct  586  GTTKVVNEMQAANISVYVSVLRNEFITLPFDYFSDPTIEIATYTSGIGV---DGIITEYP  642

Query  598  ATANRYRRNRCLGYKEIPP---YMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPP  428
            ATA+RY RN C     +P     ++P   GSLL+ +  +  PPA  P P L  +DVV+PP
Sbjct  643  ATASRYLRNPC-SSNSMPDSSYSIIPAEAGSLLKTVPEETQPPASTPTPALDVADVVDPP  701

Query  427  LPPVAK  410
            LP V K
Sbjct  702  LPAVTK  707



>ref|XP_007011972.1| SHV3-like 5 [Theobroma cacao]
 gb|EOY29591.1| SHV3-like 5 [Theobroma cacao]
Length=754

 Score =   100 bits (250),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 80/123 (65%), Gaps = 6/123 (5%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            TNV+ ++ A  + VYV +  NEFV+  +DF++DP VEL +YV   +A   DGVIT FP T
Sbjct  596  TNVLQEMHAGNISVYVFVLRNEFVALPFDFYADPMVELATYV---AALEVDGVITDFPGT  652

Query  592  ANRYRRNRCLGYK-EIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
            A+RY R+ C+    EI   ++P  PG+LL+ + P  L PA  P P L  +DVV+PPLPPV
Sbjct  653  ASRYMRSPCVDLNGEIA--IIPAEPGALLKQVPPMALSPANPPNPPLEVADVVDPPLPPV  710

Query  415  AKI  407
            A +
Sbjct  711  ANV  713



>ref|XP_004973844.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like isoform X1 [Setaria italica]
Length=768

 Score =   100 bits (250),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 74/121 (61%), Gaps = 5/121 (4%)
 Frame = -1

Query  769  NVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPATA  590
            ++V  LQ++ + VY Q+F NEFVSQ  DFF+D  VE+N YV    +    G+IT FP T 
Sbjct  609  SLVKDLQSAGLAVYAQVFRNEFVSQPLDFFADETVEINYYV---QSFNLSGIITDFPKTV  665

Query  589  NRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMSP-QYLPPAEAPYPVLTESDVVEPPLPPV  416
             RY++N C G   ++P YM  +  GSL QL+ P +  PP+  P P L  S V E PLPPV
Sbjct  666  RRYKKNTCTGLGNDMPNYMQRIDVGSLYQLLQPFKAQPPSVPPMPTLNASSVEEAPLPPV  725

Query  415  A  413
            A
Sbjct  726  A  726



>ref|NP_001159159.1| uncharacterized protein LOC100304242 [Zea mays]
 gb|ACN25264.1| unknown [Zea mays]
Length=165

 Score = 94.7 bits (234),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 77/123 (63%), Gaps = 4/123 (3%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            T+ V+ LQ + + V++ +  NEF++  +DFF+DP +E+ +Y +   A   DG++T +PAT
Sbjct  5    TDTVSSLQDANLTVFLGVLKNEFMNLGFDFFADPTIEIVTYSWAVLA---DGLVTDYPAT  61

Query  592  ANRYRRNRCLGYKEIPPY-MLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
            A  Y R+ C        Y +LP  PG+L+ L +P  L PA AP P+L  SDVV+PPLPPV
Sbjct  62   AASYFRSPCSDMNLNLSYSILPAQPGALVNLAAPGTLAPAGAPAPLLQPSDVVDPPLPPV  121

Query  415  AKI  407
              +
Sbjct  122  KAV  124



>ref|XP_002446646.1| hypothetical protein SORBIDRAFT_06g019730 [Sorghum bicolor]
 gb|EES10974.1| hypothetical protein SORBIDRAFT_06g019730 [Sorghum bicolor]
Length=749

 Score =   100 bits (248),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 77/119 (65%), Gaps = 4/119 (3%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            TN+V  LQ++ + VYV    NEF SQ +DFFSD   ++N+YV GA     DG+IT FPAT
Sbjct  594  TNLVQTLQSAGLSVYVYTLMNEFPSQPYDFFSDATAQINAYVKGALV---DGLITDFPAT  650

Query  592  ANRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPP  419
            A RY+ N C+      P +M PV PG L+Q +S    PPA AP P LTESDV +PPLPP
Sbjct  651  ARRYKVNSCMNMGNNTPNFMAPVHPGDLMQSISRSAQPPALAPIPPLTESDVAQPPLPP  709



>gb|KCW70260.1| hypothetical protein EUGRSUZ_F03515 [Eucalyptus grandis]
Length=574

 Score = 99.4 bits (246),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 55/73 (75%), Gaps = 3/73 (4%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
            G+T+VV KL A K+ VYVQ FSNEFVSQAWDFFSD  VE+NS+V G      DGVIT FP
Sbjct  478  GITDVVTKLHAFKLPVYVQTFSNEFVSQAWDFFSDATVEVNSFVVGGDV---DGVITDFP  534

Query  598  ATANRYRRNRCLG  560
             T+  Y+RN+CLG
Sbjct  535  KTSASYKRNKCLG  547



>ref|XP_002308389.2| hypothetical protein POPTR_0006s20170g [Populus trichocarpa]
 gb|EEE91912.2| hypothetical protein POPTR_0006s20170g [Populus trichocarpa]
Length=731

 Score = 99.8 bits (247),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 52/125 (42%), Positives = 76/125 (61%), Gaps = 5/125 (4%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
              T VV ++ A+ + VYV +  NEFV+ A+D+F+DP +E+ +Y  G      DG+IT +P
Sbjct  573  ATTKVVNEMHAANISVYVTVLRNEFVTLAFDYFADPTIEIATYTSGIGV---DGIITEYP  629

Query  598  ATANRYRRNRCLGYK--EIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPL  425
            ATA+RY RN C      E    ++P   GSLL+ +  +  PPA +P P L  +D+V+PPL
Sbjct  630  ATASRYLRNPCSSDSMPESSYSIIPAEAGSLLKTVPEETQPPASSPTPALDVADIVDPPL  689

Query  424  PPVAK  410
            P V K
Sbjct  690  PAVTK  694



>emb|CDY59886.1| BnaC02g47600D [Brassica napus]
Length=182

 Score = 94.7 bits (234),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 72/119 (61%), Gaps = 15/119 (13%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            T+VV +L+AS V+V+V+ FSNEFV+Q  D FSD  VE++  V  A     DG+IT FPAT
Sbjct  55   TDVVPRLKASGVRVFVETFSNEFVTQPLDLFSDSTVEIDFLVQRAK---IDGIITDFPAT  111

Query  592  ANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
              RY++            M     G LL   +P  L PA+APYP+L +SDV+E PLP V
Sbjct  112  TARYKK------------MGLFRTGELLPFANPMLLSPAQAPYPLLVKSDVMESPLPEV  158



>ref|XP_010235616.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
isoform X2 [Brachypodium distachyon]
Length=659

 Score = 99.4 bits (246),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 77/120 (64%), Gaps = 3/120 (3%)
 Frame = -1

Query  766  VVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFG-ASANPFDGVITGFPATA  590
            VV  LQ++ + VYV L  NEFVSQ +DFFSD   ++N+YV         DGVIT FP TA
Sbjct  506  VVKSLQSAGLPVYVYLLMNEFVSQPYDFFSDATAQINAYVQKDGDGGGVDGVITDFPGTA  565

Query  589  NRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMS-PQYLPPAEAPYPVLTESDVVEPPLPPV  416
            +RY+ N C    K+ P +M P   G L+  +S P  LPPA +P PVLT+SDV EPPLPPV
Sbjct  566  HRYKLNSCKNMGKKTPLFMQPPQRGGLVGTISDPSALPPAMSPMPVLTDSDVAEPPLPPV  625



>ref|XP_006406374.1| hypothetical protein EUTSA_v10020151mg [Eutrema salsugineum]
 gb|ESQ47827.1| hypothetical protein EUTSA_v10020151mg [Eutrema salsugineum]
Length=727

 Score = 99.4 bits (246),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 77/119 (65%), Gaps = 9/119 (8%)
 Frame = -1

Query  772  TNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFPAT  593
            T+V  +L +S ++VYV+  SNEFVS  +DF+SDP ++++++V     +   G+IT FPAT
Sbjct  582  TDVFPRLNSSGLRVYVETLSNEFVSYPFDFYSDPTMQIDTFVRDIKIH---GIITDFPAT  638

Query  592  ANRYRRNRCLGYKEIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPLPPV  416
              RYR+N+C  Y ++  +      G L+   +P  +PPA APYP L ESDV EPPLP V
Sbjct  639  TARYRKNQC--YSKMNLFR----TGELITFGNPLLVPPAGAPYPSLVESDVTEPPLPEV  691



>ref|XP_003575252.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
isoform X1 [Brachypodium distachyon]
Length=749

 Score = 99.8 bits (247),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 77/120 (64%), Gaps = 3/120 (3%)
 Frame = -1

Query  766  VVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYV-FGASANPFDGVITGFPATA  590
            VV  LQ++ + VYV L  NEFVSQ +DFFSD   ++N+YV         DGVIT FP TA
Sbjct  596  VVKSLQSAGLPVYVYLLMNEFVSQPYDFFSDATAQINAYVQKDGDGGGVDGVITDFPGTA  655

Query  589  NRYRRNRCLGY-KEIPPYMLPVGPGSLLQLMS-PQYLPPAEAPYPVLTESDVVEPPLPPV  416
            +RY+ N C    K+ P +M P   G L+  +S P  LPPA +P PVLT+SDV EPPLPPV
Sbjct  656  HRYKLNSCKNMGKKTPLFMQPPQRGGLVGTISDPSALPPAMSPMPVLTDSDVAEPPLPPV  715



>ref|XP_011033465.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL6-like 
[Populus euphratica]
Length=744

 Score = 99.4 bits (246),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 52/125 (42%), Positives = 76/125 (61%), Gaps = 5/125 (4%)
 Frame = -1

Query  778  GVTNVVAKLQASKVKVYVQLFSNEFVSQAWDFFSDPYVELNSYVFGASANPFDGVITGFP  599
              T VV ++ A+ + VYV +  NEFV+ A+D+F+DP +E+ +Y  G      DG+IT +P
Sbjct  586  ATTKVVNEMHAANISVYVTVLRNEFVTLAFDYFADPTIEIATYTSGIGV---DGIITEYP  642

Query  598  ATANRYRRNRCLGYK--EIPPYMLPVGPGSLLQLMSPQYLPPAEAPYPVLTESDVVEPPL  425
            ATA+RY RN C      E    ++P   GSLL+ +  +  PPA +P P L  +D+V+PPL
Sbjct  643  ATASRYLRNPCSSDSMPESSYSIIPAEAGSLLKTVPEETQPPASSPTPALDVADIVDPPL  702

Query  424  PPVAK  410
            P V K
Sbjct  703  PAVTK  707



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1507754616730