BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF008P22

Length=665
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009789240.1|  PREDICTED: probable calcium-binding protein ...    238   3e-75   Nicotiana sylvestris
ref|XP_009601106.1|  PREDICTED: probable calcium-binding protein ...    235   4e-74   Nicotiana tomentosiformis
ref|XP_011075386.1|  PREDICTED: probable calcium-binding protein ...    230   5e-72   Sesamum indicum [beniseed]
ref|XP_011078930.1|  PREDICTED: probable calcium-binding protein ...    227   6e-71   Sesamum indicum [beniseed]
ref|XP_009595400.1|  PREDICTED: probable calcium-binding protein ...    223   1e-69   Nicotiana tomentosiformis
gb|EYU20776.1|  hypothetical protein MIMGU_mgv1a020784mg                222   5e-69   Erythranthe guttata [common monkey flower]
emb|CDP14208.1|  unnamed protein product                                222   1e-68   Coffea canephora [robusta coffee]
gb|EYU18659.1|  hypothetical protein MIMGU_mgv1a026895mg                219   9e-68   Erythranthe guttata [common monkey flower]
ref|XP_009765839.1|  PREDICTED: probable calcium-binding protein ...    219   1e-67   Nicotiana sylvestris
ref|XP_004249249.1|  PREDICTED: probable calcium-binding protein ...    218   3e-67   Solanum lycopersicum
ref|XP_004249247.1|  PREDICTED: probable calcium-binding protein ...    216   7e-67   Solanum lycopersicum
ref|XP_006351257.1|  PREDICTED: probable calcium-binding protein ...    216   9e-67   Solanum tuberosum [potatoes]
ref|XP_006351283.1|  PREDICTED: probable calcium-binding protein ...    215   3e-66   Solanum tuberosum [potatoes]
ref|XP_002276334.1|  PREDICTED: probable calcium-binding protein ...    213   4e-65   Vitis vinifera
ref|XP_009622394.1|  PREDICTED: probable calcium-binding protein ...    206   1e-62   Nicotiana tomentosiformis
ref|XP_009763879.1|  PREDICTED: probable calcium-binding protein ...    205   3e-62   Nicotiana sylvestris
ref|XP_007202521.1|  hypothetical protein PRUPE_ppa010940mg             197   6e-59   Prunus persica
ref|XP_008240735.1|  PREDICTED: probable calcium-binding protein ...    195   2e-58   Prunus mume [ume]
emb|CBI30075.3|  unnamed protein product                                192   6e-58   Vitis vinifera
ref|XP_010277607.1|  PREDICTED: probable calcium-binding protein ...    194   7e-58   Nelumbo nucifera [Indian lotus]
gb|KDP26218.1|  hypothetical protein JCGZ_22464                         190   2e-56   Jatropha curcas
emb|CDY14768.1|  BnaC04g47650D                                          182   2e-53   Brassica napus [oilseed rape]
ref|XP_007028573.1|  Calcium-binding EF-hand family protein, puta...    181   2e-53   
ref|XP_009141989.1|  PREDICTED: probable calcium-binding protein ...    180   1e-52   Brassica rapa
ref|XP_008392376.1|  PREDICTED: LOW QUALITY PROTEIN: probable cal...    180   2e-52   
ref|XP_006364430.1|  PREDICTED: probable calcium-binding protein ...    179   3e-52   Solanum tuberosum [potatoes]
ref|XP_004303614.1|  PREDICTED: probable calcium-binding protein ...    178   5e-52   Fragaria vesca subsp. vesca
ref|XP_009341958.1|  PREDICTED: LOW QUALITY PROTEIN: probable cal...    180   1e-51   
ref|XP_008376081.1|  PREDICTED: probable calcium-binding protein ...    179   2e-51   
ref|XP_002534401.1|  Calcium-binding allergen Ole e, putative           177   2e-51   Ricinus communis
emb|CDY06925.1|  BnaA04g23900D                                          177   2e-51   
gb|KJB35924.1|  hypothetical protein B456_006G133800                    175   1e-50   Gossypium raimondii
gb|KJB16379.1|  hypothetical protein B456_002G227200                    174   5e-50   Gossypium raimondii
ref|XP_002308908.1|  Calmodulin-like family protein                     173   8e-50   Populus trichocarpa [western balsam poplar]
ref|XP_006421261.1|  hypothetical protein CICLE_v10005842mg             172   1e-49   Citrus clementina [clementine]
ref|NP_001265939.1|  Hop-interacting protein THI026                     172   2e-49   Solanum lycopersicum
ref|XP_008373033.1|  PREDICTED: probable calcium-binding protein ...    172   2e-49   
ref|XP_006491566.1|  PREDICTED: probable calcium-binding protein ...    172   3e-49   Citrus sinensis [apfelsine]
ref|XP_008790571.1|  PREDICTED: probable calcium-binding protein ...    170   8e-49   Phoenix dactylifera
ref|XP_003625055.1|  hypothetical protein MTR_7g090450                  169   3e-48   Medicago truncatula
ref|XP_010924236.1|  PREDICTED: probable calcium-binding protein ...    169   4e-48   Elaeis guineensis
ref|XP_002323262.1|  Calmodulin-like family protein                     168   5e-48   Populus trichocarpa [western balsam poplar]
ref|XP_010544017.1|  PREDICTED: probable calcium-binding protein ...    168   9e-48   Tarenaya hassleriana [spider flower]
ref|XP_010508721.1|  PREDICTED: probable calcium-binding protein ...    167   1e-47   Camelina sativa [gold-of-pleasure]
gb|AFK42347.1|  unknown                                                 167   1e-47   Medicago truncatula
ref|XP_002881773.1|  hypothetical protein ARALYDRAFT_903457             167   2e-47   Arabidopsis lyrata subsp. lyrata
ref|XP_011027298.1|  PREDICTED: probable calcium-binding protein ...    167   2e-47   Populus euphratica
emb|CDY23852.1|  BnaC04g01850D                                          166   6e-47   Brassica napus [oilseed rape]
ref|XP_004493430.1|  PREDICTED: probable calcium-binding protein ...    164   1e-46   Cicer arietinum [garbanzo]
gb|KDO37863.1|  hypothetical protein CISIN_1g027592mg                   164   2e-46   Citrus sinensis [apfelsine]
ref|XP_011033138.1|  PREDICTED: probable calcium-binding protein ...    164   3e-46   Populus euphratica
gb|AAM61257.1|  calmodulin-like protein                                 163   6e-46   Arabidopsis thaliana [mouse-ear cress]
ref|NP_181672.1|  putative calcium-binding protein CML35                163   7e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010554792.1|  PREDICTED: probable calcium-binding protein ...    162   9e-46   Tarenaya hassleriana [spider flower]
ref|XP_006295474.1|  hypothetical protein CARUB_v10024577mg             162   9e-46   Capsella rubella
ref|XP_008800223.1|  PREDICTED: calmodulin-like                         162   1e-45   Phoenix dactylifera
emb|CAA48190.1|  calmodulin like protein                                162   1e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010543513.1|  PREDICTED: probable calcium-binding protein ...    162   1e-45   Tarenaya hassleriana [spider flower]
ref|XP_010273279.1|  PREDICTED: probable calcium-binding protein ...    162   1e-45   Nelumbo nucifera [Indian lotus]
gb|KFK38406.1|  hypothetical protein AALP_AA3G109000                    161   1e-45   Arabis alpina [alpine rockcress]
ref|XP_002882655.1|  hypothetical protein ARALYDRAFT_897194             161   2e-45   Arabidopsis lyrata subsp. lyrata
gb|KDO37862.1|  hypothetical protein CISIN_1g027592mg                   160   3e-45   Citrus sinensis [apfelsine]
ref|XP_010938625.1|  PREDICTED: calmodulin-like protein 3               161   4e-45   Elaeis guineensis
ref|NP_187630.1|  putative calcium-binding protein CML36                160   5e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006411405.1|  hypothetical protein EUTSA_v10017207mg             160   6e-45   Eutrema salsugineum [saltwater cress]
gb|KFK36989.1|  hypothetical protein AALP_AA4G198000                    159   3e-44   Arabis alpina [alpine rockcress]
ref|XP_010517632.1|  PREDICTED: probable calcium-binding protein ...    158   4e-44   Camelina sativa [gold-of-pleasure]
emb|CDX79938.1|  BnaA05g02180D                                          157   6e-44   
ref|XP_009142741.1|  PREDICTED: probable calcium-binding protein ...    157   6e-44   Brassica rapa
ref|XP_006296622.1|  hypothetical protein CARUB_v10014618mg             157   7e-44   Capsella rubella
ref|XP_010505921.1|  PREDICTED: probable calcium-binding protein ...    157   2e-43   Camelina sativa [gold-of-pleasure]
ref|XP_010102734.1|  putative calcium-binding protein CML36             157   2e-43   
ref|XP_009412818.1|  PREDICTED: probable calcium-binding protein ...    156   2e-43   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY00910.1|  BnaC05g42900D                                          155   4e-43   
ref|XP_006407598.1|  hypothetical protein EUTSA_v10021512mg             154   9e-43   Eutrema salsugineum [saltwater cress]
gb|AGV22098.1|  calmodulin-like protein                                 152   7e-42   Brassica juncea [brown mustard]
emb|CDY60169.1|  BnaAnng16630D                                          152   1e-41   Brassica napus [oilseed rape]
ref|XP_010525531.1|  PREDICTED: probable calcium-binding protein ...    152   1e-41   Tarenaya hassleriana [spider flower]
ref|XP_010056433.1|  PREDICTED: probable calcium-binding protein ...    152   2e-41   Eucalyptus grandis [rose gum]
ref|XP_003554140.1|  PREDICTED: probable calcium-binding protein ...    151   2e-41   Glycine max [soybeans]
ref|XP_010931583.1|  PREDICTED: probable calcium-binding protein ...    150   6e-41   Elaeis guineensis
ref|XP_003521150.1|  PREDICTED: probable calcium-binding protein ...    149   1e-40   Glycine max [soybeans]
ref|XP_007162132.1|  hypothetical protein PHAVU_001G126700g             148   4e-40   Phaseolus vulgaris [French bean]
ref|XP_009146864.1|  PREDICTED: probable calcium-binding protein ...    149   4e-40   Brassica rapa
ref|XP_010922185.1|  PREDICTED: probable calcium-binding protein ...    147   5e-40   Elaeis guineensis
ref|XP_009399974.1|  PREDICTED: probable calcium-binding protein ...    147   1e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010486615.1|  PREDICTED: probable calcium-binding protein ...    147   1e-39   Camelina sativa [gold-of-pleasure]
ref|XP_010481256.1|  PREDICTED: probable calcium-binding protein ...    146   2e-39   Camelina sativa [gold-of-pleasure]
ref|XP_010672963.1|  PREDICTED: probable calcium-binding protein ...    145   5e-39   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008789596.1|  PREDICTED: probable calcium-binding protein ...    144   6e-39   Phoenix dactylifera
ref|XP_010464685.1|  PREDICTED: probable calcium-binding protein ...    144   8e-39   Camelina sativa [gold-of-pleasure]
ref|XP_008786895.1|  PREDICTED: probable calcium-binding protein ...    144   1e-38   Phoenix dactylifera
ref|XP_008443339.1|  PREDICTED: probable calcium-binding protein ...    141   2e-37   
ref|XP_010036330.1|  PREDICTED: probable calcium-binding protein ...    140   5e-37   Eucalyptus grandis [rose gum]
ref|XP_004136671.1|  PREDICTED: probable calcium-binding protein ...    138   8e-37   
ref|XP_004159632.1|  PREDICTED: probable calcium-binding protein ...    138   8e-37   
ref|XP_006288691.1|  hypothetical protein CARUB_v10002001mg             139   8e-37   
ref|XP_008457589.1|  PREDICTED: probable calcium-binding protein ...    135   2e-35   Cucumis melo [Oriental melon]
ref|XP_004151276.1|  PREDICTED: probable calcium-binding protein ...    129   2e-33   Cucumis sativus [cucumbers]
ref|XP_002970730.1|  hypothetical protein SELMODRAFT_94292              123   4e-31   
ref|XP_002969393.1|  hypothetical protein SELMODRAFT_91501              122   4e-31   
ref|XP_010062249.1|  PREDICTED: calcium-binding protein CML24-like      122   2e-30   Eucalyptus grandis [rose gum]
ref|XP_009606381.1|  PREDICTED: probable calcium-binding protein ...    119   6e-30   Nicotiana tomentosiformis
gb|ABK24059.1|  unknown                                                 121   2e-29   Picea sitchensis
ref|XP_004233476.1|  PREDICTED: probable calcium-binding protein ...    116   9e-29   Solanum lycopersicum
ref|XP_008381742.1|  PREDICTED: probable calcium-binding protein ...    117   1e-28   Malus domestica [apple tree]
gb|EYU30122.1|  hypothetical protein MIMGU_mgv1a025962mg                117   1e-28   Erythranthe guttata [common monkey flower]
ref|XP_009775333.1|  PREDICTED: probable calcium-binding protein ...    115   2e-28   Nicotiana sylvestris
ref|XP_004498255.1|  PREDICTED: probable calcium-binding protein ...    117   2e-28   Cicer arietinum [garbanzo]
ref|XP_011072994.1|  PREDICTED: calcium-binding allergen Ole e 8-...    115   3e-28   Sesamum indicum [beniseed]
ref|XP_006346894.1|  PREDICTED: probable calcium-binding protein ...    114   4e-28   Solanum tuberosum [potatoes]
gb|KCW78265.1|  hypothetical protein EUGRSUZ_D02448                     114   5e-28   Eucalyptus grandis [rose gum]
ref|XP_003544994.1|  PREDICTED: probable calcium-binding protein ...    114   5e-28   Glycine max [soybeans]
gb|EPS62655.1|  hypothetical protein M569_12136                         115   5e-28   Genlisea aurea
gb|KHN40730.1|  Putative calcium-binding protein CML25                  114   5e-28   Glycine soja [wild soybean]
ref|XP_008389977.1|  PREDICTED: probable calcium-binding protein ...    117   6e-28   
ref|XP_009351545.1|  PREDICTED: probable calcium-binding protein ...    115   8e-28   Pyrus x bretschneideri [bai li]
ref|XP_006843397.1|  hypothetical protein AMTR_s00053p00122010          115   9e-28   Amborella trichopoda
ref|XP_004298507.1|  PREDICTED: probable calcium-binding protein ...    114   1e-27   Fragaria vesca subsp. vesca
ref|XP_006583713.1|  PREDICTED: probable calcium-binding protein ...    114   1e-27   Glycine max [soybeans]
ref|XP_008801290.1|  PREDICTED: probable calcium-binding protein ...    114   2e-27   Phoenix dactylifera
ref|XP_009411743.1|  PREDICTED: probable calcium-binding protein ...    114   2e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010053891.1|  PREDICTED: calmodulin-like protein 3               114   2e-27   Eucalyptus grandis [rose gum]
ref|XP_004169010.1|  PREDICTED: probable calcium-binding protein ...    114   2e-27   
ref|XP_010920375.1|  PREDICTED: probable calcium-binding protein ...    113   2e-27   Elaeis guineensis
ref|XP_008467096.1|  PREDICTED: probable calcium-binding protein ...    113   3e-27   Cucumis melo [Oriental melon]
ref|XP_006357771.1|  PREDICTED: calcium-binding protein CML24-like      112   3e-27   Solanum tuberosum [potatoes]
ref|XP_003637661.1|  Calcium-binding pollen allergen                    113   4e-27   
ref|XP_003519336.1|  PREDICTED: probable calcium-binding protein ...    112   4e-27   Glycine max [soybeans]
ref|XP_007033045.1|  Calmodulin like 23, putative                       112   4e-27   
ref|XP_011070577.1|  PREDICTED: probable calcium-binding protein ...    113   4e-27   Sesamum indicum [beniseed]
ref|XP_004150619.1|  PREDICTED: probable calcium-binding protein ...    112   4e-27   
ref|XP_004241666.2|  PREDICTED: calcium-binding allergen Ole e 8-...    113   5e-27   Solanum lycopersicum
ref|XP_007141898.1|  hypothetical protein PHAVU_008G235100g             111   7e-27   Phaseolus vulgaris [French bean]
gb|AFK34900.1|  unknown                                                 112   8e-27   Lotus japonicus
ref|XP_010693960.1|  PREDICTED: probable calcium-binding protein ...    110   9e-27   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011084270.1|  PREDICTED: calcium-binding allergen Ole e 8-...    111   1e-26   Sesamum indicum [beniseed]
ref|XP_010104706.1|  putative calcium-binding protein CML25             112   1e-26   Morus notabilis
ref|XP_006365410.1|  PREDICTED: calcium-binding allergen Ole e 8-...    110   1e-26   Solanum tuberosum [potatoes]
ref|XP_009804163.1|  PREDICTED: calcium-binding protein CML24-like      110   2e-26   Nicotiana sylvestris
ref|XP_002274476.1|  PREDICTED: probable calcium-binding protein ...    110   2e-26   Vitis vinifera
gb|KJB08532.1|  hypothetical protein B456_001G087100                    110   2e-26   Gossypium raimondii
ref|XP_007223528.1|  hypothetical protein PRUPE_ppa012032mg             111   3e-26   Prunus persica
gb|KJB50384.1|  hypothetical protein B456_008G168100                    111   3e-26   Gossypium raimondii
ref|XP_008464718.1|  PREDICTED: probable calcium-binding protein ...    110   3e-26   Cucumis melo [Oriental melon]
ref|XP_004503360.1|  PREDICTED: probable calcium-binding protein ...    110   3e-26   Cicer arietinum [garbanzo]
emb|CDP16307.1|  unnamed protein product                                110   4e-26   Coffea canephora [robusta coffee]
ref|XP_004231987.1|  PREDICTED: calcium-binding protein CML24           109   4e-26   Solanum lycopersicum
ref|XP_010043960.1|  PREDICTED: probable calcium-binding protein ...    110   5e-26   Eucalyptus grandis [rose gum]
gb|EYU46532.1|  hypothetical protein MIMGU_mgv1a021796mg                109   5e-26   Erythranthe guttata [common monkey flower]
ref|XP_009628802.1|  PREDICTED: probable calcium-binding protein ...    109   6e-26   Nicotiana tomentosiformis
ref|XP_011099473.1|  PREDICTED: probable calcium-binding protein ...    108   8e-26   Sesamum indicum [beniseed]
ref|XP_006654163.1|  PREDICTED: probable calcium-binding protein ...    108   8e-26   
ref|XP_009392676.1|  PREDICTED: probable calcium-binding protein ...    109   9e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002459097.1|  hypothetical protein SORBIDRAFT_03g045770          109   1e-25   Sorghum bicolor [broomcorn]
ref|XP_002279679.1|  PREDICTED: probable calcium-binding protein ...    110   1e-25   Vitis vinifera
ref|XP_008221464.1|  PREDICTED: probable calcium-binding protein ...    109   1e-25   Prunus mume [ume]
ref|XP_010271345.1|  PREDICTED: probable calcium-binding protein ...    109   1e-25   Nelumbo nucifera [Indian lotus]
ref|XP_003616365.1|  Polcalcin Nic t                                    108   1e-25   Medicago truncatula
ref|XP_008378130.1|  PREDICTED: probable calcium-binding protein ...    108   1e-25   Malus domestica [apple tree]
ref|XP_009334418.1|  PREDICTED: probable calcium-binding protein ...    107   2e-25   Pyrus x bretschneideri [bai li]
ref|XP_010262278.1|  PREDICTED: probable calcium-binding protein ...    108   2e-25   Nelumbo nucifera [Indian lotus]
ref|XP_006430624.1|  hypothetical protein CICLE_v10013012mg             107   3e-25   Citrus clementina [clementine]
gb|KHM99973.1|  Putative calcium-binding protein CML25                  107   3e-25   Glycine soja [wild soybean]
gb|EYU17655.1|  hypothetical protein MIMGU_mgv1a015081mg                107   3e-25   Erythranthe guttata [common monkey flower]
ref|XP_004971250.1|  PREDICTED: probable calcium-binding protein ...    109   3e-25   
ref|XP_004230637.1|  PREDICTED: calmodulin-like                         107   4e-25   Solanum lycopersicum
ref|XP_004142374.1|  PREDICTED: probable calcium-binding protein ...    107   4e-25   Cucumis sativus [cucumbers]
ref|XP_006355093.1|  PREDICTED: probable calcium-binding protein ...    108   4e-25   Solanum tuberosum [potatoes]
gb|EPS63975.1|  hypothetical protein M569_10810                         107   5e-25   Genlisea aurea
ref|XP_011467223.1|  PREDICTED: calcium-binding protein CML24-like      106   5e-25   Fragaria vesca subsp. vesca
ref|XP_009103045.1|  PREDICTED: probable calcium-binding protein ...    107   6e-25   
emb|CDY40786.1|  BnaAnng06490D                                          107   7e-25   Brassica napus [oilseed rape]
ref|XP_009770094.1|  PREDICTED: calmodulin-like                         106   7e-25   Nicotiana sylvestris
ref|XP_007160425.1|  hypothetical protein PHAVU_002G320800g             107   8e-25   Phaseolus vulgaris [French bean]
ref|XP_007045260.1|  Polcalcin Jun o, putative                          107   8e-25   
ref|XP_004145834.1|  PREDICTED: probable calcium-binding protein ...    106   8e-25   Cucumis sativus [cucumbers]
ref|XP_009414956.1|  PREDICTED: probable calcium-binding protein ...    107   8e-25   
ref|XP_007163392.1|  hypothetical protein PHAVU_001G231000g             105   9e-25   Phaseolus vulgaris [French bean]
ref|XP_002312460.2|  hypothetical protein POPTR_0008s13390g             106   9e-25   
ref|XP_002962635.1|  hypothetical protein SELMODRAFT_69135              105   9e-25   
ref|XP_011079925.1|  PREDICTED: calmodulin-like                         105   9e-25   Sesamum indicum [beniseed]
ref|XP_004159084.1|  PREDICTED: probable calcium-binding protein ...    107   1e-24   
ref|XP_006574101.1|  PREDICTED: probable calcium-binding protein ...    107   1e-24   
ref|XP_009413607.1|  PREDICTED: probable calcium-binding protein ...    106   1e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006351748.1|  PREDICTED: calmodulin-5/6/7/8-like                 105   1e-24   Solanum tuberosum [potatoes]
ref|XP_010109033.1|  putative calcium-binding protein CML23             105   2e-24   Morus notabilis
ref|XP_002525994.1|  Polcalcin Jun o, putative                          106   2e-24   Ricinus communis
ref|XP_008457051.1|  PREDICTED: probable calcium-binding protein ...    105   2e-24   Cucumis melo [Oriental melon]
gb|AAZ20284.1|  calcium-binding pollen allergen                         105   2e-24   Arachis hypogaea [goober]
ref|XP_008381330.1|  PREDICTED: probable calcium-binding protein ...    105   2e-24   Malus domestica [apple tree]
ref|NP_173866.1|  putative calcium-binding protein CML25                106   2e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010526084.1|  PREDICTED: calmodulin-like protein 4               106   2e-24   Tarenaya hassleriana [spider flower]
ref|XP_006415824.1|  hypothetical protein EUTSA_v10008816mg             106   2e-24   Eutrema salsugineum [saltwater cress]
ref|NP_001045400.1|  Os01g0949500                                       105   2e-24   
ref|XP_004960644.1|  PREDICTED: probable calcium-binding protein ...    105   2e-24   Setaria italica
gb|KJB15360.1|  hypothetical protein B456_002G172400                    106   2e-24   Gossypium raimondii
ref|XP_004490807.1|  PREDICTED: calcium-binding protein CML24-like      104   2e-24   Cicer arietinum [garbanzo]
ref|XP_009379268.1|  PREDICTED: probable calcium-binding protein ...    106   2e-24   Pyrus x bretschneideri [bai li]
ref|XP_003630938.1|  Calcium-binding pollen allergen                    105   2e-24   
ref|XP_002980456.1|  hypothetical protein SELMODRAFT_59198              104   2e-24   
gb|AAM67124.1|  calmodulin-related protein                              105   2e-24   Arabidopsis thaliana [mouse-ear cress]
gb|AET05414.2|  EF hand calcium-binding family protein                  105   3e-24   Medicago truncatula
ref|XP_010033692.1|  PREDICTED: probable calcium-binding protein ...    105   3e-24   Eucalyptus grandis [rose gum]
ref|XP_002890700.1|  hypothetical protein ARALYDRAFT_335836             105   3e-24   
gb|KDP23917.1|  hypothetical protein JCGZ_27077                         104   3e-24   Jatropha curcas
ref|XP_011082591.1|  PREDICTED: calmodulin-like                         104   3e-24   Sesamum indicum [beniseed]
ref|NP_564874.1|  calmodulin like 23                                    104   3e-24   Arabidopsis thaliana [mouse-ear cress]
gb|AFK37714.1|  unknown                                                 104   3e-24   Medicago truncatula
gb|ABK26821.1|  unknown                                                 105   3e-24   Picea sitchensis
ref|XP_003524362.1|  PREDICTED: probable calcium-binding protein ...    105   3e-24   Glycine max [soybeans]
gb|KEH26932.1|  EF hand calcium-binding family protein                  105   3e-24   Medicago truncatula
gb|ABK26031.1|  unknown                                                 105   4e-24   Picea sitchensis
ref|XP_009371792.1|  PREDICTED: probable calcium-binding protein ...    104   4e-24   Pyrus x bretschneideri [bai li]
emb|CDM86427.1|  unnamed protein product                                105   4e-24   Triticum aestivum [Canadian hard winter wheat]
gb|EAY97018.1|  hypothetical protein OsI_18939                          105   5e-24   Oryza sativa Indica Group [Indian rice]
ref|XP_003552973.1|  PREDICTED: calcium-binding protein CML24-lik...    103   5e-24   Glycine max [soybeans]
ref|XP_010271280.1|  PREDICTED: probable calcium-binding protein ...    105   5e-24   Nelumbo nucifera [Indian lotus]
ref|XP_010477987.1|  PREDICTED: probable calcium-binding protein ...    105   5e-24   Camelina sativa [gold-of-pleasure]
ref|XP_010499149.1|  PREDICTED: probable calcium-binding protein ...    105   5e-24   Camelina sativa [gold-of-pleasure]
ref|XP_003538397.1|  PREDICTED: probable calcium-binding protein ...    103   5e-24   
ref|XP_008800225.1|  PREDICTED: probable calcium-binding protein ...    105   5e-24   Phoenix dactylifera
ref|XP_010531587.1|  PREDICTED: probable calcium-binding protein ...    105   6e-24   Tarenaya hassleriana [spider flower]
emb|CDM86445.1|  unnamed protein product                                104   6e-24   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006304603.1|  hypothetical protein CARUB_v10011672mg             104   6e-24   Capsella rubella
ref|XP_009370750.1|  PREDICTED: calmodulin-like protein 11              103   7e-24   Pyrus x bretschneideri [bai li]
ref|XP_010925995.1|  PREDICTED: probable calcium-binding protein ...    104   7e-24   Elaeis guineensis
ref|XP_008343178.1|  PREDICTED: probable calcium-binding protein ...    105   7e-24   Malus domestica [apple tree]
ref|XP_007215081.1|  hypothetical protein PRUPE_ppa012612mg             103   9e-24   Prunus persica
ref|XP_010925997.1|  PREDICTED: probable calcium-binding protein ...    103   1e-23   Elaeis guineensis
ref|XP_010938627.1|  PREDICTED: probable calcium-binding protein ...    103   1e-23   Elaeis guineensis
ref|XP_009617304.1|  PREDICTED: calmodulin-like                         102   1e-23   Nicotiana tomentosiformis
ref|NP_001152603.1|  polcalcin Jun o 2                                  103   1e-23   
gb|ACG44451.1|  polcalcin Jun o 2                                       103   1e-23   Zea mays [maize]
ref|XP_011024051.1|  PREDICTED: probable calcium-binding protein ...    103   1e-23   Populus euphratica
gb|KDO60746.1|  hypothetical protein CISIN_1g029304mg                   103   1e-23   Citrus sinensis [apfelsine]
ref|XP_008673034.1|  PREDICTED: polcalcin Jun o 2 isoform X1            103   1e-23   
ref|XP_008229213.1|  PREDICTED: probable calcium-binding protein ...    102   2e-23   Prunus mume [ume]
ref|XP_006469245.1|  PREDICTED: probable calcium-binding protein ...    104   2e-23   Citrus sinensis [apfelsine]
ref|XP_011075365.1|  PREDICTED: probable calcium-binding protein ...    103   2e-23   Sesamum indicum [beniseed]
ref|XP_010038682.1|  PREDICTED: calmodulin-like protein 11              102   2e-23   Eucalyptus grandis [rose gum]
ref|XP_010663678.1|  PREDICTED: calcium-binding allergen Ole e 8        102   2e-23   Vitis vinifera
ref|XP_004962216.1|  PREDICTED: probable calcium-binding protein ...    103   2e-23   Setaria italica
ref|XP_002888497.1|  hypothetical protein ARALYDRAFT_475742             102   2e-23   
gb|KCW69357.1|  hypothetical protein EUGRSUZ_F02840                     102   2e-23   Eucalyptus grandis [rose gum]
ref|XP_003536119.1|  PREDICTED: calmodulin-like protein 11-like         102   2e-23   Glycine max [soybeans]
dbj|BAJ88405.1|  predicted protein                                      103   2e-23   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002968790.1|  hypothetical protein SELMODRAFT_17991              101   3e-23   
ref|XP_011090880.1|  PREDICTED: probable calcium-binding protein ...    103   3e-23   Sesamum indicum [beniseed]
ref|XP_009109853.1|  PREDICTED: probable calcium-binding protein ...    102   3e-23   Brassica rapa
ref|XP_011034524.1|  PREDICTED: probable calcium-binding protein ...    103   3e-23   Populus euphratica
ref|XP_007219711.1|  hypothetical protein PRUPE_ppa025855mg             102   3e-23   
gb|AFK83800.1|  calmodulin                                              101   4e-23   Mnemiopsis leidyi [American comb jelly]
ref|XP_009113828.1|  PREDICTED: probable calcium-binding protein ...    102   4e-23   Brassica rapa
ref|XP_002974189.1|  hypothetical protein SELMODRAFT_100711             102   4e-23   
emb|CDX84967.1|  BnaC05g20880D                                          102   4e-23   
ref|XP_003554273.1|  PREDICTED: calmodulin-3-like                       101   4e-23   Glycine max [soybeans]
ref|XP_001779680.1|  predicted protein                                  102   4e-23   
ref|XP_009403239.1|  PREDICTED: calmodulin-like protein 3               101   4e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008368689.1|  PREDICTED: calmodulin-like protein 11              101   5e-23   
ref|XP_001768532.1|  predicted protein                                  102   5e-23   
ref|XP_010908206.1|  PREDICTED: probable calcium-binding protein ...    102   5e-23   Elaeis guineensis
ref|XP_006443961.1|  hypothetical protein CICLE_v10022698mg             101   6e-23   Citrus clementina [clementine]
emb|CDP19328.1|  unnamed protein product                                101   6e-23   Coffea canephora [robusta coffee]
gb|KEH41241.1|  EF hand calcium-binding family protein                  100   6e-23   Medicago truncatula
ref|XP_009782225.1|  PREDICTED: calcium-binding allergen Ole e 8-...    101   6e-23   Nicotiana sylvestris
ref|XP_009595960.1|  PREDICTED: calcium-binding allergen Ole e 8-...    101   7e-23   Nicotiana tomentosiformis
ref|XP_004517285.1|  PREDICTED: probable calcium-binding protein ...    100   8e-23   Cicer arietinum [garbanzo]
gb|ADD38579.1|  Calmodulin                                              100   8e-23   Lepeophtheirus salmonis
gb|EYU44572.1|  hypothetical protein MIMGU_mgv1a015576mg                100   9e-23   Erythranthe guttata [common monkey flower]
gb|KFK44513.1|  hypothetical protein AALP_AA1G266400                    101   9e-23   Arabis alpina [alpine rockcress]
ref|XP_010231590.1|  PREDICTED: probable calcium-binding protein ...    101   9e-23   Brachypodium distachyon [annual false brome]
gb|ACO12252.1|  Calmodulin                                              100   1e-22   Lepeophtheirus salmonis
ref|XP_003568726.2|  PREDICTED: probable calcium-binding protein ...    101   1e-22   Brachypodium distachyon [annual false brome]
ref|XP_006301789.1|  hypothetical protein CARUB_v10022253mg             100   1e-22   Capsella rubella
ref|XP_009608299.1|  PREDICTED: probable calcium-binding protein ...    101   1e-22   Nicotiana tomentosiformis
gb|EPS69688.1|  hypothetical protein M569_05080                         100   1e-22   Genlisea aurea
gb|KEH41232.1|  EF hand calcium-binding family protein                  100   1e-22   Medicago truncatula
emb|CBX25368.1|  hypothetical_protein                                 99.8    1e-22   Oryza brachyantha
gb|EMS57491.1|  putative calcium-binding protein CML18                  102   1e-22   
ref|XP_009797345.1|  PREDICTED: probable calcium-binding protein ...    101   1e-22   
ref|NP_001150713.1|  LOC100284346                                       101   1e-22   
ref|XP_003623726.1|  Calcium-binding protein CML24                      101   1e-22   
ref|XP_009604908.1|  PREDICTED: probable calcium-binding protein ...    101   1e-22   
ref|NP_001241810.1|  polcalcin Jun o 2                                  101   1e-22   
ref|XP_004236933.1|  PREDICTED: probable calcium-binding protein ...    101   1e-22   
ref|XP_010922191.1|  PREDICTED: probable calcium-binding protein ...    101   1e-22   
ref|XP_004492663.1|  PREDICTED: probable calcium-binding protein ...    101   1e-22   
emb|CDY24421.1|  BnaCnng04880D                                          102   1e-22   
ref|XP_004235822.1|  PREDICTED: calcium-binding allergen Ole e 8-...    100   1e-22   
gb|AAV59327.1|  unknown protein                                         100   1e-22   
gb|KCW52116.1|  hypothetical protein EUGRSUZ_J01551                     100   1e-22   
sp|Q0DJV6.1|CML18_ORYSJ  RecName: Full=Probable calcium-binding p...    100   2e-22   
ref|XP_003631098.1|  SLR1/LCR-like protein                              100   2e-22   
emb|CBX25281.1|  hypothetical_protein                                   100   2e-22   
gb|KJB30167.1|  hypothetical protein B456_005G131800                    100   2e-22   
ref|XP_010511464.1|  PREDICTED: probable calcium-binding protein ...    100   2e-22   
gb|AHA51383.1|  EF-hand_1 domain-containing protein                     100   2e-22   
ref|XP_010032678.1|  PREDICTED: calcium-binding protein CML24         99.8    2e-22   
ref|XP_006402687.1|  hypothetical protein EUTSA_v10006367mg             101   2e-22   
ref|XP_007052033.1|  EF hand calcium-binding family protein, puta...    100   2e-22   
gb|KHN17940.1|  Putative calcium-binding protein CML27                99.4    2e-22   
dbj|BAK01430.1|  predicted protein                                      100   2e-22   
gb|EEE62792.1|  hypothetical protein OsJ_17595                          100   2e-22   
ref|XP_001765534.1|  predicted protein                                  100   2e-22   
gb|KJB24793.1|  hypothetical protein B456_004G160800                    100   2e-22   
gb|KHN04934.1|  Calmodulin-like protein 8                             99.4    2e-22   
ref|XP_002520954.1|  calmodulin, putative                             99.4    3e-22   
ref|XP_008787648.1|  PREDICTED: probable calcium-binding protein ...    100   3e-22   
gb|KJB60897.1|  hypothetical protein B456_009G330300                    100   3e-22   
ref|XP_006372871.1|  hypothetical protein POPTR_0017s05860g             100   3e-22   
gb|KDP33161.1|  hypothetical protein JCGZ_13426                       99.4    3e-22   
ref|XP_011078048.1|  PREDICTED: calmodulin-like protein 1             99.8    4e-22   
ref|XP_003556466.1|  PREDICTED: calmodulin-like protein 8-like is...  99.0    4e-22   
ref|XP_005717351.1|  Calmodulin                                       99.0    4e-22   
ref|XP_007160530.1|  hypothetical protein PHAVU_002G329300g           99.4    4e-22   
gb|EYU40667.1|  hypothetical protein MIMGU_mgv1a015381mg              99.0    4e-22   
ref|XP_003580040.2|  PREDICTED: probable calcium-binding protein ...    101   5e-22   
gb|ABK21927.1|  unknown                                               99.0    5e-22   
ref|XP_002532464.1|  Calcium-binding allergen Ole e, putative         99.0    5e-22   
gb|KDO48936.1|  hypothetical protein CISIN_1g031616mg                 99.0    5e-22   
gb|KFK41060.1|  hypothetical protein AALP_AA2G080200                  99.0    5e-22   
ref|XP_004299534.1|  PREDICTED: probable calcium-binding protein ...  99.4    5e-22   
emb|CDX98375.1|  BnaC06g17360D                                          100   5e-22   
ref|XP_001751654.1|  predicted protein                                99.0    5e-22   
ref|XP_006471667.1|  PREDICTED: calmodulin-like protein 11-like       99.0    5e-22   
ref|XP_011008803.1|  PREDICTED: probable calcium-binding protein ...  99.4    5e-22   
ref|XP_010935758.1|  PREDICTED: neo-calmodulin-like                   98.6    5e-22   
ref|XP_008808019.1|  PREDICTED: calmodulin-like                       98.6    5e-22   
ref|XP_002440821.1|  hypothetical protein SORBIDRAFT_09g007360        99.4    6e-22   
ref|XP_008240158.1|  PREDICTED: probable calcium-binding protein ...  99.0    6e-22   
ref|XP_010097572.1|  putative calcium-binding protein CML27           99.0    6e-22   
ref|XP_001785090.1|  predicted protein                                99.4    6e-22   
ref|XP_007153253.1|  hypothetical protein PHAVU_003G019600g           99.8    6e-22   
ref|XP_009104207.1|  PREDICTED: calmodulin-like protein 4             99.8    6e-22   
emb|CDX67796.1|  BnaA07g18360D                                        99.8    6e-22   
ref|XP_003565059.1|  PREDICTED: probable calcium-binding protein ...  99.8    6e-22   
ref|XP_008351927.1|  PREDICTED: probable calcium-binding protein ...  98.6    7e-22   
emb|CDO98355.1|  unnamed protein product                                100   7e-22   
ref|NP_173259.1|  putative calcium-binding protein CML27              99.0    7e-22   
ref|XP_011037098.1|  PREDICTED: calmodulin-like protein 3               100   7e-22   
ref|XP_006416628.1|  hypothetical protein EUTSA_v10008945mg           98.6    7e-22   
ref|XP_006409534.1|  hypothetical protein EUTSA_v10022869mg           99.4    8e-22   
ref|XP_006341535.1|  PREDICTED: calcium-binding allergen Ole e 8-...  98.6    8e-22   
ref|XP_006663807.1|  PREDICTED: probable calcium-binding protein ...  99.0    9e-22   
gb|EYU41337.1|  hypothetical protein MIMGU_mgv1a015814mg              97.8    9e-22   
ref|XP_002892987.1|  hypothetical protein ARALYDRAFT_889234           98.6    9e-22   
ref|XP_009405944.1|  PREDICTED: neo-calmodulin-like                   97.8    1e-21   
ref|XP_007209701.1|  hypothetical protein PRUPE_ppa012426mg           98.6    1e-21   
ref|XP_008791135.1|  PREDICTED: calmodulin-like protein 8             97.8    1e-21   
emb|CAH67730.1|  H0522A01.1                                           99.0    1e-21   
ref|XP_002320065.2|  hypothetical protein POPTR_0014s06640g           99.4    1e-21   
ref|XP_007134898.1|  hypothetical protein PHAVU_010G085100g           99.4    1e-21   
gb|EMT07142.1|  Putative calcium-binding protein CML10                98.6    1e-21   
gb|EAY86614.1|  hypothetical protein OsI_07995                        98.2    1e-21   
ref|XP_011012929.1|  PREDICTED: calmodulin-like protein 3             99.4    1e-21   
ref|XP_009356047.1|  PREDICTED: probable calcium-binding protein ...  98.2    1e-21   
ref|XP_006303188.1|  hypothetical protein CARUB_v10010474mg           98.2    1e-21   
ref|XP_008356663.1|  PREDICTED: probable calcium-binding protein ...  98.2    1e-21   
gb|KEH30330.1|  EF hand calcium-binding family protein                97.4    1e-21   
emb|CAD41532.1|  OSJNBb0091E11.1                                      98.6    1e-21   
emb|CAC34625.1|  putative calmodulin-related protein                  98.2    1e-21   
ref|XP_008374843.1|  PREDICTED: probable calcium-binding protein ...  98.2    1e-21   
ref|XP_010459434.1|  PREDICTED: probable calcium-binding protein ...  98.2    1e-21   
ref|XP_001785095.1|  predicted protein                                97.4    1e-21   
ref|XP_009388516.1|  PREDICTED: calmodulin-like protein 8             97.4    1e-21   
emb|CDY19196.1|  BnaC05g13970D                                        98.2    1e-21   
ref|XP_008809156.1|  PREDICTED: probable calcium-binding protein ...  98.2    1e-21   
ref|XP_011002781.1|  PREDICTED: calcium-binding protein CML24-like    97.4    1e-21   
ref|XP_009380286.1|  PREDICTED: probable calcium-binding protein ...  97.8    1e-21   
ref|XP_006120374.1|  PREDICTED: calmodulin, striated muscle-like      97.4    1e-21   
ref|XP_011427007.1|  PREDICTED: calmodulin-A-like                     97.4    2e-21   
ref|XP_003530955.1|  PREDICTED: calcium-binding allergen Ole e 8      98.2    2e-21   
ref|XP_002322096.1|  calcium binding family protein                   97.8    2e-21   
ref|XP_008808789.1|  PREDICTED: probable calcium-binding protein ...  97.4    2e-21   
ref|XP_010917630.1|  PREDICTED: calmodulin-like protein 11            97.4    2e-21   
ref|XP_009110358.1|  PREDICTED: probable calcium-binding protein ...  97.8    2e-21   
gb|KFK43984.1|  hypothetical protein AALP_AA1G199600                  97.8    2e-21   
ref|XP_009408507.1|  PREDICTED: calmodulin-like protein 11            97.1    2e-21   
emb|CAC43238.1|  calcium binding protein                              97.8    2e-21   
sp|Q9M7R0.1|ALL8_OLEEU  RecName: Full=Calcium-binding allergen Ol...  97.8    2e-21   
emb|CDX96729.1|  BnaA08g22720D                                        97.8    2e-21   
ref|XP_009596484.1|  PREDICTED: probable calcium-binding protein ...  97.8    2e-21   
ref|XP_010528534.1|  PREDICTED: calcium-binding protein CML24-like    97.4    2e-21   
gb|KFK41806.1|  hypothetical protein AALP_AA2G174300                  97.4    2e-21   
gb|ACN35459.1|  unknown                                               99.0    2e-21   
gb|AAF31152.1|AF078680_1  calcium-binding protein                     97.8    2e-21   
gb|KFK40244.1|  hypothetical protein AALP_AA3G348900                  98.6    2e-21   
gb|EMT17394.1|  Putative calcium-binding protein CML18                97.4    2e-21   
ref|XP_006367611.1|  PREDICTED: probable calcium-binding protein ...  97.8    2e-21   
gb|ACG37753.1|  calmodulin                                            98.6    2e-21   
ref|XP_002734090.1|  PREDICTED: calmodulin-like                       97.1    2e-21   
ref|XP_002317881.2|  calcium binding family protein                   97.4    2e-21   
ref|XP_010274712.1|  PREDICTED: calcium-binding allergen Ole e 8      97.4    2e-21   
gb|KFK37167.1|  hypothetical protein AALP_AA4G222400                  97.4    2e-21   
emb|CDP17785.1|  unnamed protein product                              97.1    2e-21   
ref|XP_010924246.1|  PREDICTED: probable calcium-binding protein ...    100   2e-21   
ref|XP_009360087.1|  PREDICTED: probable calcium-binding protein ...  97.1    2e-21   
gb|EAY97840.1|  hypothetical protein OsI_19761                        98.2    2e-21   
ref|XP_006095104.1|  PREDICTED: calmodulin-like                       97.1    2e-21   
ref|XP_011008351.1|  PREDICTED: probable calcium-binding protein ...  97.4    3e-21   
gb|EYU46104.1|  hypothetical protein MIMGU_mgv1a022077mg              97.1    3e-21   
ref|XP_010476999.1|  PREDICTED: probable calcium-binding protein ...  97.4    3e-21   
ref|XP_009386769.1|  PREDICTED: calmodulin-like                       96.7    3e-21   
ref|NP_001237178.1|  uncharacterized protein LOC100527005             96.7    3e-21   
ref|XP_002310432.2|  hypothetical protein POPTR_0007s01960g           98.2    3e-21   
ref|XP_010520850.1|  PREDICTED: calmodulin-like protein 2             96.7    3e-21   
ref|NP_001055397.1|  Os05g0380900                                     97.8    3e-21   
ref|XP_006366822.1|  PREDICTED: calmodulin-like protein 3-like        96.7    3e-21   
ref|XP_010506196.1|  PREDICTED: calmodulin-like protein 5             98.2    3e-21   
ref|NP_565996.1|  calmodulin-like protein MSS3                        98.2    3e-21   
ref|XP_008232680.1|  PREDICTED: calmodulin-like                       97.8    3e-21   
gb|AFW81600.1|  polcalcin Jun o 2                                     97.4    3e-21   
emb|CDY70127.1|  BnaA06g38470D                                        97.1    4e-21   
ref|XP_009123945.1|  PREDICTED: calmodulin-like protein 5             97.1    4e-21   
ref|XP_006851533.1|  hypothetical protein AMTR_s00040p00172050        97.4    4e-21   
ref|XP_009149267.1|  PREDICTED: probable calcium-binding protein ...  96.7    4e-21   
gb|KJB30717.1|  hypothetical protein B456_005G156600                  96.7    4e-21   
ref|XP_011026425.1|  PREDICTED: calmodulin-like protein 3             97.8    4e-21   
sp|P14533.1|CABO_DORPE  RecName: Full=Squidulin; AltName: Full=Op...  96.3    4e-21   
gb|AAB03218.1|  calmodulin-like myosin-light chain                    96.3    4e-21   
ref|XP_007036791.1|  Calcium-binding EF-hand family protein           96.7    4e-21   
ref|XP_001779716.1|  predicted protein                                95.9    4e-21   
ref|XP_007144825.1|  hypothetical protein PHAVU_007G187200g           96.3    4e-21   
ref|XP_010467315.1|  PREDICTED: calmodulin-like protein 1 isoform X1  97.1    4e-21   
ref|XP_007163958.1|  hypothetical protein PHAVU_L002000g              96.7    4e-21   
ref|XP_009786057.1|  PREDICTED: calmodulin-like protein 8             96.3    4e-21   
ref|XP_010517286.1|  PREDICTED: calmodulin-like protein 1             97.1    5e-21   
ref|NP_191503.1|  calmodulin-like protein 4                           97.4    5e-21   
ref|XP_004228711.1|  PREDICTED: probable calcium-binding protein ...  96.7    5e-21   
ref|XP_009607745.1|  PREDICTED: calmodulin-like protein 3             96.3    5e-21   
ref|XP_010036949.1|  PREDICTED: probable calcium-binding protein ...  96.3    5e-21   
ref|XP_006851809.1|  hypothetical protein AMTR_s00041p00030040        97.4    5e-21   
ref|XP_002305867.1|  putative calmodulin-related family protein       96.3    5e-21   
ref|XP_003372739.1|  EF hand domain containing protein                97.8    5e-21   
ref|XP_001768906.1|  predicted protein                                95.5    5e-21   
prf||0608335A  calmodulin                                             95.9    6e-21   
ref|XP_002593251.1|  hypothetical protein BRAFLDRAFT_115029           95.9    6e-21   
ref|XP_009419782.1|  PREDICTED: calmodulin-like protein 11            95.9    6e-21   
ref|XP_001766863.1|  predicted protein                                95.5    6e-21   
gb|AHA51313.1|  EF-hand_1 domain-containing protein                   95.9    6e-21   
ref|XP_010098458.1|  Calmodulin-like protein 1                        95.5    6e-21   
ref|NP_001053179.1|  Os04g0492800                                     97.8    6e-21   
ref|XP_008359373.1|  PREDICTED: calmodulin-like protein 8             95.5    6e-21   
ref|NP_001147205.1|  calmodulin                                       97.4    6e-21   
ref|XP_006662725.1|  PREDICTED: probable calcium-binding protein ...  96.7    7e-21   
ref|XP_009799079.1|  PREDICTED: probable calcium-binding protein ...  96.3    7e-21   
ref|XP_010671432.1|  PREDICTED: calcium-binding allergen Ole e 8-...  96.3    7e-21   
ref|XP_006299618.1|  hypothetical protein CARUB_v10015796mg           97.1    7e-21   
ref|XP_005704341.1|  calmodulin isoform 1                             95.9    7e-21   
ref|XP_008673745.1|  PREDICTED: probable calcium-binding protein ...  96.7    8e-21   
gb|EYC14046.1|  hypothetical protein Y032_0042g679                    95.5    8e-21   
ref|NP_001173067.1|  Os02g0606501                                     95.9    8e-21   
gb|KJB42986.1|  hypothetical protein B456_007G178400                  95.5    8e-21   
gb|KDO85857.1|  hypothetical protein CISIN_1g047502mg                 95.5    8e-21   
gb|KJB53034.1|  hypothetical protein B456_008G289600                  95.5    8e-21   
gb|EYC14045.1|  hypothetical protein Y032_0042g679                    95.5    8e-21   
ref|XP_009142186.1|  PREDICTED: calmodulin-like protein 5             96.7    8e-21   
ref|XP_010097540.1|  Calmodulin-like protein 5                        96.3    8e-21   
ref|XP_011073627.1|  PREDICTED: probable calcium-binding protein ...  95.5    9e-21   
ref|XP_007208587.1|  hypothetical protein PRUPE_ppa023004mg           95.1    9e-21   
ref|XP_002881895.1|  hypothetical protein ARALYDRAFT_903714           96.7    9e-21   
gb|ABR17206.1|  unknown                                               97.4    9e-21   
gb|KEQ79382.1|  putative calmodulin                                   95.5    9e-21   
ref|XP_007162475.1|  hypothetical protein PHAVU_001G155400g           95.1    9e-21   
ref|XP_004302046.1|  PREDICTED: calmodulin-like protein 11            95.1    9e-21   
ref|NP_001041950.2|  Os01g0135700                                     95.9    9e-21   
ref|XP_009147069.1|  PREDICTED: calmodulin-like protein 3             95.5    1e-20   
emb|CDY23356.1|  BnaC04g48840D                                        96.7    1e-20   
ref|XP_001768907.1|  predicted protein                                95.9    1e-20   
ref|XP_010279286.1|  PREDICTED: calmodulin-like protein 11            95.1    1e-20   
ref|XP_010508448.1|  PREDICTED: calmodulin-like protein 5             96.7    1e-20   
gb|KEQ93845.1|  hypothetical protein AUEXF2481DRAFT_6419              95.5    1e-20   
emb|CDY30399.1|  BnaA04g25000D                                        96.7    1e-20   
ref|XP_008235348.1|  PREDICTED: calmodulin-like protein 11            95.1    1e-20   
ref|XP_004486916.1|  PREDICTED: calmodulin-like protein 5-like        95.9    1e-20   
gb|KEQ67258.1|  putative calmodulin                                   95.1    1e-20   
ref|XP_004241038.1|  PREDICTED: calmodulin-like protein 8             95.1    1e-20   
ref|XP_004290639.1|  PREDICTED: calmodulin-like protein 8             94.7    1e-20   
gb|KDP23657.1|  hypothetical protein JCGZ_23490                       94.7    1e-20   
ref|XP_003465878.1|  PREDICTED: calmodulin-like                       94.7    1e-20   
ref|XP_009611663.1|  PREDICTED: calmodulin-like protein 8             95.1    1e-20   
ref|XP_011032625.1|  PREDICTED: calmodulin-like protein 11            94.7    1e-20   
ref|XP_004605359.1|  PREDICTED: calmodulin-like protein 3             94.7    1e-20   
ref|XP_007295339.1|  calmodulin                                       95.5    1e-20   
ref|XP_011084127.1|  PREDICTED: calmodulin-like protein 3             96.3    1e-20   
ref|XP_006122412.1|  PREDICTED: calmodulin                            94.7    1e-20   
ref|NP_187405.1|  calmodulin-like protein 3                           94.7    1e-20   
ref|XP_011080544.1|  PREDICTED: calmodulin-like protein 3             94.7    1e-20   
gb|EPX74846.1|  calmodulin Cam1                                       94.7    1e-20   
ref|XP_009048149.1|  hypothetical protein LOTGIDRAFT_148903           94.7    2e-20   
ref|XP_010517888.1|  PREDICTED: calmodulin-like protein 5             96.3    2e-20   
ref|XP_009801939.1|  PREDICTED: probable calcium-binding protein ...  95.5    2e-20   
ref|XP_009799072.1|  PREDICTED: probable calcium-binding protein ...  95.9    2e-20   
ref|XP_007200520.1|  hypothetical protein PRUPE_ppa012929mg           94.7    2e-20   
ref|XP_003568563.1|  PREDICTED: probable calcium-binding protein ...  95.5    2e-20   
ref|XP_006296176.1|  hypothetical protein CARUB_v10025336mg           96.3    2e-20   
ref|XP_006397493.1|  hypothetical protein EUTSA_v10001753mg           97.1    2e-20   
gb|EYC14044.1|  hypothetical protein Y032_0042g679                    95.5    2e-20   
gb|KHM98879.1|  Putative calcium-binding protein CML18                95.9    2e-20   



>ref|XP_009789240.1| PREDICTED: probable calcium-binding protein CML36 [Nicotiana 
sylvestris]
Length=219

 Score =   238 bits (608),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 129/154 (84%), Gaps = 4/154 (3%)
 Frame = -1

Query  665  DEISPDELSGL----YAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLML  498
            +EIS DE S +    YAELVQAF +ID D DGKIRKEELE +LS+VG EPPS+EEL L+L
Sbjct  63   NEISADEWSEISAEVYAELVQAFHVIDTDGDGKIRKEELEAILSRVGTEPPSKEELTLLL  122

Query  497  SEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  318
             EVDRDGDGCISLEEF  + SAF PPSCD ELRDAFDFFD DHDG I+AEELFNVF+TIG
Sbjct  123  DEVDRDGDGCISLEEFGAIRSAFGPPSCDGELRDAFDFFDADHDGMITAEELFNVFRTIG  182

Query  317  DSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  216
            D RCTLEDCRRMI GVD NGDGFVCFEDFC MME
Sbjct  183  DGRCTLEDCRRMIRGVDKNGDGFVCFEDFCFMME  216



>ref|XP_009601106.1| PREDICTED: probable calcium-binding protein CML36 [Nicotiana 
tomentosiformis]
Length=219

 Score =   235 bits (600),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 116/154 (75%), Positives = 129/154 (84%), Gaps = 4/154 (3%)
 Frame = -1

Query  665  DEISPDELSGL----YAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLML  498
            +EIS D+ S +    YAELVQAF +ID D DGKI KEELE +LS+VG EPPS+EEL L+L
Sbjct  63   NEISADKWSEISAEVYAELVQAFHMIDTDGDGKIMKEELEAILSRVGTEPPSKEELTLLL  122

Query  497  SEVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIG  318
             EVDRDGDGCISLEEF  +SSAF PPSCD ELRD FDFFD DHDGKI+AE+LFNVF+TIG
Sbjct  123  DEVDRDGDGCISLEEFGAISSAFGPPSCDGELRDVFDFFDADHDGKITAEKLFNVFRTIG  182

Query  317  DSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  216
            D RCTLEDCRRMI GVD NGDGFVCF+DFC MME
Sbjct  183  DGRCTLEDCRRMIRGVDKNGDGFVCFDDFCLMME  216



>ref|XP_011075386.1| PREDICTED: probable calcium-binding protein CML36 [Sesamum indicum]
Length=221

 Score =   230 bits (587),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 130/149 (87%), Gaps = 4/149 (3%)
 Frame = -1

Query  662  EISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDR  483
            EIS D    +Y EL QAF++IDRD DGKI+KEELE LL ++GAEPP++EEL+LMLS+VDR
Sbjct  72   EISAD----VYFELKQAFEMIDRDGDGKIKKEELEALLCRLGAEPPNQEELQLMLSDVDR  127

Query  482  DGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCT  303
            DGDGCI+LEEF  + SAFAPP+CD ELRD FDFFD+D DGKI+AEELFNVFKTIGDS+CT
Sbjct  128  DGDGCITLEEFYAIGSAFAPPTCDMELRDTFDFFDSDRDGKITAEELFNVFKTIGDSQCT  187

Query  302  LEDCRRMILGVDNNGDGFVCFEDFCRMME  216
            LEDCRRMI GVD NGDGFVCFEDF RMME
Sbjct  188  LEDCRRMISGVDTNGDGFVCFEDFSRMME  216



>ref|XP_011078930.1| PREDICTED: probable calcium-binding protein CML36 [Sesamum indicum]
Length=220

 Score =   227 bits (579),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 113/153 (74%), Positives = 130/153 (85%), Gaps = 4/153 (3%)
 Frame = -1

Query  662  EISPDEL----SGLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLS  495
            EISP+E     + +Y EL QAF++IDRD DGKI+KEELE LL ++G EPP +EEL+LML+
Sbjct  64   EISPNEWPEIPADIYFELKQAFEMIDRDGDGKIKKEELEGLLCRLGPEPPCQEELKLMLT  123

Query  494  EVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGD  315
            EVDRDGDGCISLEEF  + SAFAPP+ D ELRDAFDFFD+D DGKI+AEEL NVFKTIGD
Sbjct  124  EVDRDGDGCISLEEFYAIGSAFAPPARDGELRDAFDFFDSDRDGKITAEELLNVFKTIGD  183

Query  314  SRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  216
            +RCTLEDCRRMI GV+ NGDGFVCFEDF RMME
Sbjct  184  ARCTLEDCRRMIRGVNRNGDGFVCFEDFSRMME  216



>ref|XP_009595400.1| PREDICTED: probable calcium-binding protein CML36 [Nicotiana 
tomentosiformis]
Length=209

 Score =   223 bits (569),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 127/149 (85%), Gaps = 4/149 (3%)
 Frame = -1

Query  662  EISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDR  483
            EIS DE    ++E++QAF +ID D DGKIRKE+LE +L++VG +PPS EEL  +L+EVDR
Sbjct  62   EISADE----WSEILQAFHMIDSDGDGKIRKEQLEAILTRVGPDPPSEEELISLLNEVDR  117

Query  482  DGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCT  303
            +GDGCISLEEF  +SSAF PP+CD ELR+AFDFFD DHDGKI+AEELFNVF+TIGD RCT
Sbjct  118  NGDGCISLEEFGAISSAFGPPACDDELRNAFDFFDADHDGKITAEELFNVFRTIGDGRCT  177

Query  302  LEDCRRMILGVDNNGDGFVCFEDFCRMME  216
            L+DCRRMI GVD NGDGFVCFEDFC MME
Sbjct  178  LDDCRRMIRGVDKNGDGFVCFEDFCLMME  206



>gb|EYU20776.1| hypothetical protein MIMGU_mgv1a020784mg [Erythranthe guttata]
Length=209

 Score =   222 bits (565),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = -1

Query  635  LYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  456
            L +EL QAF++IDRD DGKI+KEELE LLS++GAEPPS+EEL+LM+SEVDRDGDGCISLE
Sbjct  59   LCSELKQAFEMIDRDGDGKIKKEELEGLLSRLGAEPPSQEELKLMVSEVDRDGDGCISLE  118

Query  455  EFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMIL  276
            EF  + SAFAPP+CD ELR  FDFFD+D DGKI+AEELF VF+TIGD+RCTLEDCRRMI 
Sbjct  119  EFYAIGSAFAPPTCDGELRSTFDFFDSDRDGKITAEELFRVFETIGDARCTLEDCRRMIK  178

Query  275  GVDNNGDGFVCFEDFCRMME  216
            GVD NGDGFVCFEDF  MM+
Sbjct  179  GVDRNGDGFVCFEDFSLMMD  198



>emb|CDP14208.1| unnamed protein product [Coffea canephora]
Length=238

 Score =   222 bits (566),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 128/152 (84%), Gaps = 4/152 (3%)
 Frame = -1

Query  662  EISPDELS----GLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLS  495
            EI+ DE S    G+Y ++ +AFK+IDRD DGKI ++ELE LLS+VGAEPPS EEL ++LS
Sbjct  82   EITSDEWSEISGGVYEDVKEAFKMIDRDGDGKITRDELEALLSRVGAEPPSAEELNMLLS  141

Query  494  EVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGD  315
            EVDRDGDGCISLEEF  + SAF PPSCDSE+RDAFDFFDTDHDG+I+AEEL+NVF+ IGD
Sbjct  142  EVDRDGDGCISLEEFEAIGSAFGPPSCDSEMRDAFDFFDTDHDGRITAEELYNVFRVIGD  201

Query  314  SRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  219
             +CTL++C+RMI GV  NG GFVCFEDF RMM
Sbjct  202  GQCTLDECQRMISGVGKNGVGFVCFEDFSRMM  233



>gb|EYU18659.1| hypothetical protein MIMGU_mgv1a026895mg [Erythranthe guttata]
Length=224

 Score =   219 bits (559),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 108/153 (71%), Positives = 128/153 (84%), Gaps = 4/153 (3%)
 Frame = -1

Query  662  EISPDELSGL----YAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLS  495
            EIS +E S +    Y +L QAF++IDRD DGK+ K ELE LL  +GA+PPSREELRLMLS
Sbjct  67   EISTEEWSEISADVYFDLKQAFEMIDRDGDGKVTKAELEDLLCGLGADPPSREELRLMLS  126

Query  494  EVDRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGD  315
            EVDRDGDGCI+LEEF  + SAFAPP+CD+E+R+ FDFFD+D DGKI+AEELF VF+TIGD
Sbjct  127  EVDRDGDGCITLEEFHSIGSAFAPPTCDTEMRETFDFFDSDRDGKITAEELFGVFRTIGD  186

Query  314  SRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  216
            ++CTLEDCRRMI GVD NGDGFVCFEDF  MM+
Sbjct  187  AKCTLEDCRRMIRGVDRNGDGFVCFEDFSLMMD  219



>ref|XP_009765839.1| PREDICTED: probable calcium-binding protein CML36 [Nicotiana 
sylvestris]
Length=209

 Score =   219 bits (557),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 105/150 (70%), Positives = 126/150 (84%), Gaps = 4/150 (3%)
 Frame = -1

Query  665  DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVD  486
            ++IS DE    ++E++QAF +ID   DGKIRKE+LE +L++VG +PPS EEL  +L+EVD
Sbjct  61   NDISADE----WSEILQAFHMIDSGGDGKIRKEQLEAILTRVGPDPPSEEELISLLNEVD  116

Query  485  RDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRC  306
            R+GDGCISLEEF  +SSAF PP+CD ELR+AFDFFD +HDGKI+AEELFNVF+TIGD RC
Sbjct  117  RNGDGCISLEEFGAISSAFGPPACDDELRNAFDFFDANHDGKITAEELFNVFRTIGDGRC  176

Query  305  TLEDCRRMILGVDNNGDGFVCFEDFCRMME  216
            TLEDCR MI GVD NGDGFVCFEDFC MME
Sbjct  177  TLEDCRHMIRGVDKNGDGFVCFEDFCLMME  206



>ref|XP_004249249.1| PREDICTED: probable calcium-binding protein CML36 [Solanum lycopersicum]
Length=239

 Score =   218 bits (556),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 125/147 (85%), Gaps = 1/147 (1%)
 Frame = -1

Query  653  PDELSG-LYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDG  477
            P E+S  +Y+ELVQAF++ID D DGKI KEEL  +L++VG++PP+ EEL  +L+EVD +G
Sbjct  90   PSEISAEVYSELVQAFQMIDGDGDGKIHKEELSAILTRVGSDPPTEEELVQLLNEVDVNG  149

Query  476  DGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLE  297
            DGCISL+EF  +SSAF PPSCDSE+RD F+FFD +HDGKI+AEELFNVF+TIGD RCTLE
Sbjct  150  DGCISLQEFGAISSAFGPPSCDSEMRDTFEFFDANHDGKITAEELFNVFRTIGDGRCTLE  209

Query  296  DCRRMILGVDNNGDGFVCFEDFCRMME  216
            +CRRMI GVD NGDGFVCFEDF  MME
Sbjct  210  ECRRMIRGVDKNGDGFVCFEDFSLMME  236



>ref|XP_004249247.1| PREDICTED: probable calcium-binding protein CML36 [Solanum lycopersicum]
Length=209

 Score =   216 bits (551),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 110/151 (73%), Positives = 129/151 (85%), Gaps = 3/151 (2%)
 Frame = -1

Query  659  ISPDELSG---LYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEV  489
            + P+E+S    +YAEL+ AF ++D D DGKIRKEELE +LS+VG EPPS+EEL L+L EV
Sbjct  54   VLPNEISAAEVVYAELIHAFHMMDTDGDGKIRKEELEAILSRVGTEPPSKEELMLLLEEV  113

Query  488  DRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR  309
            D DGDGCISL+EF  +SSAF PP+CDSELRDAFDFFD DHDGKI+A+ELF+VF+ IGDSR
Sbjct  114  DVDGDGCISLQEFGAISSAFGPPACDSELRDAFDFFDADHDGKITADELFSVFRQIGDSR  173

Query  308  CTLEDCRRMILGVDNNGDGFVCFEDFCRMME  216
            CTLE+CRRMI GVD NGDGFVCFEDFC MME
Sbjct  174  CTLEECRRMIRGVDKNGDGFVCFEDFCIMME  204



>ref|XP_006351257.1| PREDICTED: probable calcium-binding protein CML36-like [Solanum 
tuberosum]
Length=205

 Score =   216 bits (550),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 124/147 (84%), Gaps = 1/147 (1%)
 Frame = -1

Query  653  PDELSG-LYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDG  477
            P E+   +Y+ELVQAF++ID D DGKI KEE+  +L++VG++PP+ EEL  +L+EVD +G
Sbjct  56   PSEIPAEVYSELVQAFQMIDVDGDGKIHKEEISAILTRVGSDPPTEEELVQLLNEVDVNG  115

Query  476  DGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLE  297
            DGCISL+EF  +SSAF PPSCDSE+RD F+FFD +HDGKI+AEELFNVF+TIGD RCTLE
Sbjct  116  DGCISLQEFGAISSAFGPPSCDSEMRDTFEFFDANHDGKITAEELFNVFRTIGDGRCTLE  175

Query  296  DCRRMILGVDNNGDGFVCFEDFCRMME  216
            +CRRMI GVD NGDGFVCFEDF  MME
Sbjct  176  ECRRMIRGVDKNGDGFVCFEDFSLMME  202



>ref|XP_006351283.1| PREDICTED: probable calcium-binding protein CML36-like [Solanum 
tuberosum]
Length=211

 Score =   215 bits (548),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 128/151 (85%), Gaps = 3/151 (2%)
 Frame = -1

Query  659  ISPDELSGL---YAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEV  489
            + P+E+S     YAEL+ AF ++D D DGKIRKEELE +LS+VG EPPS+EEL L+L EV
Sbjct  56   VLPNEISAAEVGYAELIHAFHMMDTDGDGKIRKEELEAILSRVGTEPPSKEELMLLLEEV  115

Query  488  DRDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR  309
            D +GDGCISL+EF  +SSAF PP+CDSELRDAFDFFD DHDGKI+A+ELF+VF+ IGDSR
Sbjct  116  DVNGDGCISLQEFGAISSAFGPPACDSELRDAFDFFDADHDGKITADELFSVFRQIGDSR  175

Query  308  CTLEDCRRMILGVDNNGDGFVCFEDFCRMME  216
            CTLE+CRRMI GVD NGDGFVCFEDFC MME
Sbjct  176  CTLEECRRMIRGVDKNGDGFVCFEDFCVMME  206



>ref|XP_002276334.1| PREDICTED: probable calcium-binding protein CML35 [Vitis vinifera]
Length=222

 Score =   213 bits (541),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 117/142 (82%), Gaps = 1/142 (1%)
 Frame = -1

Query  641  SGLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCIS  462
            S +  ELV AFK+IDRD DGKI K ELE LLS+VG EPPS EE+ +MLSEVDRDGDGCIS
Sbjct  79   SDIQTELVHAFKMIDRDGDGKITKRELEALLSRVGVEPPSEEEIMMMLSEVDRDGDGCIS  138

Query  461  LEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRM  282
            LEEF  +SSAF P +CD+ELRDAF FFDTD DGKI+AEEL  VF  IGD RCTLEDC+RM
Sbjct  139  LEEFGAISSAFGP-ACDTELRDAFCFFDTDRDGKITAEELNQVFAAIGDDRCTLEDCQRM  197

Query  281  ILGVDNNGDGFVCFEDFCRMME  216
            I GVD NGDGFVCFEDF RMME
Sbjct  198  IAGVDKNGDGFVCFEDFSRMME  219



>ref|XP_009622394.1| PREDICTED: probable calcium-binding protein CML35 [Nicotiana 
tomentosiformis]
Length=225

 Score =   206 bits (524),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 103/149 (69%), Positives = 122/149 (82%), Gaps = 7/149 (5%)
 Frame = -1

Query  641  SGLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAE-PPSREELRLMLSEVDRDGDGCI  465
            SG+Y++LVQAF LID D DGKIRKE+LE +LS+VG + PPS EEL  +L+EVD++GDGCI
Sbjct  74   SGVYSDLVQAFSLIDGDGDGKIRKEQLEAILSRVGGKSPPSEEELISLLNEVDKNGDGCI  133

Query  464  SLEEFSVLSSAFAPPSCDS------ELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCT  303
            SLE+F ++SSAF      +      E+RDAFDFFDTDHDGKI+AEELFNVF+ IGD+RCT
Sbjct  134  SLEDFGIISSAFELTEATTAEDGGDEMRDAFDFFDTDHDGKITAEELFNVFRMIGDARCT  193

Query  302  LEDCRRMILGVDNNGDGFVCFEDFCRMME  216
            LEDCRRMI  VD NGDGFVCFEDFC MME
Sbjct  194  LEDCRRMIRSVDKNGDGFVCFEDFCLMME  222



>ref|XP_009763879.1| PREDICTED: probable calcium-binding protein CML36 [Nicotiana 
sylvestris]
Length=225

 Score =   205 bits (522),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 106/159 (67%), Positives = 127/159 (80%), Gaps = 9/159 (6%)
 Frame = -1

Query  665  DEISPDELS--GLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAE-PPSREELRLMLS  495
            D+ S +E+S  G+Y++LVQAF LID D DGKIRKE+LE +LS+VG + PPS EEL  +L+
Sbjct  64   DDWSSEEISNSGVYSDLVQAFSLIDGDGDGKIRKEQLEAILSRVGGKSPPSEEELISLLN  123

Query  494  EVDRDGDGCISLEEFSVLSSAFAPPS------CDSELRDAFDFFDTDHDGKISAEELFNV  333
            EVD++GDGCISLE+F ++SSAF  P          E+RDAFDFFD DHDGKI+AEELFNV
Sbjct  124  EVDKNGDGCISLEDFGIISSAFELPEEMTAEDGGDEMRDAFDFFDADHDGKITAEELFNV  183

Query  332  FKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  216
            F+ IGD+RCTLEDCRRMI  VD NGDGFVCFEDFC MME
Sbjct  184  FRMIGDARCTLEDCRRMIRSVDKNGDGFVCFEDFCLMME  222



>ref|XP_007202521.1| hypothetical protein PRUPE_ppa010940mg [Prunus persica]
 gb|EMJ03720.1| hypothetical protein PRUPE_ppa010940mg [Prunus persica]
Length=229

 Score =   197 bits (500),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 96/140 (69%), Positives = 112/140 (80%), Gaps = 0/140 (0%)
 Frame = -1

Query  635  LYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  456
            L  ++ QAFKLIDRD+DG + ++ELE LLS++GA+PPS+EE+ LMLSEVDR+G+G ISLE
Sbjct  87   LQLDMAQAFKLIDRDNDGVVSRKELEALLSRLGADPPSQEEVMLMLSEVDREGNGSISLE  146

Query  455  EFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMIL  276
                       P+ DSELRDAF+ FD+DHDGKISAEEL NVF  IGD RCTLEDCRRMI 
Sbjct  147  ALLSRVGPVCGPAADSELRDAFEVFDSDHDGKISAEELLNVFTAIGDDRCTLEDCRRMIA  206

Query  275  GVDNNGDGFVCFEDFCRMME  216
            GVD NGDGFVCFEDF RMME
Sbjct  207  GVDKNGDGFVCFEDFARMME  226



>ref|XP_008240735.1| PREDICTED: probable calcium-binding protein CML36 [Prunus mume]
Length=229

 Score =   195 bits (496),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/140 (68%), Positives = 112/140 (80%), Gaps = 0/140 (0%)
 Frame = -1

Query  635  LYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  456
            L  ++ QAFKLIDRD+DG + ++ELE LLS++GA+PPS+EE+ LMLSEVDR+G+G I+L+
Sbjct  87   LQLDMAQAFKLIDRDNDGVVSRKELEALLSRLGADPPSQEEVMLMLSEVDREGNGSITLD  146

Query  455  EFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMIL  276
                       P+ DSELRDAF  FD+DHDGKISAEELFNVF  IGD RCTLEDCRRMI 
Sbjct  147  ALLNRVGPVCGPAADSELRDAFKVFDSDHDGKISAEELFNVFTAIGDDRCTLEDCRRMIA  206

Query  275  GVDNNGDGFVCFEDFCRMME  216
            GVD NGDGFVCFEDF RMME
Sbjct  207  GVDKNGDGFVCFEDFARMME  226



>emb|CBI30075.3| unnamed protein product [Vitis vinifera]
Length=175

 Score =   192 bits (489),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 105/126 (83%), Gaps = 1/126 (1%)
 Frame = -1

Query  593  DDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSC  414
            D DGKI K ELE LLS+VG EPPS EE+ +MLSEVDRDGDGCISLEEF  +SSAF P +C
Sbjct  48   DGDGKITKRELEALLSRVGVEPPSEEEIMMMLSEVDRDGDGCISLEEFGAISSAFGP-AC  106

Query  413  DSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFED  234
            D+ELRDAF FFDTD DGKI+AEEL  VF  IGD RCTLEDC+RMI GVD NGDGFVCFED
Sbjct  107  DTELRDAFCFFDTDRDGKITAEELNQVFAAIGDDRCTLEDCQRMIAGVDKNGDGFVCFED  166

Query  233  FCRMME  216
            F RMME
Sbjct  167  FSRMME  172



>ref|XP_010277607.1| PREDICTED: probable calcium-binding protein CML36 [Nelumbo nucifera]
Length=219

 Score =   194 bits (492),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 111/139 (80%), Gaps = 1/139 (1%)
 Frame = -1

Query  632  YAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEE  453
            + E +QAFKLIDRD DGK+   ELE LLS++G EPPS+EE+ LML+E+D+DGDGCISLEE
Sbjct  78   HLEHLQAFKLIDRDGDGKVTIHELEGLLSRIGGEPPSKEEMLLMLTEIDQDGDGCISLEE  137

Query  452  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG  273
            F  +SS+  P +  S+LR+AF+ FD D DGKISAEEL  VF  IGD RCTLEDCRRMI  
Sbjct  138  FEAISSSLVPAAL-SDLREAFNVFDADRDGKISAEELLGVFSAIGDDRCTLEDCRRMIRS  196

Query  272  VDNNGDGFVCFEDFCRMME  216
            VD NGDGFVCFEDF RMME
Sbjct  197  VDTNGDGFVCFEDFSRMME  215



>gb|KDP26218.1| hypothetical protein JCGZ_22464 [Jatropha curcas]
Length=219

 Score =   190 bits (482),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 108/140 (77%), Gaps = 0/140 (0%)
 Frame = -1

Query  635  LYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  456
             Y++LVQAFKLIDRD+DG + + ELE LLS++GAEPPS+EE+  MLSEVD  GDGCIS+E
Sbjct  77   FYSDLVQAFKLIDRDNDGIVSRRELEALLSRLGAEPPSQEEVATMLSEVDHVGDGCISVE  136

Query  455  EFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMIL  276
                   +   P+ D ELR AF+FFD D DGKI+AEELF V+K IGD RCT EDC RMI 
Sbjct  137  ALMNRIGSACEPAGDDELRVAFEFFDADQDGKITAEELFGVYKAIGDERCTFEDCMRMIA  196

Query  275  GVDNNGDGFVCFEDFCRMME  216
             VD NGDGFVCFEDFCRMME
Sbjct  197  SVDKNGDGFVCFEDFCRMME  216



>emb|CDY14768.1| BnaC04g47650D [Brassica napus]
Length=217

 Score =   182 bits (463),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 95/153 (62%), Positives = 113/153 (74%), Gaps = 8/153 (5%)
 Frame = -1

Query  659  ISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRD  480
            + P +  G Y+EL+QAFKLIDRDDDG + + +L  LLS++  EPPS+EE+ LML EVD  
Sbjct  61   VLPGDHDGFYSELIQAFKLIDRDDDGVVSRRDLAALLSRLSPEPPSQEEVTLMLQEVDGG  120

Query  479  GDGCISLEEFSVLSSAFAPPSCDS-----ELRDAFDFFDTDHDGKISAEELFNVFKTIGD  315
            GDGCISLEE   L+S  A  S DS     E+R+ F+FFD DHDG+ISAEEL  VF  IGD
Sbjct  121  GDGCISLEE---LASRVAGTSSDSDEGSVEMREVFEFFDVDHDGRISAEELHRVFGVIGD  177

Query  314  SRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  216
             RCTLE+C RMI  VD NGDGFVCF+DFCRMME
Sbjct  178  ERCTLEECVRMIATVDGNGDGFVCFDDFCRMME  210



>ref|XP_007028573.1| Calcium-binding EF-hand family protein, putative [Theobroma cacao]
 gb|EOY09075.1| Calcium-binding EF-hand family protein, putative [Theobroma cacao]
Length=180

 Score =   181 bits (459),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/141 (67%), Positives = 108/141 (77%), Gaps = 3/141 (2%)
 Frame = -1

Query  629  AELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  450
            +EL QAFK+ID+D+DG I + ELE LLS+V  +PPSREE+ LMLSEV  DG GCISL+  
Sbjct  35   SELCQAFKIIDKDNDGVITRSELEALLSKVARQPPSREEVSLMLSEVYGDGVGCISLDTL  94

Query  449  --SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFK-TIGDSRCTLEDCRRMI  279
               V+  A   P+C+ ELR+ FD FDTDHDGKI+AEEL   FK TIGD RCTLEDCRRMI
Sbjct  95   MTQVVVPACDEPACEPELRETFDIFDTDHDGKITAEELMAFFKETIGDERCTLEDCRRMI  154

Query  278  LGVDNNGDGFVCFEDFCRMME  216
              VD NGDGFVCFEDF RMME
Sbjct  155  ASVDKNGDGFVCFEDFARMME  175



>ref|XP_009141989.1| PREDICTED: probable calcium-binding protein CML35 [Brassica rapa]
Length=215

 Score =   180 bits (456),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 109/145 (75%), Gaps = 8/145 (6%)
 Frame = -1

Query  635  LYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  456
             Y+EL+QAFKLIDRDDDG + ++EL  LLS +  EPPS+EE+ LML EVD  GDGCISLE
Sbjct  67   FYSELIQAFKLIDRDDDGVVSRKELAALLSGLSPEPPSQEEVTLMLQEVDGGGDGCISLE  126

Query  455  EFSVLSSAFAPPSCDS-----ELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDC  291
            E   L+S  A  S DS     E+R+ F+FFD DHDG+ISAEEL  VF  IGD RCTLE+C
Sbjct  127  E---LASRVAGTSSDSDEGSVEMREVFEFFDLDHDGRISAEELHRVFGVIGDERCTLEEC  183

Query  290  RRMILGVDNNGDGFVCFEDFCRMME  216
             RMI  VD NGDGFVCF+DFCRMME
Sbjct  184  VRMIATVDGNGDGFVCFDDFCRMME  208



>ref|XP_008392376.1| PREDICTED: LOW QUALITY PROTEIN: probable calcium-binding protein 
CML36 [Malus domestica]
Length=220

 Score =   180 bits (456),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 108/137 (79%), Gaps = 0/137 (0%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            ++ QAFKLIDRD+DG + ++ELE LLS++G +PPS+EE+ LMLSEVDRDG+G I+LE   
Sbjct  81   DMAQAFKLIDRDNDGVVSRKELEALLSRLGNDPPSQEEVTLMLSEVDRDGNGSITLEALL  140

Query  446  VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVD  267
                  + P+ DSELRDAF+  DTD+DGKISAEEL  VF  IGD RCTLE+CRRMI GVD
Sbjct  141  NQVGPVSGPAADSELRDAFEVXDTDNDGKISAEELLRVFTAIGDERCTLEECRRMIDGVD  200

Query  266  NNGDGFVCFEDFCRMME  216
             +GDGFVCFE+F  MME
Sbjct  201  KDGDGFVCFEEFVHMME  217


 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = -1

Query  665  DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVD  486
            +++ P       +EL  AF++ D D+DGKI  EEL  + + +G E  + EE R M+  VD
Sbjct  141  NQVGPVSGPAADSELRDAFEVXDTDNDGKISAEELLRVFTAIGDERCTLEECRRMIDGVD  200

Query  485  RDGDGCISLEEF  450
            +DGDG +  EEF
Sbjct  201  KDGDGFVCFEEF  212



>ref|XP_006364430.1| PREDICTED: probable calcium-binding protein CML35-like [Solanum 
tuberosum]
Length=216

 Score =   179 bits (454),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 102/161 (63%), Positives = 125/161 (78%), Gaps = 12/161 (7%)
 Frame = -1

Query  665  DEISPDELS-----GLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAE-PPSREELRL  504
            +EIS D+ S     G+Y++LVQAF +ID + DGKIRKE+LE +LS+VG + PP+ EEL L
Sbjct  54   NEISADDWSEISTAGVYSDLVQAFSVID-NGDGKIRKEQLEAILSRVGGKSPPTEEELVL  112

Query  503  MLSEVDRDGDGCISLEEFSVLSSAF--APPSCD---SELRDAFDFFDTDHDGKISAEELF  339
            +L E+D++GDGCISLE F  ++SAF   PPS      E+RDAFDFFD DHDGKI+ EELF
Sbjct  113  LLDELDKNGDGCISLENFETITSAFEPTPPSAAEDAGEMRDAFDFFDEDHDGKITGEELF  172

Query  338  NVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  216
            NVF+ IGD RCTLE+C+RMI  VD NGDGFVCFEDFC MME
Sbjct  173  NVFRMIGDERCTLEECKRMITSVDKNGDGFVCFEDFCLMME  213



>ref|XP_004303614.1| PREDICTED: probable calcium-binding protein CML36 [Fragaria vesca 
subsp. vesca]
Length=210

 Score =   178 bits (452),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 91/141 (65%), Positives = 110/141 (78%), Gaps = 7/141 (5%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQV-GAEPPSREELRLMLSEVDRDGDGCISLEEF  450
            ++ QAF+LIDRD+DG + + ELE LL ++ GAEPP++EE+ +MLSEVD DGDGCI LE  
Sbjct  70   DMAQAFRLIDRDNDGVVSRTELEALLKRLLGAEPPTQEEVAMMLSEVDGDGDGCIPLE--  127

Query  449  SVLSSAFAP---PSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMI  279
              L   F P   P+ DSELR+AF+ FDTDHDGKISAEEL +VF  IGD RCTLE+CRRMI
Sbjct  128  -ALLHRFGPGCEPAADSELREAFEVFDTDHDGKISAEELLSVFTAIGDERCTLEECRRMI  186

Query  278  LGVDNNGDGFVCFEDFCRMME  216
              VD NGDGFVCF+DF RMM+
Sbjct  187  AEVDKNGDGFVCFQDFARMMD  207


 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = -1

Query  629  AELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  450
            +EL +AF++ D D DGKI  EEL  + + +G E  + EE R M++EVD++GDG +  ++F
Sbjct  143  SELREAFEVFDTDHDGKISAEELLSVFTAIGDERCTLEECRRMIAEVDKNGDGFVCFQDF  202

Query  449  S  447
            +
Sbjct  203  A  203



>ref|XP_009341958.1| PREDICTED: LOW QUALITY PROTEIN: probable calcium-binding protein 
CML36, partial [Pyrus x bretschneideri]
Length=291

 Score =   180 bits (456),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 107/137 (78%), Gaps = 0/137 (0%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            ++ QAFKLIDRD+DG + ++ELE LL ++G  PPS+EE+ LMLSEVDRDG+G I+LE   
Sbjct  152  DMAQAFKLIDRDNDGVVSRKELEALLCRLGNAPPSQEEVTLMLSEVDRDGNGSITLEALL  211

Query  446  VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVD  267
                  + P+ DSELRDAF+ FDTD+DGKISAEEL  VF  IGD RCTLE+CRRMI GVD
Sbjct  212  NQVGPVSGPAADSELRDAFEVFDTDNDGKISAEELLRVFTAIGDERCTLEECRRMIDGVD  271

Query  266  NNGDGFVCFEDFCRMME  216
             +GDGFVCFE+F  MME
Sbjct  272  KDGDGFVCFEEFVHMME  288


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = -1

Query  665  DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVD  486
            +++ P       +EL  AF++ D D+DGKI  EEL  + + +G E  + EE R M+  VD
Sbjct  212  NQVGPVSGPAADSELRDAFEVFDTDNDGKISAEELLRVFTAIGDERCTLEECRRMIDGVD  271

Query  485  RDGDGCISLEEF  450
            +DGDG +  EEF
Sbjct  272  KDGDGFVCFEEF  283



>ref|XP_008376081.1| PREDICTED: probable calcium-binding protein CML36 [Malus domestica]
Length=281

 Score =   179 bits (455),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 105/140 (75%), Gaps = 0/140 (0%)
 Frame = -1

Query  635  LYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  456
            L  ++ +AFKLIDRD+DG + ++ELE LL Q+G  PPS+EE+ LMLSEVDRDG G I+LE
Sbjct  139  LQLDMAKAFKLIDRDNDGVVSRKELEALLCQLGNNPPSQEEVTLMLSEVDRDGSGSITLE  198

Query  455  EFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMIL  276
                     + P  DSELRDAF+ FDTD+DGKISAEEL  VF  IGD RCTLE+CRRMI 
Sbjct  199  ALLNQVGPVSGPPADSELRDAFEVFDTDNDGKISAEELLRVFTAIGDERCTLEECRRMIA  258

Query  275  GVDNNGDGFVCFEDFCRMME  216
             VD NGDGFVCFE+F  MME
Sbjct  259  EVDKNGDGFVCFEEFVHMME  278



>ref|XP_002534401.1| Calcium-binding allergen Ole e, putative [Ricinus communis]
 gb|EEF27979.1| Calcium-binding allergen Ole e, putative [Ricinus communis]
Length=211

 Score =   177 bits (449),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 109/143 (76%), Gaps = 5/143 (3%)
 Frame = -1

Query  641  SGLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCIS  462
            S  ++ELVQAFKL+D D+DG + + +LE LL ++GAE    EE+  MLSEVDRDGDGCIS
Sbjct  70   SDFFSELVQAFKLMDNDNDGIVSRTQLESLLIRLGAE----EEVATMLSEVDRDGDGCIS  125

Query  461  LEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRR  285
            +E   S +      P+ D ELR AF+FFDTDHDGKI+AEEL  V+K IGD RCTL+DCRR
Sbjct  126  VEALMSRIGGPACEPAGDDELRVAFEFFDTDHDGKITAEELMGVYKAIGDERCTLDDCRR  185

Query  284  MILGVDNNGDGFVCFEDFCRMME  216
            MI GVD NGDGFVCFEDF RMME
Sbjct  186  MIAGVDKNGDGFVCFEDFARMME  208



>emb|CDY06925.1| BnaA04g23900D [Brassica napus]
Length=217

 Score =   177 bits (449),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 107/142 (75%), Gaps = 2/142 (1%)
 Frame = -1

Query  635  LYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  456
             Y+EL+QAFKLIDRDDDG + ++EL  LLS++  EPPS+EE+ LML EVD  GDGCISLE
Sbjct  69   FYSELIQAFKLIDRDDDGVVSRKELAALLSRLSPEPPSQEEVTLMLQEVDGGGDGCISLE  128

Query  455  EFS--VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRM  282
            E +  V  S+        E+R+ F+FFD DHDG+ISAEEL  VF  IGD RCTLE+C RM
Sbjct  129  ELASRVAGSSSDSDESSVEMREVFEFFDVDHDGRISAEELHRVFGVIGDERCTLEECVRM  188

Query  281  ILGVDNNGDGFVCFEDFCRMME  216
            I  VD NGDGFVCF+DFCRMME
Sbjct  189  IATVDGNGDGFVCFDDFCRMME  210



>gb|KJB35924.1| hypothetical protein B456_006G133800 [Gossypium raimondii]
Length=229

 Score =   175 bits (444),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 106/145 (73%), Gaps = 3/145 (2%)
 Frame = -1

Query  641  SGLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCIS  462
            +  Y EL QAFK++D+D+DG I + ELE LL +V  +PPSR E+ LMLSEVD DGDG I+
Sbjct  82   ANFYLELCQAFKMLDKDNDGVISRSELEALLGKVARQPPSRIEVSLMLSEVDGDGDGYIN  141

Query  461  LEEF--SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFK-TIGDSRCTLEDC  291
            LE     V+  A   P+C+ ELR+ FD FDTDHDGKI+AEEL   FK  IGD RCTLEDC
Sbjct  142  LETLMNQVVGPACDEPACEPELRETFDIFDTDHDGKITAEELMAFFKDKIGDERCTLEDC  201

Query  290  RRMILGVDNNGDGFVCFEDFCRMME  216
            RRMI  VD N DGFVCFEDF RMME
Sbjct  202  RRMIASVDKNEDGFVCFEDFSRMME  226



>gb|KJB16379.1| hypothetical protein B456_002G227200 [Gossypium raimondii]
Length=223

 Score =   174 bits (440),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 87/143 (61%), Positives = 105/143 (73%), Gaps = 4/143 (3%)
 Frame = -1

Query  641  SGLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCIS  462
            +  Y EL QAFK +D+D+DG I + E+E LLS+   +PPS+EE+  ML EVD DGDGCIS
Sbjct  81   ANFYVELCQAFKTMDKDNDGVITRSEVEALLSKFARQPPSQEEISSMLGEVDGDGDGCIS  140

Query  461  LEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFK-TIGDSRCTLEDCRR  285
            LE    L +  A P+C+ ELR+ FD FDTDHDGKI+AEEL   +K  +GD RCTLEDCR 
Sbjct  141  LE---TLINQVAGPACEPELRETFDIFDTDHDGKITAEELMAFYKEKLGDERCTLEDCRL  197

Query  284  MILGVDNNGDGFVCFEDFCRMME  216
            MI  VD NGDGFVCF+DF RMME
Sbjct  198  MIASVDKNGDGFVCFDDFSRMME  220



>ref|XP_002308908.1| Calmodulin-like family protein [Populus trichocarpa]
 gb|ABK96152.1| unknown [Populus trichocarpa]
 gb|EEE92431.1| Calmodulin-like family protein [Populus trichocarpa]
Length=213

 Score =   173 bits (438),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 104/140 (74%), Gaps = 5/140 (4%)
 Frame = -1

Query  635  LYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  456
            LY EL QAFKLIDRD+DG + + ELE LL+++GAEPPS EE+ ++L EVD      IS+E
Sbjct  76   LYFELTQAFKLIDRDNDGLVSRNELEALLTRLGAEPPSSEEMAVILGEVDH-----ISVE  130

Query  455  EFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMIL  276
              +        P+ D ELRDAF FFD+D DGKI+A+EL NV+K  GD +CTLEDCRRMI 
Sbjct  131  ALASRLGTACEPAGDDELRDAFVFFDSDRDGKITADELLNVYKAFGDEKCTLEDCRRMIA  190

Query  275  GVDNNGDGFVCFEDFCRMME  216
             VD NGDGFVCFEDFCRMME
Sbjct  191  VVDKNGDGFVCFEDFCRMME  210



>ref|XP_006421261.1| hypothetical protein CICLE_v10005842mg [Citrus clementina]
 gb|ESR34501.1| hypothetical protein CICLE_v10005842mg [Citrus clementina]
 gb|KDO37861.1| hypothetical protein CISIN_1g027592mg [Citrus sinensis]
Length=221

 Score =   172 bits (437),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/138 (62%), Positives = 108/138 (78%), Gaps = 1/138 (1%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF-  450
            ELVQA KL+DRD+DG + + ELE LL ++GA+PP++EE++ MLSEVDR+GDG I LE   
Sbjct  81   ELVQACKLLDRDNDGVVLRSELEALLIRLGADPPTQEEVKSMLSEVDREGDGYIPLEALI  140

Query  449  SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  270
            S + ++   P+C+ EL++ FDFFD DHDGKI+AEELF VF  +GD  CTL+DCR MI  V
Sbjct  141  SRVGNSSCEPACEPELKETFDFFDADHDGKITAEELFGVFTKLGDELCTLDDCRGMIALV  200

Query  269  DNNGDGFVCFEDFCRMME  216
            D NGDGFVCFEDF RMME
Sbjct  201  DKNGDGFVCFEDFSRMME  218



>ref|NP_001265939.1| Hop-interacting protein THI026 [Solanum lycopersicum]
 gb|AEW69790.1| Hop-interacting protein THI026 [Solanum lycopersicum]
Length=214

 Score =   172 bits (436),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 123/161 (76%), Gaps = 12/161 (7%)
 Frame = -1

Query  665  DEISPDELS-----GLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAE-PPSREELRL  504
            +EIS DE S     G+Y++LV+AF +ID + DGKI+KE+LE +LS+VG + PPS EEL L
Sbjct  52   NEISADEWSDISTAGVYSDLVRAFSVID-NGDGKIKKEKLEAILSRVGGKSPPSEEELVL  110

Query  503  MLSEVDRDGDGCISLEEFSVLSSAF--APPSCDS---ELRDAFDFFDTDHDGKISAEELF  339
            +L E+D +GDGCISLE F  ++SAF   P S      E+RDAFDFFD DHDGKI+ EELF
Sbjct  111  LLDELDENGDGCISLENFETITSAFESTPTSAAGDAGEMRDAFDFFDEDHDGKITGEELF  170

Query  338  NVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  216
            NVF+ IGD RCTLE+C+RMI  VD NGDGFVCF+DFC MME
Sbjct  171  NVFRMIGDERCTLEECKRMITSVDKNGDGFVCFDDFCLMME  211



>ref|XP_008373033.1| PREDICTED: probable calcium-binding protein CML36 [Malus domestica]
Length=223

 Score =   172 bits (436),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 105/140 (75%), Gaps = 0/140 (0%)
 Frame = -1

Query  635  LYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  456
            L  ++ QAFK IDRD+DG + ++ELE LL ++G +P SREE+ LMLSEVDRDG+G ISLE
Sbjct  81   LQLDMAQAFKXIDRDNDGVVSRKELEALLCRLGNDPQSREEVTLMLSEVDRDGNGSISLE  140

Query  455  EFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMIL  276
                     + P+ DSELRDAF+ FDTD+DGKISAEEL + F+ IGD  CTLE+C RMI 
Sbjct  141  AVLNRVGPVSGPAADSELRDAFEVFDTDNDGKISAEELLSFFRAIGDEGCTLEECGRMIA  200

Query  275  GVDNNGDGFVCFEDFCRMME  216
            G D NGDGFVCFE+F  MME
Sbjct  201  GADKNGDGFVCFEEFAHMME  220



>ref|XP_006491566.1| PREDICTED: probable calcium-binding protein CML36-like [Citrus 
sinensis]
Length=221

 Score =   172 bits (435),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 87/141 (62%), Positives = 108/141 (77%), Gaps = 1/141 (1%)
 Frame = -1

Query  635  LYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  456
            L  ELVQA KL+DRD+DG + + ELE LL ++GA+PP++EE+  MLSEVDR+GDG I LE
Sbjct  78   LNYELVQACKLLDRDNDGVVLRSELEALLIRLGADPPTQEEVSSMLSEVDREGDGYIPLE  137

Query  455  EF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMI  279
               S + ++   P+C+ EL++ FDFFD DHDGKI+AEELF VF  +GD  CTL+DCR MI
Sbjct  138  ALISRVGNSSCEPACEPELKETFDFFDADHDGKITAEELFGVFTKLGDELCTLDDCRGMI  197

Query  278  LGVDNNGDGFVCFEDFCRMME  216
              VD NGDGFVCFEDF RMME
Sbjct  198  ALVDKNGDGFVCFEDFSRMME  218



>ref|XP_008790571.1| PREDICTED: probable calcium-binding protein CML17 [Phoenix dactylifera]
Length=216

 Score =   170 bits (431),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 85/133 (64%), Positives = 104/133 (78%), Gaps = 2/133 (2%)
 Frame = -1

Query  611  FKLIDRDDDGKIRKEELEXLLSQVG-AEPPSREELRLMLSEVDRDGDGCISLEEFSVLSS  435
            F + DRD DGKI + EL+ +L ++G A+PP+ EE+  M++EVDRDGDGCISLEEF  + S
Sbjct  82   FAVFDRDGDGKITRHELQAVLRRLGGADPPTEEEVASMVAEVDRDGDGCISLEEFGAIGS  141

Query  434  AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGD  255
            AF PP+  ++LR+AF  FD D DGKISAEEL  VF T+GD  CTLEDCRRMI GVD +GD
Sbjct  142  AFGPPA-GADLREAFAVFDADGDGKISAEELLGVFITLGDEGCTLEDCRRMIGGVDTDGD  200

Query  254  GFVCFEDFCRMME  216
            GFVCFEDF RMM+
Sbjct  201  GFVCFEDFVRMMD  213



>ref|XP_003625055.1| hypothetical protein MTR_7g090450 [Medicago truncatula]
 gb|AES81273.1| EF hand calcium-binding family protein [Medicago truncatula]
 gb|AFK35504.1| unknown [Medicago truncatula]
Length=216

 Score =   169 bits (428),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 110/144 (76%), Gaps = 4/144 (3%)
 Frame = -1

Query  635  LYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  456
            +  EL QAF+LIDRD+DG + +EELE +L+++GA PP+ EE+ LMLSEVD DG GCIS+E
Sbjct  70   VQCELAQAFRLIDRDNDGVVSREELEAVLTRLGARPPTPEEIALMLSEVDSDGKGCISVE  129

Query  455  EF----SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCR  288
                     SS+ + P+ + ELR+AF+ FDTD DG+ISAEEL  VF+ IGD RCTLE+C+
Sbjct  130  TIMNRVGSGSSSGSDPNPEEELREAFEVFDTDRDGRISAEELLRVFRAIGDERCTLEECK  189

Query  287  RMILGVDNNGDGFVCFEDFCRMME  216
            RMI GVD NGDGFVCF++F  MM+
Sbjct  190  RMIAGVDKNGDGFVCFQEFSLMMD  213



>ref|XP_010924236.1| PREDICTED: probable calcium-binding protein CML36 [Elaeis guineensis]
Length=218

 Score =   169 bits (427),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 106/144 (74%), Gaps = 2/144 (1%)
 Frame = -1

Query  644  LSGLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGA-EPPSREELRLMLSEVDRDGDGC  468
            LS   + +   F + DRD DGKI   ELE +L ++G  +PP+ EE+  M++EVDRDGDGC
Sbjct  73   LSPASSSVSDLFAVFDRDGDGKITPHELEAVLRRLGGVDPPTEEEVASMVAEVDRDGDGC  132

Query  467  ISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCR  288
            ISLEEF  + +AF PP+  +ELR+AF  FD + DGKISAEEL  VF T+GD  CTLEDCR
Sbjct  133  ISLEEFGAIGTAFGPPA-GAELREAFAVFDANGDGKISAEELLGVFSTLGDEGCTLEDCR  191

Query  287  RMILGVDNNGDGFVCFEDFCRMME  216
            RMI GVD +GDGFVCF+DF RMM+
Sbjct  192  RMIGGVDTDGDGFVCFDDFVRMMD  215



>ref|XP_002323262.1| Calmodulin-like family protein [Populus trichocarpa]
 gb|EEF05023.1| Calmodulin-like family protein [Populus trichocarpa]
Length=216

 Score =   168 bits (426),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 103/140 (74%), Gaps = 5/140 (4%)
 Frame = -1

Query  635  LYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  456
             Y EL QAFK+IDRD+DG + + ELE LL+++GAEPPS +E+ +ML EVD      IS+E
Sbjct  79   FYFELTQAFKVIDRDNDGLVSRNELEALLTRLGAEPPSSQEMAVMLGEVD-----LISVE  133

Query  455  EFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMIL  276
            E +    +   P+   ELRDAF FFD+D DGKI+AEEL NV+K  GD +CTLEDC+ MI 
Sbjct  134  ELASRLGSACEPAGGDELRDAFVFFDSDRDGKITAEELLNVYKAFGDEKCTLEDCKGMIA  193

Query  275  GVDNNGDGFVCFEDFCRMME  216
             VD NGDGFVCFEDFCRMME
Sbjct  194  VVDKNGDGFVCFEDFCRMME  213



>ref|XP_010544017.1| PREDICTED: probable calcium-binding protein CML35 [Tarenaya hassleriana]
Length=224

 Score =   168 bits (425),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 103/142 (73%), Gaps = 2/142 (1%)
 Frame = -1

Query  635  LYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  456
             YAELVQAFKLIDRDDDG + + EL  LLS++  +PPS+EE+ +ML  VD   DGCISLE
Sbjct  80   FYAELVQAFKLIDRDDDGMVSRSELAALLSRLSPDPPSQEEVSMMLRVVDGGDDGCISLE  139

Query  455  EFS--VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRM  282
            E +  V  S+ A      ELR+ F FFD D DG+ISAEEL  VF  IGD RCTLE+C+RM
Sbjct  140  ELANRVAGSSAAGSMEAGELREVFGFFDADRDGRISAEELHRVFAVIGDERCTLEECQRM  199

Query  281  ILGVDNNGDGFVCFEDFCRMME  216
            I  VD NGDG+VCF+DF RMME
Sbjct  200  IATVDGNGDGYVCFDDFSRMME  221



>ref|XP_010508721.1| PREDICTED: probable calcium-binding protein CML35 [Camelina sativa]
Length=224

 Score =   167 bits (424),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 91/153 (59%), Positives = 111/153 (73%), Gaps = 5/153 (3%)
 Frame = -1

Query  659  ISPDELSG-LYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDR  483
            + P + SG  Y ELVQAFKLIDRDDDG + + +L  LLS++  EPPS+EE+ LML EVD 
Sbjct  62   VLPPQSSGDFYTELVQAFKLIDRDDDGVVSRGDLAALLSRLSPEPPSQEEVSLMLKEVDG  121

Query  482  DGD--GCISLEEF-SVLSSAFAPPSCDSE-LRDAFDFFDTDHDGKISAEELFNVFKTIGD  315
            D D  GCISLE+  S ++      S ++E LR+ F++FD D +GKISAEEL  VF  IGD
Sbjct  122  DNDDGGCISLEDLASRVAGTSGQGSVETEELREVFEYFDADRNGKISAEELHRVFGVIGD  181

Query  314  SRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  216
             RCTL++C RMI  VD NGDGFVCFEDFCRMME
Sbjct  182  ERCTLDECVRMIATVDRNGDGFVCFEDFCRMME  214



>gb|AFK42347.1| unknown [Medicago truncatula]
Length=216

 Score =   167 bits (423),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/144 (58%), Positives = 109/144 (76%), Gaps = 4/144 (3%)
 Frame = -1

Query  635  LYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  456
            +  EL QAF+LIDRD+DG + +EELE +L+++GA PP+ EE+ LMLSEVD DG GCIS+E
Sbjct  70   VQCELAQAFRLIDRDNDGVVSREELEAVLTRLGARPPTPEEIALMLSEVDSDGKGCISVE  129

Query  455  EF----SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCR  288
                     SS+ + P+ + ELR+AF+ FDTD DG+ISAEEL  VF+ IGD RC LE+C+
Sbjct  130  TIMNRVGSGSSSGSDPNPEEELREAFEVFDTDRDGRISAEELLRVFRAIGDERCALEECK  189

Query  287  RMILGVDNNGDGFVCFEDFCRMME  216
            RMI GVD NGDGFVCF++F  MM+
Sbjct  190  RMIAGVDKNGDGFVCFQEFSLMMD  213



>ref|XP_002881773.1| hypothetical protein ARALYDRAFT_903457 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58032.1| hypothetical protein ARALYDRAFT_903457 [Arabidopsis lyrata subsp. 
lyrata]
Length=216

 Score =   167 bits (423),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 89/152 (59%), Positives = 105/152 (69%), Gaps = 8/152 (5%)
 Frame = -1

Query  659  ISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRD  480
            + P      YAEL+QAFKLIDRDDDG + + +L  L+S++  EPPS+EE+ LML EVD  
Sbjct  59   VLPQNSGDFYAELIQAFKLIDRDDDGVVSRGDLAALISRLSPEPPSQEEVSLMLREVDGG  118

Query  479  GDGCISLEEFSVLSSAFAPPSCDS-----ELRDAFDFFDTDHDGKISAEELFNVFKTIGD  315
              GCISLEE   L+S  A  S +      ELR+ F+ FD D +GKISAEEL  VF  IGD
Sbjct  119  DGGCISLEE---LASRVAGTSGEGSVETEELREVFEIFDVDRNGKISAEELHRVFGVIGD  175

Query  314  SRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  219
             RCTLE+C RMI  VD NGDGFVCFEDFCRMM
Sbjct  176  ERCTLEECMRMIATVDGNGDGFVCFEDFCRMM  207



>ref|XP_011027298.1| PREDICTED: probable calcium-binding protein CML35 [Populus euphratica]
Length=208

 Score =   167 bits (422),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 103/140 (74%), Gaps = 5/140 (4%)
 Frame = -1

Query  635  LYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  456
            LY EL QAFKLID D+DG + + ELE LL+++GAEPPS EE+ ++L EVD      IS+E
Sbjct  71   LYFELTQAFKLIDGDNDGLVSRSELEALLTRLGAEPPSSEEMAVILGEVDH-----ISVE  125

Query  455  EFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMIL  276
              +        P+ + ELRDAF FFD+D DGKI+A+EL NV+K  GD +CTL+DCRRMI 
Sbjct  126  ALASRLGTACEPAGNDELRDAFVFFDSDRDGKITADELLNVYKAFGDEKCTLDDCRRMIA  185

Query  275  GVDNNGDGFVCFEDFCRMME  216
             VD NGDGFVCFEDFCRMME
Sbjct  186  VVDKNGDGFVCFEDFCRMME  205



>emb|CDY23852.1| BnaC04g01850D [Brassica napus]
Length=213

 Score =   166 bits (419),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 88/151 (58%), Positives = 108/151 (72%), Gaps = 5/151 (3%)
 Frame = -1

Query  659  ISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRD  480
            + P      Y+ELV+AFKLIDRDDDG + ++EL  LLS++  EPPS+EE+ +ML EVD  
Sbjct  55   VLPQSSGDFYSELVEAFKLIDRDDDGVVSRKELAALLSRLSPEPPSQEEVSMMLREVD--  112

Query  479  GDGCISLEEF-SVLSSAFAPPSC--DSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR  309
             DGCISLEE  S ++ + +   C    E+R+ F+FFD D DG+ISAEEL  VF  IGD R
Sbjct  113  ADGCISLEELASRVAGSTSGEGCVETEEMREVFEFFDADRDGRISAEELHRVFGVIGDER  172

Query  308  CTLEDCRRMILGVDNNGDGFVCFEDFCRMME  216
            CTLEDC RMI  VD NGDGFV F+DFCRMME
Sbjct  173  CTLEDCVRMIATVDRNGDGFVRFDDFCRMME  203



>ref|XP_004493430.1| PREDICTED: probable calcium-binding protein CML36-like [Cicer 
arietinum]
Length=214

 Score =   164 bits (416),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 104/140 (74%), Gaps = 3/140 (2%)
 Frame = -1

Query  635  LYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  456
            +  EL QAF+LIDRD+DG + +EELE +L+++GA     EE+ +ML+EVD DG GCIS+E
Sbjct  75   VQWELSQAFRLIDRDNDGVVSREELELVLTRLGARA---EEIAIMLTEVDGDGRGCISVE  131

Query  455  EFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMIL  276
                     + P+ + ELR+AF+ FDTD DG+ISAEEL  VFK IGD RCTLE+CRRMI 
Sbjct  132  AIMNRVGTGSDPNPEEELREAFEVFDTDRDGRISAEELLRVFKAIGDERCTLEECRRMIE  191

Query  275  GVDNNGDGFVCFEDFCRMME  216
            GVD N DGFVCFEDF RMME
Sbjct  192  GVDKNRDGFVCFEDFSRMME  211



>gb|KDO37863.1| hypothetical protein CISIN_1g027592mg [Citrus sinensis]
Length=212

 Score =   164 bits (415),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/140 (59%), Positives = 105/140 (75%), Gaps = 8/140 (6%)
 Frame = -1

Query  635  LYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  456
            +  ELVQA KL+DRD+DG + + ELE LL ++GA+PP++EE++ MLSEVDR+GDG +   
Sbjct  78   MNYELVQACKLLDRDNDGVVLRSELEALLIRLGADPPTQEEVKSMLSEVDREGDGRVG--  135

Query  455  EFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMIL  276
                  ++   P+C+ EL++ FDFFD DHDGKI+AEELF VF  +GD  CTL+DCR MI 
Sbjct  136  ------NSSCEPACEPELKETFDFFDADHDGKITAEELFGVFTKLGDELCTLDDCRGMIA  189

Query  275  GVDNNGDGFVCFEDFCRMME  216
             VD NGDGFVCFEDF RMME
Sbjct  190  LVDKNGDGFVCFEDFSRMME  209



>ref|XP_011033138.1| PREDICTED: probable calcium-binding protein CML36 [Populus euphratica]
Length=216

 Score =   164 bits (414),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 82/140 (59%), Positives = 101/140 (72%), Gaps = 5/140 (4%)
 Frame = -1

Query  635  LYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  456
             Y EL QAFK+IDRD+DG + + ELE LL+++GAEPPS EE+ +ML E D      +S+E
Sbjct  79   FYFELTQAFKVIDRDNDGLVSRNELEALLTRLGAEPPSSEEMAVMLGERDH-----VSVE  133

Query  455  EFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMIL  276
              +    +   P+ D ELRDAF FFD+D DG+I+AEEL NV+K  GD +CTLEDC  MI 
Sbjct  134  ALASRLGSACEPAGDDELRDAFVFFDSDRDGRITAEELLNVYKAFGDEKCTLEDCAGMIA  193

Query  275  GVDNNGDGFVCFEDFCRMME  216
             VD NGDGFVCFEDFCRMME
Sbjct  194  VVDKNGDGFVCFEDFCRMME  213



>gb|AAM61257.1| calmodulin-like protein [Arabidopsis thaliana]
Length=216

 Score =   163 bits (412),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 104/152 (68%), Gaps = 8/152 (5%)
 Frame = -1

Query  659  ISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRD  480
            + P      Y ELVQAFKLIDRDDDG + + +L  L+S++  EPPS+EE+ LML EVD  
Sbjct  59   VLPQNSGDFYTELVQAFKLIDRDDDGVVSRGDLAALISRLSHEPPSQEEVSLMLREVDGG  118

Query  479  GDGCISLEEFSVLSSAFAPPSCDS-----ELRDAFDFFDTDHDGKISAEELFNVFKTIGD  315
              GCISLE+   L+S  A  S +      ELR+ F+ FD D +GKISAEEL  VF  IGD
Sbjct  119  DGGCISLED---LASRVAGTSGEGSVETEELREVFEIFDVDRNGKISAEELHRVFGVIGD  175

Query  314  SRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  219
             RCTLE+C RMI  VD NGDGFVCF+DFCRMM
Sbjct  176  ERCTLEECMRMIATVDGNGDGFVCFDDFCRMM  207



>ref|NP_181672.1| putative calcium-binding protein CML35 [Arabidopsis thaliana]
 sp|P30188.2|CML35_ARATH RecName: Full=Probable calcium-binding protein CML35; AltName: 
Full=Calmodulin-like protein 1; AltName: Full=Calmodulin-like 
protein 35 [Arabidopsis thaliana]
 gb|AAK26017.1|AF360307_1 putative calmodulin protein [Arabidopsis thaliana]
 gb|AAC78532.1| calmodulin-like protein [Arabidopsis thaliana]
 gb|AAL07243.1| putative calmodulin protein [Arabidopsis thaliana]
 gb|AEC09970.1| putative calcium-binding protein CML35 [Arabidopsis thaliana]
Length=216

 Score =   163 bits (412),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 104/152 (68%), Gaps = 8/152 (5%)
 Frame = -1

Query  659  ISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRD  480
            + P      Y ELVQAFKLIDRDDDG + + +L  L+S++  EPPS+EE+ LML EVD  
Sbjct  59   VLPQNSGDFYTELVQAFKLIDRDDDGVVSRGDLAALISRLSHEPPSQEEVSLMLREVDGG  118

Query  479  GDGCISLEEFSVLSSAFAPPSCDS-----ELRDAFDFFDTDHDGKISAEELFNVFKTIGD  315
              GCISLE+   L+S  A  S +      ELR+ F+ FD D +GKISAEEL  VF  IGD
Sbjct  119  DGGCISLED---LASRVAGTSGEGSVETEELREVFEIFDVDRNGKISAEELHRVFGVIGD  175

Query  314  SRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  219
             RCTLE+C RMI  VD NGDGFVCF+DFCRMM
Sbjct  176  ERCTLEECMRMIATVDGNGDGFVCFDDFCRMM  207



>ref|XP_010554792.1| PREDICTED: probable calcium-binding protein CML35 [Tarenaya hassleriana]
Length=218

 Score =   162 bits (411),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 105/151 (70%), Gaps = 8/151 (5%)
 Frame = -1

Query  647  ELSG----LYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRD  480
            E+SG     Y ELVQAFKLIDRDDDG + + EL  +L ++  EPPS EE+R+ML EVD  
Sbjct  66   EISGGDRDFYTELVQAFKLIDRDDDGVVSRNELAAVLRRLSPEPPSEEEVRMMLREVD-G  124

Query  479  GDGCISLEEFS---VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR  309
            GDGCISLEE +     +SA        ELR+ F+FFD D DG+ISAEEL  VF  IGD R
Sbjct  125  GDGCISLEELASRVAGTSATGSSVEKGELREVFEFFDADRDGRISAEELLRVFGVIGDDR  184

Query  308  CTLEDCRRMILGVDNNGDGFVCFEDFCRMME  216
            CTL++CRRMI  VD  GDGFV F+DF RMME
Sbjct  185  CTLDECRRMIATVDMKGDGFVRFDDFSRMME  215



>ref|XP_006295474.1| hypothetical protein CARUB_v10024577mg [Capsella rubella]
 gb|EOA28372.1| hypothetical protein CARUB_v10024577mg [Capsella rubella]
Length=215

 Score =   162 bits (411),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 91/154 (59%), Positives = 105/154 (68%), Gaps = 9/154 (6%)
 Frame = -1

Query  659  ISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRD  480
            + P      Y ELVQAFKLIDRD DG + + +L  LLS++  EPPS+EE+ LML EVD D
Sbjct  59   VLPHNSGDFYTELVQAFKLIDRDHDGVVSRGDLAALLSRLSPEPPSQEEVSLMLKEVDGD  118

Query  479  GDG-CISLEEFSVLSSAFAPPSCDS-----ELRDAFDFFDTDHDGKISAEELFNVFKTIG  318
             DG  I LEE   L+S  A  S +      ELR+ F+FFD D +GKISAEEL  VF  IG
Sbjct  119  DDGDSIRLEE---LASRVAGTSGEGSVETEELREVFEFFDADRNGKISAEELHRVFGVIG  175

Query  317  DSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  216
            D RCTLE+C RMI  VD NGDGFVCFEDFCRMME
Sbjct  176  DERCTLEECIRMIATVDRNGDGFVCFEDFCRMME  209



>ref|XP_008800223.1| PREDICTED: calmodulin-like [Phoenix dactylifera]
Length=227

 Score =   162 bits (411),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 102/133 (77%), Gaps = 2/133 (2%)
 Frame = -1

Query  611  FKLIDRDDDGKIRKEELEXLLSQVG-AEPPSREELRLMLSEVDRDGDGCISLEEFSVLSS  435
            F + D D DGKI ++ELE +L ++G A+PP+ EE+  M++EVDRDGDGCISLEEF  + S
Sbjct  93   FAVFDCDGDGKITRQELEAVLRRLGGADPPTEEEVASMVAEVDRDGDGCISLEEFGAIGS  152

Query  434  AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGD  255
            AF PP+  +ELR+ F  FD D DGKISAEEL  VF  +GD  CTLEDCRRMI GVD +GD
Sbjct  153  AFGPPA-GAELREVFAVFDDDGDGKISAEELQRVFVMLGDDGCTLEDCRRMIGGVDTDGD  211

Query  254  GFVCFEDFCRMME  216
            GFVCFEDF RMM+
Sbjct  212  GFVCFEDFVRMMD  224



>emb|CAA48190.1| calmodulin like protein [Arabidopsis thaliana]
Length=215

 Score =   162 bits (410),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 106/153 (69%), Gaps = 9/153 (6%)
 Frame = -1

Query  659  ISPDELSG-LYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDR  483
            IS    SG  Y ELVQAFKLIDRDDDG + + +L  L+S++  EPPS+EE+ LML EVD 
Sbjct  57   ISVSSNSGDFYTELVQAFKLIDRDDDGVVSRGDLAALISRLSHEPPSQEEVSLMLREVDG  116

Query  482  DGDGCISLEEFSVLSSAFAPPSCDS-----ELRDAFDFFDTDHDGKISAEELFNVFKTIG  318
               GCISLE+   L+S  A  S +      ELR+ F+ FD D +GKISAEEL  VF  IG
Sbjct  117  GDGGCISLED---LASRVAGTSGEGSVETEELREVFEIFDVDRNGKISAEELHRVFGVIG  173

Query  317  DSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  219
            D RCTLE+C RMI  VD NGDGFVCF+DFCRMM
Sbjct  174  DERCTLEECMRMIATVDGNGDGFVCFDDFCRMM  206



>ref|XP_010543513.1| PREDICTED: probable calcium-binding protein CML36 [Tarenaya hassleriana]
Length=215

 Score =   162 bits (410),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/140 (59%), Positives = 105/140 (75%), Gaps = 1/140 (1%)
 Frame = -1

Query  632  YAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEE  453
            Y ELVQAFKLID+D+DG + +++LE LLS++G +P S+EE+ +ML ++DRDGDG I LE 
Sbjct  73   YLELVQAFKLIDKDNDGAVSRQDLEALLSRLGPDPLSQEEIDVMLGDLDRDGDGAIRLEA  132

Query  452  F-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMIL  276
              S + SA       +ELR+ F+FFD D DG ISAEEL  VF +IGD +CTLEDCRRMI 
Sbjct  133  LASRVVSAGDLSRHSAELRETFEFFDADRDGLISAEELLRVFASIGDEQCTLEDCRRMIA  192

Query  275  GVDNNGDGFVCFEDFCRMME  216
             VD +GDGFVCF +F RMME
Sbjct  193  AVDEDGDGFVCFGEFSRMME  212


 Score = 48.9 bits (115),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 41/71 (58%), Gaps = 0/71 (0%)
 Frame = -1

Query  659  ISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRD  480
            +S  +LS   AEL + F+  D D DG I  EEL  + + +G E  + E+ R M++ VD D
Sbjct  138  VSAGDLSRHSAELRETFEFFDADRDGLISAEELLRVFASIGDEQCTLEDCRRMIAAVDED  197

Query  479  GDGCISLEEFS  447
            GDG +   EFS
Sbjct  198  GDGFVCFGEFS  208



>ref|XP_010273279.1| PREDICTED: probable calcium-binding protein CML36 [Nelumbo nucifera]
Length=221

 Score =   162 bits (410),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 104/142 (73%), Gaps = 3/142 (2%)
 Frame = -1

Query  635  LYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSE--VDRDGDGCIS  462
             + +LV+AFK IDRD DGKI + ELE +LS++GA+ PS E   +++    VDRDGDGCI+
Sbjct  77   FHFQLVEAFKFIDRDGDGKITRRELENILSRLGADTPSEEMQMMLMELMEVDRDGDGCIN  136

Query  461  LEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRM  282
            L+E    S AF P    SELRDAFDFFD   DGKISA+EL  VF  +GD RCT+EDCR M
Sbjct  137  LKETGATSPAFGPYDG-SELRDAFDFFDAGRDGKISADELHRVFTALGDDRCTIEDCRLM  195

Query  281  ILGVDNNGDGFVCFEDFCRMME  216
            I GVD +GDGFVCFEDF RMME
Sbjct  196  IGGVDTDGDGFVCFEDFLRMME  217



>gb|KFK38406.1| hypothetical protein AALP_AA3G109000 [Arabis alpina]
Length=196

 Score =   161 bits (408),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 82/149 (55%), Positives = 108/149 (72%), Gaps = 2/149 (1%)
 Frame = -1

Query  662  EISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDR  483
            EISP   S  Y E++++F LIDR++DG I K +LE LLS++G EP + EE+ +M+ EVDR
Sbjct  47   EISPSPYS--YVEILKSFSLIDRNNDGAISKHDLESLLSKLGPEPLTEEEIDVMIKEVDR  104

Query  482  DGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCT  303
            DGDG I LEE +    +  P    +EL++ F+FFD D DG ISAEEL  VF+TIGD RCT
Sbjct  105  DGDGTIRLEELASRVVSLDPCRDSTELKETFEFFDADRDGMISAEELLRVFETIGDERCT  164

Query  302  LEDCRRMILGVDNNGDGFVCFEDFCRMME  216
            L+DC+RMI  VD +G+GFVCF +F RMM+
Sbjct  165  LDDCKRMIADVDVDGNGFVCFTEFSRMMD  193



>ref|XP_002882655.1| hypothetical protein ARALYDRAFT_897194 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58914.1| hypothetical protein ARALYDRAFT_897194 [Arabidopsis lyrata subsp. 
lyrata]
Length=206

 Score =   161 bits (408),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/139 (56%), Positives = 102/139 (73%), Gaps = 0/139 (0%)
 Frame = -1

Query  632  YAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEE  453
            Y E++QAFKLIDRD+DG + + +LE LLS++G EP + EE+ +M+ EVD DGDG I LEE
Sbjct  65   YIEILQAFKLIDRDNDGAVSRHDLESLLSRLGPEPLTEEEINVMIKEVDGDGDGTIRLEE  124

Query  452  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG  273
             +    +  P    +EL++ F+FFD D DG ISA+EL  VF TIGD RCTL+DC+RMI  
Sbjct  125  LASRVVSLDPARDSTELKETFEFFDADRDGLISADELLRVFSTIGDERCTLDDCKRMIAD  184

Query  272  VDNNGDGFVCFEDFCRMME  216
            VD +GDGFVCF +F RMM+
Sbjct  185  VDEDGDGFVCFTEFSRMMD  203



>gb|KDO37862.1| hypothetical protein CISIN_1g027592mg [Citrus sinensis]
Length=208

 Score =   160 bits (406),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 100/137 (73%), Gaps = 12/137 (9%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            ELVQA KL+DRD+DG + + ELE LL ++GA+PP++EE++ MLSEVDR+GDG I LE   
Sbjct  81   ELVQACKLLDRDNDGVVLRSELEALLIRLGADPPTQEEVKSMLSEVDREGDGYIPLEALI  140

Query  446  VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVD  267
                        S L++ FDFFD DHDGKI+AEELF VF  +GD  CTL+DCR MI  VD
Sbjct  141  ------------SRLKETFDFFDADHDGKITAEELFGVFTKLGDELCTLDDCRGMIALVD  188

Query  266  NNGDGFVCFEDFCRMME  216
             NGDGFVCFEDF RMME
Sbjct  189  KNGDGFVCFEDFSRMME  205



>ref|XP_010938625.1| PREDICTED: calmodulin-like protein 3 [Elaeis guineensis]
Length=218

 Score =   161 bits (407),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 104/144 (72%), Gaps = 2/144 (1%)
 Frame = -1

Query  644  LSGLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVG-AEPPSREELRLMLSEVDRDGDGC  468
            LS   + +   F + DRD DGKI ++ELE +L  +G A+PP+ EE+  M++EVD DGDGC
Sbjct  73   LSPASSSVSDLFAVFDRDRDGKITRQELEAVLRGLGGADPPTEEEVASMVAEVDLDGDGC  132

Query  467  ISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCR  288
            ISLEEF  + SAF PP+   +LR+AF  FD D DGKISAEEL  VF T+GD   TLEDCR
Sbjct  133  ISLEEFGAIGSAFGPPA-GGDLREAFAVFDADGDGKISAEELLGVFVTLGDDGWTLEDCR  191

Query  287  RMILGVDNNGDGFVCFEDFCRMME  216
            RMI  VD +GDGFVCFEDF RMM+
Sbjct  192  RMIGEVDTDGDGFVCFEDFVRMMD  215



>ref|NP_187630.1| putative calcium-binding protein CML36 [Arabidopsis thaliana]
 sp|Q9SS31.1|CML36_ARATH RecName: Full=Probable calcium-binding protein CML36; AltName: 
Full=Calmodulin-like protein 36 [Arabidopsis thaliana]
 gb|AAF02827.1|AC009400_23 calmodulin-like protein [Arabidopsis thaliana]
 gb|AAO24546.1| At3g10190 [Arabidopsis thaliana]
 dbj|BAF00087.1| calmodulin like protein [Arabidopsis thaliana]
 gb|AEE74869.1| putative calcium-binding protein CML36 [Arabidopsis thaliana]
Length=209

 Score =   160 bits (405),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 78/139 (56%), Positives = 102/139 (73%), Gaps = 0/139 (0%)
 Frame = -1

Query  632  YAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEE  453
            Y E++QAFKLIDRD+DG + + +LE LLS++G +P + EE+ +ML EVD DGDG I LEE
Sbjct  68   YVEILQAFKLIDRDNDGAVSRHDLESLLSRLGPDPLTEEEINVMLKEVDCDGDGTIRLEE  127

Query  452  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG  273
             +    +  P    +EL++ F+FFD D DG ISA+EL  VF TIGD RCTL+DC+RMI  
Sbjct  128  LASRVVSLDPARDSTELKETFEFFDADRDGLISADELLRVFSTIGDERCTLDDCKRMIAD  187

Query  272  VDNNGDGFVCFEDFCRMME  216
            VD +GDGFVCF +F RMM+
Sbjct  188  VDEDGDGFVCFTEFSRMMD  206



>ref|XP_006411405.1| hypothetical protein EUTSA_v10017207mg [Eutrema salsugineum]
 gb|ESQ52858.1| hypothetical protein EUTSA_v10017207mg [Eutrema salsugineum]
Length=226

 Score =   160 bits (406),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 84/144 (58%), Positives = 107/144 (74%), Gaps = 4/144 (3%)
 Frame = -1

Query  635  LYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDR-DGDGCISL  459
             Y++L+QAFKLIDRDDDG + + +L  LLS++  +PPS+EE+ LML EVD  +  GCISL
Sbjct  77   FYSDLIQAFKLIDRDDDGVVSRGDLAALLSRLSPDPPSQEEVSLMLREVDGGEESGCISL  136

Query  458  EEFS--VLSSAFAPPSCDSE-LRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCR  288
            EE +  V  S+    S ++E +R+ F+FFD D DGKISAEEL+ VF  IGD RCT+++CR
Sbjct  137  EELASRVAGSSSGEGSVETEEMREVFEFFDADRDGKISAEELYRVFGVIGDERCTIDECR  196

Query  287  RMILGVDNNGDGFVCFEDFCRMME  216
            RMI  V  NGDGFVCFEDF RMME
Sbjct  197  RMIATVGRNGDGFVCFEDFSRMME  220



>gb|KFK36989.1| hypothetical protein AALP_AA4G198000 [Arabis alpina]
Length=225

 Score =   159 bits (401),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 84/151 (56%), Positives = 108/151 (72%), Gaps = 4/151 (3%)
 Frame = -1

Query  659  ISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRD  480
            + P   S  ++EL+QAFKLIDRDDDG + + +L  L+S++  EPPS EE+ LML EVD D
Sbjct  64   VLPWSGSDFHSELIQAFKLIDRDDDGVVSRRDLANLISKLSPEPPSHEEVSLMLREVD-D  122

Query  479  G--DGCISLEEFS-VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR  309
            G  DGCISLE+ +  +  A +    + E+R+ F++FD D DG+ISAEEL+ VF  IGD R
Sbjct  123  GEEDGCISLEDLANRVVVASSGDGSEEEMREVFEYFDVDRDGRISAEELYRVFGVIGDER  182

Query  308  CTLEDCRRMILGVDNNGDGFVCFEDFCRMME  216
            CTL++CRRMI  VD NGDGFVCF DF  MME
Sbjct  183  CTLDECRRMIATVDKNGDGFVCFHDFSCMME  213



>ref|XP_010517632.1| PREDICTED: probable calcium-binding protein CML35 isoform X1 
[Camelina sativa]
 ref|XP_010517633.1| PREDICTED: probable calcium-binding protein CML35 isoform X2 
[Camelina sativa]
Length=224

 Score =   158 bits (400),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 108/153 (71%), Gaps = 5/153 (3%)
 Frame = -1

Query  659  ISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRD  480
            + P      Y ELVQAFKLIDRDDDG + + +L  LLS++  EPPS+EE+ LML EVD D
Sbjct  60   VLPQSSGDFYTELVQAFKLIDRDDDGVVSRGDLAALLSKLSPEPPSQEEVSLMLKEVDGD  119

Query  479  GDG---CISLEEF-SVLSSAFAPPSCDSE-LRDAFDFFDTDHDGKISAEELFNVFKTIGD  315
            GD    CISLE+  S ++      S ++E LR+ F++FD D +GKISAEEL  VF  IGD
Sbjct  120  GDDDGGCISLEDLASRVAGTSGQGSVETEELREVFEYFDADRNGKISAEELHRVFGVIGD  179

Query  314  SRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  216
             RCTLE+C RMI  VD NGDGFVCFEDFCRMME
Sbjct  180  ERCTLEECVRMIATVDRNGDGFVCFEDFCRMME  212



>emb|CDX79938.1| BnaA05g02180D [Brassica napus]
Length=213

 Score =   157 bits (398),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 86/151 (57%), Positives = 105/151 (70%), Gaps = 5/151 (3%)
 Frame = -1

Query  659  ISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRD  480
            + P      Y+ELV+AFKLIDRDDDG + +++L  LLS++  EPPS EE+ +ML EVD  
Sbjct  55   VLPQSSGDFYSELVEAFKLIDRDDDGVVSRKDLAALLSRLSPEPPSPEEVSMMLREVD--  112

Query  479  GDGCISLEEF-SVLSSAFAPPSC--DSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR  309
             DGCISLEE  S ++   +   C    E+R+ F+FFD D DG+ISAEEL  VF  IGD R
Sbjct  113  ADGCISLEELASRVAGTSSGEGCIETEEMREVFEFFDADRDGRISAEELHRVFGVIGDER  172

Query  308  CTLEDCRRMILGVDNNGDGFVCFEDFCRMME  216
            CTLEDC RMI  VD NGDGFV F+DF RMME
Sbjct  173  CTLEDCVRMIATVDRNGDGFVRFDDFRRMME  203



>ref|XP_009142741.1| PREDICTED: probable calcium-binding protein CML35 [Brassica rapa]
Length=213

 Score =   157 bits (398),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 86/151 (57%), Positives = 105/151 (70%), Gaps = 5/151 (3%)
 Frame = -1

Query  659  ISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRD  480
            + P      Y+ELV+AFKLIDRDDDG + +++L  LLS++  EPPS EE+ +ML EVD  
Sbjct  55   VLPQSSGDFYSELVEAFKLIDRDDDGVVSRKDLAALLSRLSPEPPSPEEVSMMLREVD--  112

Query  479  GDGCISLEEF-SVLSSAFAPPSC--DSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR  309
             DGCISLEE  S ++   +   C    E+R+ F+FFD D DG+ISAEEL  VF  IGD R
Sbjct  113  ADGCISLEELASRVAGTSSGEGCIETEEMREVFEFFDADRDGRISAEELHRVFGVIGDER  172

Query  308  CTLEDCRRMILGVDNNGDGFVCFEDFCRMME  216
            CTLEDC RMI  VD NGDGFV F+DF RMME
Sbjct  173  CTLEDCVRMIATVDRNGDGFVRFDDFRRMME  203



>ref|XP_006296622.1| hypothetical protein CARUB_v10014618mg [Capsella rubella]
 gb|EOA29520.1| hypothetical protein CARUB_v10014618mg [Capsella rubella]
Length=212

 Score =   157 bits (398),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 102/139 (73%), Gaps = 0/139 (0%)
 Frame = -1

Query  632  YAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEE  453
            Y E++QAFKLIDRD+DG + + +LE LLS++G +P + +E+ +M+ EVD DGDG I LEE
Sbjct  71   YVEILQAFKLIDRDNDGAVSRHDLESLLSRLGPDPLTEDEISVMIQEVDCDGDGAIRLEE  130

Query  452  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG  273
             +    +  P    +EL++ F+FFD D DG ISAEEL  VF TIGD RCTL+DC+RMI  
Sbjct  131  LASRLVSSDPSRDSAELKETFEFFDADRDGLISAEELLRVFSTIGDDRCTLDDCKRMIAD  190

Query  272  VDNNGDGFVCFEDFCRMME  216
            VD +GDGFVCF +F RMM+
Sbjct  191  VDEDGDGFVCFTEFSRMMD  209



>ref|XP_010505921.1| PREDICTED: probable calcium-binding protein CML35 [Camelina sativa]
Length=220

 Score =   157 bits (396),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 89/153 (58%), Positives = 108/153 (71%), Gaps = 5/153 (3%)
 Frame = -1

Query  659  ISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRD  480
            + P      Y ELVQAFKLIDRDDDG + + +L  LLS++  EPPS+EE+ LML EVD D
Sbjct  60   VLPQSSGDFYTELVQAFKLIDRDDDGVVSRGDLAALLSRLSPEPPSQEEVSLMLKEVDGD  119

Query  479  GDG---CISLEEF-SVLSSAFAPPSCDSE-LRDAFDFFDTDHDGKISAEELFNVFKTIGD  315
            GD    CISLE+  S ++      S ++E LR+ F++FD D +GKISAEEL  VF  IGD
Sbjct  120  GDDDGGCISLEDLASRVAGTSGQGSVETEELREVFEYFDADRNGKISAEELHRVFGVIGD  179

Query  314  SRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  216
             RCTL++C RMI  VD NGDGFVCFEDFCRMME
Sbjct  180  ERCTLDECVRMIATVDRNGDGFVCFEDFCRMME  212



>ref|XP_010102734.1| putative calcium-binding protein CML36 [Morus notabilis]
 gb|EXB93986.1| putative calcium-binding protein CML36 [Morus notabilis]
Length=231

 Score =   157 bits (396),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 86/146 (59%), Positives = 110/146 (75%), Gaps = 6/146 (4%)
 Frame = -1

Query  635  LYAELVQAFKLIDRDDDGKIRKEELEXLLSQ---VGAEPPSREELRLMLSEVDR-DGDGC  468
            +++EL +AFKLIDRD+DG + ++ELE LLS+   VG+   S + +  MLSEVD  DG+GC
Sbjct  81   IHSELAEAFKLIDRDNDGIVSRKELEALLSRLGGVGSISESEDFVASMLSEVDGGDGEGC  140

Query  467  ISLEEF--SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLED  294
            IS+E     V S+A   P+ DSELR+AFDFFDTD DG+I+A+EL + F  IGD RCTL+D
Sbjct  141  ISVEALMSRVGSAAACEPAGDSELREAFDFFDTDRDGRITADELHSFFTAIGDERCTLQD  200

Query  293  CRRMILGVDNNGDGFVCFEDFCRMME  216
            CRRMI GV  +G+GFVCFEDF RMME
Sbjct  201  CRRMIDGVGRSGEGFVCFEDFSRMME  226



>ref|XP_009412818.1| PREDICTED: probable calcium-binding protein CML18 [Musa acuminata 
subsp. malaccensis]
Length=225

 Score =   156 bits (395),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 85/148 (57%), Positives = 105/148 (71%), Gaps = 7/148 (5%)
 Frame = -1

Query  653  PDELSGLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGD  474
            PDE+S     L+  F + D D DGKI K ELE +L ++  + P+ EE+  M++E+DRDGD
Sbjct  78   PDEVS-----LLDLFNMFDCDGDGKITKRELEAVLRRLVPDAPTAEEVASMVAEMDRDGD  132

Query  473  GCISLEEFSVLSSAFAPPSC--DSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTL  300
            GCISL+EF+ L  A A  +   +SELR+AF  FD D DGKISAEEL  VF T+GD  CTL
Sbjct  133  GCISLDEFAALGPALAASAGGGESELREAFAVFDADGDGKISAEELLGVFATLGDCGCTL  192

Query  299  EDCRRMILGVDNNGDGFVCFEDFCRMME  216
            EDCRRMI GVD +GDGFV FEDF RMM+
Sbjct  193  EDCRRMIGGVDADGDGFVGFEDFVRMMD  220



>emb|CDY00910.1| BnaC05g42900D [Brassica napus]
Length=218

 Score =   155 bits (393),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 81/145 (56%), Positives = 105/145 (72%), Gaps = 6/145 (4%)
 Frame = -1

Query  632  YAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEE  453
            Y E++QAFKLIDRD+DG + + +LE LL+++G +PP+ EE+ +ML EVD DGDG I LEE
Sbjct  71   YVEILQAFKLIDRDNDGAVSRHDLESLLTRLGPDPPTEEEIDVMLKEVDCDGDGTIRLEE  130

Query  452  FS----VLSSAFAPPS--CDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDC  291
             +    V+SS     S     EL++ F+FFD D DGKISAEEL  VF  IGD RCTLE+C
Sbjct  131  LASRCVVVSSEDDNKSRGGSDELKETFEFFDADRDGKISAEELLRVFSAIGDERCTLEEC  190

Query  290  RRMILGVDNNGDGFVCFEDFCRMME  216
             RMI  VD++G+GFVCF +F RMM+
Sbjct  191  ERMIAAVDDDGNGFVCFAEFSRMMD  215



>ref|XP_006407598.1| hypothetical protein EUTSA_v10021512mg [Eutrema salsugineum]
 gb|ESQ49051.1| hypothetical protein EUTSA_v10021512mg [Eutrema salsugineum]
Length=211

 Score =   154 bits (390),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 81/151 (54%), Positives = 109/151 (72%), Gaps = 4/151 (3%)
 Frame = -1

Query  662  EISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDR  483
            E+S D     Y E++ AF+LIDRD+DG + + +L  LLS++G +PPS EE+ +ML EVD 
Sbjct  60   EVSGDPSPYSYVEILHAFQLIDRDNDGAVTRRDLSSLLSRLGPDPPSEEEIDVMLREVDC  119

Query  482  DGDGCISLEEFS--VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR  309
            DG+G I +EE +  V+SS  +  S  +EL++ F+FFD D DG ISAEEL  VF  IGD R
Sbjct  120  DGEGTIRIEELASRVVSSDQSRDS--TELKETFEFFDADRDGFISAEELLRVFSAIGDER  177

Query  308  CTLEDCRRMILGVDNNGDGFVCFEDFCRMME  216
            CTLEDC+RMI  VD++G+GFVCF +F RMM+
Sbjct  178  CTLEDCKRMIAAVDDDGNGFVCFSEFSRMMD  208



>gb|AGV22098.1| calmodulin-like protein [Brassica juncea]
Length=208

 Score =   152 bits (384),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 101/140 (72%), Gaps = 1/140 (1%)
 Frame = -1

Query  632  YAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEE  453
            Y E++QAFKLIDRD+DG + + +LE LL+++G +PP+ EE+ +ML EVD DGDG + LEE
Sbjct  66   YVEILQAFKLIDRDNDGAVSRHDLESLLTRLGPDPPTEEEIDVMLREVDCDGDGTVRLEE  125

Query  452  FSVLSSAFAPPSCDS-ELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMIL  276
             +            S EL++ F+FFD D DGKISAEEL  VF  IGD RCTLE+C RMI 
Sbjct  126  LASRCVDDDQSRGGSDELKETFEFFDADRDGKISAEELLRVFSAIGDERCTLEECERMIA  185

Query  275  GVDNNGDGFVCFEDFCRMME  216
             VD++G+GFVCF +F RMM+
Sbjct  186  AVDDDGNGFVCFTEFSRMMD  205



>emb|CDY60169.1| BnaAnng16630D [Brassica napus]
Length=208

 Score =   152 bits (383),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 101/140 (72%), Gaps = 1/140 (1%)
 Frame = -1

Query  632  YAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEE  453
            Y E++QAFKLIDRD+DG + + +LE LL+++G +PP+ EE+ +ML EV+ DGDG + LEE
Sbjct  66   YVEILQAFKLIDRDNDGAVSRHDLESLLTRLGPDPPTEEEIDVMLKEVNCDGDGTVRLEE  125

Query  452  FSVLSSAFAPPSCDS-ELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMIL  276
             +            S EL++ F+FFD D DGKISAEEL  VF  IGD RCTLE+C RMI 
Sbjct  126  LASRCVDDDQSRGGSDELKETFEFFDADRDGKISAEELLRVFSAIGDERCTLEECERMIA  185

Query  275  GVDNNGDGFVCFEDFCRMME  216
             VD++G+GFVCF +F RMM+
Sbjct  186  AVDDDGNGFVCFTEFSRMMD  205



>ref|XP_010525531.1| PREDICTED: probable calcium-binding protein CML35 [Tarenaya hassleriana]
Length=211

 Score =   152 bits (383),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 99/142 (70%), Gaps = 11/142 (8%)
 Frame = -1

Query  641  SGLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCIS  462
            S LY+ELVQAFKLIDRDDDG + + EL  LL+++  EPPS++E+ +ML    R+ DG ++
Sbjct  78   SDLYSELVQAFKLIDRDDDGAVSRSELAALLTRLSPEPPSQDEVSMML----READGGVA  133

Query  461  LEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRM  282
                    ++ A      ELR+ F+FFD D DG+ISAEEL  VF  IGD RCTLE+C RM
Sbjct  134  -------GTSAAGSVEAEELREVFEFFDADRDGRISAEELLRVFGVIGDDRCTLEECLRM  186

Query  281  ILGVDNNGDGFVCFEDFCRMME  216
            I  VD NGDGFVCFEDF RMME
Sbjct  187  IATVDVNGDGFVCFEDFSRMME  208



>ref|XP_010056433.1| PREDICTED: probable calcium-binding protein CML36 [Eucalyptus 
grandis]
 gb|KCW90088.1| hypothetical protein EUGRSUZ_A02286 [Eucalyptus grandis]
Length=224

 Score =   152 bits (383),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 84/147 (57%), Positives = 103/147 (70%), Gaps = 8/147 (5%)
 Frame = -1

Query  644  LSGLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDG--  471
             +G   EL +AF LIDRD DG + ++ELE LLS++G    SR+E+ +MLSEV   G+G  
Sbjct  79   WAGSNLELARAFGLIDRDGDGILSRKELEALLSRLG----SRDEVAVMLSEVGCHGEGED  134

Query  470  -CISLEEF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLE  297
              +S+EE  S +  A  P   D+ELR+ F+FFD DHDGKI+AEEL  VF   GD RCTLE
Sbjct  135  AAVSIEELLSRVGPACGPACDDAELRETFEFFDADHDGKITAEELLGVFAAFGDERCTLE  194

Query  296  DCRRMILGVDNNGDGFVCFEDFCRMME  216
            +CRRMI  VD NGDGFVCFEDF RMME
Sbjct  195  ECRRMISEVDKNGDGFVCFEDFTRMME  221



>ref|XP_003554140.1| PREDICTED: probable calcium-binding protein CML36-like [Glycine 
max]
Length=218

 Score =   151 bits (382),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 99/137 (72%), Gaps = 3/137 (2%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            +L QAF+LIDRD+DG + +++LE LL+ +GA P   +++ +ML EVD  GDG       S
Sbjct  80   DLAQAFRLIDRDNDGVVTRQDLEALLTCLGASP-CPDDVAVMLGEVD--GDGITVERLMS  136

Query  446  VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVD  267
             + S   P S   EL++AF+ FDTD DG+ISAEEL  VFK IGD RCTLE+CRRMI GVD
Sbjct  137  YVGSGLKPGSDPDELKEAFEVFDTDRDGRISAEELLRVFKAIGDERCTLEECRRMIEGVD  196

Query  266  NNGDGFVCFEDFCRMME  216
             NGDGFVCFEDF RMME
Sbjct  197  RNGDGFVCFEDFSRMME  213



>ref|XP_010931583.1| PREDICTED: probable calcium-binding protein CML36 [Elaeis guineensis]
Length=215

 Score =   150 bits (378),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 93/128 (73%), Gaps = 1/128 (1%)
 Frame = -1

Query  599  DRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPP  420
            +++ DG+I + ELE +L ++G +PP+ EE+  ML+E DR GDG I LEE   L SAF PP
Sbjct  86   EKEGDGRITRRELEVVLRRLGPDPPTEEEVVAMLAEADRAGDGSIRLEEIVALGSAFGPP  145

Query  419  SCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCF  240
                ELR+ F  FD D DG ISAEEL  +F T+GD RCTLEDCRRMI  VD++GDGFVCF
Sbjct  146  VV-PELRETFAVFDGDGDGMISAEELLAMFVTLGDKRCTLEDCRRMIGVVDSDGDGFVCF  204

Query  239  EDFCRMME  216
            EDF RMM+
Sbjct  205  EDFVRMMD  212



>ref|XP_003521150.1| PREDICTED: probable calcium-binding protein CML36-like [Glycine 
max]
Length=219

 Score =   149 bits (376),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 99/137 (72%), Gaps = 3/137 (2%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            +L QA +LIDRD+DG + +++LE LL+++GA P S  ++ LML EVD DG    SL   S
Sbjct  83   DLAQALRLIDRDNDGVVTRQDLESLLTRLGASP-SPGDVALMLGEVDGDGITVESL--MS  139

Query  446  VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVD  267
             + S     S   EL++AF+ FDTD DG+ISAEEL  VFK IGD RCTLE+CRRMI GVD
Sbjct  140  YVGSGLETGSDPDELKEAFEVFDTDRDGRISAEELLRVFKAIGDERCTLEECRRMIEGVD  199

Query  266  NNGDGFVCFEDFCRMME  216
             NGDGFVCFEDF RMM+
Sbjct  200  RNGDGFVCFEDFSRMMD  216



>ref|XP_007162132.1| hypothetical protein PHAVU_001G126700g [Phaseolus vulgaris]
 gb|ESW34126.1| hypothetical protein PHAVU_001G126700g [Phaseolus vulgaris]
Length=215

 Score =   148 bits (373),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 103/140 (74%), Gaps = 10/140 (7%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            +L QAF+LIDRD+DG + +++LE +L+++GA      ++ LMLSEV+    GCI++E  +
Sbjct  80   DLAQAFRLIDRDNDGVVSRQDLEAVLTRLGAS-----DVALMLSEVEGGAGGCITVE--A  132

Query  446  VLSSAFAPPSCDS---ELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMIL  276
            +++   + P   S   EL++AF  FDTD DG+ISAEEL  VF+ IGD RCTLE+CRRMI 
Sbjct  133  LMNHIGSGPESGSDPEELKEAFAVFDTDRDGRISAEELLRVFRAIGDERCTLEECRRMIE  192

Query  275  GVDNNGDGFVCFEDFCRMME  216
            GVD NGDGFVCFEDF RMME
Sbjct  193  GVDRNGDGFVCFEDFSRMME  212



>ref|XP_009146864.1| PREDICTED: probable calcium-binding protein CML36 [Brassica rapa]
Length=245

 Score =   149 bits (375),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 100/140 (71%), Gaps = 1/140 (1%)
 Frame = -1

Query  632  YAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEE  453
            Y E++QAFKLIDRD+DG + + +LE LL+++G +P + EE+ +ML EVD DGDG + LEE
Sbjct  103  YVEILQAFKLIDRDNDGAVSRHDLESLLTRLGPDPLTEEEIDVMLKEVDCDGDGTVRLEE  162

Query  452  FSVLSSAFAPPSCDS-ELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMIL  276
             +            S EL++ F+FFD D DGKISAEEL  VF  IGD RCTLE+C RMI 
Sbjct  163  LASRCVDDDQSRGGSDELKETFEFFDADRDGKISAEELLRVFSAIGDERCTLEECERMIA  222

Query  275  GVDNNGDGFVCFEDFCRMME  216
             VD++G+GFVCF +F RMM+
Sbjct  223  AVDDDGNGFVCFTEFSRMMD  242



>ref|XP_010922185.1| PREDICTED: probable calcium-binding protein CML36 [Elaeis guineensis]
Length=209

 Score =   147 bits (372),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 92/129 (71%), Gaps = 1/129 (1%)
 Frame = -1

Query  602  IDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAP  423
            ++RD + ++ + ELE +L ++G +PP+ EE+  ML+E DR G+G I L+E   L SAF P
Sbjct  79   VERDGEERVTRRELEVVLRRLGPDPPTEEEVVAMLAEADRGGEGSIRLQEIVALGSAFGP  138

Query  422  PSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVC  243
            P    EL+  F  FD D DGKISAEEL  +F T+GD RCTLEDCRRMI  VD++GDGFVC
Sbjct  139  PVA-PELQQTFAVFDVDGDGKISAEELLAMFVTLGDERCTLEDCRRMIGVVDSDGDGFVC  197

Query  242  FEDFCRMME  216
            FEDF RMM 
Sbjct  198  FEDFVRMMH  206



>ref|XP_009399974.1| PREDICTED: probable calcium-binding protein CML17 [Musa acuminata 
subsp. malaccensis]
Length=225

 Score =   147 bits (370),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 83/147 (56%), Positives = 101/147 (69%), Gaps = 6/147 (4%)
 Frame = -1

Query  653  PDELSGLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGD  474
            PDE     A  +  F + D D DGKI K ELE +L ++  +PP+ EE+  M++EVDRDGD
Sbjct  79   PDE-----AAWLDLFNVFDCDGDGKITKRELEAVLRRLVPDPPTAEEVASMVAEVDRDGD  133

Query  473  GCISLEEFSVLSSAFAPPSC-DSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLE  297
            GCISL+EF  L +        +SELRDAF  FD D DGKISAEEL  VF T+GD  CTL+
Sbjct  134  GCISLDEFGALGALLGGGRGGESELRDAFAVFDADGDGKISAEELLGVFATLGDGGCTLD  193

Query  296  DCRRMILGVDNNGDGFVCFEDFCRMME  216
            DCRRMI GVD +GDGFV F+DF RMM+
Sbjct  194  DCRRMIGGVDTDGDGFVGFDDFVRMMD  220



>ref|XP_010486615.1| PREDICTED: probable calcium-binding protein CML36 [Camelina sativa]
Length=218

 Score =   147 bits (370),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 101/140 (72%), Gaps = 2/140 (1%)
 Frame = -1

Query  632  YAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGD-GCISLE  456
            Y E++QAFKLIDRD+DG I + +LE LL+++G +P + +E+ +M+ EV  +GD G I LE
Sbjct  74   YVEILQAFKLIDRDNDGAISRHDLESLLTRLGPDPLTEDEINVMIKEVGCEGDDGTIRLE  133

Query  455  EFSVLSSAFAPPSCDS-ELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMI  279
            E +        PS DS E+++ F+FFD D DG ISAEEL  VF TIGD RCTL+DC+RMI
Sbjct  134  ELASRVVLSLDPSRDSAEMKETFEFFDADRDGLISAEELLRVFSTIGDERCTLDDCKRMI  193

Query  278  LGVDNNGDGFVCFEDFCRMM  219
              VD +GDGFVCF +F RMM
Sbjct  194  ADVDEDGDGFVCFTEFSRMM  213



>ref|XP_010481256.1| PREDICTED: probable calcium-binding protein CML36 [Camelina sativa]
Length=220

 Score =   146 bits (368),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 100/141 (71%), Gaps = 3/141 (2%)
 Frame = -1

Query  632  YAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEV--DRDGDGCISL  459
            Y E++QAFKLIDRD+DG I + +LE LLS++G +P + +E+ +M+ EV  +   DG I L
Sbjct  75   YVEILQAFKLIDRDNDGAISRHDLESLLSRLGPDPLTEDEINVMIKEVGCEEGDDGTIRL  134

Query  458  EEFSVLSSAFAPPSCDS-ELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRM  282
            EE +        PS DS EL++ F+FFD D DG ISAEEL  VF TIGD RCTL+DC+RM
Sbjct  135  EELASRVVLSLDPSRDSAELKETFEFFDADRDGLISAEELLRVFSTIGDERCTLDDCKRM  194

Query  281  ILGVDNNGDGFVCFEDFCRMM  219
            I  VD +GDGFVCF +F RMM
Sbjct  195  IADVDEDGDGFVCFTEFSRMM  215



>ref|XP_010672963.1| PREDICTED: probable calcium-binding protein CML35 [Beta vulgaris 
subsp. vulgaris]
Length=209

 Score =   145 bits (365),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 92/136 (68%), Gaps = 3/136 (2%)
 Frame = -1

Query  617  QAFKLIDRDDDGKIRKEELEXLLSQVGAEPPS--REELRLMLSEVDRDGDGCISLEEFSV  444
            +AFK++D D DGKI + EL  L  +V    PS   EE+  M+ ++D DGDGCISLEE   
Sbjct  70   EAFKMMDLDGDGKITRVELHSLFKRVRVNAPSLSEEEVAEMIKDIDTDGDGCISLEELEA  129

Query  443  LSSAFAPPSCDSE-LRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVD  267
            + SA  P   D + L+DAF FFD + DGKIS EEL   F  +GD RCTLE+CRRMI GVD
Sbjct  130  VGSALDPTGADEDDLKDAFGFFDVNKDGKISPEELHAGFVALGDERCTLEECRRMIEGVD  189

Query  266  NNGDGFVCFEDFCRMM  219
             N DGFVCF+DF RMM
Sbjct  190  KNKDGFVCFQDFSRMM  205



>ref|XP_008789596.1| PREDICTED: probable calcium-binding protein CML36 [Phoenix dactylifera]
Length=209

 Score =   144 bits (364),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 91/128 (71%), Gaps = 1/128 (1%)
 Frame = -1

Query  599  DRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPP  420
            +R+ + ++ + ELE +L ++G +PP+ EE+  ML+E DR GDG I L+E   L SAF PP
Sbjct  80   EREGEERVTRRELEVVLQRLGPDPPTEEEVAAMLAEADRGGDGSIRLQEIVALGSAFGPP  139

Query  419  SCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCF  240
                ELR+ F  FD D DGKISAEEL  +F T+GD RCTLEDCRRMI  VD++ DGFVCF
Sbjct  140  -VAPELRETFAVFDVDGDGKISAEELLAMFVTLGDERCTLEDCRRMIGVVDSDCDGFVCF  198

Query  239  EDFCRMME  216
            EDF RMM 
Sbjct  199  EDFVRMMH  206



>ref|XP_010464685.1| PREDICTED: probable calcium-binding protein CML36 [Camelina sativa]
Length=221

 Score =   144 bits (364),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 100/141 (71%), Gaps = 3/141 (2%)
 Frame = -1

Query  632  YAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEV--DRDGDGCISL  459
            Y E++QAFKLIDRD+DG I + +LE LL+++G +P + +E+ +M+ EV  +   DG I L
Sbjct  76   YVEILQAFKLIDRDNDGAISRHDLESLLTRLGPDPLTEDEINVMIKEVGCEEGDDGTIRL  135

Query  458  EEFSVLSSAFAPPSCDS-ELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRM  282
            EE +        PS DS E+++ F+FFD D DG ISAEEL  VF TIGD RCTL+DC+RM
Sbjct  136  EELASRVVLSLDPSRDSAEMKETFEFFDADRDGLISAEELLRVFSTIGDERCTLDDCKRM  195

Query  281  ILGVDNNGDGFVCFEDFCRMM  219
            I  VD +GDGFVCF +F RMM
Sbjct  196  IADVDEDGDGFVCFTEFSRMM  216



>ref|XP_008786895.1| PREDICTED: probable calcium-binding protein CML36 [Phoenix dactylifera]
Length=205

 Score =   144 bits (362),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 93/132 (70%), Gaps = 1/132 (1%)
 Frame = -1

Query  611  FKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSA  432
            +   +R+ +G+I + ELE +L ++G +PP+ EE+  ML+E DR GDG I LEE   L S 
Sbjct  72   YPSAEREGEGRITRRELEVVLRRLGPDPPTEEEVVAMLAEADRAGDGSIRLEEIVELGSV  131

Query  431  FAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDG  252
              PP    ELR+ F  FD D DGKISAEEL  +F T+GD +CTLEDCRRMI  VD++GDG
Sbjct  132  VGPPVV-PELRETFAVFDADGDGKISAEELLAMFVTLGDEQCTLEDCRRMIGVVDSDGDG  190

Query  251  FVCFEDFCRMME  216
            FVCF+DF RMM+
Sbjct  191  FVCFQDFVRMMD  202



>ref|XP_008443339.1| PREDICTED: probable calcium-binding protein CML35 [Cucumis melo]
Length=233

 Score =   141 bits (355),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 86/124 (69%), Gaps = 18/124 (15%)
 Frame = -1

Query  587  DGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDS  408
            D  + ++EL+ LL  +GAEPPS EE+++M+ E+DR G                  P+C S
Sbjct  125  DPTLSRKELKALLGLIGAEPPSEEEIKIMMGEMDRVG------------------PACHS  166

Query  407  ELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFC  228
            ELRD F+ FD DHDG+I+AEELF+VF  +GD  CTLEDCRRMI GVD NGDGFVCF+DF 
Sbjct  167  ELRDTFEIFDADHDGRITAEELFSVFTAMGDEGCTLEDCRRMIAGVDKNGDGFVCFDDFA  226

Query  227  RMME  216
            RMM+
Sbjct  227  RMMD  230



>ref|XP_010036330.1| PREDICTED: probable calcium-binding protein CML36 [Eucalyptus 
grandis]
Length=224

 Score =   140 bits (353),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 81/166 (49%), Positives = 106/166 (64%), Gaps = 18/166 (11%)
 Frame = -1

Query  659  ISPDELSGLYA----------ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREEL  510
            + P +LSG ++          ELV+AF  ID D+DG + +E+LE LLS++GAEP S +E 
Sbjct  56   VLPPQLSGEWSDVASSSEMNGELVRAFTYIDGDNDGVLSREDLEALLSRLGAEPLSADEK  115

Query  509  RLMLSEV---DRDGDGCISLEEF-SVLSSAF----APPSCDSELRDAFDFFDTDHDGKIS  354
             LML EV   D  G   + +E+  S + SA     A   CD E+R  F+FFD + DG+I+
Sbjct  116  ALMLREVGCADEGGAAGVRIEDLVSRVGSAGGDEEADAGCDVEMRRTFEFFDRNGDGRIT  175

Query  353  AEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFCRMME  216
            AEEL   F+ +GD RCTL +CRRMI  VD NGDGFVCFEDF RMM+
Sbjct  176  AEELLGAFEAMGDGRCTLGECRRMIAEVDRNGDGFVCFEDFSRMMQ  221



>ref|XP_004136671.1| PREDICTED: probable calcium-binding protein CML35-like [Cucumis 
sativus]
Length=166

 Score =   138 bits (347),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 86/124 (69%), Gaps = 18/124 (15%)
 Frame = -1

Query  587  DGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDS  408
            D  + ++EL+ LL  +GAEPPS EE+++M+ E+DR G                  P+C S
Sbjct  58   DPTLSRKELKALLGLIGAEPPSEEEIKIMMGEMDRVG------------------PTCHS  99

Query  407  ELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFC  228
            ELRD F+ FD DHDG+I+AEELF+VF  +GD  CTLEDC+RMI GVD NGDGFVCF+DF 
Sbjct  100  ELRDTFEIFDADHDGRITAEELFSVFAAMGDDGCTLEDCQRMIAGVDKNGDGFVCFDDFV  159

Query  227  RMME  216
            RMM+
Sbjct  160  RMMD  163



>ref|XP_004159632.1| PREDICTED: probable calcium-binding protein CML35-like [Cucumis 
sativus]
 gb|KGN59507.1| hypothetical protein Csa_3G823060 [Cucumis sativus]
Length=167

 Score =   138 bits (347),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 86/124 (69%), Gaps = 18/124 (15%)
 Frame = -1

Query  587  DGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPSCDS  408
            D  + ++EL+ LL  +GAEPPS EE+++M+ E+DR G                  P+C S
Sbjct  59   DPTLSRKELKALLGLIGAEPPSEEEIKIMMGEMDRVG------------------PTCHS  100

Query  407  ELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFEDFC  228
            ELRD F+ FD DHDG+I+AEELF+VF  +GD  CTLEDC+RMI GVD NGDGFVCF+DF 
Sbjct  101  ELRDTFEIFDADHDGRITAEELFSVFAAMGDDGCTLEDCQRMIAGVDKNGDGFVCFDDFV  160

Query  227  RMME  216
            RMM+
Sbjct  161  RMMD  164



>ref|XP_006288691.1| hypothetical protein CARUB_v10002001mg [Capsella rubella]
 gb|EOA21589.1| hypothetical protein CARUB_v10002001mg [Capsella rubella]
Length=199

 Score =   139 bits (349),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 100/144 (69%), Gaps = 5/144 (3%)
 Frame = -1

Query  632  YAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEE  453
            + EL++AF LID+D+DG + + +LE LL+Q+G  PP+++E+ +ML EVDRDG G IS++ 
Sbjct  54   HLELLKAFTLIDKDNDGAVSRHDLEALLTQLGPNPPNKDEINVMLREVDRDGHGTISIDT  113

Query  452  FSV----LSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVF-KTIGDSRCTLEDCR  288
             +       S+ +     +EL++ F+ FD+D +G ISAEEL  VF   IGD RCTLE+C 
Sbjct  114  LATRVVSSVSSDSSHGSSTELKETFELFDSDRNGLISAEELLRVFAAAIGDDRCTLEECS  173

Query  287  RMILGVDNNGDGFVCFEDFCRMME  216
            RMI  VD +GDGFV F +F RMM+
Sbjct  174  RMIAAVDEDGDGFVSFNEFSRMMD  197



>ref|XP_008457589.1| PREDICTED: probable calcium-binding protein CML36 [Cucumis melo]
Length=192

 Score =   135 bits (339),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/146 (49%), Positives = 97/146 (66%), Gaps = 5/146 (3%)
 Frame = -1

Query  653  PDELSGLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGD  474
            P+ ++  Y           R+++G + ++ELE +LS++ +E    EE+ +MLSEVD  GD
Sbjct  49   PNSVNTGYGTPTSVLDSDVRENEGVVTRKELEAILSRIASE----EEVAMMLSEVDSGGD  104

Query  473  GCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLED  294
            G I LEE      +    + +SELR+ F+FFD D DG+I+AEEL  VF++IGD +CTLED
Sbjct  105  GFIRLEELMARVGS-GEAAGESELRETFEFFDADQDGRITAEELHGVFRSIGDEQCTLED  163

Query  293  CRRMILGVDNNGDGFVCFEDFCRMME  216
            CRRMI  VD NGDGFVCF +F RMME
Sbjct  164  CRRMIRDVDENGDGFVCFAEFVRMME  189



>ref|XP_004151276.1| PREDICTED: probable calcium-binding protein CML36-like [Cucumis 
sativus]
 ref|XP_004172820.1| PREDICTED: probable calcium-binding protein CML36-like [Cucumis 
sativus]
 gb|KGN54524.1| hypothetical protein Csa_4G355130 [Cucumis sativus]
Length=192

 Score =   129 bits (325),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 89/127 (70%), Gaps = 5/127 (4%)
 Frame = -1

Query  596  RDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSAFAPPS  417
            R ++G + ++ELE +LS++ +E    EE+ +ML EVD  GDG I LEE      +    +
Sbjct  68   RGNEGVVSRKELEAILSRIASE----EEVAMMLREVDSGGDGFIRLEELMARVGS-GEAA  122

Query  416  CDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFE  237
             +SE+R+ F+FFD D DG+I+AEEL  VF++IGD RCTLEDC RMI  VD NGDGFVCF 
Sbjct  123  GESEMRETFEFFDADQDGRITAEELHGVFRSIGDERCTLEDCGRMIRDVDENGDGFVCFA  182

Query  236  DFCRMME  216
            +F RMME
Sbjct  183  EFVRMME  189



>ref|XP_002970730.1| hypothetical protein SELMODRAFT_94292 [Selaginella moellendorffii]
 gb|EFJ28056.1| hypothetical protein SELMODRAFT_94292 [Selaginella moellendorffii]
Length=160

 Score =   123 bits (308),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 69/139 (50%), Positives = 89/139 (64%), Gaps = 4/139 (3%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            EL  AF+  D + DGKI   EL  +L  +G E PS E+LR M+ EVD DGDG +  +EF 
Sbjct  12   ELEHAFRYFDANGDGKISVAELGGVLKSLG-ENPSEEDLRTMVREVDADGDGFVDFDEFV  70

Query  446  VLSSAF---APPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMIL  276
             L++     A  +   EL+ AF  FDTD +G ISAEEL+ V   +G+   T+EDC RMI 
Sbjct  71   HLNTEILGDALAASVEELKAAFYVFDTDKNGYISAEELYKVMFNLGEKGVTMEDCNRMIG  130

Query  275  GVDNNGDGFVCFEDFCRMM  219
            GVD++GDGFV FE+F RMM
Sbjct  131  GVDSDGDGFVNFEEFQRMM  149


 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 47/85 (55%), Gaps = 2/85 (2%)
 Frame = -1

Query  662  EISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDR  483
            EI  D L+    EL  AF + D D +G I  EEL  ++  +G +  + E+   M+  VD 
Sbjct  75   EILGDALAASVEELKAAFYVFDTDKNGYISAEELYKVMFNLGEKGVTMEDCNRMIGGVDS  134

Query  482  DGDGCISLEEFS--VLSSAFAPPSC  414
            DGDG ++ EEF   +LSS+ A PS 
Sbjct  135  DGDGFVNFEEFQRMMLSSSNASPST  159



>ref|XP_002969393.1| hypothetical protein SELMODRAFT_91501 [Selaginella moellendorffii]
 gb|EFJ29481.1| hypothetical protein SELMODRAFT_91501 [Selaginella moellendorffii]
Length=162

 Score =   122 bits (307),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 69/139 (50%), Positives = 89/139 (64%), Gaps = 4/139 (3%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            EL  AF+  D + DGKI   EL  +L  +G E PS E+LR M+ EVD DGDG +  +EF 
Sbjct  12   ELEHAFRYFDANGDGKISVAELGGVLKSLG-ENPSEEDLRTMVREVDADGDGFVDFDEFV  70

Query  446  VLSSAF---APPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMIL  276
             L++     A  +   EL+ AF  FDTD +G ISAEEL+ V   +G+   T+EDC RMI 
Sbjct  71   HLNTEILGDALAASVEELKAAFYVFDTDKNGYISAEELYKVMFNLGEKGVTMEDCNRMIG  130

Query  275  GVDNNGDGFVCFEDFCRMM  219
            GVD++GDGFV FE+F RMM
Sbjct  131  GVDSDGDGFVNFEEFQRMM  149


 Score = 48.1 bits (113),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 39/72 (54%), Gaps = 0/72 (0%)
 Frame = -1

Query  662  EISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDR  483
            EI  D L+    EL  AF + D D +G I  EEL  ++  +G +  + E+   M+  VD 
Sbjct  75   EILGDALAASVEELKAAFYVFDTDKNGYISAEELYKVMFNLGEKGVTMEDCNRMIGGVDS  134

Query  482  DGDGCISLEEFS  447
            DGDG ++ EEF 
Sbjct  135  DGDGFVNFEEFQ  146



>ref|XP_010062249.1| PREDICTED: calcium-binding protein CML24-like [Eucalyptus grandis]
Length=184

 Score =   122 bits (305),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/151 (44%), Positives = 95/151 (63%), Gaps = 4/151 (3%)
 Frame = -1

Query  662  EISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDR  483
            +  P +  G   ++ Q F   D++ DGKI  +EL  +LS +G+ P +REE +  ++E+D+
Sbjct  26   QAKPADSLGNVDQVRQVFAQYDKNGDGKISCDELREVLSALGSSPTTREEAQAAMAEIDK  85

Query  482  DGDGCISLEEFS--VLSSAFAPPSCDS-ELRDAFDFFDTDHDGKISAEELFNVFKTIGDS  312
            DGDG I L+EF+  +L      P C + ELRDAFD +D D +G IS  EL  V K +G  
Sbjct  86   DGDGFIDLDEFAELILGGGDGGPECGAKELRDAFDLYDLDGNGVISVSELHAVMKKLG-Q  144

Query  311  RCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  219
            +C+L DCR+MI  VD +GDG V FE+F +MM
Sbjct  145  KCSLRDCRKMISSVDRDGDGNVNFEEFKKMM  175



>ref|XP_009606381.1| PREDICTED: probable calcium-binding protein CML23 [Nicotiana 
tomentosiformis]
Length=157

 Score =   119 bits (299),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 95/150 (63%), Gaps = 3/150 (2%)
 Frame = -1

Query  665  DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVD  486
            D   P  L+    E+ + FK  D + DGKI   EL  +L+ +G +    E  R+ML EVD
Sbjct  7    DSSQPTSLTAEMEEVEKVFKKFDTNGDGKISLSELGGILNALGTKTTPDEAKRMML-EVD  65

Query  485  RDGDGCISLEEFSVLSSAF-APPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR  309
             DGDG I L+EF+       +P + + +LR+AF+ +D D +GKISA EL +V K IG+ +
Sbjct  66   TDGDGFIDLKEFAAFHCPVESPNTVNKDLREAFNLYDKDKNGKISAAELHSVMKGIGE-K  124

Query  308  CTLEDCRRMILGVDNNGDGFVCFEDFCRMM  219
            C+L+DCRRMI  VD++GDG V FE+F +MM
Sbjct  125  CSLKDCRRMISSVDDDGDGSVNFEEFKKMM  154


 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 45/74 (61%), Gaps = 4/74 (5%)
 Frame = -1

Query  656  SPDELSGLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDG  477
            SP+ ++    +L +AF L D+D +GKI   EL  ++  +G E  S ++ R M+S VD DG
Sbjct  86   SPNTVN---KDLREAFNLYDKDKNGKISAAELHSVMKGIG-EKCSLKDCRRMISSVDDDG  141

Query  476  DGCISLEEFSVLSS  435
            DG ++ EEF  + S
Sbjct  142  DGSVNFEEFKKMMS  155



>gb|ABK24059.1| unknown [Picea sitchensis]
 gb|ABK24534.1| unknown [Picea sitchensis]
Length=260

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 72/147 (49%), Positives = 93/147 (63%), Gaps = 13/147 (9%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            EL + FK+ D D DGKI   EL  +L  +G +  S EEL LM+   D+DGDG I L+EF 
Sbjct  112  ELREVFKVFDADGDGKITITELGCVLRSLG-DDLSEEELALMVQAADKDGDGSIDLDEFI  170

Query  446  VLSSAFAP-----------PSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTL  300
             L++A A            P+ D +L DAF  FD D DGKISA+EL  V  ++GD+ CT+
Sbjct  171  SLNTAAADAAEFSASAGVFPATD-DLHDAFRIFDADKDGKISAQELHRVLTSLGDAECTI  229

Query  299  EDCRRMILGVDNNGDGFVCFEDFCRMM  219
            +DCR+MI GVD NGDG+V F+DF  MM
Sbjct  230  DDCRQMIRGVDKNGDGYVDFQDFSTMM  256



>ref|XP_004233476.1| PREDICTED: probable calcium-binding protein CML18 [Solanum lycopersicum]
Length=145

 Score =   116 bits (290),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 70/146 (48%), Positives = 95/146 (65%), Gaps = 9/146 (6%)
 Frame = -1

Query  647  ELSGLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGC  468
            +L+    E+ + F+  D + DGKI   EL+ +L+ +G +    E  R+ML EVD DGDG 
Sbjct  3    KLTPRMKEVEKVFRKYDTNGDGKISLSELDGVLNALGTKTTPDEAKRMML-EVDTDGDGF  61

Query  467  ISLEEFSVLSSAFAPP---SCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLE  297
            I LEEF+    AF  P   S   +LRDAFD +D D +GKISA EL +V K IG+ +C+L+
Sbjct  62   IDLEEFA----AFHCPVEGSNSKDLRDAFDLYDKDKNGKISASELHSVMKGIGE-KCSLK  116

Query  296  DCRRMILGVDNNGDGFVCFEDFCRMM  219
            DCRRMI  VD++GDG V FE+F +MM
Sbjct  117  DCRRMISSVDDDGDGSVNFEEFKKMM  142



>ref|XP_008381742.1| PREDICTED: probable calcium-binding protein CML25 [Malus domestica]
 ref|XP_008348739.1| PREDICTED: probable calcium-binding protein CML25 [Malus domestica]
Length=202

 Score =   117 bits (294),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 66/138 (48%), Positives = 93/138 (67%), Gaps = 3/138 (2%)
 Frame = -1

Query  629  AELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  450
            AEL Q FK  D + DGKI   EL  ++S +G +P S EEL  M+SEVD DGDG I+ +EF
Sbjct  55   AELDQVFKKFDVNGDGKISSSELGAIMSSLG-QPSSDEELNSMISEVDSDGDGFINFKEF  113

Query  449  SVLSSAFAPPSCDSE-LRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG  273
              L++     +   E L+DAF  +D D +G ISAEEL+ V +++GD  C++++CR+MI G
Sbjct  114  VELNTKGVDSAEALENLKDAFSVYDIDGNGSISAEELYEVLRSLGD-ECSIDECRQMIGG  172

Query  272  VDNNGDGFVCFEDFCRMM  219
            VD++GDG + FE+F  MM
Sbjct  173  VDSDGDGMISFEEFKVMM  190



>gb|EYU30122.1| hypothetical protein MIMGU_mgv1a025962mg [Erythranthe guttata]
Length=187

 Score =   117 bits (293),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 91/150 (61%), Gaps = 6/150 (4%)
 Frame = -1

Query  656  SPDELSG---LYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVD  486
            SP +  G   +  EL   FK  D + DGKI   EL  ++  +G  P + EELR M+ EVD
Sbjct  27   SPSQNGGRCRIEEELEHVFKKFDVNGDGKICAAELGSIMGSLG-HPATEEELRTMIQEVD  85

Query  485  RDGDGCISLEEFSVLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR  309
             DGDG I L EF  L++           LRDAF+ FD D +G ISAEEL NV K++G+  
Sbjct  86   SDGDGFIDLREFIELNTNGIGQDEVIENLRDAFEVFDMDKNGSISAEELHNVLKSLGE-E  144

Query  308  CTLEDCRRMILGVDNNGDGFVCFEDFCRMM  219
            CTL +CR+MI GVD +G+G +CF++F  MM
Sbjct  145  CTLAECRKMISGVDADGNGTICFDEFKVMM  174



>ref|XP_009775333.1| PREDICTED: probable calcium-binding protein CML23 [Nicotiana 
sylvestris]
Length=157

 Score =   115 bits (289),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 94/150 (63%), Gaps = 3/150 (2%)
 Frame = -1

Query  665  DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVD  486
            D   P  L+    E+ + FK  D + DGKI   EL  +L+ +G +    E  R+M+ EVD
Sbjct  7    DSSPPASLTAEMEEVKKVFKKFDTNGDGKISLSELGGILNALGTKTTPDEAKRMMI-EVD  65

Query  485  RDGDGCISLEEFSVLSSAF-APPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR  309
             DGDG I L+EF+       +P + + +LRDAF+ +D D +GKISA EL +V K IG+ +
Sbjct  66   TDGDGFIDLKEFAAFHCPVESPNTVNKDLRDAFNLYDKDKNGKISAAELHSVMKGIGE-K  124

Query  308  CTLEDCRRMILGVDNNGDGFVCFEDFCRMM  219
            C+L+DCRRMI  VD++ DG V FE+F +MM
Sbjct  125  CSLKDCRRMISSVDDDCDGSVNFEEFKKMM  154



>ref|XP_004498255.1| PREDICTED: probable calcium-binding protein CML25-like [Cicer 
arietinum]
Length=200

 Score =   117 bits (292),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 88/137 (64%), Gaps = 3/137 (2%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            +L   F+  D + DGKI   EL  ++  +G +P + EEL  M+ EVD DGDG I+LEEF 
Sbjct  49   DLEHVFRKFDVNGDGKISSSELGSIMGSLG-QPATEEELNNMIREVDADGDGHINLEEFI  107

Query  446  VLSSA-FAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  270
             L++    P      L+DAF  FD D +G I+AEEL NV  +IGD +C+L +C++MI GV
Sbjct  108  ELNTKDVNPNEIIENLKDAFSIFDIDGNGSITAEELHNVMVSIGD-KCSLAECKKMIRGV  166

Query  269  DNNGDGFVCFEDFCRMM  219
            D +GDG + FE+F RMM
Sbjct  167  DKDGDGMIDFEEFKRMM  183



>ref|XP_011072994.1| PREDICTED: calcium-binding allergen Ole e 8-like [Sesamum indicum]
Length=166

 Score =   115 bits (288),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 94/152 (62%), Gaps = 8/152 (5%)
 Frame = -1

Query  656  SPDELSGLY----AELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEV  489
            +P     +Y    AE+ + F   D ++DGKI   EL  +L  +G+E  S +E+  M+ E+
Sbjct  6    TPTSTPSMYLEDMAEVQKVFDRFDTNNDGKISPGELGGVLKALGSES-SPDEVARMMGEI  64

Query  488  DRDGDGCISLEEFSVLSSAFAPP--SCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGD  315
            D D DG I+L+EF+   SA A P  S + ELR+AF+ +D +HDGKISA EL      +G+
Sbjct  65   DTDKDGNINLQEFAAFCSAEADPYHSAEKELREAFELYDQNHDGKISAAELQKTLLRLGE  124

Query  314  SRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  219
              C++EDC  MI  +D NGDG+V FE+F +MM
Sbjct  125  -HCSIEDCAGMIKPIDANGDGYVSFEEFKKMM  155



>ref|XP_006346894.1| PREDICTED: probable calcium-binding protein CML18-like [Solanum 
tuberosum]
Length=145

 Score =   114 bits (286),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 70/146 (48%), Positives = 93/146 (64%), Gaps = 9/146 (6%)
 Frame = -1

Query  647  ELSGLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGC  468
            +L+    E+ + F+  D + DGKI   EL+ +L  +G +    E  R+ML EVD DGDG 
Sbjct  3    KLTARMKEVEKVFRKFDTNGDGKISLLELDEVLKALGTKTTPDEAKRMML-EVDTDGDGF  61

Query  467  ISLEEFSVLSSAFAPP---SCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLE  297
            I LEEF+    AF  P   S   +LRDAFD +D D +GKISA EL +V K IG+ +C+L+
Sbjct  62   IDLEEFA----AFHCPVEGSNSKDLRDAFDLYDKDKNGKISAAELHSVMKGIGE-KCSLK  116

Query  296  DCRRMILGVDNNGDGFVCFEDFCRMM  219
            DCRRMI  VD +GDG V FE+F +MM
Sbjct  117  DCRRMISSVDVDGDGSVNFEEFKKMM  142



>gb|KCW78265.1| hypothetical protein EUGRSUZ_D02448, partial [Eucalyptus grandis]
Length=142

 Score =   114 bits (285),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 92/145 (63%), Gaps = 12/145 (8%)
 Frame = -1

Query  641  SGLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVG--AEPPSREELRLMLSEVDRDGDGC  468
            S + A+L Q F+LID D DGKI   EL  +LS +G      + EE R+M+ E+DRDGDG 
Sbjct  1    SEVSAQLRQVFELIDADGDGKISPTELSRVLSGLGHVGAAAADEEARVMVKEIDRDGDGR  60

Query  467  ISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRC--TLED  294
            + L+EF V     A  S D +L DAF  FD + DG ISA+EL  V + +   RC  ++ED
Sbjct  61   VDLDEFLV-----AVLSGDDDLMDAFLIFDANKDGLISAKELQRVLQGV---RCEASIED  112

Query  293  CRRMILGVDNNGDGFVCFEDFCRMM  219
            CRRMI GVD +GDGFV FE+F  MM
Sbjct  113  CRRMIRGVDTDGDGFVNFEEFRSMM  137



>ref|XP_003544994.1| PREDICTED: probable calcium-binding protein CML18-like [Glycine 
max]
Length=141

 Score =   114 bits (285),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 91/137 (66%), Gaps = 3/137 (2%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            E+ Q F   D++ DGKI   EL+ +LS +G++    EEL+ M+ E+D++GDG I L+EF+
Sbjct  4    EVQQIFNKFDKNGDGKISMAELKDMLSALGSKTTD-EELKRMIEELDQNGDGFIDLKEFA  62

Query  446  VLSSAFAPPSCDS-ELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  270
                       DS ELRDAFD +D D +G ISA+EL +V + +G+ +C+L DCRRMI  V
Sbjct  63   DFHCNGGAGKDDSKELRDAFDLYDVDKNGLISAKELHHVLRNLGE-KCSLSDCRRMISNV  121

Query  269  DNNGDGFVCFEDFCRMM  219
            D +GDG V FE+F +MM
Sbjct  122  DGDGDGNVNFEEFKKMM  138



>gb|EPS62655.1| hypothetical protein M569_12136 [Genlisea aurea]
Length=186

 Score =   115 bits (288),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 89/137 (65%), Gaps = 3/137 (2%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            EL Q FK  D + DGKI  EEL  +++ +G    + EE+R+M+ EVD DGDG I L EF 
Sbjct  35   ELEQVFKKFDANGDGKISGEELGKIIASLG-HSVTDEEIRIMIQEVDSDGDGFIDLREFI  93

Query  446  VLSSA-FAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  270
             L++A          LR AFD FD D +G ISAEEL  V +++G+  CT+EDCR+MI GV
Sbjct  94   DLNTADVDNDEALENLRRAFDVFDIDRNGAISAEELRQVLRSLGEE-CTIEDCRKMISGV  152

Query  269  DNNGDGFVCFEDFCRMM  219
            D +G+G +CF++F  MM
Sbjct  153  DADGNGTICFDEFQVMM  169



>gb|KHN40730.1| Putative calcium-binding protein CML25 [Glycine soja]
Length=143

 Score =   114 bits (285),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 89/137 (65%), Gaps = 3/137 (2%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            +L   FK  D + DGKI   EL  ++  +G +P + EEL+ ++ EVD DGDG I+LEEF+
Sbjct  3    DLEYVFKKFDANGDGKISASELGSMMKSLG-QPATEEELKKLIREVDSDGDGHINLEEFT  61

Query  446  VLSSA-FAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  270
             L++    P      L+DAF  FD D +G I+AEEL  V  ++GD+ C++E+CR+MI GV
Sbjct  62   ELNTKDVDPDEVLENLKDAFSIFDLDGNGSITAEELKMVMASLGDA-CSIEECRKMIAGV  120

Query  269  DNNGDGFVCFEDFCRMM  219
            D NGDG + F++F  MM
Sbjct  121  DGNGDGMINFDEFQIMM  137



>ref|XP_008389977.1| PREDICTED: probable calcium-binding protein CML25 [Malus domestica]
Length=269

 Score =   117 bits (293),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 91/138 (66%), Gaps = 3/138 (2%)
 Frame = -1

Query  629  AELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  450
            AEL Q FK  D + DGKI   EL  ++S +G +P S EEL  M+SEVD DGDG I+ +EF
Sbjct  122  AELDQVFKKFDVNGDGKISSSELGAIMSSLG-QPASDEELNGMISEVDSDGDGFINFKEF  180

Query  449  SVLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG  273
              L++    P      L+DAF  +D D +G IS EEL+ V +++GD  C++++CR+MI G
Sbjct  181  VELNTKGIDPDEALENLKDAFSVYDIDGNGSISVEELYKVLRSLGD-ECSMDECRKMIGG  239

Query  272  VDNNGDGFVCFEDFCRMM  219
            VD++GDG + FE+F  MM
Sbjct  240  VDSDGDGMINFEEFKVMM  257



>ref|XP_009351545.1| PREDICTED: probable calcium-binding protein CML25 [Pyrus x bretschneideri]
Length=197

 Score =   115 bits (288),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 92/138 (67%), Gaps = 3/138 (2%)
 Frame = -1

Query  629  AELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  450
            AEL Q FK  D + DGKI   EL  ++S +G +  S EEL  M+SEVD DGDG I+ +EF
Sbjct  50   AELDQVFKKFDVNGDGKISSSELGAIMSSLG-QASSDEELNSMISEVDSDGDGFINFKEF  108

Query  449  SVLSSAFAPPSCDSE-LRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG  273
              L++     +   E L+DAF  +D D +G ISAEEL+ V +++GD  C++++CR+MI G
Sbjct  109  VELNTKGVDSAEALENLKDAFSVYDIDGNGSISAEELYEVLRSLGD-ECSIDECRKMIGG  167

Query  272  VDNNGDGFVCFEDFCRMM  219
            VD++GDG + FE+F  MM
Sbjct  168  VDSDGDGMISFEEFKVMM  185



>ref|XP_006843397.1| hypothetical protein AMTR_s00053p00122010 [Amborella trichopoda]
 gb|ERN05072.1| hypothetical protein AMTR_s00053p00122010 [Amborella trichopoda]
Length=229

 Score =   115 bits (289),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 85/136 (63%), Gaps = 4/136 (3%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            E+    ++++   DGKI KE++  +   +G EPPS EELR     V  D +G ISLE+ +
Sbjct  91   EIYDTCRILELVGDGKISKEDVGPVFRALGVEPPSYEELR----NVATDDEGRISLEDLA  146

Query  446  VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVD  267
               +  +     SEL +AF  FD D DG+ISAEEL  V   +GD+ CT+ DC RMI G D
Sbjct  147  RFGAPASAEEPVSELMEAFGVFDRDGDGRISAEELQGVLSALGDAECTVGDCHRMIRGFD  206

Query  266  NNGDGFVCFEDFCRMM  219
            ++GDGFVCF+DF RMM
Sbjct  207  SDGDGFVCFQDFARMM  222



>ref|XP_004298507.1| PREDICTED: probable calcium-binding protein CML25 [Fragaria vesca 
subsp. vesca]
Length=184

 Score =   114 bits (286),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 85/138 (62%), Gaps = 3/138 (2%)
 Frame = -1

Query  629  AELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  450
            AEL Q F   D + DGKI   EL  ++  +G  P + +ELR M+ EVD DGDG I + EF
Sbjct  36   AELEQVFNKFDVNGDGKISSSELGAIMGSLG-HPATEDELRSMILEVDADGDGFIDINEF  94

Query  449  SVLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG  273
              L++           LRDAF  +D D +G ISAEELF V K++GD  C+L +CR+MI G
Sbjct  95   VELNTKGIDSAEALQNLRDAFSVYDKDGNGSISAEELFEVLKSLGD-ECSLAECRKMIGG  153

Query  272  VDNNGDGFVCFEDFCRMM  219
            VD +GDG + FE+F  MM
Sbjct  154  VDADGDGMINFEEFKVMM  171


 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 43/73 (59%), Gaps = 1/73 (1%)
 Frame = -1

Query  440  SSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNN  261
            S +FA  +  +EL   F+ FD + DGKIS+ EL  +  ++G    T ++ R MIL VD +
Sbjct  26   SPSFATRAQIAELEQVFNKFDVNGDGKISSSELGAIMGSLGHP-ATEDELRSMILEVDAD  84

Query  260  GDGFVCFEDFCRM  222
            GDGF+   +F  +
Sbjct  85   GDGFIDINEFVEL  97



>ref|XP_006583713.1| PREDICTED: probable calcium-binding protein CML25-like [Glycine 
max]
Length=182

 Score =   114 bits (285),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 89/137 (65%), Gaps = 3/137 (2%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            +L   FK  D + DGKI   EL  ++  +G +P + EEL+ ++ EVD DGDG I+LEEF+
Sbjct  42   DLEYVFKKFDANGDGKISASELGSMMKSLG-QPATEEELKKLIREVDSDGDGHINLEEFT  100

Query  446  VLSSA-FAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  270
             L++    P      L+DAF  FD D +G I+AEEL  V  ++GD+ C++E+CR+MI GV
Sbjct  101  ELNTKDVDPDEVLENLKDAFSIFDLDGNGSITAEELKMVMASLGDA-CSIEECRKMIAGV  159

Query  269  DNNGDGFVCFEDFCRMM  219
            D NGDG + F++F  MM
Sbjct  160  DGNGDGMINFDEFQIMM  176



>ref|XP_008801290.1| PREDICTED: probable calcium-binding protein CML10 [Phoenix dactylifera]
Length=180

 Score =   114 bits (284),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/146 (44%), Positives = 89/146 (61%), Gaps = 2/146 (1%)
 Frame = -1

Query  656  SPDELSGLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDG  477
            SP     +  EL + F+L D + DGKI   EL  +++++G  P    EL +M+ E D DG
Sbjct  28   SPAATPPVEDELERVFRLYDTNGDGKISAAELRDMMAKLGRPPADDHELEMMMKEADADG  87

Query  476  DGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLE  297
            DG I+L EF  ++ A      +++LR+AF  FD DHDGKISA EL  V K +G+   T +
Sbjct  88   DGFINLAEFKDINRA-GEGVQEADLREAFAVFDEDHDGKISASELRGVLKGLGEEVTTAQ  146

Query  296  DCRRMILGVDNNGDGFVCFEDFCRMM  219
             CR+MI GVD +GDG V F++F  MM
Sbjct  147  -CRKMIRGVDRDGDGMVSFQEFKVMM  171


 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 41/70 (59%), Gaps = 1/70 (1%)
 Frame = -1

Query  629  AELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  450
            A+L +AF + D D DGKI   EL  +L  +G E  +  + R M+  VDRDGDG +S +EF
Sbjct  109  ADLREAFAVFDEDHDGKISASELRGVLKGLGEEVTT-AQCRKMIRGVDRDGDGMVSFQEF  167

Query  449  SVLSSAFAPP  420
             V+ +    P
Sbjct  168  KVMMTGGGRP  177



>ref|XP_009411743.1| PREDICTED: probable calcium-binding protein CML36 [Musa acuminata 
subsp. malaccensis]
Length=202

 Score =   114 bits (285),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 87/135 (64%), Gaps = 3/135 (2%)
 Frame = -1

Query  611  FKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLSSA  432
            F ++DRD DGKI   ELE +L ++G +P + EE   + +EV   GDGCI++EE   L + 
Sbjct  65   FGVLDRDGDGKIVVRELEAVLRRLGPDPLTAEEAASVAAEVGLAGDGCITVEELEALGAK  124

Query  431  FAPPSCDSELRDAFD---FFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNN  261
               P+      +  +    FD D DG+ISAEEL  VF T+GD  CTLEDCR MI GVD +
Sbjct  125  LQLPAAAEAEAELREAFAVFDADGDGRISAEELLGVFVTLGDDGCTLEDCRCMIQGVDTD  184

Query  260  GDGFVCFEDFCRMME  216
            GDGFVCF+DF RMM+
Sbjct  185  GDGFVCFDDFARMMD  199



>ref|XP_010053891.1| PREDICTED: calmodulin-like protein 3 [Eucalyptus grandis]
Length=202

 Score =   114 bits (285),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 92/145 (63%), Gaps = 12/145 (8%)
 Frame = -1

Query  641  SGLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVG--AEPPSREELRLMLSEVDRDGDGC  468
            S + A+L Q F+LID D DGKI   EL  +LS +G      + EE R+M+ E+DRDGDG 
Sbjct  61   SEVSAQLRQVFELIDADGDGKISPTELSRVLSGLGHVGAAAADEEARVMVKEIDRDGDGR  120

Query  467  ISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRC--TLED  294
            + L+EF V     A  S D +L DAF  FD + DG ISA+EL  V + +   RC  ++ED
Sbjct  121  VDLDEFLV-----AVLSGDDDLMDAFLIFDANKDGLISAKELQRVLQGV---RCEASIED  172

Query  293  CRRMILGVDNNGDGFVCFEDFCRMM  219
            CRRMI GVD +GDGFV FE+F  MM
Sbjct  173  CRRMIRGVDTDGDGFVNFEEFRSMM  197



>ref|XP_004169010.1| PREDICTED: probable calcium-binding protein CML25-like [Cucumis 
sativus]
 gb|KGN51467.1| Polcalcin Jun o [Cucumis sativus]
Length=182

 Score =   114 bits (284),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 66/142 (46%), Positives = 89/142 (63%), Gaps = 11/142 (8%)
 Frame = -1

Query  629  AELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  450
            AEL Q F   D + DGKI   EL  ++  +G +P + EEL+ M+ EVD DGDG I L+EF
Sbjct  36   AELEQVFNKFDVNGDGKICSSELGSIMGSLG-QPATEEELQNMIKEVDADGDGYIDLDEF  94

Query  449  SVLSSAFAPPSCDSE-----LRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRR  285
              L++       DS+     L+DAF  +D D +G I+AEEL  V K++GD  C+L DCR+
Sbjct  95   IELNT----KGVDSDEVLENLKDAFSVYDIDGNGSITAEELHEVLKSLGDD-CSLADCRK  149

Query  284  MILGVDNNGDGFVCFEDFCRMM  219
            MI GVD NGDG + F++F  MM
Sbjct  150  MITGVDKNGDGMISFDEFKVMM  171



>ref|XP_010920375.1| PREDICTED: probable calcium-binding protein CML10 [Elaeis guineensis]
Length=174

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/136 (46%), Positives = 87/136 (64%), Gaps = 2/136 (1%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            EL + F+L D + DGKI   EL+  ++++G  P +  EL +M+ E D DGDG ISL EF 
Sbjct  30   ELERVFRLYDTNGDGKISAAELQETMAKLGHHPANDHELEMMMKEADADGDGFISLAEFK  89

Query  446  VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVD  267
             ++ A      + +L++AF  FD D DGKISA+EL NV K +G+ + T E C+ MI GVD
Sbjct  90   DINGA-GEGVEEVDLKEAFAVFDEDRDGKISAKELQNVLKGLGE-QVTTEQCQEMIRGVD  147

Query  266  NNGDGFVCFEDFCRMM  219
             +GDG V F++F  MM
Sbjct  148  RDGDGMVSFQEFKVMM  163



>ref|XP_008467096.1| PREDICTED: probable calcium-binding protein CML25 [Cucumis melo]
Length=182

 Score =   113 bits (283),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 86/138 (62%), Gaps = 3/138 (2%)
 Frame = -1

Query  629  AELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  450
            AEL Q F   D + DGKI   EL  ++  +G +P + EEL  M+ EVD DGDG I L+EF
Sbjct  36   AELEQVFNKFDVNGDGKICSSELGSIMGSLG-QPATEEELHNMIKEVDADGDGYIDLDEF  94

Query  449  SVLSSAFAPPS-CDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG  273
              L++     +     L+DAF  +D D +G I+AEEL  V K++GD  C+L DCR+MI G
Sbjct  95   IELNTKGVDSNEVLENLKDAFSVYDIDGNGSITAEELHEVLKSLGDD-CSLADCRKMITG  153

Query  272  VDNNGDGFVCFEDFCRMM  219
            VD NGDG + F++F  MM
Sbjct  154  VDKNGDGMISFDEFKVMM  171



>ref|XP_006357771.1| PREDICTED: calcium-binding protein CML24-like [Solanum tuberosum]
Length=156

 Score =   112 bits (281),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 90/136 (66%), Gaps = 2/136 (1%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            E+ + F+  D + DGKI   EL  +L+ +G++    E  R+ML EVD DGDG I L+EF+
Sbjct  20   EVEKVFRKFDANGDGKISLSELGAILNALGSKTSPDEVKRIML-EVDTDGDGFIDLKEFA  78

Query  446  VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVD  267
                     S + ELR+AFD +D D +GKI+A EL +V K++G+ +C+L+DCRRMI  VD
Sbjct  79   AFYCPGGADSDNKELREAFDLYDKDKNGKITAAELHSVMKSLGE-KCSLKDCRRMISKVD  137

Query  266  NNGDGFVCFEDFCRMM  219
             +GDG V FE+F +MM
Sbjct  138  VDGDGCVNFEEFKKMM  153


 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 42/64 (66%), Gaps = 1/64 (2%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            EL +AF L D+D +GKI   EL  ++  +G E  S ++ R M+S+VD DGDGC++ EEF 
Sbjct  92   ELREAFDLYDKDKNGKITAAELHSVMKSLG-EKCSLKDCRRMISKVDVDGDGCVNFEEFK  150

Query  446  VLSS  435
             + S
Sbjct  151  KMMS  154



>ref|XP_003637661.1| Calcium-binding pollen allergen [Medicago truncatula]
 gb|KEH40591.1| EF hand calcium-binding family protein [Medicago truncatula]
Length=198

 Score =   113 bits (283),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 89/137 (65%), Gaps = 3/137 (2%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            +L   F+  D + DGKI   EL  ++  +G +P + EEL  M+ EVD DGDG I+LEEF 
Sbjct  46   DLEHVFRKFDVNGDGKISSSELGSIMGSLG-QPATEEELDNMIREVDADGDGHINLEEFI  104

Query  446  VLSSA-FAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  270
             L++    P      L+DAF  FD D +G ISAEEL NV  ++GD +C+L +C++MI GV
Sbjct  105  ELNTKDIDPNEILENLKDAFSVFDIDKNGSISAEELHNVMVSLGD-QCSLAECQKMIGGV  163

Query  269  DNNGDGFVCFEDFCRMM  219
            D++GDG + FE+F +MM
Sbjct  164  DSDGDGMIDFEEFKKMM  180



>ref|XP_003519336.1| PREDICTED: probable calcium-binding protein CML18-like [Glycine 
max]
Length=141

 Score =   112 bits (279),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 91/138 (66%), Gaps = 3/138 (2%)
 Frame = -1

Query  629  AELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  450
             E+ Q F   D++ DGKI   EL+ +L+ +G++    EEL+ M+ E+D++GDG I L+EF
Sbjct  3    VEVRQIFNKFDKNGDGKISVTELKDMLAALGSKTTD-EELKRMMEELDQNGDGFIDLKEF  61

Query  449  SVLSSAFAPPSCDS-ELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG  273
            +           DS ELRDAFD +D D +G ISA+EL +V + +G+ +C+L DCRRMI  
Sbjct  62   ADFHCNGGAGKDDSKELRDAFDLYDVDKNGLISAKELHDVLRNLGE-KCSLSDCRRMISN  120

Query  272  VDNNGDGFVCFEDFCRMM  219
            VD +GDG V FE+F +MM
Sbjct  121  VDADGDGNVNFEEFKKMM  138



>ref|XP_007033045.1| Calmodulin like 23, putative [Theobroma cacao]
 gb|EOY03971.1| Calmodulin like 23, putative [Theobroma cacao]
Length=152

 Score =   112 bits (280),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 92/146 (63%), Gaps = 8/146 (5%)
 Frame = -1

Query  638  GLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISL  459
            G   E+ + F   D++ DGKI ++EL+ +LS +G+ PPS +E+  ++S +D+DG+G + L
Sbjct  6    GSMEEMKEVFNKFDKNGDGKISRDELKSILSALGS-PPSSDEVDRIMSMMDKDGNGYVDL  64

Query  458  EEFSVLSSAFAPPSCD------SELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLE  297
            +EF          + D       EL+DAFD +D D +G ISA EL  V K +G+ +C+L 
Sbjct  65   DEFIAFHGTNINGNGDDSQCGNKELKDAFDMYDLDKNGLISANELHAVLKRLGE-KCSLS  123

Query  296  DCRRMILGVDNNGDGFVCFEDFCRMM  219
            DCRRMI  VD +GDG V FE+F +MM
Sbjct  124  DCRRMISQVDKDGDGNVNFEEFKKMM  149



>ref|XP_011070577.1| PREDICTED: probable calcium-binding protein CML25 [Sesamum indicum]
Length=195

 Score =   113 bits (283),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 65/142 (46%), Positives = 89/142 (63%), Gaps = 3/142 (2%)
 Frame = -1

Query  641  SGLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCIS  462
            S L  EL Q FK  D + DGKI   EL  +L  VG +P + EELR+M+ EVD DGDG I 
Sbjct  43   SRLEEELEQVFKKFDVNGDGKISASELGSILGSVG-QPATEEELRIMIQEVDADGDGFID  101

Query  461  LEEFSVLSSA-FAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRR  285
            L+EF  L++           L+DAF  FD D +G I+AEEL +V +++G+  CTL +C +
Sbjct  102  LQEFIALNTTDVGHEEVMENLKDAFKVFDIDKNGYITAEELQDVLQSLGE-ECTLAECEK  160

Query  284  MILGVDNNGDGFVCFEDFCRMM  219
            MI GVD++G G + F++F  MM
Sbjct  161  MISGVDSDGSGTINFDEFKVMM  182



>ref|XP_004150619.1| PREDICTED: probable calcium-binding protein CML25-like [Cucumis 
sativus]
Length=164

 Score =   112 bits (280),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 66/142 (46%), Positives = 89/142 (63%), Gaps = 11/142 (8%)
 Frame = -1

Query  629  AELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  450
            AEL Q F   D + DGKI   EL  ++  +G +P + EEL+ M+ EVD DGDG I L+EF
Sbjct  18   AELEQVFNKFDVNGDGKICSSELGSIMGSLG-QPATEEELQNMIKEVDADGDGYIDLDEF  76

Query  449  SVLSSAFAPPSCDSE-----LRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRR  285
              L++       DS+     L+DAF  +D D +G I+AEEL  V K++GD  C+L DCR+
Sbjct  77   IELNT----KGVDSDEVLENLKDAFSVYDIDGNGSITAEELHEVLKSLGDD-CSLADCRK  131

Query  284  MILGVDNNGDGFVCFEDFCRMM  219
            MI GVD NGDG + F++F  MM
Sbjct  132  MITGVDKNGDGMISFDEFKVMM  153



>ref|XP_004241666.2| PREDICTED: calcium-binding allergen Ole e 8-like [Solanum lycopersicum]
Length=197

 Score =   113 bits (282),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 60/137 (44%), Positives = 89/137 (65%), Gaps = 3/137 (2%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            E+ + F   D + DG I  +EL  +L  +G++  S EE+  M++E+D D DGCI+L+EF+
Sbjct  60   EVKKVFARFDANGDGMISGDELSGVLKALGSDT-SPEEVARMMAEIDTDKDGCINLDEFA  118

Query  446  -VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  270
                +  +      EL++AFD +D DH+G+ISA EL  +   +G + CTL+DC RMI  V
Sbjct  119  DFCKNDESVDGGAKELKEAFDLYDQDHNGRISATELHQILNRLGQN-CTLQDCTRMITSV  177

Query  269  DNNGDGFVCFEDFCRMM  219
            D NGDG+VCFE+F +MM
Sbjct  178  DANGDGYVCFEEFKKMM  194



>ref|XP_007141898.1| hypothetical protein PHAVU_008G235100g [Phaseolus vulgaris]
 gb|ESW13892.1| hypothetical protein PHAVU_008G235100g [Phaseolus vulgaris]
Length=140

 Score =   111 bits (277),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 88/136 (65%), Gaps = 2/136 (1%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            E+ Q F   D++ DGKI   EL  +L  +G+   ++EEL+ ++ E+D++GDG I L+EF+
Sbjct  4    EVRQIFNKFDKNGDGKISITELRDMLGTLGS-KTTKEELKRIMEELDQNGDGYIDLKEFA  62

Query  446  VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVD  267
                  A      ELRDAFD +D D +G ISA+EL +V   +G+ +C+L DCRRMI  VD
Sbjct  63   DFHCNDAGNDESKELRDAFDLYDVDKNGLISAKELHDVLSKLGE-KCSLSDCRRMISNVD  121

Query  266  NNGDGFVCFEDFCRMM  219
             +GDG V FE+F +MM
Sbjct  122  ADGDGSVNFEEFKKMM  137


 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 41/62 (66%), Gaps = 1/62 (2%)
 Frame = -1

Query  413  DSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFED  234
            D E+R  F+ FD + DGKIS  EL ++  T+G S+ T E+ +R++  +D NGDG++  ++
Sbjct  2    DDEVRQIFNKFDKNGDGKISITELRDMLGTLG-SKTTKEELKRIMEELDQNGDGYIDLKE  60

Query  233  FC  228
            F 
Sbjct  61   FA  62



>gb|AFK34900.1| unknown [Lotus japonicus]
Length=196

 Score =   112 bits (281),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 89/137 (65%), Gaps = 3/137 (2%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            EL + F+  D + DGKI   EL  ++  +G +  ++EEL  M+ EVD DGDG ISLEEF 
Sbjct  51   ELEKVFEKFDVNRDGKISSSELGSIMGSLG-QSATKEELDNMIREVDSDGDGYISLEEFI  109

Query  446  VLSSA-FAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  270
             L++    P      LRDAF  FD D +G I+AEEL NV  ++GD  C+LE+C++MI GV
Sbjct  110  ELNTKDIDPNEILENLRDAFSVFDIDGNGSITAEELHNVMASLGD-ECSLEECQKMIGGV  168

Query  269  DNNGDGFVCFEDFCRMM  219
            D++GDG + FE+F  MM
Sbjct  169  DSDGDGMIDFEEFRTMM  185



>ref|XP_010693960.1| PREDICTED: probable calcium-binding protein CML18 [Beta vulgaris 
subsp. vulgaris]
Length=142

 Score =   110 bits (276),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 92/138 (67%), Gaps = 3/138 (2%)
 Frame = -1

Query  629  AELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  450
            +E+ + F   D + DGKI   EL+ LL  +G+E  S EE++ M+ E+D+DGDG + L EF
Sbjct  5    SEIERIFSKFDANGDGKISATELKSLLQALGSET-STEEVKKMMEEMDKDGDGFVDLLEF  63

Query  449  SVLSSAFAPPSCDS-ELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG  273
            S   +     +  + EL +AF  +D D +GKISA EL++V K++G+ +C+L+DC++MI  
Sbjct  64   SEFHAGSGGNAGSTKELEEAFRLYDKDGNGKISARELYDVLKSLGE-KCSLKDCKKMISS  122

Query  272  VDNNGDGFVCFEDFCRMM  219
            VD +GDG V FE+F +MM
Sbjct  123  VDADGDGHVDFEEFKKMM  140


 Score = 50.4 bits (119),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 43/70 (61%), Gaps = 1/70 (1%)
 Frame = -1

Query  641  SGLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCIS  462
            +G   EL +AF+L D+D +GKI   EL  +L  +G E  S ++ + M+S VD DGDG + 
Sbjct  74   AGSTKELEEAFRLYDKDGNGKISARELYDVLKSLG-EKCSLKDCKKMISSVDADGDGHVD  132

Query  461  LEEFSVLSSA  432
             EEF  + +A
Sbjct  133  FEEFKKMMAA  142



>ref|XP_011084270.1| PREDICTED: calcium-binding allergen Ole e 8-like [Sesamum indicum]
Length=160

 Score =   111 bits (278),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 91/140 (65%), Gaps = 6/140 (4%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            E+ + F   D + DGKI  +EL  ++  +G+E  S +E+  M+ E+D D DG ISLEEF+
Sbjct  20   EVKRVFDRFDANGDGKISSDELGGVIEALGSET-SADEVARMMEEIDTDKDGFISLEEFA  78

Query  446  VLSSAFAPPS----CDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMI  279
            V  SA + PS     + ELR+AFD +D DHDG+IS  EL  +   +G+ RC++ DC  MI
Sbjct  79   VFCSADSDPSGGGNSEKELREAFDLYDQDHDGQISKTELHLILTRLGE-RCSVNDCSEMI  137

Query  278  LGVDNNGDGFVCFEDFCRMM  219
              VD++GDGFV F++F +MM
Sbjct  138  RSVDSDGDGFVSFDEFRKMM  157



>ref|XP_010104706.1| putative calcium-binding protein CML25 [Morus notabilis]
 gb|EXC48677.1| putative calcium-binding protein CML25 [Morus notabilis]
Length=193

 Score =   112 bits (279),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/141 (46%), Positives = 89/141 (63%), Gaps = 11/141 (8%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            EL Q FK  D + DGKI   EL  ++  +G +P   EELR M+ EVD DGDG I L+EF 
Sbjct  44   ELEQVFKKFDVNGDGKISSSELGAIMGSLG-QPSGEEELRKMIKEVDSDGDGFIDLKEFI  102

Query  446  VLSSAFAPPSCDSE-----LRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRM  282
             L++       DS+     L+DAF  +D D +G ISAEEL+ V +++GD  C++ +CR+M
Sbjct  103  ELNTK----GVDSDEVLENLKDAFSVYDIDKNGSISAEELYEVLRSLGD-ECSIAECRKM  157

Query  281  ILGVDNNGDGFVCFEDFCRMM  219
            I GVD +GDG + FE+F  MM
Sbjct  158  ISGVDCDGDGTISFEEFKVMM  178



>ref|XP_006365410.1| PREDICTED: calcium-binding allergen Ole e 8-like [Solanum tuberosum]
Length=154

 Score =   110 bits (276),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 88/137 (64%), Gaps = 3/137 (2%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            E+ + F   D + DG I  +EL  +L  +G++  S EE+  M++E+D D DGCI+++EF+
Sbjct  17   EVKKVFARFDANGDGMISGDELSGVLKALGSDT-SPEEVARMMAEIDTDKDGCINIDEFA  75

Query  446  -VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  270
                +  +      EL++AFD +D DH+G+ISA EL  +   +G   CT++DC RMI  V
Sbjct  76   DFCKNDDSVDGGAKELKEAFDLYDQDHNGRISATELHQILNRLG-QNCTIQDCTRMITSV  134

Query  269  DNNGDGFVCFEDFCRMM  219
            D NGDG+VCFE+F +MM
Sbjct  135  DANGDGYVCFEEFKKMM  151



>ref|XP_009804163.1| PREDICTED: calcium-binding protein CML24-like [Nicotiana sylvestris]
Length=158

 Score =   110 bits (275),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 89/138 (64%), Gaps = 4/138 (3%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            E+ + F+  D + DGKI   EL  +L+ +G+     E  R+ML EVD DGDG I L+EF+
Sbjct  20   EVAKVFRKFDTNGDGKISLSELGAILNALGSTTSPDEVKRIML-EVDTDGDGFIDLKEFA  78

Query  446  VLSSAFAPPSCD--SELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG  273
                     + D   ELR+AFD +D D +GKI+A EL +V K++G+ +C+L+DCRRMI  
Sbjct  79   AFHCPGGETNGDDSKELREAFDLYDKDKNGKITAAELHSVMKSLGE-KCSLKDCRRMISS  137

Query  272  VDNNGDGFVCFEDFCRMM  219
            VD +GDG V FE+F +MM
Sbjct  138  VDVDGDGCVNFEEFKKMM  155


 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 41/64 (64%), Gaps = 1/64 (2%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            EL +AF L D+D +GKI   EL  ++  +G E  S ++ R M+S VD DGDGC++ EEF 
Sbjct  94   ELREAFDLYDKDKNGKITAAELHSVMKSLG-EKCSLKDCRRMISSVDVDGDGCVNFEEFK  152

Query  446  VLSS  435
             + S
Sbjct  153  KMMS  156



>ref|XP_002274476.1| PREDICTED: probable calcium-binding protein CML23 [Vitis vinifera]
 emb|CAN68471.1| hypothetical protein VITISV_028194 [Vitis vinifera]
Length=150

 Score =   110 bits (275),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 88/140 (63%), Gaps = 2/140 (1%)
 Frame = -1

Query  638  GLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISL  459
            G   E+ + F   D++ DGKI  EE   +L  +G+   S +EL  ++SE+D DGDG I L
Sbjct  10   GTMEEVERVFNRFDKNGDGKISAEEFGEVLQALGS-TTSPDELTRIMSEIDTDGDGFIDL  68

Query  458  EEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMI  279
            +EF+    A       +ELRDAFD +D D +G ISA EL  VFK++G+ + TL+DC RMI
Sbjct  69   KEFADFHRATDSNGGLTELRDAFDMYDRDKNGLISASELHAVFKSLGE-KVTLKDCSRMI  127

Query  278  LGVDNNGDGFVCFEDFCRMM  219
              VD +GDG V FE+F +MM
Sbjct  128  SSVDADGDGCVNFEEFKKMM  147



>gb|KJB08532.1| hypothetical protein B456_001G087100 [Gossypium raimondii]
 gb|KJB08533.1| hypothetical protein B456_001G087100 [Gossypium raimondii]
Length=154

 Score =   110 bits (275),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 91/146 (62%), Gaps = 8/146 (5%)
 Frame = -1

Query  638  GLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISL  459
            G   E+ + F   D++ DGKI ++EL+ +L+ +G+ P S E  R+M SE+D+DG+G + L
Sbjct  6    GSVEEMKKVFNKFDKNGDGKISRDELKSVLTALGSAPSSGEVDRIM-SEMDKDGNGYVDL  64

Query  458  EEFSVLSSAF-----APPSC-DSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLE  297
            +EF                C + EL+DAFD +D D +G ISA EL  V K +G+ +C+L 
Sbjct  65   DEFVAFQQTNINDDDGEAQCGNKELKDAFDMYDLDKNGLISANELHAVLKRLGE-KCSLS  123

Query  296  DCRRMILGVDNNGDGFVCFEDFCRMM  219
            DCRRMI  VD +GDG V F++F +MM
Sbjct  124  DCRRMISQVDKDGDGNVNFDEFKKMM  149



>ref|XP_007223528.1| hypothetical protein PRUPE_ppa012032mg [Prunus persica]
 gb|EMJ24727.1| hypothetical protein PRUPE_ppa012032mg [Prunus persica]
Length=186

 Score =   111 bits (277),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 87/138 (63%), Gaps = 3/138 (2%)
 Frame = -1

Query  629  AELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  450
            AEL Q FK  D + DGKI   EL  ++S +G +P + EEL  M+ EVD DGDG I  +EF
Sbjct  39   AELDQVFKKFDVNGDGKISSSELGAIMSSLG-QPANEEELSHMILEVDSDGDGFIDFKEF  97

Query  449  SVL-SSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG  273
              L ++          L+DAF  +D D +G ISAEEL+ V +++GD  C++ +C++MI  
Sbjct  98   VELNTNGVDQAEALENLKDAFSVYDIDGNGSISAEELYKVLRSLGD-ECSIAECKKMISA  156

Query  272  VDNNGDGFVCFEDFCRMM  219
            VD++GDG + FE+F  MM
Sbjct  157  VDSDGDGMINFEEFKVMM  174



>gb|KJB50384.1| hypothetical protein B456_008G168100 [Gossypium raimondii]
Length=195

 Score =   111 bits (277),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 63/141 (45%), Positives = 89/141 (63%), Gaps = 11/141 (8%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            EL   FK+ D + DGKI   EL  ++  +G +P S EE++ M+ E D DGDG I+ EEF 
Sbjct  50   ELEHIFKMFDANGDGKISSSELASIMGSLGQQP-SDEEVQKMIKEFDADGDGFINFEEFV  108

Query  446  VLSSAFAPPSCDSE-----LRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRM  282
             L++       DS+     L+DAF  +D D +G ISAEEL  V K++GD  C++ +CR+M
Sbjct  109  ELNTK----GVDSKEVLENLKDAFSVYDLDGNGSISAEELHKVLKSLGDD-CSITECRKM  163

Query  281  ILGVDNNGDGFVCFEDFCRMM  219
            I GVDN+G+G + FE+F  MM
Sbjct  164  ISGVDNDGNGMIDFEEFKVMM  184



>ref|XP_008464718.1| PREDICTED: probable calcium-binding protein CML25 [Cucumis melo]
Length=185

 Score =   110 bits (276),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 86/138 (62%), Gaps = 3/138 (2%)
 Frame = -1

Query  629  AELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  450
            AEL + FK  D + DGKI   EL  +++ +G    + EEL  M+ E D DGDG I+L EF
Sbjct  41   AELEEVFKKFDVNGDGKISSAELGSIMTSLG-HNATEEELGKMIEEFDADGDGFINLHEF  99

Query  449  SVLSSA-FAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG  273
              L++    P      LR+AF  +D D +G ISAEEL  V +++GD  C++ DCR+MI G
Sbjct  100  VELNTKEIDPEELLENLREAFSVYDIDGNGSISAEELHKVLRSLGDD-CSVADCRQMISG  158

Query  272  VDNNGDGFVCFEDFCRMM  219
            VD+NGDG + FE+F  MM
Sbjct  159  VDSNGDGMISFEEFKVMM  176


 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 44/77 (57%), Gaps = 4/77 (5%)
 Frame = -1

Query  662  EISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDR  483
            EI P+EL      L +AF + D D +G I  EEL  +L  +G +  S  + R M+S VD 
Sbjct  106  EIDPEEL---LENLREAFSVYDIDGNGSISAEELHKVLRSLG-DDCSVADCRQMISGVDS  161

Query  482  DGDGCISLEEFSVLSSA  432
            +GDG IS EEF V+ S 
Sbjct  162  NGDGMISFEEFKVMMST  178



>ref|XP_004503360.1| PREDICTED: probable calcium-binding protein CML25-like [Cicer 
arietinum]
Length=190

 Score =   110 bits (276),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 90/140 (64%), Gaps = 11/140 (8%)
 Frame = -1

Query  635  LYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  456
            L  EL Q FK  D + DGKI   EL  ++  +G +P + +EL  M+ EVD DGDGCISL+
Sbjct  35   LAGELEQVFKKFDVNGDGKISASELGSIMGSLG-QPATEQELDNMIREVDGDGDGCISLQ  93

Query  455  EFSVLSSAFAPPSCDSE-----LRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDC  291
            EF  L++       DS+     L+DAF  FD D +G I+AEEL  V +++G+  C+L +C
Sbjct  94   EFIELNTK----GVDSDEILENLKDAFAVFDMDGNGSITAEELNTVMRSLGE-ECSLAEC  148

Query  290  RRMILGVDNNGDGFVCFEDF  231
            RRMI GVD++GDG + FE+F
Sbjct  149  RRMIGGVDSDGDGMIDFEEF  168



>emb|CDP16307.1| unnamed protein product [Coffea canephora]
Length=189

 Score =   110 bits (276),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 86/137 (63%), Gaps = 3/137 (2%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            EL Q FK  D + DGKI   EL  ++  +G  P + EEL  +++E D DGDG I L+EF 
Sbjct  42   ELEQVFKKFDVNGDGKISASELGQIMGSLGY-PTTDEELHKLMNEADSDGDGFIDLQEFI  100

Query  446  VLSSA-FAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  270
             L++           L+DAF  FD D +G ISA+EL NV K++G+  C+L +CR+MI GV
Sbjct  101  ELNTKDIDSDEVMENLKDAFSVFDIDKNGSISADELQNVLKSLGE-ECSLAECRKMICGV  159

Query  269  DNNGDGFVCFEDFCRMM  219
            D +GDG +CFE+F  MM
Sbjct  160  DADGDGMICFEEFKVMM  176



>ref|XP_004231987.1| PREDICTED: calcium-binding protein CML24 [Solanum lycopersicum]
Length=156

 Score =   109 bits (273),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 64/147 (44%), Positives = 93/147 (63%), Gaps = 6/147 (4%)
 Frame = -1

Query  659  ISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRD  480
            +S  E+ G+     + F+  D + DGKI   EL  +L+ +G++    E  R+ML EVD D
Sbjct  13   VSSAEMDGVE----KVFRKFDANGDGKISLSELGAILNALGSKTSPDEVNRIML-EVDTD  67

Query  479  GDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTL  300
            GDG I L+EF+           + ELR+AFD +D D +GKI+A EL +V K++G+ +C+L
Sbjct  68   GDGFIDLKEFAAFYCPRGADGDNKELREAFDLYDKDKNGKITAAELHSVMKSLGE-KCSL  126

Query  299  EDCRRMILGVDNNGDGFVCFEDFCRMM  219
            +DCRRMI  VD +GDG V FE+F +MM
Sbjct  127  KDCRRMISKVDVDGDGCVNFEEFKKMM  153


 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 44/73 (60%), Gaps = 1/73 (1%)
 Frame = -1

Query  653  PDELSGLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGD  474
            P    G   EL +AF L D+D +GKI   EL  ++  +G E  S ++ R M+S+VD DGD
Sbjct  83   PRGADGDNKELREAFDLYDKDKNGKITAAELHSVMKSLG-EKCSLKDCRRMISKVDVDGD  141

Query  473  GCISLEEFSVLSS  435
            GC++ EEF  + S
Sbjct  142  GCVNFEEFKKMMS  154



>ref|XP_010043960.1| PREDICTED: probable calcium-binding protein CML25 [Eucalyptus 
grandis]
 gb|KCW85969.1| hypothetical protein EUGRSUZ_B02672 [Eucalyptus grandis]
Length=194

 Score =   110 bits (275),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 87/137 (64%), Gaps = 3/137 (2%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            EL Q F+  D + DGKI   EL  ++S +G  P + EEL  M+ EVD DGDG I  +EF 
Sbjct  43   ELEQVFRKFDANGDGKISASELGSIMSSLG-HPETEEELAKMVREVDSDGDGFIDFDEFV  101

Query  446  VLSSAFAPPSCDSE-LRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  270
             L++    P+   E LRDAF  +D D DG I+AEEL  V +++G+   +L +CR+MI GV
Sbjct  102  ELNTKGVDPAEAMENLRDAFSVYDIDGDGSITAEELHKVMRSLGEEN-SLAECRKMIGGV  160

Query  269  DNNGDGFVCFEDFCRMM  219
            D++GDG + FE+F  MM
Sbjct  161  DSDGDGMISFEEFKVMM  177



>gb|EYU46532.1| hypothetical protein MIMGU_mgv1a021796mg [Erythranthe guttata]
Length=150

 Score =   109 bits (272),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 85/137 (62%), Gaps = 2/137 (1%)
 Frame = -1

Query  629  AELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  450
            AE  +AF LID+D DG I  EEL  L  Q   E P+ EE++ M++E D DGDG +  EEF
Sbjct  11   AEFREAFSLIDKDSDGVITVEEL-ALAIQSLNEHPTSEEIQEMVNEADSDGDGTVDFEEF  69

Query  449  SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  270
             ++ S+    +   E++DAF  FD D DG ISA EL NV   +G+ R T E+  +MI  V
Sbjct  70   LIVMSSKMKENVVEEIKDAFKVFDRDQDGFISAIELRNVMINMGE-RLTEEEAEQMINEV  128

Query  269  DNNGDGFVCFEDFCRMM  219
            D +GDG V ++DF +MM
Sbjct  129  DLDGDGLVSYDDFVKMM  145



>ref|XP_009628802.1| PREDICTED: probable calcium-binding protein CML18 [Nicotiana 
tomentosiformis]
Length=158

 Score =   109 bits (272),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 88/138 (64%), Gaps = 4/138 (3%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            E+ + F+  D + DGKI   EL  +L+ +G+     E  R+ML EVD DGDG I L+EF+
Sbjct  20   EVAKVFRKFDANGDGKISLSELGAILNALGSTTSPDEVKRIML-EVDTDGDGFIDLKEFA  78

Query  446  VLSSAFAPPSCD--SELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG  273
                       D   ELR+AFD +D D +GKI+A EL +V K++G+ +C+L+DCRRMI  
Sbjct  79   AFHCPGGGTDGDDSKELREAFDLYDKDKNGKITAAELHSVMKSLGE-KCSLKDCRRMISS  137

Query  272  VDNNGDGFVCFEDFCRMM  219
            VD +GDG V FE+F +MM
Sbjct  138  VDVDGDGCVNFEEFKKMM  155


 Score = 53.9 bits (128),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 41/64 (64%), Gaps = 1/64 (2%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            EL +AF L D+D +GKI   EL  ++  +G E  S ++ R M+S VD DGDGC++ EEF 
Sbjct  94   ELREAFDLYDKDKNGKITAAELHSVMKSLG-EKCSLKDCRRMISSVDVDGDGCVNFEEFK  152

Query  446  VLSS  435
             + S
Sbjct  153  KMMS  156



>ref|XP_011099473.1| PREDICTED: probable calcium-binding protein CML18 [Sesamum indicum]
Length=152

 Score =   108 bits (271),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 62/139 (45%), Positives = 88/139 (63%), Gaps = 3/139 (2%)
 Frame = -1

Query  635  LYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  456
            L  E+ + F   D + DG+I   EL  +L+ +G+  P  E  R+M SE+D DGDG I L 
Sbjct  12   LEEEVEKVFSKFDTNGDGRISLTELGAILNGLGSATPGDEVARIM-SELDTDGDGFIDLN  70

Query  455  EFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMIL  276
            EF          S + EL++AFD +D D +GKISA EL +V +++G+ +C+L+DCRRMI 
Sbjct  71   EFKAFHCGGGEDS-NKELKEAFDLYDKDKNGKISASELHSVLRSLGE-KCSLKDCRRMIS  128

Query  275  GVDNNGDGFVCFEDFCRMM  219
             VD +GDG V FE+F +MM
Sbjct  129  SVDVDGDGCVNFEEFKKMM  147



>ref|XP_006654163.1| PREDICTED: probable calcium-binding protein CML18-like [Oryza 
brachyantha]
Length=154

 Score =   108 bits (271),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 63/145 (43%), Positives = 88/145 (61%), Gaps = 10/145 (7%)
 Frame = -1

Query  629  AELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  450
            AEL Q F+  D + DGKI  EEL  +L  +GA PP   E+R M+ E+D D DG + L EF
Sbjct  4    AELEQVFRRYDANGDGKISAEELASVLRALGA-PPGPGEVRRMMDEMDSDRDGFVDLTEF  62

Query  449  SVL--------SSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLED  294
            +          S+     + ++ELR+AF  +D D +GKISA EL  V + +GD +C++ D
Sbjct  63   TAFHCSGGSGDSAKDQEAASEAELREAFRMYDADSNGKISARELHRVLRQLGD-KCSVAD  121

Query  293  CRRMILGVDNNGDGFVCFEDFCRMM  219
            C RMI  VD +GDG V F++F +MM
Sbjct  122  CSRMIRSVDADGDGCVNFDEFKKMM  146


 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 44/77 (57%), Gaps = 1/77 (1%)
 Frame = -1

Query  656  SPDELSGLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDG  477
            + D+ +   AEL +AF++ D D +GKI   EL  +L Q+G +  S  +   M+  VD DG
Sbjct  75   AKDQEAASEAELREAFRMYDADSNGKISARELHRVLRQLG-DKCSVADCSRMIRSVDADG  133

Query  476  DGCISLEEFSVLSSAFA  426
            DGC++ +EF  +    A
Sbjct  134  DGCVNFDEFKKMMGGGA  150



>ref|XP_009392676.1| PREDICTED: probable calcium-binding protein CML10 [Musa acuminata 
subsp. malaccensis]
Length=183

 Score =   109 bits (273),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 82/137 (60%), Gaps = 3/137 (2%)
 Frame = -1

Query  629  AELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  450
             +L + F   D + DGKI   EL  +L  +  +PPS EEL  M+ E D DGDG IS  EF
Sbjct  36   GDLERVFNKFDANGDGKISSAELAAVLEILSGQPPSEEELGRMMREADVDGDGFISFAEF  95

Query  449  SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  270
              L++  AP + + +LR AF  FD D  G ISA+EL ++   IG+   +L  CRRMI GV
Sbjct  96   VDLNT--APAALEEDLRLAFAVFDLDRSGSISADELAHILGGIGEG-ASLAQCRRMIDGV  152

Query  269  DNNGDGFVCFEDFCRMM  219
            D +GDG V FE+F  MM
Sbjct  153  DRDGDGLVSFEEFKAMM  169



>ref|XP_002459097.1| hypothetical protein SORBIDRAFT_03g045770 [Sorghum bicolor]
 gb|EES04217.1| hypothetical protein SORBIDRAFT_03g045770 [Sorghum bicolor]
Length=189

 Score =   109 bits (273),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 88/148 (59%), Gaps = 4/148 (3%)
 Frame = -1

Query  656  SPDELSGLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDG  477
            SP   +    E+ + F+  D + DG+I + EL  L   +G    S +E+  M++E D DG
Sbjct  34   SPPRAATAEEEMARVFRKFDANGDGRISRSELAALFESLG-HAASDDEVARMMAEADADG  92

Query  476  DGCISLEEFSVLSSAFA--PPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCT  303
            DG ISL+EF+ L++  A    + + +LR AF  FD D +G ISA EL  V + +G+S  +
Sbjct  93   DGFISLDEFAALNATVAGDAAAVEEDLRHAFRVFDADGNGTISAAELARVLRGLGES-AS  151

Query  302  LEDCRRMILGVDNNGDGFVCFEDFCRMM  219
            +  CRRMI GVD NGDG + FE+F  MM
Sbjct  152  VAQCRRMIEGVDQNGDGLISFEEFKVMM  179



>ref|XP_002279679.1| PREDICTED: probable calcium-binding protein CML23 [Vitis vinifera]
Length=204

 Score =   110 bits (274),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 66/141 (47%), Positives = 92/141 (65%), Gaps = 5/141 (4%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSR-EELRLMLSEVDRDGDGCISLEEF  450
            +L Q F+L+D + DGKI   EL  +L  +G E  +  EE   M+ EVD +GDG I L+EF
Sbjct  55   QLKQVFRLLDTNGDGKISSFELSEVLLWLGQEKSTAVEEAEGMVREVDCNGDGFIDLDEF  114

Query  449  -SVLSSAF---APPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRM  282
              V+++ F   +  +CD  L DAF  FD+D +G ISAEEL  V  ++G  +C+L++C+RM
Sbjct  115  MRVMNTDFTVGSSSTCDDGLMDAFLIFDSDKNGVISAEELQRVLISLGCVKCSLQECKRM  174

Query  281  ILGVDNNGDGFVCFEDFCRMM  219
            I GVD +GDGFV FE+F  MM
Sbjct  175  IKGVDKDGDGFVDFEEFRSMM  195


 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 47/79 (59%), Gaps = 1/79 (1%)
 Frame = -1

Query  452  FSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCT-LEDCRRMIL  276
            F +L+S+F      ++L+  F   DT+ DGKIS+ EL  V   +G  + T +E+   M+ 
Sbjct  40   FDLLTSSFTAMEVSNQLKQVFRLLDTNGDGKISSFELSEVLLWLGQEKSTAVEEAEGMVR  99

Query  275  GVDNNGDGFVCFEDFCRMM  219
             VD NGDGF+  ++F R+M
Sbjct  100  EVDCNGDGFIDLDEFMRVM  118



>ref|XP_008221464.1| PREDICTED: probable calcium-binding protein CML25 [Prunus mume]
Length=186

 Score =   109 bits (272),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 87/138 (63%), Gaps = 3/138 (2%)
 Frame = -1

Query  629  AELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  450
            AEL Q FK  D + DGKI   EL  ++S +G +P + EEL  M+ EVD DGDG I  +EF
Sbjct  39   AELDQVFKKFDVNGDGKISSSELGAIMSSLG-QPANEEELSHMILEVDSDGDGFIDFKEF  97

Query  449  SVL-SSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG  273
              L ++          L+DAF  +D D +G ISAEEL+ V +++GD  C++ +C++MI  
Sbjct  98   VELNTNGVDQAEALENLKDAFSVYDIDGNGLISAEELYKVLRSLGD-ECSIAECKKMISA  156

Query  272  VDNNGDGFVCFEDFCRMM  219
            VD++GDG + FE+F  MM
Sbjct  157  VDSDGDGMINFEEFKVMM  174



>ref|XP_010271345.1| PREDICTED: probable calcium-binding protein CML25 [Nelumbo nucifera]
Length=190

 Score =   109 bits (272),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 88/150 (59%), Gaps = 10/150 (7%)
 Frame = -1

Query  653  PDELSGLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGD  474
            P     L  EL   FK  D + DGKI   EL  ++  +G  P + EEL+ M+  VD DG+
Sbjct  35   PGNSRTLVEELGAVFKKFDMNGDGKISWSELGSIMENLG-NPVTEEELQKMVKVVDLDGN  93

Query  473  GCISLEEFSVLSSAFAPPSCDSE-----LRDAFDFFDTDHDGKISAEELFNVFKTIGDSR  309
            G I L EF  L++       DSE     LR AF  FDTD +G IS EEL  VF+++GD +
Sbjct  94   GFIDLNEFIDLNTN----GVDSEKAVEDLRHAFMIFDTDGNGSISPEELQAVFRSLGDDK  149

Query  308  CTLEDCRRMILGVDNNGDGFVCFEDFCRMM  219
            C++ DC++MI GVD +GDG + FE+F  MM
Sbjct  150  CSIADCKKMIRGVDCDGDGLISFEEFKNMM  179



>ref|XP_003616365.1| Polcalcin Nic t [Medicago truncatula]
 gb|AES99323.1| EF hand calcium-binding family protein [Medicago truncatula]
Length=139

 Score =   108 bits (269),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 88/136 (65%), Gaps = 2/136 (1%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            E+ + F   D++ DGKI + EL+ +L  +G+E  S EE++ M+ E+D++GDG I L+EF+
Sbjct  4    EVRKIFSKFDKNGDGKISRSELKEMLLTLGSETTS-EEVKRMMEELDQNGDGFIDLKEFA  62

Query  446  VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVD  267
                        SELRDAFD +D D +G ISA EL  V   +G+ +C+L DC++MI  VD
Sbjct  63   DFHCTEPGKDESSELRDAFDLYDLDKNGLISANELHAVLMKLGE-KCSLNDCKKMISNVD  121

Query  266  NNGDGFVCFEDFCRMM  219
             +GDG V FE+F +MM
Sbjct  122  VDGDGNVNFEEFKKMM  137


 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 38/62 (61%), Gaps = 1/62 (2%)
 Frame = -1

Query  413  DSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCFED  234
            D E+R  F  FD + DGKIS  EL  +  T+G S  T E+ +RM+  +D NGDGF+  ++
Sbjct  2    DDEVRKIFSKFDKNGDGKISRSELKEMLLTLG-SETTSEEVKRMMEELDQNGDGFIDLKE  60

Query  233  FC  228
            F 
Sbjct  61   FA  62



>ref|XP_008378130.1| PREDICTED: probable calcium-binding protein CML23 [Malus domestica]
Length=154

 Score =   108 bits (270),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/146 (41%), Positives = 90/146 (62%), Gaps = 5/146 (3%)
 Frame = -1

Query  656  SPDELSGLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDG  477
            S D  +G   EL + F   D++ DG+I  +EL  +   +G+E  S EE++ +++E D+DG
Sbjct  11   SGDGAAGSMEELKKVFDKFDKNGDGRISCDELRGVFGDLGSETASLEEVQRIMAEFDKDG  70

Query  476  DGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLE  297
            DG I +EEF+ + +  +      ELRDAFD +D D +G IS  EL  V K +G  +C+L+
Sbjct  71   DGHIDIEEFAEIINGGSTK----ELRDAFDLYDLDKNGLISTSELHEVLKRLG-QKCSLK  125

Query  296  DCRRMILGVDNNGDGFVCFEDFCRMM  219
            DC +MI  VD +GDG V F +F +MM
Sbjct  126  DCAKMISSVDVDGDGHVNFAEFKKMM  151



>ref|XP_009334418.1| PREDICTED: probable calcium-binding protein CML23 [Pyrus x bretschneideri]
Length=154

 Score =   107 bits (268),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/146 (41%), Positives = 89/146 (61%), Gaps = 5/146 (3%)
 Frame = -1

Query  656  SPDELSGLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDG  477
            S D  +G   EL + F   D++ DG+I  EEL  +   +G+E  S EE++ +++E D+DG
Sbjct  11   SGDGAAGSMEELKKVFDKFDKNGDGRISCEELRGVFGDLGSETASLEEVQRIMAEFDKDG  70

Query  476  DGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLE  297
            DG I + EF+ + +  +      ELRDAFD +D D +G IS  EL  V K +G  +C+L+
Sbjct  71   DGHIDIVEFAEIINGGSTK----ELRDAFDLYDLDKNGLISTSELHEVLKRLG-QKCSLK  125

Query  296  DCRRMILGVDNNGDGFVCFEDFCRMM  219
            DC +MI  VD +GDG V F +F +MM
Sbjct  126  DCAKMISSVDADGDGHVNFAEFKKMM  151



>ref|XP_010262278.1| PREDICTED: probable calcium-binding protein CML23 [Nelumbo nucifera]
Length=164

 Score =   108 bits (269),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 89/141 (63%), Gaps = 7/141 (5%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            E+ + FK  D + DGKI   EL  +L  +G++  S EE+  M+SE+D DGDG I L+EF+
Sbjct  18   EVEKVFKRFDANGDGKISSTELRDVLGALGSDT-SPEEIHRMMSEIDTDGDGFIDLKEFA  76

Query  446  VLSSAFAPPSCDSE-----LRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRM  282
                +    +  +E     L+DAF+ +D D +G ISA+EL+ V K +G+ +C+L+DC RM
Sbjct  77   EFHKSNGTGNTKAEDELKELKDAFNLYDKDKNGLISAKELYTVLKRLGE-KCSLQDCSRM  135

Query  281  ILGVDNNGDGFVCFEDFCRMM  219
            I  VD +GDG V FE+F  MM
Sbjct  136  INSVDVDGDGHVNFEEFKLMM  156



>ref|XP_006430624.1| hypothetical protein CICLE_v10013012mg [Citrus clementina]
 gb|ESR43864.1| hypothetical protein CICLE_v10013012mg [Citrus clementina]
 gb|KDO63083.1| hypothetical protein CISIN_1g031791mg [Citrus sinensis]
Length=153

 Score =   107 bits (267),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 85/136 (63%), Gaps = 2/136 (1%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            E+ + F   D++ DGKI  +EL+ +L  +G++  S EE++ ++ E+D DGDG I  +EFS
Sbjct  17   EVRKVFNKFDKNGDGKISADELKDVLRSLGSKT-SPEEVKRVMDEIDTDGDGYIDFKEFS  75

Query  446  VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVD  267
                A        EL+DAFD +D D +G ISA EL  V K +G+ + +L+DC  MI  VD
Sbjct  76   TFHLAGGSTDGTKELKDAFDLYDMDQNGLISANELHAVLKKLGE-KSSLKDCVNMIKKVD  134

Query  266  NNGDGFVCFEDFCRMM  219
             +GDG V FE+F +MM
Sbjct  135  ADGDGHVNFEEFKKMM  150



>gb|KHM99973.1| Putative calcium-binding protein CML25 [Glycine soja]
Length=152

 Score =   107 bits (267),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 88/140 (63%), Gaps = 3/140 (2%)
 Frame = -1

Query  635  LYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  456
            +  +L   FK  D + DGKI   EL  ++  +G +P + EE++ M+ EVD +GDG I+L 
Sbjct  5    ITEDLEYVFKKFDANGDGKISSSELGSIMKSLG-QPATEEEVKRMIQEVDANGDGHINLG  63

Query  455  EFSVLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMI  279
            EF  L++    P      L+DAF  FD D +G I+A+EL  V  ++GD+ C++++C++MI
Sbjct  64   EFLELNTKGVDPDEVLENLKDAFSIFDVDGNGLITAQELNMVMASLGDA-CSIDECQKMI  122

Query  278  LGVDNNGDGFVCFEDFCRMM  219
             GVD NGDG + FE+F  MM
Sbjct  123  AGVDGNGDGMINFEEFQLMM  142



>gb|EYU17655.1| hypothetical protein MIMGU_mgv1a015081mg [Erythranthe guttata]
Length=168

 Score =   107 bits (268),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 89/138 (64%), Gaps = 4/138 (3%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            E+ + F+  D + DGKI  +EL  +L+ +G+   S +E+  M+ E+D D DG I+L+EF+
Sbjct  20   EVRKVFQRFDTNGDGKISSDELGGVLNALGS-GTSADEVARMMEEIDTDKDGHINLQEFA  78

Query  446  VLSSAFAPP--SCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG  273
               S  + P  S + ELR+AF  +D DH+GKISA EL  +   +G+  C+ +DC  MI  
Sbjct  79   AFCSGDSDPYNSAEKELREAFQLYDQDHNGKISAAELHQILTRLGE-HCSEQDCAGMIRT  137

Query  272  VDNNGDGFVCFEDFCRMM  219
            VD++GDGFV F++F +MM
Sbjct  138  VDSDGDGFVSFDEFRKMM  155



>ref|XP_004971250.1| PREDICTED: probable calcium-binding protein CML10-like [Setaria 
italica]
Length=235

 Score =   109 bits (272),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 85/138 (62%), Gaps = 4/138 (3%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            E+ + F+  D + DG+I + EL  L   +G    S +EL  M++E D DGDG ISL+EF+
Sbjct  90   EMARVFRKFDANGDGRISRSELAALFESLG-HAASDDELARMMAEADADGDGFISLDEFA  148

Query  446  VLSSAFA--PPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG  273
             L++  A    + + +LR AF  FD D +G ISA EL  V + +G+S  ++  CRRMI G
Sbjct  149  ALNATVAGDAAAVEEDLRHAFRVFDADGNGTISATELARVLRGLGES-ASVAQCRRMIEG  207

Query  272  VDNNGDGFVCFEDFCRMM  219
            VD NGDG + FE+F  MM
Sbjct  208  VDQNGDGLISFEEFKVMM  225



>ref|XP_004230637.1| PREDICTED: calmodulin-like [Solanum lycopersicum]
Length=147

 Score =   107 bits (266),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 93/149 (62%), Gaps = 6/149 (4%)
 Frame = -1

Query  665  DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVD  486
            D ++ D++S    E  QAF +ID+D DG IR EEL  ++  +  E P+REE++ M++EVD
Sbjct  3    DALTEDQIS----EFRQAFWVIDKDCDGVIRIEELASVIQSL-HENPTREEMQEMMNEVD  57

Query  485  RDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRC  306
             DGDG I  E+F  + +     +   EL++AF  FD D DG ISA EL NV   +G+ R 
Sbjct  58   PDGDGTIDFEDFLNIMAKKLKDNVTEELKEAFKVFDRDQDGFISANELRNVMMNLGE-RL  116

Query  305  TLEDCRRMILGVDNNGDGFVCFEDFCRMM  219
            T E+ ++MI   D +GDG V +E+F ++M
Sbjct  117  TEEEAQQMIREADLDGDGLVSYEEFVKIM  145



>ref|XP_004142374.1| PREDICTED: probable calcium-binding protein CML25-like [Cucumis 
sativus]
 gb|KGN52351.1| hypothetical protein Csa_5G627080 [Cucumis sativus]
Length=185

 Score =   107 bits (268),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 84/138 (61%), Gaps = 3/138 (2%)
 Frame = -1

Query  629  AELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  450
             EL + FK  D + DGKI   EL  ++  +G    + EEL  M+ E D DGDG I+L EF
Sbjct  41   TELEEVFKKFDVNGDGKISSAELGSIMRSLG-HNATEEELGKMIDEFDADGDGFINLHEF  99

Query  449  SVLSSA-FAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG  273
              L++    P      LR+AF  +D D +G ISAEEL  V +++GD  C++ DCR+MI G
Sbjct  100  VELNTKEIDPEELLENLREAFSVYDIDGNGSISAEELHKVLQSLGDD-CSVADCRQMISG  158

Query  272  VDNNGDGFVCFEDFCRMM  219
            VD+NGDG + FE+F  MM
Sbjct  159  VDSNGDGMISFEEFKVMM  176


 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 44/77 (57%), Gaps = 4/77 (5%)
 Frame = -1

Query  662  EISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDR  483
            EI P+EL      L +AF + D D +G I  EEL  +L  +G +  S  + R M+S VD 
Sbjct  106  EIDPEEL---LENLREAFSVYDIDGNGSISAEELHKVLQSLG-DDCSVADCRQMISGVDS  161

Query  482  DGDGCISLEEFSVLSSA  432
            +GDG IS EEF V+ S 
Sbjct  162  NGDGMISFEEFKVMMST  178



>ref|XP_006355093.1| PREDICTED: probable calcium-binding protein CML25-like [Solanum 
tuberosum]
Length=194

 Score =   108 bits (269),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 66/147 (45%), Positives = 89/147 (61%), Gaps = 3/147 (2%)
 Frame = -1

Query  656  SPDELSGLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDG  477
            S D  + +  EL Q FK  D + DGKI   EL  +++ +G  P + EEL  M+ EVD DG
Sbjct  36   SIDSRARIEEELEQVFKKFDMNGDGKICSSELGSIMASLG-NPTTEEELVNMIREVDSDG  94

Query  476  DGCISLEEFSVLSSA-FAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTL  300
            DG I L+EF  L++           L+DAF  FD D +G ISAEEL  V +++G+  CTL
Sbjct  95   DGFIDLQEFIELNTKDIDSNEVLESLKDAFSVFDMDKNGSISAEELLTVLRSLGED-CTL  153

Query  299  EDCRRMILGVDNNGDGFVCFEDFCRMM  219
             +CR+MI GVD +GDG + FE+F  MM
Sbjct  154  AECRKMISGVDCDGDGMINFEEFKIMM  180



>gb|EPS63975.1| hypothetical protein M569_10810, partial [Genlisea aurea]
Length=170

 Score =   107 bits (266),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 83/137 (61%), Gaps = 2/137 (1%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            EL Q FK  D + DGKI   EL  +   +G E  + EEL+ M+ EVD DGDG I L+EF 
Sbjct  28   ELEQVFKKFDVNGDGKISGSELGAIFRSLGGEAMAEEELKSMIREVDSDGDGFIDLKEFV  87

Query  446  VLSSA-FAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  270
             L++           L+DAF  FD D DG IS EEL  V +++G+  CTL +C +MI GV
Sbjct  88   ELNTKDIDYDETVENLKDAFQVFDIDGDGSISCEELRQVLESLGE-ECTLGECAKMIAGV  146

Query  269  DNNGDGFVCFEDFCRMM  219
            D++G+G + FE+F  MM
Sbjct  147  DSDGNGMISFEEFKVMM  163


 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 42/75 (56%), Gaps = 6/75 (8%)
 Frame = -1

Query  428  APPSCDS------ELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVD  267
            + PS +S      EL   F  FD + DGKIS  EL  +F+++G      E+ + MI  VD
Sbjct  15   STPSMNSRAQIEEELEQVFKKFDVNGDGKISGSELGAIFRSLGGEAMAEEELKSMIREVD  74

Query  266  NNGDGFVCFEDFCRM  222
            ++GDGF+  ++F  +
Sbjct  75   SDGDGFIDLKEFVEL  89



>ref|XP_011467223.1| PREDICTED: calcium-binding protein CML24-like [Fragaria vesca 
subsp. vesca]
Length=148

 Score =   106 bits (265),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 91/137 (66%), Gaps = 6/137 (4%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            EL + F   D++ DGKI ++EL  +  ++G+E    EE++ +++E D+DGDG I L+EF+
Sbjct  17   ELKKIFNKFDKNGDGKICRDELREIFRELGSETTP-EEVKTIMAEFDKDGDGRIDLDEFA  75

Query  446  VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVD  267
             + +  +      +LRDAFD +D D +G+ISA EL  V K +G  +C+L+DC +MI  VD
Sbjct  76   EILNGGSTK----DLRDAFDLYDLDKNGRISASELHEVLKRLG-QKCSLKDCAKMIGSVD  130

Query  266  NNGDGFVCFEDFCRMME  216
             +GDG V FE+F +MM+
Sbjct  131  ADGDGHVNFEEFKKMMK  147



>ref|XP_009103045.1| PREDICTED: probable calcium-binding protein CML25 [Brassica rapa]
Length=184

 Score =   107 bits (267),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 86/137 (63%), Gaps = 3/137 (2%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF-  450
            EL   FK  D + DGKI  +EL  +++ +G E P  EEL+  ++E+D+ GDG I+LEEF 
Sbjct  34   ELEAVFKKFDVNGDGKISSKELGSIMASLGHEVP-EEELQKAVAEIDKKGDGYINLEEFV  92

Query  449  SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  270
             + +           L+DAF  +D D +G ISAEEL  V +++GD  C++ +CR+MI GV
Sbjct  93   ELFTKGMDQNDVLENLKDAFSVYDIDGNGSISAEELHEVLRSLGD-ECSIAECRKMISGV  151

Query  269  DNNGDGFVCFEDFCRMM  219
            D +GDG + FE+F  MM
Sbjct  152  DKDGDGTIDFEEFKVMM  168



>emb|CDY40786.1| BnaAnng06490D [Brassica napus]
 emb|CDY03874.1| BnaC07g10990D [Brassica napus]
Length=184

 Score =   107 bits (267),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 86/137 (63%), Gaps = 3/137 (2%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF-  450
            EL   FK  D + DGKI  +EL  +++ +G E P  EEL+  ++E+D+ GDG I+LEEF 
Sbjct  34   ELEAVFKKFDVNGDGKISSKELGAIMASLGHEVP-EEELQKAVAEIDKKGDGYINLEEFV  92

Query  449  SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  270
             + +           L+DAF  +D D +G ISAEEL  V +++GD  C++ +CR+MI GV
Sbjct  93   ELFTKGMDQNDVLENLKDAFSVYDIDGNGSISAEELHEVLRSLGD-ECSIAECRKMISGV  151

Query  269  DNNGDGFVCFEDFCRMM  219
            D +GDG + FE+F  MM
Sbjct  152  DKDGDGTIDFEEFKVMM  168



>ref|XP_009770094.1| PREDICTED: calmodulin-like [Nicotiana sylvestris]
Length=147

 Score =   106 bits (264),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 94/149 (63%), Gaps = 6/149 (4%)
 Frame = -1

Query  665  DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVD  486
            D +S D++S    EL +AF +ID+D DG IR EEL  ++  +  E P++EE++ M++EVD
Sbjct  3    DALSEDQIS----ELREAFWVIDKDCDGVIRMEELAAVIQSLN-EHPTKEEIQEMVNEVD  57

Query  485  RDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRC  306
             DGDG I  E+F  + +     +   EL++AF  FD D DG ISA EL NV   +G+ R 
Sbjct  58   PDGDGTIDFEDFLNIMARKLKDNVSEELKEAFKVFDRDQDGFISANELRNVMMNLGE-RL  116

Query  305  TLEDCRRMILGVDNNGDGFVCFEDFCRMM  219
            T E+ ++MI   D +GDG V +E+F ++M
Sbjct  117  TDEEAQQMIREADLDGDGLVSYEEFVKIM  145



>ref|XP_007160425.1| hypothetical protein PHAVU_002G320800g [Phaseolus vulgaris]
 gb|ESW32419.1| hypothetical protein PHAVU_002G320800g [Phaseolus vulgaris]
Length=188

 Score =   107 bits (266),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 87/140 (62%), Gaps = 3/140 (2%)
 Frame = -1

Query  635  LYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  456
            +  EL Q FK  D + DGKI   EL  ++  +G E  + +E+  M+ EVD DGDGCISL+
Sbjct  32   MAGELEQVFKKFDVNGDGKISASELGSIMRSLGQEA-TEQEVDNMIREVDGDGDGCISLQ  90

Query  455  EFSVLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMI  279
            EF  L++           L+DAF  FD D +G I+AEEL  V +++G+  C+L +CRRMI
Sbjct  91   EFIELNTKGVDSDEVLENLKDAFSVFDMDGNGLITAEELNTVMRSLGE-ECSLAECRRMI  149

Query  278  LGVDNNGDGFVCFEDFCRMM  219
             GVD +GDG + FE+F  MM
Sbjct  150  GGVDRDGDGTIDFEEFRVMM  169



>ref|XP_007045260.1| Polcalcin Jun o, putative [Theobroma cacao]
 gb|EOY01092.1| Polcalcin Jun o, putative [Theobroma cacao]
Length=199

 Score =   107 bits (267),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 62/141 (44%), Positives = 88/141 (62%), Gaps = 11/141 (8%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            EL + FK  D + DGKI   EL  ++  +G   PS +EL+ M+ E D DGDG I+ +EF 
Sbjct  54   ELEEVFKKFDVNGDGKISSSELGSIMGSLG-HKPSEDELQKMIKEFDADGDGSINFKEFV  112

Query  446  VLSSAFAPPSCDSE-----LRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRM  282
             L++       DS+     L+DAF  +D D +G ISAEEL  V K++GD  C++ +CR+M
Sbjct  113  ELNT----KGVDSDEVLENLKDAFSVYDIDGNGSISAEELHEVLKSLGD-ECSIAECRKM  167

Query  281  ILGVDNNGDGFVCFEDFCRMM  219
            I GVD++GDG + FE+F  MM
Sbjct  168  ISGVDSDGDGMIDFEEFKVMM  188



>ref|XP_004145834.1| PREDICTED: probable calcium-binding protein CML23-like [Cucumis 
sativus]
 ref|XP_004160107.1| PREDICTED: probable calcium-binding protein CML23-like [Cucumis 
sativus]
 gb|KGN57816.1| hypothetical protein Csa_3G319280 [Cucumis sativus]
Length=156

 Score =   106 bits (264),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 59/140 (42%), Positives = 91/140 (65%), Gaps = 4/140 (3%)
 Frame = -1

Query  638  GLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISL  459
            G   E+++ F   D++ DGKI   EL   L ++     S +E+  ++SE+D+DGDG I L
Sbjct  18   GSMDEIIRVFNKFDKNGDGKISVTELAAALGELSGNI-STDEIHRIMSEIDKDGDGFIDL  76

Query  458  EEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMI  279
            +EF+  +S+      + +L+DAFD +D D +G ISA+EL +V K +G+ +C+L+DC RMI
Sbjct  77   DEFTDFTSS--STGGNKDLQDAFDLYDIDKNGLISAKELHSVLKRLGE-KCSLKDCCRMI  133

Query  278  LGVDNNGDGFVCFEDFCRMM  219
              VD +GDG V FE+F +MM
Sbjct  134  SSVDVDGDGHVNFEEFKKMM  153



>ref|XP_009414956.1| PREDICTED: probable calcium-binding protein CML15 [Musa acuminata 
subsp. malaccensis]
Length=180

 Score =   107 bits (266),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 61/137 (45%), Positives = 82/137 (60%), Gaps = 2/137 (1%)
 Frame = -1

Query  629  AELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  450
              L + F   D + DGKI   EL  +L  +G + PS EEL  M+ E D DGDG ISL EF
Sbjct  29   GNLERVFNKFDSNGDGKISSAELADVLESLGGQRPSEEELGRMMREADADGDGFISLAEF  88

Query  449  SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  270
              L+++  P + + +LR AF  FD D  G ISA+E+  V + IG+   ++  CRRMI GV
Sbjct  89   VELNTS-PPAAVEEDLRLAFAVFDLDRSGAISADEIARVLRGIGEG-ASVAQCRRMIDGV  146

Query  269  DNNGDGFVCFEDFCRMM  219
            D +GDG + FE+F  MM
Sbjct  147  DLDGDGLISFEEFKAMM  163



>ref|XP_007163392.1| hypothetical protein PHAVU_001G231000g [Phaseolus vulgaris]
 gb|ESW35386.1| hypothetical protein PHAVU_001G231000g [Phaseolus vulgaris]
Length=139

 Score =   105 bits (263),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 89/136 (65%), Gaps = 3/136 (2%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            E+ + F   D++ DGKI   EL  L++ +G++  + EE+R M++E+DR+GDG I L+EF 
Sbjct  4    EVRKIFNKFDKNGDGKISCSELRELMAALGSKTTT-EEVRRMMAELDRNGDGYIDLKEFG  62

Query  446  VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVD  267
                         ELR+AF+ +D D +G ISA+EL +V + +G+ +C+L DCRRMI  VD
Sbjct  63   EFHCGGGGGD-GKELREAFELYDLDKNGLISAKELHSVMRRLGE-KCSLSDCRRMIGNVD  120

Query  266  NNGDGFVCFEDFCRMM  219
             +GDG V FE+F +MM
Sbjct  121  ADGDGNVNFEEFKKMM  136



>ref|XP_002312460.2| hypothetical protein POPTR_0008s13390g [Populus trichocarpa]
 gb|EEE89827.2| hypothetical protein POPTR_0008s13390g [Populus trichocarpa]
Length=172

 Score =   106 bits (265),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 86/137 (63%), Gaps = 3/137 (2%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            EL Q FK  D + DGKI   EL+    ++G E  S EEL+ M++E D DGDG I L+EF 
Sbjct  21   ELEQVFKKFDVNGDGKISSAELDSFWKKLGHEA-SEEELQRMITEFDADGDGFIDLQEFV  79

Query  446  VLSSAFAPPSCDSE-LRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  270
             L++     +   E L+DAF  +D D +G ISAEEL  V  ++G+  C++ +CR+MI GV
Sbjct  80   ALNTQGVDTNEVMENLKDAFSVYDIDGNGSISAEELHKVMASLGEP-CSMAECRKMISGV  138

Query  269  DNNGDGFVCFEDFCRMM  219
            D +GDG + FE+F  MM
Sbjct  139  DRDGDGMIDFEEFKVMM  155



>ref|XP_002962635.1| hypothetical protein SELMODRAFT_69135, partial [Selaginella moellendorffii]
 gb|EFJ36098.1| hypothetical protein SELMODRAFT_69135, partial [Selaginella moellendorffii]
Length=140

 Score =   105 bits (263),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 65/139 (47%), Positives = 83/139 (60%), Gaps = 5/139 (4%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGA---EPPSREELRLMLSEVDRDGDGCISLE  456
            EL   F+L D + DG+I   EL  +L  +      PP+ EEL  M+ EVD DGDG ISL+
Sbjct  1    ELEAVFRLFDANGDGRISVSELGAVLKCLAMGNDPPPTEEELHKMVEEVDADGDGFISLD  60

Query  455  EFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMIL  276
            EF  L       +  +EL+ AF  FD D +G ISA+EL  V   +G+   T+EDC RMI 
Sbjct  61   EF--LHFHAQSTASVAELKAAFYVFDLDRNGFISADELHRVLVGLGEVNLTMEDCGRMIR  118

Query  275  GVDNNGDGFVCFEDFCRMM  219
            GVD+NGDG V FE+F  MM
Sbjct  119  GVDSNGDGRVDFEEFKLMM  137



>ref|XP_011079925.1| PREDICTED: calmodulin-like [Sesamum indicum]
Length=150

 Score =   105 bits (263),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 61/137 (45%), Positives = 84/137 (61%), Gaps = 2/137 (1%)
 Frame = -1

Query  629  AELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  450
            AE  +AF LID+D DG I  EEL  ++  +  E P+ EE++ M+SEVD DGDG +  EEF
Sbjct  11   AEFREAFSLIDKDSDGVITVEELTSVMQSLN-EHPTMEEIQEMVSEVDGDGDGTVDFEEF  69

Query  449  SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  270
              + +     +   EL++AF  FD D DG ISA EL NV   +G+ R + E+  +MI   
Sbjct  70   LGIMARKMKENVGEELKEAFKVFDRDQDGFISAIELKNVMINLGE-RVSDEEAEQMIREA  128

Query  269  DNNGDGFVCFEDFCRMM  219
            D +GDG V +E+F RMM
Sbjct  129  DVDGDGVVSYEEFVRMM  145



>ref|XP_004159084.1| PREDICTED: probable calcium-binding protein CML25-like [Cucumis 
sativus]
Length=185

 Score =   107 bits (266),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 83/138 (60%), Gaps = 3/138 (2%)
 Frame = -1

Query  629  AELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  450
             EL + FK  D + DGKI   EL   +  +G    + EEL  M+ E D DGDG I+L EF
Sbjct  41   TELEEVFKKFDVNGDGKISSAELGSTMRSLG-HNATEEELGKMIDEFDADGDGFINLHEF  99

Query  449  SVLSSA-FAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG  273
              L++    P      LR+AF  +D D +G ISAEEL  V +++GD  C++ DCR+MI G
Sbjct  100  VELNTKEIDPEELLENLREAFSVYDIDGNGSISAEELHKVLQSLGDD-CSVADCRQMISG  158

Query  272  VDNNGDGFVCFEDFCRMM  219
            VD+NGDG + FE+F  MM
Sbjct  159  VDSNGDGMISFEEFKVMM  176


 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 44/77 (57%), Gaps = 4/77 (5%)
 Frame = -1

Query  662  EISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDR  483
            EI P+EL      L +AF + D D +G I  EEL  +L  +G +  S  + R M+S VD 
Sbjct  106  EIDPEEL---LENLREAFSVYDIDGNGSISAEELHKVLQSLG-DDCSVADCRQMISGVDS  161

Query  482  DGDGCISLEEFSVLSSA  432
            +GDG IS EEF V+ S 
Sbjct  162  NGDGMISFEEFKVMMST  178



>ref|XP_006574101.1| PREDICTED: probable calcium-binding protein CML25-like [Glycine 
max]
Length=195

 Score =   107 bits (266),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 88/140 (63%), Gaps = 3/140 (2%)
 Frame = -1

Query  635  LYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  456
            +  +L   FK  D + DGKI   EL  ++  +G +P + EE++ M+ EVD +GDG I+L 
Sbjct  48   ITEDLEYVFKKFDANGDGKISSSELGSIMKSLG-QPATEEEVKRMIQEVDANGDGHINLG  106

Query  455  EFSVLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMI  279
            EF  L++    P      L+DAF  FD D +G I+A+EL  V  ++GD+ C++++C++MI
Sbjct  107  EFLELNTKGVDPDEVLENLKDAFSIFDVDGNGLITAQELNMVMASLGDA-CSIDECQKMI  165

Query  278  LGVDNNGDGFVCFEDFCRMM  219
             GVD NGDG + FE+F  MM
Sbjct  166  AGVDGNGDGMINFEEFQLMM  185



>ref|XP_009413607.1| PREDICTED: probable calcium-binding protein CML18 [Musa acuminata 
subsp. malaccensis]
Length=177

 Score =   106 bits (264),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 60/137 (44%), Positives = 87/137 (64%), Gaps = 3/137 (2%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            EL + F   D D DG+I   EL  +L  +G++P S +E+R M++E+D D DG + L+EF+
Sbjct  26   ELEKVFARFDADGDGRISASELAAVLRALGSDP-SPDEIRDMIAEMDADRDGFVDLQEFA  84

Query  446  VLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  270
                        ++EL+DAF  +D D DG IS +EL  V +++G+ +CTLEDC RMI  V
Sbjct  85   AFHRCGVGRGGAEAELKDAFRMYDLDSDGLISVDELLRVMRSLGE-KCTLEDCARMIRSV  143

Query  269  DNNGDGFVCFEDFCRMM  219
            D++GDG V FE+F  MM
Sbjct  144  DSDGDGSVSFEEFKTMM  160



>ref|XP_006351748.1| PREDICTED: calmodulin-5/6/7/8-like [Solanum tuberosum]
Length=147

 Score =   105 bits (262),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 62/149 (42%), Positives = 93/149 (62%), Gaps = 6/149 (4%)
 Frame = -1

Query  665  DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVD  486
            D ++ D++S    E  QAF +ID+D DG IR EEL  ++  +  E P+REE++ M++EVD
Sbjct  3    DALTEDQIS----EFRQAFWVIDKDCDGVIRMEELASVIQSL-HEHPTREEIQEMINEVD  57

Query  485  RDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRC  306
             DGDG I  E+F  + +     +   EL++AF  FD D DG ISA EL NV   +G+ R 
Sbjct  58   PDGDGSIDFEDFLNIMAKKLKDNVTEELKEAFKVFDRDQDGFISANELRNVMMNLGE-RL  116

Query  305  TLEDCRRMILGVDNNGDGFVCFEDFCRMM  219
            T E+ ++MI   D +GDG V +++F ++M
Sbjct  117  TEEEAQQMIREADLDGDGLVSYDEFVKIM  145



>ref|XP_010109033.1| putative calcium-binding protein CML23 [Morus notabilis]
 gb|EXC20673.1| putative calcium-binding protein CML23 [Morus notabilis]
Length=151

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/143 (41%), Positives = 90/143 (63%), Gaps = 5/143 (3%)
 Frame = -1

Query  638  GLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISL  459
            G   E+ + F   D++ DGKI + EL  +L  +G+   S +E++ +++E+D DGDG I  
Sbjct  7    GSMEEVQKIFNKFDKNRDGKISRSELRDVLGALGS-KTSDDEVKRVMAEIDADGDGYIDF  65

Query  458  EEFSVLSSAFAP---PSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCR  288
            +EF    S  +     + + ELRDAFD +D D +G IS+ EL +V +++G+ +C+L DC 
Sbjct  66   DEFVKFHSGGSENDGAANEKELRDAFDLYDLDKNGVISSRELHSVLRSLGE-KCSLSDCS  124

Query  287  RMILGVDNNGDGFVCFEDFCRMM  219
            RMI  VD +GDG V FE+F +MM
Sbjct  125  RMIRSVDADGDGSVNFEEFKKMM  147



>ref|XP_002525994.1| Polcalcin Jun o, putative [Ricinus communis]
 gb|EEF36418.1| Polcalcin Jun o, putative [Ricinus communis]
Length=190

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 85/137 (62%), Gaps = 3/137 (2%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            EL Q FK  D + DGKI   EL  ++S +G E  + EE+  M+ E D DGDG I  +EF 
Sbjct  45   ELEQVFKKFDVNGDGKISSLELGSIMSSLGHEA-NEEEVMKMIKEFDADGDGFIDFKEFV  103

Query  446  VLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  270
             L++           L+DAFD +D D +G ISAEEL  V  +IG+S C++ +CR+MI GV
Sbjct  104  ELNTQGVGSDEVMENLKDAFDVYDIDGNGSISAEELHKVMGSIGES-CSIAECRKMISGV  162

Query  269  DNNGDGFVCFEDFCRMM  219
            D++GDG + FE+F  MM
Sbjct  163  DSDGDGMIDFEEFKVMM  179



>ref|XP_008457051.1| PREDICTED: probable calcium-binding protein CML27 [Cucumis melo]
Length=157

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/140 (43%), Positives = 90/140 (64%), Gaps = 4/140 (3%)
 Frame = -1

Query  638  GLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISL  459
            G   E+++ F   D++ DGKI   EL   L ++     + E  R+M SE+D+DGDG I L
Sbjct  19   GSMDEVIRVFNKFDKNGDGKISVSELGAALGELSGNISTGEIHRIM-SEIDKDGDGFIDL  77

Query  458  EEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMI  279
            +EF+  +S+      + +L+DAFD +D D +G ISA+EL +V K +G+ +C+L+DC RMI
Sbjct  78   DEFTDFTSS--STGGNKDLQDAFDLYDIDKNGLISAKELHSVLKRLGE-KCSLKDCCRMI  134

Query  278  LGVDNNGDGFVCFEDFCRMM  219
              VD +GDG V FE+F +MM
Sbjct  135  SSVDVDGDGHVNFEEFKKMM  154



>gb|AAZ20284.1| calcium-binding pollen allergen [Arachis hypogaea]
Length=164

 Score =   105 bits (263),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 87/140 (62%), Gaps = 3/140 (2%)
 Frame = -1

Query  635  LYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  456
            + AEL Q F   D + DGKI   EL  ++  +G +  + +EL  ML EVD DGDG ISL+
Sbjct  9    MAAELEQVFHKFDVNGDGKIDASELGAVMGSLG-QKATEQELINMLREVDGDGDGYISLQ  67

Query  455  EFSVLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMI  279
            EF  L++           L++AF  FD D +G I+AEEL  V +++G+  CTL +CRRMI
Sbjct  68   EFIELNTKGVDSDEVLENLKEAFSVFDIDGNGSITAEELNTVMRSLGE-ECTLAECRRMI  126

Query  278  LGVDNNGDGFVCFEDFCRMM  219
             GVD++GDG + FE+F  MM
Sbjct  127  SGVDSDGDGMIDFEEFRVMM  146



>ref|XP_008381330.1| PREDICTED: probable calcium-binding protein CML23 [Malus domestica]
Length=154

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 88/141 (62%), Gaps = 5/141 (4%)
 Frame = -1

Query  641  SGLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCIS  462
            SG   EL + F   D++ DG+I  +EL  +  ++G+E  S EE++ +++E D+DGDG I 
Sbjct  16   SGSMEELKKIFNKFDKNGDGRISCDELRGIFGELGSETASLEEVQRIMAEFDKDGDGHID  75

Query  461  LEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRM  282
            + EF+ + +  +      ELRDAFD +D D +G IS  EL  V K +G  +C+L++C +M
Sbjct  76   IAEFAEIINGGSTK----ELRDAFDLYDLDKNGLISKSELHEVLKRLG-QKCSLKECAKM  130

Query  281  ILGVDNNGDGFVCFEDFCRMM  219
            I  VD +GDG V F +F +MM
Sbjct  131  IGSVDADGDGHVNFAEFKKMM  151



>ref|NP_173866.1| putative calcium-binding protein CML25 [Arabidopsis thaliana]
 sp|Q9FYK2.1|CML25_ARATH RecName: Full=Probable calcium-binding protein CML25; AltName: 
Full=Calmodulin-like protein 25 [Arabidopsis thaliana]
 gb|AAF97973.1|AC000103_23 F21J9.28 [Arabidopsis thaliana]
 gb|ABE65653.1| polcalcin [Arabidopsis thaliana]
 gb|AEE30554.1| putative calcium-binding protein CML25 [Arabidopsis thaliana]
Length=186

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/137 (44%), Positives = 85/137 (62%), Gaps = 3/137 (2%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            EL   FK  D + DGKI  +EL  +++ +G E P  EEL   ++E+DR GDG I+ EEF 
Sbjct  37   ELEAVFKKFDVNGDGKISSKELGAIMTSLGHEVP-EEELEKAITEIDRKGDGYINFEEFV  95

Query  446  VLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  270
             L++           L+DAF  +D D +G ISAEEL  V +++GD  C++ +CR+MI GV
Sbjct  96   ELNTKGMDQNDVLENLKDAFSVYDIDGNGSISAEELHEVLRSLGD-ECSIAECRKMIGGV  154

Query  269  DNNGDGFVCFEDFCRMM  219
            D +GDG + FE+F  MM
Sbjct  155  DKDGDGTIDFEEFKIMM  171



>ref|XP_010526084.1| PREDICTED: calmodulin-like protein 4 [Tarenaya hassleriana]
Length=208

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/140 (43%), Positives = 91/140 (65%), Gaps = 3/140 (2%)
 Frame = -1

Query  629  AELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  450
             EL + F++ D++ DG+I KEEL   L  +G   P RE L  M+ ++D +GDGC+ ++EF
Sbjct  66   VELKRVFQMFDKNGDGRITKEELNDSLENLGLFLPDRE-LAQMIQKIDANGDGCVDMDEF  124

Query  449  SVLSSAFAPPS-CDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRC-TLEDCRRMIL  276
              L  +    S  D ++RDAFD FD D DG I+ EEL +V  ++G  +  TLEDC++MI+
Sbjct  125  ESLYKSIVDQSDKDDDMRDAFDVFDQDGDGFITVEELKSVMGSLGLKQGKTLEDCKKMIM  184

Query  275  GVDNNGDGFVCFEDFCRMME  216
             VD +GDG V +++F +MM+
Sbjct  185  QVDVDGDGRVNYKEFLQMMK  204



>ref|XP_006415824.1| hypothetical protein EUTSA_v10008816mg [Eutrema salsugineum]
 gb|ESQ34177.1| hypothetical protein EUTSA_v10008816mg [Eutrema salsugineum]
Length=198

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/137 (44%), Positives = 86/137 (63%), Gaps = 3/137 (2%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            EL   FK  D + DGKI  +EL  +++ +G E P  EEL+  ++E+DR GDG I+ EEF 
Sbjct  50   ELEAVFKKFDVNGDGKISSKELGAIMANLGHEVPE-EELQKAITEIDRKGDGYINFEEFV  108

Query  446  VLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  270
             L++           L+DAF  +D D +G ISAEEL  V +++GD  C++ +CR+MI GV
Sbjct  109  ELNTKGMDQNDVLENLKDAFSVYDIDGNGSISAEELHEVLRSLGDD-CSIAECRKMIGGV  167

Query  269  DNNGDGFVCFEDFCRMM  219
            D +GDG + FE+F  MM
Sbjct  168  DKDGDGTIDFEEFKVMM  184



>ref|NP_001045400.1| Os01g0949500 [Oryza sativa Japonica Group]
 sp|Q8RZB5.1|CML10_ORYSJ RecName: Full=Probable calcium-binding protein CML10; AltName: 
Full=Calmodulin-like protein 10 [Oryza sativa Japonica Group]
 dbj|BAB86193.1| putative pollen allergen Jun o 4 [Oryza sativa Japonica Group]
 dbj|BAF07314.1| Os01g0949500 [Oryza sativa Japonica Group]
 dbj|BAG96408.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96462.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG92083.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC72159.1| hypothetical protein OsI_05196 [Oryza sativa Indica Group]
 gb|EEE56004.1| hypothetical protein OsJ_04761 [Oryza sativa Japonica Group]
Length=185

 Score =   105 bits (263),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 85/138 (62%), Gaps = 4/138 (3%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            E+ + F+  D + DG+I + EL  L   +G    + +EL  M++E D DGDG ISL+EF+
Sbjct  40   EMERVFRKFDANGDGRISRSELGALFESLG-HAATDDELARMMAEADADGDGFISLDEFA  98

Query  446  VLSSAFA--PPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG  273
             L++  +    + + +LR AF  FD D +G ISA EL  V   +G+ + T++ CRRMI G
Sbjct  99   ALNATASGDAAAVEEDLRHAFRVFDADGNGTISAAELARVLHGLGE-KATVQQCRRMIEG  157

Query  272  VDNNGDGFVCFEDFCRMM  219
            VD NGDG + FE+F  MM
Sbjct  158  VDQNGDGLISFEEFKVMM  175



>ref|XP_004960644.1| PREDICTED: probable calcium-binding protein CML18-like [Setaria 
italica]
Length=179

 Score =   105 bits (263),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 85/146 (58%), Gaps = 11/146 (8%)
 Frame = -1

Query  629  AELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  450
            AE+ Q F+  D + DGKI  EEL  +L  +GA PP   E+R M+ E+D D DG + L EF
Sbjct  30   AEVEQVFRRYDANGDGKISAEELASVLRALGA-PPGPGEVRRMMDEMDADRDGFVDLAEF  88

Query  449  SVLS---------SAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLE  297
                               + ++ELR+AF  +D DH+G ISA EL  V + +GD +C++ 
Sbjct  89   VAFHCGPSGGAGAGEGQEDATEAELREAFRMYDADHNGLISARELHRVLRQLGD-KCSVA  147

Query  296  DCRRMILGVDNNGDGFVCFEDFCRMM  219
            DC RMI  VD +GDG V F++F +MM
Sbjct  148  DCSRMIRSVDADGDGSVNFDEFKKMM  173



>gb|KJB15360.1| hypothetical protein B456_002G172400 [Gossypium raimondii]
Length=197

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/141 (44%), Positives = 87/141 (62%), Gaps = 11/141 (8%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            E+ + FK  D + DGKI   EL  ++  +G + PS EEL  M+ E D DGDG I+  EF 
Sbjct  46   EIEEVFKKFDANGDGKISASELGSIMKSLG-QQPSDEELHNMIKEFDADGDGFINFNEFI  104

Query  446  VLSSAFAPPSCDSE-----LRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRM  282
             L++       DSE     L+DAF  +D D +G ISAEEL  V K++G+  C++ +CR+M
Sbjct  105  ELNT----KGVDSEEVLENLKDAFSVYDIDGNGWISAEELHEVLKSLGE-ECSIAECRKM  159

Query  281  ILGVDNNGDGFVCFEDFCRMM  219
            I GVDN+G+G + FE+F  MM
Sbjct  160  ISGVDNDGNGMIDFEEFKVMM  180



>ref|XP_004490807.1| PREDICTED: calcium-binding protein CML24-like [Cicer arietinum]
Length=143

 Score =   104 bits (260),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 86/136 (63%), Gaps = 2/136 (1%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            E+ + F   D++ DGKI   EL+ +L  +G +  S +E++ M+  +D++GDG I L+EFS
Sbjct  8    EVRKIFSKFDKNGDGKISSSELKEMLITLGTKTTS-DEVKRMMEMIDQNGDGYIDLKEFS  66

Query  446  VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVD  267
                  A     +ELRDAFD +D D +G ISA EL  V   +G+ +C+L DCRRMI  VD
Sbjct  67   DFHCIDAGKDDANELRDAFDLYDLDKNGLISANELHAVLIKLGE-KCSLGDCRRMIKNVD  125

Query  266  NNGDGFVCFEDFCRMM  219
             +GDG V FE+F +MM
Sbjct  126  VDGDGNVNFEEFKKMM  141


 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 41/63 (65%), Gaps = 1/63 (2%)
 Frame = -1

Query  419  SCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFVCF  240
            S D E+R  F  FD + DGKIS+ EL  +  T+G ++ T ++ +RM+  +D NGDG++  
Sbjct  4    SMDDEVRKIFSKFDKNGDGKISSSELKEMLITLG-TKTTSDEVKRMMEMIDQNGDGYIDL  62

Query  239  EDF  231
            ++F
Sbjct  63   KEF  65



>ref|XP_009379268.1| PREDICTED: probable calcium-binding protein CML25 [Pyrus x bretschneideri]
 ref|XP_009347046.1| PREDICTED: probable calcium-binding protein CML25 [Pyrus x bretschneideri]
Length=205

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 90/152 (59%), Gaps = 13/152 (9%)
 Frame = -1

Query  635  LYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPP-SREELRLMLSEVDRDGDGCISL  459
            + ++  Q F+++D + DGKI   EL  +LS +G +   + EE   ++ E+DR+GDGCI L
Sbjct  48   VSSQFRQVFEVMDANGDGKISPLELSAVLSCLGNKKSIAAEEAEGIVREMDRNGDGCIDL  107

Query  458  EEFSVL------------SSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGD  315
            +EF               S  F     DSEL DAF  FDTD +GKISA+EL  V  ++G 
Sbjct  108  DEFMNAVNVDRSRSNDNNSVGFGNEEEDSELMDAFRIFDTDKNGKISAKELQRVLFSLGC  167

Query  314  SRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  219
              C+L +CR+MI GVD NGDG V FE+F  MM
Sbjct  168  KECSLRECRQMIKGVDRNGDGAVDFEEFRLMM  199



>ref|XP_003630938.1| Calcium-binding pollen allergen [Medicago truncatula]
Length=188

 Score =   105 bits (263),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 89/140 (64%), Gaps = 11/140 (8%)
 Frame = -1

Query  635  LYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  456
            L  EL + FK  D + DGKI   EL  ++  +G +  S +EL  M+ EVD DGDGCISL+
Sbjct  31   LAGELEEVFKKFDVNGDGKISASELGSIMGSLG-QQTSEQELNNMIREVDGDGDGCISLQ  89

Query  455  EFSVLSSAFAPPSCDSE-----LRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDC  291
            EF  L++       DS+     L+DAF  FD D +G I+AEEL  V +++G+  C+L +C
Sbjct  90   EFIELNT----KGVDSDEILENLKDAFAVFDMDGNGSITAEELNTVMRSLGE-ECSLAEC  144

Query  290  RRMILGVDNNGDGFVCFEDF  231
            R+MI GVD++GDG + FE+F
Sbjct  145  RKMIGGVDSDGDGTIDFEEF  164



>ref|XP_002980456.1| hypothetical protein SELMODRAFT_59198, partial [Selaginella moellendorffii]
 gb|EFJ18716.1| hypothetical protein SELMODRAFT_59198, partial [Selaginella moellendorffii]
Length=140

 Score =   104 bits (260),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 65/139 (47%), Positives = 83/139 (60%), Gaps = 5/139 (4%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGA---EPPSREELRLMLSEVDRDGDGCISLE  456
            EL   F+L D + DG+I   EL  +L  +      PP+ EEL  M+ EVD DGDG ISL+
Sbjct  1    ELEAVFRLFDANGDGRISVSELGAVLKCLAMGNDPPPTEEELLKMVEEVDADGDGFISLD  60

Query  455  EFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMIL  276
            EF  L       +  +EL+ AF  FD D +G ISA+EL  V   +G+   T+EDC RMI 
Sbjct  61   EF--LHFHAQSTASVAELKAAFYVFDLDRNGFISADELHRVLVGLGEVNLTMEDCGRMIR  118

Query  275  GVDNNGDGFVCFEDFCRMM  219
            GVD+NGDG V FE+F  MM
Sbjct  119  GVDSNGDGRVDFEEFKLMM  137



>gb|AAM67124.1| calmodulin-related protein [Arabidopsis thaliana]
Length=157

 Score =   105 bits (261),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 61/145 (42%), Positives = 94/145 (65%), Gaps = 9/145 (6%)
 Frame = -1

Query  638  GLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPP--SREELRLMLSEVDRDGDGCI  465
            G   ++ + F+  D+++DGKI  +EL+ +   +GA  P  S+EE + M+ E D DG+G I
Sbjct  11   GSMEDIKKVFQRFDKNNDGKISIDELKDV---IGALSPNASQEETKAMMKEFDLDGNGFI  67

Query  464  SLEEFSVLSSAFAPPSCDSELRD---AFDFFDTDHDGKISAEELFNVFKTIGDSRCTLED  294
             L+EF  L       S +S +RD   AFD +D D +G+ISA EL +V K +G+ +C+++D
Sbjct  68   DLDEFVALFQISDQSSNNSAIRDLKEAFDLYDLDRNGRISANELHSVMKNLGE-KCSIQD  126

Query  293  CRRMILGVDNNGDGFVCFEDFCRMM  219
            C+RMI  VD++GDG V FE+F +MM
Sbjct  127  CQRMISKVDSDGDGCVDFEEFKKMM  151



>gb|AET05414.2| EF hand calcium-binding family protein [Medicago truncatula]
Length=190

 Score =   105 bits (263),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 89/140 (64%), Gaps = 11/140 (8%)
 Frame = -1

Query  635  LYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  456
            L  EL + FK  D + DGKI   EL  ++  +G +  S +EL  M+ EVD DGDGCISL+
Sbjct  33   LAGELEEVFKKFDVNGDGKISASELGSIMGSLGQQT-SEQELNNMIREVDGDGDGCISLQ  91

Query  455  EFSVLSSAFAPPSCDSE-----LRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDC  291
            EF  L++       DS+     L+DAF  FD D +G I+AEEL  V +++G+  C+L +C
Sbjct  92   EFIELNT----KGVDSDEILENLKDAFAVFDMDGNGSITAEELNTVMRSLGE-ECSLAEC  146

Query  290  RRMILGVDNNGDGFVCFEDF  231
            R+MI GVD++GDG + FE+F
Sbjct  147  RKMIGGVDSDGDGTIDFEEF  166



>ref|XP_010033692.1| PREDICTED: probable calcium-binding protein CML27 [Eucalyptus 
grandis]
 gb|KCW84060.1| hypothetical protein EUGRSUZ_B00943 [Eucalyptus grandis]
Length=171

 Score =   105 bits (261),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 85/136 (63%), Gaps = 4/136 (3%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            EL + F   D + DGKI   EL  +L+ +G+  P  E+L   ++E+D DGDG ISL EF+
Sbjct  33   ELRKVFDQFDANGDGKISASELSQVLAAMGSAVPP-EDLDRAMAEIDADGDGFISLPEFA  91

Query  446  VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVD  267
             L  +   PS D++LRDAFD +D D +G ISA EL  V   +    C++EDC RMI  VD
Sbjct  92   GLCRS--GPSPDADLRDAFDLYDQDRNGLISAAELHLVLNRLS-MNCSVEDCARMIKSVD  148

Query  266  NNGDGFVCFEDFCRMM  219
             +GDG V FE+F +MM
Sbjct  149  GDGDGNVNFEEFRKMM  164


 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 36/66 (55%), Gaps = 1/66 (2%)
 Frame = -1

Query  425  PPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNGDGFV  246
            P   + ELR  FD FD + DGKISA EL  V   +G S    ED  R +  +D +GDGF+
Sbjct  27   PHMTNEELRKVFDQFDANGDGKISASELSQVLAAMG-SAVPPEDLDRAMAEIDADGDGFI  85

Query  245  CFEDFC  228
               +F 
Sbjct  86   SLPEFA  91



>ref|XP_002890700.1| hypothetical protein ARALYDRAFT_335836 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66959.1| hypothetical protein ARALYDRAFT_335836 [Arabidopsis lyrata subsp. 
lyrata]
Length=192

 Score =   105 bits (263),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 60/137 (44%), Positives = 85/137 (62%), Gaps = 3/137 (2%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            EL   FK  D + DGKI  +EL  +++ +G E P  EEL   ++E+DR GDG I+ EEF 
Sbjct  37   ELEAVFKKFDVNGDGKISSKELGAIMASLGHEVP-EEELEKAITEIDRKGDGYINFEEFV  95

Query  446  VLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  270
             L++           L+DAF  +D D +G ISAEEL  V +++GD  C++ +CR+MI GV
Sbjct  96   ELNTKGMDQNDVLENLKDAFSVYDIDGNGSISAEELHEVLRSLGD-ECSIAECRKMIGGV  154

Query  269  DNNGDGFVCFEDFCRMM  219
            D +GDG + FE+F  MM
Sbjct  155  DKDGDGTIDFEEFKIMM  171



>gb|KDP23917.1| hypothetical protein JCGZ_27077 [Jatropha curcas]
Length=158

 Score =   104 bits (260),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 87/137 (64%), Gaps = 2/137 (1%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            EL + F   D + DGKI   EL  +L  +G+     E  R+M  +VD D DG I+LEEF+
Sbjct  10   ELKKVFDQFDTNGDGKISTAELGGILKAMGSTYTIAELDRVM-DDVDTDKDGFINLEEFA  68

Query  446  VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVD  267
             L  + +  S  SELRDAFD +D + +G IS+ EL+ V   +G S CT++DC +MI GVD
Sbjct  69   QLCRSSSGGSAVSELRDAFDLYDQNKNGLISSSELYQVLTRLGMS-CTVDDCVQMIKGVD  127

Query  266  NNGDGFVCFEDFCRMME  216
            ++GDG V FE+F +MM+
Sbjct  128  SDGDGCVSFEEFRKMMD  144



>ref|XP_011082591.1| PREDICTED: calmodulin-like [Sesamum indicum]
Length=150

 Score =   104 bits (260),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 60/137 (44%), Positives = 84/137 (61%), Gaps = 2/137 (1%)
 Frame = -1

Query  629  AELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  450
            AE  +AF +ID+D DG I  EEL  ++  +  E P++EE+R M+ EVD DGDG +  EEF
Sbjct  11   AEFREAFCVIDKDSDGVITVEELASVIQSLN-EHPTKEEIREMMHEVDADGDGTVDFEEF  69

Query  449  SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  270
              + +     +   EL++AF  FD D DG ISA EL NV   +G+ R + E+  +MI   
Sbjct  70   LSIMARKMKENVAEELKEAFKVFDRDQDGFISAIELRNVMMNLGE-RLSDEEAEQMIREA  128

Query  269  DNNGDGFVCFEDFCRMM  219
            D +GDG V +E+F RMM
Sbjct  129  DLDGDGVVSYEEFVRMM  145



>ref|NP_564874.1| calmodulin like 23 [Arabidopsis thaliana]
 sp|Q9C8Y1.1|CML23_ARATH RecName: Full=Probable calcium-binding protein CML23; AltName: 
Full=Calmodulin-like protein 23 [Arabidopsis thaliana]
 gb|AAG52166.1|AC020665_11 calmodulin-related protein; 72976-72503 [Arabidopsis thaliana]
 gb|AAL36209.1| putative calmodulin-related protein [Arabidopsis thaliana]
 gb|AAM51400.1| putative calmodulin-related protein [Arabidopsis thaliana]
 gb|AEE34504.1| calmodulin like 23 [Arabidopsis thaliana]
Length=157

 Score =   104 bits (260),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 61/145 (42%), Positives = 94/145 (65%), Gaps = 9/145 (6%)
 Frame = -1

Query  638  GLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPP--SREELRLMLSEVDRDGDGCI  465
            G   ++ + F+  D+++DGKI  +EL+ +   +GA  P  S+EE + M+ E D DG+G I
Sbjct  11   GSMEDIKKVFQRFDKNNDGKISIDELKDV---IGALSPNASQEETKAMMKEFDLDGNGFI  67

Query  464  SLEEFSVLSSAFAPPSCDSELRD---AFDFFDTDHDGKISAEELFNVFKTIGDSRCTLED  294
             L+EF  L       S +S +RD   AFD +D D +G+ISA EL +V K +G+ +C+++D
Sbjct  68   DLDEFVALFQISDQSSNNSAIRDLKEAFDLYDLDRNGRISANELHSVMKNLGE-KCSIQD  126

Query  293  CRRMILGVDNNGDGFVCFEDFCRMM  219
            C+RMI  VD++GDG V FE+F +MM
Sbjct  127  CQRMINKVDSDGDGCVDFEEFKKMM  151



>gb|AFK37714.1| unknown [Medicago truncatula]
 gb|KEH34669.1| EF hand calcium-binding family protein [Medicago truncatula]
Length=138

 Score =   104 bits (259),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 89/136 (65%), Gaps = 5/136 (4%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            E+ + F   D++ DGKI + EL+ +++ +G++  + EE+  M+ E+DR+GDG I L+EF 
Sbjct  5    EVRKIFNKFDKNGDGKISRTELKEMMTALGSKTTT-EEVTRMMEELDRNGDGYIDLKEFG  63

Query  446  VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVD  267
             L +         ELR+AF+ +D D +G ISA+EL  V + +G+ +C+L DCR+MI  VD
Sbjct  64   ELHNGGGDTK---ELREAFEMYDLDKNGLISAKELHAVMRRLGE-KCSLGDCRKMIGNVD  119

Query  266  NNGDGFVCFEDFCRMM  219
             + DG V FE+F +MM
Sbjct  120  ADADGNVNFEEFKKMM  135



>gb|ABK26821.1| unknown [Picea sitchensis]
Length=194

 Score =   105 bits (263),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 81/133 (61%), Gaps = 3/133 (2%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            EL   FK  D + DGKI   EL  +L  +G     RE L LM+ E D DGDG ISLEEF 
Sbjct  51   ELEDVFKRFDANGDGKISSSELGDILRSMGCRVGPRE-LGLMMKEADADGDGFISLEEFI  109

Query  446  VLSSAFA-PPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  270
             L++      +C  +L++AF  FD D +G ISA+EL+ V K +GD   + EDC+ MI GV
Sbjct  110  DLNTKGNDKAACLEDLKNAFKIFDLDRNGSISADELYQVLKGMGDG-SSREDCQNMITGV  168

Query  269  DNNGDGFVCFEDF  231
            D NGDG + FE+F
Sbjct  169  DRNGDGLINFEEF  181



>ref|XP_003524362.1| PREDICTED: probable calcium-binding protein CML25-like [Glycine 
max]
Length=188

 Score =   105 bits (262),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 65/141 (46%), Positives = 87/141 (62%), Gaps = 11/141 (8%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            EL Q F   D + DGKI   EL  ++  +G +P +  EL  M+ EVD DGDGCISL EF 
Sbjct  36   ELEQVFNKFDVNGDGKISASELGSIMGSLG-QPATELELDNMIREVDGDGDGCISLPEFI  94

Query  446  VLSSAFAPPSCDSE-----LRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRM  282
             L++       DS+     L+DAF  FD D +G I+AEEL  V +++G+  C+L +CRRM
Sbjct  95   ELNT----KGVDSDEVLENLKDAFAVFDIDGNGSITAEELNTVMRSLGED-CSLAECRRM  149

Query  281  ILGVDNNGDGFVCFEDFCRMM  219
            I GVD +GDG + FE+F  MM
Sbjct  150  ISGVDGDGDGTIDFEEFRVMM  170



>gb|KEH26932.1| EF hand calcium-binding family protein [Medicago truncatula]
Length=174

 Score =   105 bits (261),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 60/146 (41%), Positives = 87/146 (60%), Gaps = 1/146 (1%)
 Frame = -1

Query  656  SPDELSGLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDG  477
            +P  L G   EL + F   D + DGKI   ELE +L  + ++ P +EELR ++ E+  D 
Sbjct  16   TPSPLLGDMDELKKVFNNFDANGDGKISVNELETVLRTLRSDVPQQEELRRVMEELSTDR  75

Query  476  DGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLE  297
            DG I+L EF+    +      DS LRDAFD +D D +G IS EEL      +G  +C++E
Sbjct  76   DGFINLSEFAAFCRSDTTDGGDSALRDAFDLYDKDKNGLISTEELHLALDRLG-MKCSVE  134

Query  296  DCRRMILGVDNNGDGFVCFEDFCRMM  219
            +C+ MI  VD++GDG V F++F +MM
Sbjct  135  ECQDMIKSVDSDGDGSVNFDEFKKMM  160



>gb|ABK26031.1| unknown [Picea sitchensis]
Length=194

 Score =   105 bits (262),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 81/133 (61%), Gaps = 3/133 (2%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            EL   FK  D + DGKI   EL  +L  +G     RE L LM+ E D DGDG ISLEEF 
Sbjct  51   ELEDVFKRFDANGDGKISSSELGDILRSMGCRVGPRE-LGLMMKEADADGDGFISLEEFI  109

Query  446  VLSSAFA-PPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  270
             L++      +C  +L++AF  FD D +G ISA+EL+ V K +GD   + EDC+ MI GV
Sbjct  110  DLNTKGNDKAACLEDLKNAFKVFDLDRNGSISADELYQVLKGMGDG-SSREDCQNMITGV  168

Query  269  DNNGDGFVCFEDF  231
            D NGDG + FE+F
Sbjct  169  DRNGDGLINFEEF  181



>ref|XP_009371792.1| PREDICTED: probable calcium-binding protein CML23 [Pyrus x bretschneideri]
Length=154

 Score =   104 bits (259),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 56/141 (40%), Positives = 88/141 (62%), Gaps = 5/141 (4%)
 Frame = -1

Query  641  SGLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCIS  462
            +G   EL + F   D++ DG+I  +EL  +  ++G+E  S EE++ +++E D+DGDG I 
Sbjct  16   AGSMEELKKIFNKFDKNGDGRISCDELRGIFGELGSETASLEEVQRIMAEFDKDGDGHID  75

Query  461  LEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRM  282
            + EF+ + +  +      ELRDAFD +D D +G IS  EL  V K +G  +C+L++C +M
Sbjct  76   IAEFAEIINGGSTK----ELRDAFDLYDLDKNGLISKSELHEVLKRLG-QKCSLKECAKM  130

Query  281  ILGVDNNGDGFVCFEDFCRMM  219
            I  VD +GDG V F +F +MM
Sbjct  131  IGSVDADGDGHVNFAEFKKMM  151



>emb|CDM86427.1| unnamed protein product [Triticum aestivum]
Length=190

 Score =   105 bits (261),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 84/136 (62%), Gaps = 3/136 (2%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            E+ + F+  D + DG+I + EL  L   +G    + +EL  M++E D DGDG ISLEEF+
Sbjct  49   EMERVFRKFDANGDGRISRPELAALFESLG-HAATEDELTRMMAEADADGDGFISLEEFA  107

Query  446  VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVD  267
             L+ A A    + +LR AF  FD D  G ISA EL +V   +G+ + T++ CRRMI GVD
Sbjct  108  ALN-ATAAGDDEEDLRLAFKVFDADGSGDISAAELASVLHGLGE-KATVQQCRRMIEGVD  165

Query  266  NNGDGFVCFEDFCRMM  219
             NGDG + F++F  MM
Sbjct  166  KNGDGLISFDEFKVMM  181



>gb|EAY97018.1| hypothetical protein OsI_18939 [Oryza sativa Indica Group]
Length=189

 Score =   105 bits (261),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 84/146 (58%), Gaps = 15/146 (10%)
 Frame = -1

Query  629  AELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  450
            AEL Q F+  D + DGKI  EEL  +L  +GA PP   E+R M+ E+D D DG + L EF
Sbjct  35   AELEQVFRRYDANGDGKISAEELASVLRALGA-PPGPGEVRRMMDEMDSDRDGFVDLSEF  93

Query  449  SVLSSAFAPP-------------SCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSR  309
            +       P              + ++ELR+AF  +D D +GKISA EL  V + +GD +
Sbjct  94   AAFHCGPTPAHGGKGGDAKDQEAASEAELREAFRMYDADSNGKISARELHRVLRQLGD-K  152

Query  308  CTLEDCRRMILGVDNNGDGFVCFEDF  231
            C++ DC RMI  VD +GDG V F++F
Sbjct  153  CSVADCSRMIRSVDADGDGCVNFDEF  178


 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 42/69 (61%), Gaps = 1/69 (1%)
 Frame = -1

Query  656  SPDELSGLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDG  477
            + D+ +   AEL +AF++ D D +GKI   EL  +L Q+G +  S  +   M+  VD DG
Sbjct  111  AKDQEAASEAELREAFRMYDADSNGKISARELHRVLRQLG-DKCSVADCSRMIRSVDADG  169

Query  476  DGCISLEEF  450
            DGC++ +EF
Sbjct  170  DGCVNFDEF  178



>ref|XP_003552973.1| PREDICTED: calcium-binding protein CML24-like isoform 1 [Glycine 
max]
Length=139

 Score =   103 bits (258),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 90/136 (66%), Gaps = 4/136 (3%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            E+ + F   D++ DGKI   EL+ +++ +G++  S +E++ M++E+DR+GDG I L+EF 
Sbjct  5    EVRKIFSKFDKNGDGKISCAELKEMMAALGSKTTS-DEVKRMMAELDRNGDGYIDLKEFG  63

Query  446  VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVD  267
                         ELR+AF+ +D D +G ISA+EL +V + +G+ +C+L DCRRMI  VD
Sbjct  64   EFHCGGGGDG--RELREAFELYDLDKNGLISAKELHSVMRRLGE-KCSLSDCRRMIGNVD  120

Query  266  NNGDGFVCFEDFCRMM  219
             +GDG V FE+F +MM
Sbjct  121  ADGDGNVNFEEFKKMM  136



>ref|XP_010271280.1| PREDICTED: probable calcium-binding protein CML25 [Nelumbo nucifera]
Length=205

 Score =   105 bits (262),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 59/133 (44%), Positives = 82/133 (62%), Gaps = 2/133 (2%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            EL   FK  D + DGKI   EL  ++  +G  P + EEL+ M+ EVD DGDG I L EF 
Sbjct  44   ELEHVFKRFDVNGDGKISWSELGSIMGSLG-HPATEEELQKMVEEVDSDGDGFIDLNEFI  102

Query  446  VLSSAFAPP-SCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  270
             L++          +L++AF  FD D +G IS EEL  V K++GD RC++ +C++MI GV
Sbjct  103  ELNTKGVDSLKVIEDLKNAFMVFDIDRNGSISPEELQTVLKSLGDDRCSIAECKKMIRGV  162

Query  269  DNNGDGFVCFEDF  231
            D +GDG + FE+F
Sbjct  163  DCDGDGLINFEEF  175



>ref|XP_010477987.1| PREDICTED: probable calcium-binding protein CML25 [Camelina sativa]
Length=187

 Score =   105 bits (261),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 60/137 (44%), Positives = 84/137 (61%), Gaps = 3/137 (2%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            EL   FK  D + DGKI  +EL  ++  +G E P  EEL   ++E+DR GDG I+ EEF 
Sbjct  37   ELEAVFKKFDVNGDGKISSKELGAIMKSLGHEVP-EEELEKAINEIDRKGDGYINFEEFV  95

Query  446  VLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  270
             L++           L+DAF  +D D +G ISAEEL  V +++GD  C++ +CR+MI GV
Sbjct  96   ELNTKGMDQNDVLENLKDAFSVYDIDGNGSISAEELHEVLRSLGD-ECSIAECRKMIGGV  154

Query  269  DNNGDGFVCFEDFCRMM  219
            D +GDG + FE+F  MM
Sbjct  155  DKDGDGTIDFEEFKIMM  171



>ref|XP_010499149.1| PREDICTED: probable calcium-binding protein CML25 [Camelina sativa]
 ref|XP_010460422.1| PREDICTED: probable calcium-binding protein CML25 [Camelina sativa]
Length=187

 Score =   105 bits (261),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 60/137 (44%), Positives = 84/137 (61%), Gaps = 3/137 (2%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            EL   FK  D + DGKI  +EL  ++  +G E P  EEL   ++E+DR GDG I+ EEF 
Sbjct  37   ELEAVFKKFDVNGDGKISSKELGAIMKSLGHEVPE-EELEKAINEIDRKGDGYINFEEFV  95

Query  446  VLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  270
             L++           L+DAF  +D D +G ISAEEL  V +++GD  C++ +CR+MI GV
Sbjct  96   ELNTKGMDQNDVLENLKDAFSVYDIDGNGSISAEELHEVLRSLGDE-CSIAECRKMIGGV  154

Query  269  DNNGDGFVCFEDFCRMM  219
            D +GDG + FE+F  MM
Sbjct  155  DKDGDGTIDFEEFKIMM  171



>ref|XP_003538397.1| PREDICTED: probable calcium-binding protein CML27-like isoformX1 
[Glycine max]
 ref|XP_006591331.1| PREDICTED: probable calcium-binding protein CML27-like isoform 
X2 [Glycine max]
Length=137

 Score =   103 bits (257),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 89/136 (65%), Gaps = 5/136 (4%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            E+ + F   D++ DGKI   EL+ ++  +G++  S EE++ M++E+DR+GDG I L+EF 
Sbjct  4    EVRKIFSKFDKNGDGKISCAELKEMMVALGSKTTS-EEVKRMMAELDRNGDGYIDLKEFG  62

Query  446  VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVD  267
                         ELR+AF+ +D D +G ISA+EL +V + +G+ +C+L DCRRMI  VD
Sbjct  63   EFHCGGGDGR---ELREAFELYDLDKNGLISAKELHSVMRRLGE-KCSLSDCRRMIGNVD  118

Query  266  NNGDGFVCFEDFCRMM  219
             +GDG V FE+F +MM
Sbjct  119  ADGDGNVNFEEFKKMM  134



>ref|XP_008800225.1| PREDICTED: probable calcium-binding protein CML10 [Phoenix dactylifera]
Length=189

 Score =   105 bits (261),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 61/137 (45%), Positives = 83/137 (61%), Gaps = 3/137 (2%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            E+ + FK  D + DGKI   EL  +   +G  PP+ EEL+ M+ E D DGDG ISL+EF 
Sbjct  42   EVERVFKKFDLNGDGKISSAELAAIFQSLG-HPPTEEELQRMMGEADADGDGFISLDEFV  100

Query  446  VLSSAFAPPSCDSE-LRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  270
             L+ +    S   E LR AF  FD D +G IS +EL  V ++IG+   ++  C+RMI GV
Sbjct  101  ELNVSTVDDSTALEDLRHAFSVFDLDRNGSISPDELARVLRSIGEG-ASVAQCKRMIEGV  159

Query  269  DNNGDGFVCFEDFCRMM  219
            D +GDG + FE+F  MM
Sbjct  160  DRDGDGLISFEEFKLMM  176



>ref|XP_010531587.1| PREDICTED: probable calcium-binding protein CML25 [Tarenaya hassleriana]
Length=202

 Score =   105 bits (261),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 87/137 (64%), Gaps = 3/137 (2%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            EL + FK  D + DGKI   EL  +++ +G E P  +EL+  ++E+D DGDG I+ EEF 
Sbjct  49   ELEEVFKKFDVNGDGKISSSELGSIMASLGHEVP-EDELQKAITEIDGDGDGNINFEEFV  107

Query  446  VLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  270
             L++           L+DAF  +D D +G ISAEEL+ V +++GD  C++ +CR+MI GV
Sbjct  108  ELNTKGMDQDDVMENLKDAFSVYDIDGNGSISAEELYEVLRSLGD-ECSIGECRKMISGV  166

Query  269  DNNGDGFVCFEDFCRMM  219
            D +GDG + FE+F  MM
Sbjct  167  DKDGDGSIDFEEFKVMM  183



>emb|CDM86445.1| unnamed protein product [Triticum aestivum]
Length=190

 Score =   104 bits (260),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 83/136 (61%), Gaps = 3/136 (2%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            E+ + F+  D + DG+I + EL  L   +G    + +EL  M++E D DGDG ISLEEF+
Sbjct  49   EMERVFRKFDANGDGRISRPELAALFESLG-HAATEDELTRMMAEADADGDGFISLEEFA  107

Query  446  VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVD  267
             L+ A A    + +LR AF  FD D  G ISA EL  V   +G+ + T++ CRRMI GVD
Sbjct  108  ALN-ATAAGDDEEDLRLAFKVFDADGSGDISAAELARVLHGLGE-KATVQQCRRMIEGVD  165

Query  266  NNGDGFVCFEDFCRMM  219
             NGDG + F++F  MM
Sbjct  166  KNGDGLISFDEFKVMM  181



>ref|XP_006304603.1| hypothetical protein CARUB_v10011672mg [Capsella rubella]
 gb|EOA37501.1| hypothetical protein CARUB_v10011672mg [Capsella rubella]
Length=184

 Score =   104 bits (260),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 84/137 (61%), Gaps = 3/137 (2%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            EL   FK  D + DGKI  +EL  ++  +G E P  EEL   ++E+DR GDG I+ EEF 
Sbjct  34   ELEAVFKKFDVNGDGKISSKELGAIMKSLGHEVP-EEELEKAITEIDRKGDGYINFEEFV  92

Query  446  VLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  270
             L++           L+DAF  +D D +G ISAEEL  V +++GD  C++ +C++MI GV
Sbjct  93   ELNTKGMDQNDVLENLKDAFSVYDIDGNGSISAEELHEVLRSLGD-ECSIAECKKMIGGV  151

Query  269  DNNGDGFVCFEDFCRMM  219
            D +GDG + FE+F  MM
Sbjct  152  DKDGDGTIDFEEFKIMM  168



>ref|XP_009370750.1| PREDICTED: calmodulin-like protein 11 [Pyrus x bretschneideri]
Length=148

 Score =   103 bits (257),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 60/140 (43%), Positives = 85/140 (61%), Gaps = 2/140 (1%)
 Frame = -1

Query  638  GLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISL  459
            G  +E  +AF LID+D DG IR EEL  ++  +  + P++EE++ M+SE+  DG+G I  
Sbjct  8    GQISEFQEAFCLIDKDSDGLIRLEELATVIQSLD-QRPTKEEIQDMISEIGADGNGTIDF  66

Query  458  EEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMI  279
            EEF  + S     +   EL++AF  FD D DG ISA EL  V   +G+ R T E+  +MI
Sbjct  67   EEFLNIMSRKMKENVAEELKEAFKVFDRDQDGYISASELRQVMINLGE-RLTDEEAEQMI  125

Query  278  LGVDNNGDGFVCFEDFCRMM  219
               D +GDG V +E+F RMM
Sbjct  126  KEADLDGDGLVSYEEFARMM  145



>ref|XP_010925995.1| PREDICTED: probable calcium-binding protein CML18 [Elaeis guineensis]
Length=171

 Score =   104 bits (259),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 85/136 (63%), Gaps = 4/136 (3%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            ++ + F   D + DGKI   EL  ++  +G+E  S EEL+ M++E+D DGDG + L+EF 
Sbjct  18   DIKRVFTRYDTNGDGKISPSELADVMRALGSEV-SDEELKAMMAELDSDGDGFVDLKEFV  76

Query  446  VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVD  267
                       + ELRDAF  +D D DG+ISA+EL  V K +G+ +C++ DC RMI  VD
Sbjct  77   AFHRGLGEK--EEELRDAFAMYDLDRDGQISAKELHLVLKQLGE-KCSVHDCSRMIRSVD  133

Query  266  NNGDGFVCFEDFCRMM  219
            ++GDG V FE+F  MM
Sbjct  134  SDGDGSVNFEEFKMMM  149



>ref|XP_008343178.1| PREDICTED: probable calcium-binding protein CML18 [Malus domestica]
Length=205

 Score =   105 bits (261),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 89/152 (59%), Gaps = 13/152 (9%)
 Frame = -1

Query  635  LYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPP-SREELRLMLSEVDRDGDGCISL  459
            + ++  Q F+++D + DGKI   EL  +LS +G +   + EE   ++ E+DR+GDGCI L
Sbjct  48   VSSQFRQVFEVMDANGDGKISPLELSAVLSCLGNKKSIAAEEAEGIVREMDRNGDGCIDL  107

Query  458  EEFSVL------------SSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGD  315
            +EF               S  F     D EL DAF  FDTD +GKISA+EL  V  ++G 
Sbjct  108  DEFMNAVNVDRSRSNDSDSVGFGNEEEDCELMDAFRIFDTDKNGKISAKELQRVLVSLGC  167

Query  314  SRCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  219
              C+L +CR+MI GVD NGDG V FE+F  MM
Sbjct  168  KECSLRECRQMIKGVDRNGDGAVDFEEFRLMM  199



>ref|XP_007215081.1| hypothetical protein PRUPE_ppa012612mg [Prunus persica]
 gb|EMJ16280.1| hypothetical protein PRUPE_ppa012612mg [Prunus persica]
Length=161

 Score =   103 bits (257),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 86/140 (61%), Gaps = 5/140 (4%)
 Frame = -1

Query  638  GLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISL  459
            G   +L   F   D++ DGKI  +EL  +  ++G++  S EE+R +++E DRDGDG I +
Sbjct  24   GSREQLETIFNKFDKNGDGKISCDELRGVFGELGSDTSSLEEVRSIMAEFDRDGDGHIDI  83

Query  458  EEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMI  279
             EF+ + +         ELRDAFD +D D +G IS  EL  V K +G  +C+L+DC +MI
Sbjct  84   LEFAEIMNG----GSSQELRDAFDLYDLDKNGLISVSELHEVMKRLG-LKCSLQDCVKMI  138

Query  278  LGVDNNGDGFVCFEDFCRMM  219
              VD +GDG V F++F +MM
Sbjct  139  RNVDADGDGHVNFDEFKKMM  158



>ref|XP_010925997.1| PREDICTED: probable calcium-binding protein CML18 [Elaeis guineensis]
Length=171

 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 59/133 (44%), Positives = 83/133 (62%), Gaps = 4/133 (3%)
 Frame = -1

Query  617  QAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFSVLS  438
            + F   D + DGKI   EL  ++  +G+E  S EEL+ M++E+D DGDG + L+EF    
Sbjct  21   RVFTRYDTNGDGKISPSELADVMRALGSEV-SDEELKAMMAELDSDGDGFVDLKEFVAFH  79

Query  437  SAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNNG  258
                    + ELRDAF  +D D DG+ISA+EL  V K +G+ +C++ DC RMI  VD++G
Sbjct  80   RGLGEK--EGELRDAFAMYDLDRDGQISAKELHLVLKRLGE-KCSVHDCSRMIRSVDSDG  136

Query  257  DGFVCFEDFCRMM  219
            DG V FE+F  MM
Sbjct  137  DGSVNFEEFKMMM  149



>ref|XP_010938627.1| PREDICTED: probable calcium-binding protein CML10 [Elaeis guineensis]
 ref|XP_010938628.1| PREDICTED: probable calcium-binding protein CML10 [Elaeis guineensis]
Length=189

 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 82/137 (60%), Gaps = 3/137 (2%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            E+ + FK  D + DGKI   EL  +   +G  P + EEL+ M+ E D DGDG ISL+EF 
Sbjct  42   EVERVFKKFDSNGDGKISSAELAAIFQNLG-HPATEEELQRMMGEADADGDGFISLDEFV  100

Query  446  VLSSAFAPPSCDSE-LRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  270
             L+      S   E LR AF  FD D +G ISA+EL  V ++IG+   ++  C+RMI GV
Sbjct  101  DLNVRTVDDSAALEDLRHAFSVFDLDRNGAISADELARVLRSIGEG-ASVTQCKRMIEGV  159

Query  269  DNNGDGFVCFEDFCRMM  219
            D +GDG V FE+F  MM
Sbjct  160  DRDGDGLVSFEEFKLMM  176



>ref|XP_009617304.1| PREDICTED: calmodulin-like [Nicotiana tomentosiformis]
Length=147

 Score =   102 bits (255),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 61/149 (41%), Positives = 93/149 (62%), Gaps = 6/149 (4%)
 Frame = -1

Query  665  DEISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVD  486
            D +S +++S    E  +AF +ID+D DG IR EEL  ++  +  E P++EE++ M++EVD
Sbjct  3    DALSEEQIS----EFREAFWVIDKDCDGVIRMEELAAVIQSLN-EHPTKEEIQEMVNEVD  57

Query  485  RDGDGCISLEEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRC  306
             DGDG I  E+F  + +     +   EL++AF  FD D DG ISA EL NV   +G+ R 
Sbjct  58   PDGDGTIDFEDFLNIMARKLKDNVSEELKEAFKVFDRDQDGFISANELRNVMMNLGE-RL  116

Query  305  TLEDCRRMILGVDNNGDGFVCFEDFCRMM  219
            T E+ ++MI   D +GDG V +E+F ++M
Sbjct  117  TDEEAQQMIREADLDGDGLVSYEEFVKIM  145



>ref|NP_001152603.1| polcalcin Jun o 2 [Zea mays]
 gb|ACG48452.1| polcalcin Jun o 2 [Zea mays]
Length=194

 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 83/138 (60%), Gaps = 4/138 (3%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            E+ + F+  D + DG+I + EL  L   +G    S +E+  M++E D DGDG ISL EF+
Sbjct  48   EMARVFRKFDANGDGRISRSELAALFESLG-HGASDDEVARMMAEADADGDGFISLPEFA  106

Query  446  VLSSAFA--PPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG  273
             L++  A    + + +LR AF  FD D  G ISA EL  V +++G+   ++  CRRMI G
Sbjct  107  ALNATVAGDAAAVEEDLRHAFRVFDADGSGAISAAELARVLRSLGEP-ASVAQCRRMIEG  165

Query  272  VDNNGDGFVCFEDFCRMM  219
            VD NGDG + F++F  MM
Sbjct  166  VDQNGDGLISFDEFKVMM  183



>gb|ACG44451.1| polcalcin Jun o 2 [Zea mays]
Length=194

 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 83/138 (60%), Gaps = 4/138 (3%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            E+ + F+  D + DG+I + EL  L   +G    S +E+  M++E D DGDG ISL EF+
Sbjct  48   EMARVFRKFDANGDGRISRSELAALFESLG-HGASDDEVARMMAEADADGDGFISLPEFA  106

Query  446  VLSSAFA--PPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG  273
             L++  A    + + +LR AF  FD D  G ISA EL  V +++G+   ++  CRRMI G
Sbjct  107  ALNATVAGDAAAVEEDLRHAFRVFDADGSGAISAAELARVLRSLGEP-ASVAQCRRMIEG  165

Query  272  VDNNGDGFVCFEDFCRMM  219
            VD NGDG + F++F  MM
Sbjct  166  VDQNGDGLISFDEFKVMM  183



>ref|XP_011024051.1| PREDICTED: probable calcium-binding protein CML25 [Populus euphratica]
Length=195

 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 61/137 (45%), Positives = 83/137 (61%), Gaps = 3/137 (2%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            EL Q FK  D + DGKI   EL+    ++G E  S EEL  M++E D DGDG I L+EF 
Sbjct  44   ELEQVFKKFDVNGDGKISSAELDSFWKKLGHEA-SEEELLRMITEFDADGDGFIDLQEFV  102

Query  446  VLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  270
             L++           L+DAF  +D D +G ISAEEL  V  ++G+  C++ +CR+MI GV
Sbjct  103  ALNTQGVDTDEVMENLKDAFSVYDIDGNGSISAEELHKVMASLGEP-CSMAECRKMISGV  161

Query  269  DNNGDGFVCFEDFCRMM  219
            D +GDG + FE+F  MM
Sbjct  162  DRDGDGMIDFEEFKVMM  178



>gb|KDO60746.1| hypothetical protein CISIN_1g029304mg [Citrus sinensis]
Length=195

 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 60/137 (44%), Positives = 83/137 (61%), Gaps = 3/137 (2%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            EL Q F   D + DGKI   EL  +L+ +G    + EEL+ M+ E+D DGDG +  +EF 
Sbjct  43   ELRQVFNKFDANGDGKISASELGSILTSLG-HAATEEELQKMVREIDADGDGFVDFDEFV  101

Query  446  VLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  270
             L++           L+DAF  +D D +G I+AEEL  V +++GD  CTL +CRRMI GV
Sbjct  102  ELNTKGVDSAEVMENLKDAFSVYDIDGNGSITAEELHQVLRSLGDD-CTLAECRRMIRGV  160

Query  269  DNNGDGFVCFEDFCRMM  219
            D +GDG + FE+F  MM
Sbjct  161  DCDGDGTIDFEEFKVMM  177



>ref|XP_008673034.1| PREDICTED: polcalcin Jun o 2 isoform X1 [Zea mays]
 tpg|DAA55826.1| TPA: polcalcin Jun o 2 [Zea mays]
Length=194

 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 83/138 (60%), Gaps = 4/138 (3%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            E+ + F+  D + DG+I + EL  L   +G    S +E+  M++E D DGDG ISL EF+
Sbjct  48   EMARVFRKFDANGDGRISRSELAALFESLG-HGASDDEVARMMAEADADGDGFISLPEFA  106

Query  446  VLSSAFA--PPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG  273
             L++  A    + + +LR AF  FD D  G ISA EL  V +++G+   ++  CRRMI G
Sbjct  107  ALNATVAGDAAAVEEDLRHAFRVFDADGSGAISAAELARVLRSLGEP-ASVAQCRRMIEG  165

Query  272  VDNNGDGFVCFEDFCRMM  219
            VD NGDG + F++F  MM
Sbjct  166  VDQNGDGLISFDEFKVMM  183



>ref|XP_008229213.1| PREDICTED: probable calcium-binding protein CML23 [Prunus mume]
Length=161

 Score =   102 bits (255),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 87/140 (62%), Gaps = 5/140 (4%)
 Frame = -1

Query  638  GLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISL  459
            G   +L   F   D++ DGKI  +EL  +  ++G++  S EE+R +++E DRDGDG I +
Sbjct  24   GSREQLETIFNKFDKNGDGKISCDELRDVFGELGSDTSSLEEVRSIMAEFDRDGDGHIDI  83

Query  458  EEFSVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMI  279
             EF+ + +  +      ELRDAFD +D D +G ISA EL  V K +G  +C+ +DC +MI
Sbjct  84   LEFAEIMNGGSS----QELRDAFDLYDLDKNGLISASELHEVMKRLG-LKCSHQDCVKMI  138

Query  278  LGVDNNGDGFVCFEDFCRMM  219
              VD +GDG V F++F +MM
Sbjct  139  RNVDADGDGHVNFDEFKKMM  158



>ref|XP_006469245.1| PREDICTED: probable calcium-binding protein CML25-like [Citrus 
sinensis]
Length=212

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/137 (44%), Positives = 83/137 (61%), Gaps = 3/137 (2%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            EL Q F   D + DGKI   EL  +L+ +G    + EEL+ M+ E+D DGDG +  +EF 
Sbjct  60   ELRQVFNKFDANGDGKISASELGSILTSLG-HAATEEELQKMVKEIDADGDGFVDFDEFV  118

Query  446  VLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  270
             L++           L+DAF  +D D +G I+AEEL  V +++GD  CTL +CRRMI GV
Sbjct  119  ELNTKGVDSAEVMENLKDAFSVYDIDGNGSITAEELHQVLRSLGDD-CTLAECRRMIRGV  177

Query  269  DNNGDGFVCFEDFCRMM  219
            D +GDG + FE+F  MM
Sbjct  178  DCDGDGTIDFEEFKVMM  194



>ref|XP_011075365.1| PREDICTED: probable calcium-binding protein CML25 [Sesamum indicum]
Length=197

 Score =   103 bits (257),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 61/137 (45%), Positives = 83/137 (61%), Gaps = 3/137 (2%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            EL Q FK  D + DGKI   EL  ++  +G    + EELR M+  VD DGDG I L+EF 
Sbjct  47   ELEQVFKKFDVNGDGKISALELGSIMGSLG-HSATEEELRTMIQGVDSDGDGHIDLQEFI  105

Query  446  VLSSA-FAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  270
             L++           L+DAF  FD D +G ISAEEL +V + +G+  CTL +CR+MI GV
Sbjct  106  ELNTKDVDYDEVLQNLKDAFQVFDIDKNGSISAEELQDVLQNLGE-ECTLAECRKMISGV  164

Query  269  DNNGDGFVCFEDFCRMM  219
            D +G+G + F++F  MM
Sbjct  165  DTDGNGAISFDEFKVMM  181


 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 43/73 (59%), Gaps = 7/73 (10%)
 Frame = -1

Query  422  PSCDS------ELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVDNN  261
            PS DS      EL   F  FD + DGKISA EL ++  ++G S  T E+ R MI GVD++
Sbjct  36   PSFDSRVQMEQELEQVFKKFDVNGDGKISALELGSIMGSLGHS-ATEEELRTMIQGVDSD  94

Query  260  GDGFVCFEDFCRM  222
            GDG +  ++F  +
Sbjct  95   GDGHIDLQEFIEL  107



>ref|XP_010038682.1| PREDICTED: calmodulin-like protein 11 [Eucalyptus grandis]
Length=148

 Score =   102 bits (254),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/137 (44%), Positives = 82/137 (60%), Gaps = 2/137 (1%)
 Frame = -1

Query  629  AELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEF  450
            A+  +AF LID+D DG I  EEL  ++  +  E P++EE++ M+SEVD  G+G I   EF
Sbjct  11   ADFREAFCLIDKDSDGMITMEELATVIQSLD-EHPTKEEVQEMISEVDSVGNGTIDFAEF  69

Query  449  SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  270
              +       +   ELR+AF  FD D DG ISA EL NV   +G+ R T E+  +MI   
Sbjct  70   LNIMGRKMKENVAEELREAFKVFDRDQDGYISASELRNVMMNLGE-RLTNEEAEQMIREA  128

Query  269  DNNGDGFVCFEDFCRMM  219
            D +GDG V +E+F RMM
Sbjct  129  DLDGDGLVSYEEFVRMM  145



>ref|XP_010663678.1| PREDICTED: calcium-binding allergen Ole e 8 [Vitis vinifera]
 emb|CAN60554.1| hypothetical protein VITISV_014971 [Vitis vinifera]
Length=163

 Score =   102 bits (255),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 85/136 (63%), Gaps = 3/136 (2%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            EL + F   D + DGKI   EL  +L  +G+E  S EE+  ++ E+D D DGCI+LEEF+
Sbjct  21   ELQKVFNRFDANGDGKISSSELANVLRALGSES-SPEEMSRVMKEIDTDDDGCINLEEFA  79

Query  446  VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVD  267
                + +      ELRDAF  +D D +G ISA EL  V K +G+ +C+++DC++MI   D
Sbjct  80   QFCKSGSNADA-GELRDAFQLYDGDKNGLISAVELHQVLKQLGE-KCSVQDCQKMIGSFD  137

Query  266  NNGDGFVCFEDFCRMM  219
            ++GDG + F++F  MM
Sbjct  138  SDGDGNISFDEFKEMM  153



>ref|XP_004962216.1| PREDICTED: probable calcium-binding protein CML15-like [Setaria 
italica]
Length=205

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 82/138 (59%), Gaps = 4/138 (3%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            E+ + F+  D D DG+I + EL  L   VG    + +E+  M+ E D DGDGCISL EF+
Sbjct  58   EMERVFRKFDADGDGQISRSELAALFESVG-HAATDDEVSRMMEEADADGDGCISLPEFA  116

Query  446  VL--SSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILG  273
             L  S+     + + +LR AF  FD D +G I+  EL  V + IG++  T+  CRRMI G
Sbjct  117  ALVRSADADAAAVEEDLRHAFMVFDADGNGLITPAELARVLRGIGEA-ATVAQCRRMIQG  175

Query  272  VDNNGDGFVCFEDFCRMM  219
            VD NGDG V F++F  MM
Sbjct  176  VDKNGDGLVSFDEFKLMM  193



>ref|XP_002888497.1| hypothetical protein ARALYDRAFT_475742 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64756.1| hypothetical protein ARALYDRAFT_475742 [Arabidopsis lyrata subsp. 
lyrata]
Length=156

 Score =   102 bits (254),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/145 (41%), Positives = 94/145 (65%), Gaps = 9/145 (6%)
 Frame = -1

Query  638  GLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPP--SREELRLMLSEVDRDGDGCI  465
            G   ++ + F+  D+++DGKI  +EL+ +   +GA  P  ++EE + M+ E D DG+G I
Sbjct  11   GSMEDIKKVFQRFDKNNDGKISIDELKDV---IGALSPNATQEETKSMMKEFDLDGNGFI  67

Query  464  SLEEFSVLSSAFAPPSCDSELRD---AFDFFDTDHDGKISAEELFNVFKTIGDSRCTLED  294
             L+EF  L       S  +E+RD   AFD +D D +G+ISA EL +V K +G+ +C+++D
Sbjct  68   DLDEFVALFQINDQSSDSNEIRDLKEAFDLYDLDRNGRISANELHSVMKNLGE-KCSVQD  126

Query  293  CRRMILGVDNNGDGFVCFEDFCRMM  219
            C+RMI  VD++GDG V FE+F +MM
Sbjct  127  CQRMISKVDSDGDGCVDFEEFKKMM  151



>gb|KCW69357.1| hypothetical protein EUGRSUZ_F02840 [Eucalyptus grandis]
Length=171

 Score =   102 bits (255),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/151 (41%), Positives = 87/151 (58%), Gaps = 17/151 (11%)
 Frame = -1

Query  662  EISPDELSGLYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDR  483
            +  P +  G   ++ Q F   D++ DGKI  +EL             REE +  ++E+D+
Sbjct  26   QAKPADSLGNVDQVRQVFAQYDKNGDGKISCDEL-------------REEAQAAMAEIDK  72

Query  482  DGDGCISLEEFS--VLSSAFAPPSCDS-ELRDAFDFFDTDHDGKISAEELFNVFKTIGDS  312
            DGDG I L+EF+  +L      P C + ELRDAFD +D D +G IS  EL  V K +G  
Sbjct  73   DGDGFIDLDEFAELILGGGDGGPECGAKELRDAFDLYDLDGNGVISVSELHAVMKKLG-Q  131

Query  311  RCTLEDCRRMILGVDNNGDGFVCFEDFCRMM  219
            +C+L DCR+MI  VD +GDG V FE+F +MM
Sbjct  132  KCSLRDCRKMISSVDRDGDGNVNFEEFKKMM  162



>ref|XP_003536119.1| PREDICTED: calmodulin-like protein 11-like [Glycine max]
 gb|KHN16197.1| Calmodulin-like protein 8 [Glycine soja]
Length=149

 Score =   102 bits (254),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 81/140 (58%), Gaps = 2/140 (1%)
 Frame = -1

Query  635  LYAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLE  456
            L  E ++AF L DRD DG I  EEL   L  +    P +EEL++M++EVD DG G I   
Sbjct  9    LIVEFLEAFCLFDRDGDGCITMEELASALRTLNQNNPRKEELQIMMNEVDMDGSGTIEFG  68

Query  455  EF-SVLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMI  279
            +F ++++        + EL++AF  FD D DG IS  EL +V + IG  + T E+   MI
Sbjct  69   QFLNLMARKMKQSEAEEELKEAFKLFDKDQDGYISPTELLSVMRNIG-VKVTEEELEHMI  127

Query  278  LGVDNNGDGFVCFEDFCRMM  219
               D +GDG V +E+F RMM
Sbjct  128  RVADLDGDGRVNYEEFMRMM  147



>dbj|BAJ88405.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK07786.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=191

 Score =   103 bits (256),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 82/136 (60%), Gaps = 3/136 (2%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            E+ + F+  D + DG+I + EL  L   +G    + +EL  M++E D DGDG ISL EF+
Sbjct  50   EMERVFRKFDANGDGRISRPELAALFESLG-HAATDDELSRMMAEADADGDGFISLAEFA  108

Query  446  VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVD  267
             L+ A A    + +LR AF  FD D  G ISA EL  V   +G+ + T++ CRRMI GVD
Sbjct  109  ALN-ATAAGDDEEDLRLAFKVFDADGSGAISAAELARVLHGLGE-KATVQQCRRMIEGVD  166

Query  266  NNGDGFVCFEDFCRMM  219
             NGDG + F++F  MM
Sbjct  167  KNGDGLISFDEFKVMM  182



>ref|XP_002968790.1| hypothetical protein SELMODRAFT_17991, partial [Selaginella moellendorffii]
 gb|EFJ29906.1| hypothetical protein SELMODRAFT_17991, partial [Selaginella moellendorffii]
Length=135

 Score =   101 bits (252),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 65/136 (48%), Positives = 83/136 (61%), Gaps = 3/136 (2%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            EL Q F+ ID D DG+I  EEL  +L  +G   P   EL  +L  +D DGDG ISLEEF 
Sbjct  2    ELEQVFRSIDTDGDGRICLEELRAMLRLIGNANPDDTELLGLLRAIDSDGDGFISLEEF-  60

Query  446  VLSSAFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGVD  267
             L +     S   +LR AF  FD D +G ISA+EL  V + +GD + T  +CRRMI GVD
Sbjct  61   -LRANDEGGSSADDLRAAFQVFDIDGNGFISADELHCVLQKMGD-KITKSECRRMIKGVD  118

Query  266  NNGDGFVCFEDFCRMM  219
            ++G+G V FE+F  MM
Sbjct  119  SDGNGLVDFEEFRIMM  134



>ref|XP_011090880.1| PREDICTED: probable calcium-binding protein CML23 [Sesamum indicum]
Length=203

 Score =   103 bits (256),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 59/145 (41%), Positives = 93/145 (64%), Gaps = 7/145 (5%)
 Frame = -1

Query  632  YAELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPP-SREELRLMLSEVDRDGDGCISLE  456
            +++L   FKLID + DGK+   EL+ +L  +G E   ++EE   ++ E+D DGDG + ++
Sbjct  54   FSQLKHVFKLIDTNGDGKLSPLELKQVLLSIGHEKANAQEEAEGIVREMDFDGDGFVDMD  113

Query  455  EFSVLSSA-----FAPPSC-DSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLED  294
            EF +          A   C +SE+ +AF  FD D++G ISA+EL +V + +G  +C++++
Sbjct  114  EFLIAMGTDQNQDAANGICRESEIMEAFRVFDADNNGLISAKELKSVLERLGCGKCSIKE  173

Query  293  CRRMILGVDNNGDGFVCFEDFCRMM  219
            CR+MI GVD +GDGFV FE+F  MM
Sbjct  174  CRKMIRGVDRDGDGFVSFEEFKCMM  198



>ref|XP_009109853.1| PREDICTED: probable calcium-binding protein CML25 [Brassica rapa]
 emb|CDY36129.1| BnaA08g19190D [Brassica napus]
Length=187

 Score =   102 bits (255),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 85/137 (62%), Gaps = 3/137 (2%)
 Frame = -1

Query  626  ELVQAFKLIDRDDDGKIRKEELEXLLSQVGAEPPSREELRLMLSEVDRDGDGCISLEEFS  447
            EL   FK  D + DGKI  +EL  +++ +G E P  E L+  ++++DR GDG I+ EEF 
Sbjct  38   ELEAVFKKFDVNGDGKISSKELGAIMTSLGHEVP-EEVLQKAITDIDRKGDGYINFEEFV  96

Query  446  VLSS-AFAPPSCDSELRDAFDFFDTDHDGKISAEELFNVFKTIGDSRCTLEDCRRMILGV  270
             L++           L+DAF  +D D +G ISAEEL  V +++GD  C++ +CR+MI GV
Sbjct  97   ELNTKGMDQNEVLENLKDAFSVYDIDGNGSISAEELHEVLRSLGD-ECSIAECRKMIGGV  155

Query  269  DNNGDGFVCFEDFCRMM  219
            D +GDG + FE+F  MM
Sbjct  156  DKDGDGTIDFEEFKIMM  172



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1037156799140