BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF008O15

Length=757
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAT09064.1|  alpha tubulin 2                                         166   1e-79   Bigelowiella natans
gb|ABL61203.1|  alpha-tubulin                                           168   7e-79   Oxymonadida environmental sample
gb|ABE68666.1|  alpha tubulin                                           162   4e-78   Trypanosoma cyclops
gb|KHG25610.1|  Tubulin alpha-3/alpha-5 chain -like protein             164   4e-78   Gossypium arboreum [tree cotton]
gb|KJB46051.1|  hypothetical protein B456_007G346000                    163   2e-77   Gossypium raimondii
gb|KJB46050.1|  hypothetical protein B456_007G346000                    162   3e-77   Gossypium raimondii
gb|AES75164.2|  tubulin beta-1 chain                                    163   4e-77   Medicago truncatula
tpg|DAA32343.1|  TPA: tubulin alpha-1C chain-like                       160   1e-75   Bos taurus [bovine]
ref|XP_008183459.1|  PREDICTED: tubulin alpha-1 chain-like              157   3e-75   
ref|XP_005680058.1|  PREDICTED: tubulin alpha-1C chain                  158   4e-75   
ref|XP_001947108.2|  PREDICTED: tubulin alpha-1 chain-like isofor...    157   4e-75   Acyrthosiphon pisum
emb|CDQ68041.1|  unnamed protein product                                157   6e-75   Oncorhynchus mykiss
ref|XP_008580941.1|  PREDICTED: tubulin alpha-1C chain                  157   8e-75   Galeopterus variegatus [Malayan flying lemur]
ref|XP_009692736.1|  tubulin subunit alpha                              155   2e-74   Theileria orientalis strain Shintoku
ref|XP_001712353.1|  tubA                                               159   2e-74   Hemiselmis andersenii
emb|CAD26889.1|  alpha-tubulin                                          156   6e-74   Miscanthus transmorrisonensis
ref|NP_001291079.1|  tubulin alpha chain                                152   2e-73   Esox lucius
ref|XP_004718096.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin, alp...    151   5e-73   
ref|XP_002613005.1|  hypothetical protein BRAFLDRAFT_58199              152   6e-73   Branchiostoma floridae
ref|XP_002735588.1|  PREDICTED: tubulin alpha-1D chain-like             152   1e-72   Saccoglossus kowalevskii
gb|EHH21696.1|  hypothetical protein EGK_04820                          153   1e-72   Macaca mulatta [rhesus macaque]
ref|XP_010891518.1|  PREDICTED: tubulin alpha chain-like                152   1e-72   Esox lucius
gb|AAK94059.1|AF401481_1  pi-tubulin                                    154   1e-72   Helianthus annuus
emb|CCF76062.1|  unnamed protein product                                157   2e-72   Babesia microti strain RI
ref|XP_005399002.1|  PREDICTED: tubulin alpha-1C chain-like             153   3e-72   
gb|EPQ12942.1|  Tubulin alpha-1C chain                                  151   5e-72   Myotis brandtii
ref|XP_002735587.1|  PREDICTED: tubulin alpha-1B chain-like             152   7e-72   Saccoglossus kowalevskii
ref|XP_003963615.1|  PREDICTED: tubulin alpha-1C chain-like             151   9e-72   
ref|XP_005622233.1|  PREDICTED: tubulin alpha chain-like                151   1e-71   
ref|XP_001713198.1|  tubulin alpha-1 chain                              151   1e-71   Guillardia theta
ref|XP_003474749.2|  PREDICTED: tubulin alpha-2/alpha-4 chain-like      156   4e-71   Cavia porcellus [guinea pig]
ref|XP_007883118.1|  PREDICTED: tubulin alpha-1 chain-like              154   4e-71   Callorhinchus milii [Australian ghost shark]
dbj|GAA48838.1|  tubulin alpha-1 chain                                  148   5e-71   Clonorchis sinensis [oriental liver fluke]
gb|EPY78320.1|  hypothetical protein CB1_001108068                      150   6e-71   Camelus ferus
dbj|GAA48839.1|  tubulin alpha-1 chain                                  148   6e-71   Clonorchis sinensis [oriental liver fluke]
dbj|GAA48837.1|  tubulin alpha-1 chain                                  148   7e-71   Clonorchis sinensis [oriental liver fluke]
dbj|GAA32775.2|  tubulin alpha                                          148   8e-71   Clonorchis sinensis [oriental liver fluke]
ref|XP_010744593.1|  PREDICTED: tubulin alpha-1C chain-like             150   8e-71   
gb|EPY85690.1|  tubulin alpha-1A chain                                  150   8e-71   Camelus ferus
ref|XP_009177221.1|  hypothetical protein T265_12043                    147   9e-71   Opisthorchis viverrini [Southeast Asian liver fluke]
ref|XP_008402109.1|  PREDICTED: tubulin alpha chain-like                150   9e-71   Poecilia reticulata
ref|XP_006135531.1|  PREDICTED: tubulin alpha-8 chain-like              149   1e-70   
ref|XP_009050464.1|  hypothetical protein LOTGIDRAFT_187046             149   1e-70   Lottia gigantea
gb|EPQ13502.1|  Tubulin alpha-3 chain                                   148   3e-70   Myotis brandtii
ref|XP_003792393.1|  PREDICTED: tubulin alpha chain-like                148   5e-70   
ref|XP_009809251.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin alph...    152   1e-69   Gavia stellata
ref|XP_006044076.1|  PREDICTED: tubulin alpha-1A chain-like isofo...    147   1e-69   
ref|XP_006044077.1|  PREDICTED: tubulin alpha-1A chain-like isofo...    147   1e-69   
ref|XP_001751395.1|  predicted protein                                  155   2e-68   
ref|XP_009171069.1|  hypothetical protein T265_14255                    148   5e-68   Opisthorchis viverrini [Southeast Asian liver fluke]
ref|XP_005451973.1|  PREDICTED: tubulin alpha chain-like isoform X2     145   7e-68   Oreochromis niloticus
ref|XP_005451972.1|  PREDICTED: tubulin alpha chain-like isoform X1     145   2e-67   Oreochromis niloticus
ref|XP_006802409.1|  PREDICTED: tubulin alpha chain-like                144   3e-67   Neolamprologus brichardi [lyretail cichlid]
gb|ERE68863.1|  tubulin alpha-1C chain                                  145   3e-67   Cricetulus griseus [Chinese hamsters]
gb|EFA86605.1|  alpha tubulin                                           147   4e-67   Heterostelium album PN500
gb|ABO61405.1|  alpha tubulin                                           167   5e-67   Mallomonas papillosa
ref|XP_005723349.1|  PREDICTED: tubulin alpha chain-like isoform X2     145   1e-66   Pundamilia nyererei
ref|XP_004712699.1|  PREDICTED: tubulin alpha chain-like 3              143   1e-66   
gb|ABL61111.1|  alpha-tubulin                                           165   1e-66   Saccinobaculus environmental sample
gb|AFM80089.1|  alpha-tubulin                                           142   2e-66   Teleopsis dalmanni
ref|XP_004555568.1|  PREDICTED: tubulin alpha chain-like isoform X5     145   2e-66   Maylandia zebra
ref|XP_005723348.1|  PREDICTED: tubulin alpha chain-like isoform X1     144   2e-66   Pundamilia nyererei
gb|ABO61431.1|  alpha tubulin                                           166   2e-66   Thalassiosira tumida
ref|XP_011331850.1|  PREDICTED: tubulin alpha-2/alpha-4 chain-like      151   3e-66   Ooceraea biroi
ref|XP_004555567.1|  PREDICTED: tubulin alpha chain-like isoform X4     145   4e-66   Maylandia zebra
gb|EFA79340.1|  Tubulin alpha-1B chain                                  149   4e-66   Heterostelium album PN500
ref|XP_004555564.1|  PREDICTED: tubulin alpha chain-like isoform X1     145   4e-66   Maylandia zebra
ref|XP_001917047.2|  PREDICTED: tubulin, alpha-like 3                   142   4e-66   Equus caballus [domestic horse]
ref|XP_008515092.1|  PREDICTED: tubulin alpha chain-like 3              142   4e-66   Equus przewalskii [Przewalski horse]
gb|EGV95091.1|  Tubulin alpha chain-like 3                              140   5e-66   Cricetulus griseus [Chinese hamsters]
ref|XP_011224672.1|  PREDICTED: tubulin alpha chain-like 3              146   5e-66   
ref|XP_006990263.1|  PREDICTED: tubulin alpha chain-like 3              139   6e-66   
gb|EKC29904.1|  Tubulin alpha-1C chain                                  150   7e-66   Crassostrea gigas
gb|ETE69211.1|  Tubulin alpha-1A chain                                  151   7e-66   Ophiophagus hannah
gb|EFB23088.1|  hypothetical protein PANDA_009124                       145   7e-66   Ailuropoda melanoleuca
ref|XP_007606261.1|  PREDICTED: tubulin alpha chain-like 3              139   1e-65   
gb|ABA41239.1|  alpha-tubulin                                           167   1e-65   Cyanophora paradoxa
ref|XP_006158532.1|  PREDICTED: tubulin alpha chain-like 3              139   2e-65   
gb|AIA82439.1|  alpha-tubulin-like protein 08                           142   2e-65   Stentor coeruleus
gb|ELW48334.1|  Tubulin alpha chain-like 3                              139   2e-65   Tupaia chinensis
ref|XP_006734821.1|  PREDICTED: tubulin alpha chain-like 3              144   2e-65   Leptonychotes weddellii
gb|ABL61124.1|  alpha-tubulin                                           160   4e-65   Saccinobaculus environmental sample
ref|XP_006516544.1|  PREDICTED: tubulin alpha chain-like 3 isofor...    138   4e-65   Mus musculus [mouse]
ref|XP_008703668.1|  PREDICTED: tubulin alpha chain-like 3              142   5e-65   Ursus maritimus [white bear]
ref|XP_008821462.1|  PREDICTED: tubulin alpha chain-like 3              140   5e-65   
dbj|GAA36475.2|  tubulin alpha                                          149   5e-65   Clonorchis sinensis [oriental liver fluke]
ref|XP_006516542.1|  PREDICTED: tubulin alpha chain-like 3 isofor...    138   5e-65   Mus musculus [mouse]
ref|XP_005320457.1|  PREDICTED: tubulin alpha chain-like 3              139   6e-65   
ref|XP_008705617.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin alph...    144   6e-65   Ursus maritimus [white bear]
ref|XP_009493580.1|  tubulin alpha-1C chain                             137   8e-65   Fonticula alba
ref|XP_004757979.1|  PREDICTED: tubulin alpha chain-like 3 isofor...    141   9e-65   
ref|XP_004757978.1|  PREDICTED: tubulin alpha chain-like 3 isofor...    141   1e-64   Mustela putorius furo [black ferret]
ref|NP_001029051.2|  tubulin alpha chain-like 3                         137   1e-64   Mus musculus [mouse]
dbj|BAE22753.1|  unnamed protein product                                137   1e-64   Mus musculus [mouse]
gb|EDL32234.1|  mCG1728                                                 137   1e-64   Mus musculus [mouse]
ref|XP_005071798.1|  PREDICTED: tubulin alpha chain-like 3              139   2e-64   
ref|XP_005617236.1|  PREDICTED: tubulin, alpha-like 3                   145   2e-64   
gb|EHB16400.1|  Tubulin alpha chain-like 3                              139   2e-64   Heterocephalus glaber [naked mole rat]
ref|XP_011281904.1|  PREDICTED: tubulin alpha chain-like 3              140   2e-64   
ref|XP_004906049.1|  PREDICTED: tubulin alpha chain-like 3              138   3e-64   
ref|XP_008216918.1|  PREDICTED: tubulin alpha-8 chain-like              144   4e-64   Nasonia vitripennis
ref|XP_004588609.1|  PREDICTED: tubulin alpha chain-like 3              140   4e-64   Ochotona princeps [southern American pika]
ref|NP_001165335.1|  tubulin alpha chain-like 3 isoform 2               136   6e-64   Homo sapiens [man]
dbj|BAG59224.1|  unnamed protein product                                136   6e-64   Homo sapiens [man]
ref|XP_004411887.1|  PREDICTED: tubulin alpha chain-like 3              145   6e-64   
ref|NP_079079.1|  tubulin alpha chain-like 3 isoform 1                  135   8e-64   Homo sapiens [man]
ref|XP_003786941.1|  PREDICTED: tubulin alpha chain-like 3              138   8e-64   
gb|EAW86447.1|  tubulin, alpha-like 3                                   135   9e-64   Homo sapiens [man]
ref|XP_003777558.1|  PREDICTED: tubulin alpha chain-like 3 isofor...    136   1e-63   
ref|XP_003827830.1|  PREDICTED: tubulin alpha chain-like 3 isofor...    136   1e-63   Pan paniscus [bonobo]
ref|XP_002820535.2|  PREDICTED: tubulin alpha chain-like 3 isofor...    136   1e-63   
ref|XP_003410795.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin alph...    140   1e-63   
ref|XP_009212160.1|  PREDICTED: tubulin alpha chain-like 3 isofor...    137   2e-63   
ref|XP_796279.1|  PREDICTED: tubulin alpha-1C chain-like                139   2e-63   
ref|XP_003827829.1|  PREDICTED: tubulin alpha chain-like 3 isofor...    136   2e-63   Pan paniscus [bonobo]
ref|XP_003903391.2|  PREDICTED: tubulin alpha chain-like 3 isofor...    137   2e-63   
gb|EPY82418.1|  tubulin alpha-1A chain                                  147   2e-63   Camelus ferus
ref|XP_003951632.1|  PREDICTED: tubulin alpha chain-like 3 isofor...    136   2e-63   
ref|XP_001118645.2|  PREDICTED: tubulin alpha chain-like 3-like         137   2e-63   
gb|EHH18859.1|  hypothetical protein EGK_19421                          137   3e-63   Macaca mulatta [rhesus macaque]
ref|XP_521409.4|  PREDICTED: tubulin alpha chain-like 3 isoform X1      135   3e-63   
ref|XP_010364789.1|  PREDICTED: tubulin alpha chain-like 3              137   3e-63   Rhinopithecus roxellana
ref|XP_005564608.1|  PREDICTED: tubulin alpha chain-like 3              137   3e-63   Macaca fascicularis [crab eating macaque]
gb|AHM94171.1|  alpha-tubulin                                           168   3e-63   Menoidium bibacillatum
ref|XP_008000339.1|  PREDICTED: tubulin alpha chain-like 3              134   5e-63   Chlorocebus sabaeus
ref|XP_007081245.1|  PREDICTED: tubulin alpha chain-like 3              136   6e-63   
gb|AAN40716.1|  alpha-tubulin                                           167   6e-63   Strobilidium sp.
dbj|GAM26554.1|  hypothetical protein SAMD00019534_097290               138   8e-63   Acytostelium subglobosum LB1
ref|XP_954407.1|  tubulin alpha chain                                   137   9e-63   Theileria annulata
ref|XP_001846203.1|  tubulin alpha chain                                136   1e-62   Culex quinquefasciatus
ref|XP_009175670.1|  hypothetical protein T265_10896                    138   1e-62   Opisthorchis viverrini [Southeast Asian liver fluke]
ref|XP_008057665.1|  PREDICTED: tubulin alpha chain-like 3              136   1e-62   
dbj|GAA31772.2|  tubulin alpha                                          136   1e-62   Clonorchis sinensis [oriental liver fluke]
ref|XP_008585572.1|  PREDICTED: tubulin alpha chain-like 3              135   2e-62   Galeopterus variegatus [Malayan flying lemur]
emb|CDO68137.1|  hypothetical protein BN946_scf185003.g9                139   2e-62   Trametes cinnabarina
dbj|GAM26553.1|  hypothetical protein SAMD00019534_097280               138   3e-62   Acytostelium subglobosum LB1
ref|XP_008246815.1|  PREDICTED: tubulin alpha chain-like 3              139   3e-62   Oryctolagus cuniculus [domestic rabbit]
ref|XP_004829933.1|  tubulin alpha chain, putative                      139   4e-62   Theileria equi strain WA
gb|ABO61435.1|  alpha tubulin                                           153   5e-62   Cryptophyceae sp. SL64/78sp
ref|XP_004049058.1|  PREDICTED: tubulin alpha chain-like 3 isoform 2    133   6e-62   Gorilla gorilla gorilla [lowland gorilla]
ref|XP_009689130.1|  tubulin subunit alpha                              133   8e-62   Theileria orientalis strain Shintoku
ref|XP_004049057.1|  PREDICTED: tubulin alpha chain-like 3 isoform 1    132   9e-62   
gb|AFP25236.1|  alpha-tubulin                                           170   9e-62   Apodiophrys ovalis
ref|XP_004862266.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin alph...    149   1e-61   
dbj|GAA93509.1|  hypothetical protein E5Q_00150                         133   2e-61   Mixia osmundae IAM 14324
ref|XP_004357077.1|  alpha tubulin                                      141   2e-61   Cavenderia fasciculata
ref|XP_004886012.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin alph...    149   2e-61   
gb|KIP10686.1|  hypothetical protein PHLGIDRAFT_125385                  136   3e-61   Phlebiopsis gigantea 11061_1 CR5-6
gb|AAL04106.2|AF405439_1  alpha tubulin IV                              133   1e-60   Homarus americanus
gb|AAD02572.1|  nucleomorph alpha-tubulin                               150   3e-60   Guillardia theta
gb|AAN40715.1|  alpha-tubulin                                           165   4e-60   Strobilidium sp.
gb|KFH62597.1|  tubulin alpha chain                                     131   9e-60   Mortierella verticillata NRRL 6337
gb|KIH59504.1|  tubulin/FtsZ family protein                             137   1e-59   Ancylostoma duodenale
gb|ETN61230.1|  tubulin alpha-2 chain                                   130   1e-59   Anopheles darlingi [American malaria mosquito]
gb|ETN62715.1|  tubulin alpha-2 chain                                   130   2e-59   Anopheles darlingi [American malaria mosquito]
ref|XP_008998177.1|  PREDICTED: tubulin alpha chain-like 3              134   2e-59   
gb|EDL10326.1|  mCG50536                                                133   4e-59   Mus musculus [mouse]
ref|XP_002431213.1|  tubulin alpha-1 chain, putative                    133   4e-59   Pediculus humanus corporis [human body lice]
ref|XP_765851.1|  tubulin subunit alpha                                 131   4e-59   Theileria parva strain Muguga
gb|ERG79399.1|  tubulin alpha-3 chain                                   130   5e-59   
ref|XP_004379779.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin alph...    129   6e-59   Trichechus manatus latirostris
ref|XP_001846298.1|  tubulin alpha-2 chain                              131   6e-59   Culex quinquefasciatus
emb|CBK21156.2|  unnamed protein product                                138   7e-59   Blastocystis hominis
ref|XP_003959948.1|  hypothetical protein KAFR_0L02020                  135   8e-59   Kazachstania africana CBS 2517
ref|XP_003883425.1|  hypothetical protein NCLIV_031800                  134   1e-58   Neospora caninum Liverpool
emb|CCF73348.1|  unnamed protein product                                134   1e-58   Babesia microti strain RI
ref|XP_007391813.1|  hypothetical protein PHACADRAFT_249557             130   1e-58   Phanerochaete carnosa HHB-10118-sp
ref|XP_008885683.1|  alpha-tubulin I, putative                          134   1e-58   
gb|KFG63712.1|  putative alpha-tubulin I                                134   1e-58   Toxoplasma gondii RUB
gb|KHN82210.1|  Tubulin alpha-2 chain                                   127   1e-58   Toxocara canis
ref|XP_007611418.1|  PREDICTED: tubulin alpha chain-like                129   1e-58   
gb|KFG51077.1|  putative alpha-tubulin I                                133   1e-58   Toxoplasma gondii p89
ref|XP_002368048.1|  tubulin alpha chain, putative                      134   2e-58   Toxoplasma gondii ME49
ref|XP_007624041.1|  PREDICTED: tubulin alpha chain isoform X2          143   2e-58   
gb|EFX80594.1|  hypothetical protein DAPPUDRAFT_318433                  130   2e-58   Daphnia pulex
ref|XP_009986403.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin alph...    140   7e-58   Tauraco erythrolophus
gb|EDZ70339.1|  YML124Cp-like protein                                   134   9e-58   Saccharomyces cerevisiae AWRI1631
ref|XP_007933654.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin alph...    135   1e-57   Orycteropus afer afer
gb|ABE68662.1|  alpha tubulin                                           154   1e-57   Herpetomonas megaseliae
ref|XP_004033314.1|  PREDICTED: tubulin alpha-4A chain                  155   1e-57   
ref|NP_013582.1|  alpha-tubulin TUB3                                    133   1e-57   Saccharomyces cerevisiae S288C
dbj|GAA25326.1|  K7_Tub3p                                               133   1e-57   Saccharomyces cerevisiae Kyokai no. 7
gb|EEU05259.1|  Tub3p                                                   133   1e-57   Saccharomyces cerevisiae JAY291
gb|AJS86201.1|  Tub3p                                                   133   2e-57   Saccharomyces cerevisiae YJM1356
gb|AJS84023.1|  Tub3p                                                   133   2e-57   Saccharomyces cerevisiae YJM1336
gb|EGA73633.1|  Tub3p                                                   133   2e-57   Saccharomyces cerevisiae AWRI796
gb|KFU99907.1|  Tubulin alpha-2 chain                                   125   3e-57   Pterocles gutturalis
ref|XP_010077816.1|  PREDICTED: tubulin alpha-8 chain-like              125   3e-57   Pterocles gutturalis
ref|XP_009070713.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin alph...    126   2e-56   Acanthisitta chloris
ref|XP_004009167.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin alph...    127   3e-56   
ref|XP_003939104.1|  PREDICTED: tubulin alpha chain-like 3 isofor...    129   4e-56   Saimiri boliviensis boliviensis
ref|XP_005713293.1|  alpha-tubulin                                      125   5e-56   Chondrus crispus [carageen]
ref|XP_003939105.1|  PREDICTED: tubulin alpha chain-like 3 isofor...    129   5e-56   Saimiri boliviensis boliviensis
ref|XP_001843131.1|  tubulin alpha chain                                128   6e-56   Culex quinquefasciatus
gb|EPY75602.1|  protein disulfide-isomerase A6                          129   3e-55   Camelus ferus
gb|EPQ09739.1|  Tubulin alpha chain-like 3                              133   3e-55   Myotis brandtii
ref|XP_005869572.1|  PREDICTED: tubulin alpha chain-like 3              133   3e-55   
gb|ABJ80981.1|  alpha tubulin                                           147   9e-55   Pyropia yezoensis
ref|XP_001610358.1|  tubulin alpha chain                                137   1e-54   Babesia bovis T2Bo
ref|XP_008153569.1|  PREDICTED: tubulin alpha chain-like 3              132   1e-54   Eptesicus fuscus
emb|CAG03832.1|  unnamed protein product                                129   1e-54   Tetraodon nigroviridis
ref|XP_007604829.1|  tubulin alpha chain                                128   1e-54   Vittaforma corneae ATCC 50505
gb|ETN78534.1|  tubulin/FtsZ family protein                             129   3e-54   Necator americanus
emb|CAJ44848.1|  alpha-tubulin                                          134   6e-54   Heterostelium tenuissimum
ref|XP_002155700.1|  PREDICTED: tubulin alpha-1C chain-like             122   1e-53   Hydra vulgaris
ref|XP_007538925.1|  PREDICTED: tubulin alpha-8 chain-like              143   1e-53   
emb|CAJ44857.1|  alpha-tubulin                                          131   3e-53   Heterostelium luridum
ref|XP_004605507.1|  PREDICTED: tubulin alpha chain-like 3              119   3e-53   
gb|KGK39289.1|  hypothetical protein JL09_g1598                         122   3e-53   Pichia kudriavzevii
emb|CDR95936.1|  TUBULIN protein,putative                               132   6e-53   Babesia bigemina
gb|AII72207.1|  alpha-tubulin                                           122   8e-53   Endoreticulatus sp. Zhenjiang
emb|CDK28648.1|  unnamed protein product                                118   1e-52   Kuraishia capsulata CBS 1993
ref|XP_007647867.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin alph...    125   2e-52   
ref|XP_002995388.1|  hypothetical protein NCER_101746                   119   2e-52   
gb|AFR46106.1|  alpha tubulin                                           140   4e-52   Macrotrachela quadricornifera
gb|AEW08142.1|  hypothetical protein 2_945_01                           177   7e-52   Pinus taeda
emb|CDW53125.1|  tubulin alpha chain                                    120   3e-51   Trichuris trichiura
gb|KFD48716.1|  hypothetical protein M513_10427                         120   3e-51   Trichuris suis
emb|CAJ44847.1|  alpha-tubulin                                          117   3e-51   Cavenderia microspora
emb|CAD20820.1|  alpha tubulin                                          177   4e-51   Zea mays [maize]
emb|CAD20821.1|  alpha tubulin                                          179   4e-51   Zea mays [maize]
gb|ABR25510.1|  tubulin alpha-1 chain                                   178   5e-51   Oryza sativa Indica Group [Indian rice]
ref|XP_010420792.1|  PREDICTED: tubulin alpha-3 chain-like              176   5e-51   Camelina sativa [gold-of-pleasure]
ref|XP_008384431.1|  PREDICTED: tubulin alpha-3 chain-like              179   6e-51   
sp|P33624.1|TBA2_ANEPH  RecName: Full=Tubulin alpha-2 chain             181   6e-51   Anemia phyllitidis
emb|CAJ44871.1|  alpha-tubulin                                          127   7e-51   Heterostelium gloeosporum
ref|XP_005154151.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin alph...    148   8e-51   
emb|CAJ44856.1|  alpha-tubulin                                          128   9e-51   Heterostelium pallidum
emb|CAK55183.2|  alpha-tubulin 4                                        174   2e-50   Quercus ilex [holly oak]
gb|KDP39691.1|  hypothetical protein JCGZ_02711                         182   2e-50   Jatropha curcas
dbj|BAH20267.1|  AT5G19780                                              178   2e-50   Arabidopsis thaliana [mouse-ear cress]
emb|CAK55182.1|  alpha-tubulin 3                                        174   2e-50   Quercus ilex [holly oak]
gb|EGW10116.1|  Tubulin alpha-1C chain                                  115   2e-50   Cricetulus griseus [Chinese hamsters]
emb|CAL69464.1|  a-tubulin                                              173   2e-50   Quercus robur [English oak]
dbj|BAD94893.1|  tubulin alpha-5 chain-like protein                     174   2e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001777110.1|  predicted protein                                  179   2e-50   
ref|XP_010054663.1|  PREDICTED: tubulin alpha-3 chain-like              181   3e-50   Eucalyptus grandis [rose gum]
emb|CAL35827.1|  alpha-2 tubulin                                        176   3e-50   Plantago major [cart-track plant]
gb|KHG26159.1|  Tubulin alpha-6 chain                                   181   3e-50   Gossypium arboreum [tree cotton]
gb|AET80381.1|  alpha-tubulin                                           176   3e-50   x Doritaenopsis hybrid cultivar
tpg|DAA41189.1|  TPA: alpha tubulin5                                    178   4e-50   
emb|CAJ44859.1|  alpha-tubulin                                          127   4e-50   Cavenderia multistipes
ref|XP_009353129.1|  PREDICTED: tubulin alpha-3 chain-like              181   4e-50   Pyrus x bretschneideri [bai li]
ref|XP_002319688.1|  Tubulin alpha-1 chain family protein               181   4e-50   Populus trichocarpa [western balsam poplar]
tpg|DAA63280.1|  TPA: alpha tubulin6                                    178   4e-50   
gb|KJB44614.1|  hypothetical protein B456_007G261000                    181   4e-50   Gossypium raimondii
ref|XP_002525416.1|  tubulin alpha chain, putative                      181   5e-50   Ricinus communis
ref|XP_008386829.1|  PREDICTED: tubulin alpha-3 chain-like              181   5e-50   Malus domestica [apple tree]
ref|XP_008240534.1|  PREDICTED: tubulin alpha-3 chain isoform X2        180   5e-50   Prunus mume [ume]
gb|AHJ80821.1|  Tua3                                                    179   6e-50   Eragrostis tef [tef]
ref|XP_011089722.1|  PREDICTED: tubulin alpha-3 chain                   181   7e-50   Sesamum indicum [beniseed]
gb|KJB83378.1|  hypothetical protein B456_013G244600                    179   7e-50   Gossypium raimondii
emb|CAD26887.1|  alpha-tubulin                                          181   7e-50   Miscanthus sinensis
emb|CAD26893.1|  alpha-tubulin                                          180   8e-50   Miscanthus floridulus
ref|XP_011461685.1|  PREDICTED: tubulin alpha-3 chain isoform X2        179   8e-50   Fragaria vesca subsp. vesca
emb|CAD26890.1|  alpha-tubulin                                          180   8e-50   Miscanthus sinensis subsp. condensatus
ref|XP_006584595.1|  PREDICTED: uncharacterized protein LOC100806...    180   9e-50   
ref|XP_002650065.1|  tubulin alpha chain                                117   9e-50   
gb|AGG37288.1|  alpha-tubulin 6                                         180   1e-49   Salix arbutifolia
ref|XP_011034391.1|  PREDICTED: tubulin alpha-3 chain                   180   1e-49   Populus euphratica
ref|XP_009366459.1|  PREDICTED: tubulin alpha-3 chain                   180   1e-49   
ref|XP_007204346.1|  hypothetical protein PRUPE_ppa005649mg             180   1e-49   Prunus persica
ref|XP_008240533.1|  PREDICTED: tubulin alpha-3 chain isoform X1        180   1e-49   Prunus mume [ume]
gb|AGI78243.1|  alpha tubulin 5                                         174   1e-49   Caragana korshinskii
ref|XP_002160359.1|  PREDICTED: tubulin alpha-1C chain-like             114   1e-49   Hydra vulgaris
ref|XP_004295008.1|  PREDICTED: tubulin alpha-3 chain isoform X1        180   1e-49   Fragaria vesca subsp. vesca
gb|KHN47983.1|  Tubulin alpha-3 chain                                   179   1e-49   Glycine soja [wild soybean]
ref|XP_006488931.1|  PREDICTED: tubulin alpha-1 chain-like isofor...    179   1e-49   
ref|XP_011075054.1|  PREDICTED: tubulin alpha-3 chain-like              179   1e-49   Sesamum indicum [beniseed]
ref|XP_007030078.1|  Tubulin alpha-5                                    180   2e-49   
gb|EYU31677.1|  hypothetical protein MIMGU_mgv1a006281mg                179   2e-49   Erythranthe guttata [common monkey flower]
gb|KHN06388.1|  Tubulin alpha-3 chain                                   179   2e-49   Glycine soja [wild soybean]
gb|AHJ80820.1|  Tua3                                                    178   2e-49   Eragrostis tef [tef]
ref|NP_001242878.1|  uncharacterized protein LOC100806907               179   2e-49   Glycine max [soybeans]
ref|XP_640483.1|  hypothetical protein DDB_G0281889                     127   2e-49   Dictyostelium discoideum AX4
ref|XP_006579487.1|  PREDICTED: tubulin A isoform X1                    179   2e-49   
gb|AAP49439.1|  tubulin                                                 171   2e-49   Viola cornuta [bedding pansy]
ref|NP_001237301.1|  tubulin A                                          179   2e-49   
ref|XP_007159433.1|  hypothetical protein PHAVU_002G237400g             179   2e-49   Phaseolus vulgaris [French bean]
ref|XP_004958110.1|  PREDICTED: tubulin alpha-3 chain-like              179   2e-49   
ref|NP_001105324.1|  tubulin alpha-5 chain                              179   2e-49   
ref|XP_003562846.1|  PREDICTED: tubulin alpha-1 chain                   179   2e-49   
ref|XP_006286664.1|  hypothetical protein CARUB_v10002583mg             179   2e-49   
dbj|BAJ06363.1|  alpha-tubulin                                          179   2e-49   
ref|XP_010923361.1|  PREDICTED: tubulin alpha-3 chain                   179   2e-49   
gb|KHG06160.1|  Tubulin alpha-3/alpha-5 chain -like protein             179   2e-49   
gb|AGY80453.1|  tubulin                                                 179   2e-49   
emb|CAD26886.1|  alpha-tubulin                                          179   2e-49   
gb|ABD92942.1|  alpha tubulin-1D                                        179   2e-49   
emb|CAD26891.1|  alpha-tubulin                                          179   2e-49   
sp|O22349.1|TBA3_ELEIN  RecName: Full=Tubulin alpha-3 chain; AltN...    179   2e-49   
emb|CAD24765.1|  alpha-tubulin                                          179   2e-49   
sp|Q43473.1|TBA1_HORVU  RecName: Full=Tubulin alpha-1 chain             179   2e-49   
ref|NP_001105588.1|  tubulin alpha-6 chain                              179   2e-49   
ref|XP_009413318.1|  PREDICTED: tubulin alpha-3 chain-like              179   2e-49   
ref|NP_001060075.1|  Os07g0574800                                       179   2e-49   
gb|ACN40824.1|  unknown                                                 179   2e-49   
ref|XP_008349406.1|  PREDICTED: tubulin alpha-3 chain                   179   2e-49   
gb|AEG74028.1|  alpha-tubulin                                           179   2e-49   
ref|XP_002532068.1|  tubulin alpha chain, putative                      179   2e-49   
ref|XP_006657877.1|  PREDICTED: tubulin alpha-3 chain-like              179   2e-49   
ref|XP_009375870.1|  PREDICTED: tubulin alpha-3 chain                   179   2e-49   
emb|CDP17586.1|  unnamed protein product                                179   2e-49   
ref|XP_011021469.1|  PREDICTED: tubulin alpha-3 chain-like              179   3e-49   
gb|AGG37290.1|  alpha-tubulin 8                                         179   3e-49   
gb|ABR26150.1|  tubulin alpha-3 chain                                   172   3e-49   
ref|XP_010257632.1|  PREDICTED: tubulin alpha-3 chain                   179   3e-49   
ref|XP_009406530.1|  PREDICTED: tubulin alpha-3 chain-like              179   3e-49   
gb|EYU23006.1|  hypothetical protein MIMGU_mgv1a006283mg                179   3e-49   
ref|XP_006858944.1|  hypothetical protein AMTR_s00068p00090790          179   3e-49   
ref|XP_002285721.1|  PREDICTED: tubulin alpha-3 chain                   179   3e-49   
ref|XP_008351479.1|  PREDICTED: tubulin alpha-3 chain                   179   3e-49   
ref|XP_009389058.1|  PREDICTED: tubulin alpha-3 chain-like              179   3e-49   
ref|XP_002325422.1|  Tubulin alpha-1 chain family protein               179   3e-49   
ref|XP_009400845.1|  PREDICTED: tubulin alpha-3 chain                   179   3e-49   
ref|XP_006445597.1|  hypothetical protein CICLE_v10015224mg             179   3e-49   
ref|XP_010673470.1|  PREDICTED: tubulin alpha-3 chain                   179   3e-49   
gb|KJB83375.1|  hypothetical protein B456_013G244600                    179   3e-49   
ref|XP_004149645.1|  PREDICTED: tubulin alpha-3 chain-like              179   3e-49   
ref|XP_008813089.1|  PREDICTED: tubulin alpha-3 chain                   179   3e-49   
ref|XP_001777081.1|  predicted protein                                  179   3e-49   
gb|KHN46768.1|  Tubulin alpha-3 chain                                   179   3e-49   
gb|AFP44109.1|  tubulin-alpha                                           172   3e-49   
gb|AGD80034.1|  alpha-tubulin 1                                         179   3e-49   
gb|ADD84794.1|  tubulin-like protein                                    171   3e-49   
gb|ABO47735.1|  alpha-tubulin                                           179   4e-49   
ref|XP_008449885.1|  PREDICTED: tubulin alpha-3 chain isoform X1        179   4e-49   
gb|ABO47741.1|  alpha-tubulin                                           179   4e-49   
gb|KCW87067.1|  hypothetical protein EUGRSUZ_B03604                     177   4e-49   
ref|XP_009408459.1|  PREDICTED: tubulin alpha-3 chain-like              179   4e-49   
ref|XP_008449886.1|  PREDICTED: tubulin alpha-3 chain isoform X2        178   4e-49   
ref|XP_001782790.1|  predicted protein                                  179   4e-49   
gb|KJB80786.1|  hypothetical protein B456_013G115100                    178   4e-49   
ref|XP_010934670.1|  PREDICTED: tubulin alpha-3 chain-like              179   4e-49   
emb|CAD24767.1|  alpha-tubulin                                          179   4e-49   
gb|KHG06861.1|  Tubulin alpha-6 chain                                   179   4e-49   
ref|XP_008804327.1|  PREDICTED: tubulin alpha-1 chain-like              178   4e-49   
gb|ABV55994.1|  alpha-tubulin 6                                         178   4e-49   
emb|CBI16534.3|  unnamed protein product                                177   4e-49   
ref|XP_010535935.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    178   5e-49   
gb|ABB16994.1|  unknown                                                 179   5e-49   
gb|AFR42026.1|  alpha-tubulin                                           171   5e-49   
gb|AGO86872.1|  alpha tubulin                                           169   5e-49   
emb|CAK55181.1|  alpha-tubulin 2                                        170   5e-49   
gb|AAP93564.1|  alpha-tubulin                                           171   5e-49   
emb|CAD24768.1|  alpha-tubulin                                          178   5e-49   
gb|AFR42020.1|  alpha-tubulin                                           171   5e-49   
gb|AFR42035.1|  alpha-tubulin                                           171   5e-49   
ref|XP_010276368.1|  PREDICTED: tubulin alpha-3 chain-like              178   5e-49   
gb|AFR42036.1|  alpha-tubulin                                           171   5e-49   
ref|XP_010535933.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    178   6e-49   
emb|CAK55180.1|  alpha-tubulin 1                                        170   6e-49   
ref|XP_010531152.1|  PREDICTED: tubulin alpha-3 chain                   178   6e-49   
gb|ABR25378.1|  tubulin alpha 3 chain                                   171   6e-49   
gb|AFR42049.1|  alpha-tubulin                                           171   6e-49   
emb|CAK55184.1|  alpha-tubulin 5                                        170   6e-49   
ref|XP_010454260.1|  PREDICTED: tubulin alpha-3 chain-like              178   6e-49   
emb|CDY42294.1|  BnaC02g09000D                                          178   6e-49   
ref|NP_197478.1|  tubulin alpha-3                                       178   6e-49   
gb|AAP93569.1|  alpha-tubulin                                           171   6e-49   
emb|CDX88875.1|  BnaA03g07740D                                          178   6e-49   
ref|XP_004504311.1|  PREDICTED: tubulin alpha-3 chain-like              178   6e-49   
ref|XP_003629736.1|  Alpha-tubulin                                      178   6e-49   
gb|AFR42042.1|  alpha-tubulin                                           171   6e-49   
gb|AHZ58481.1|  alpha-tubulin                                           171   7e-49   
gb|AAW57310.1|  alpha-tubulin                                           173   7e-49   
gb|AFR42054.1|  alpha-tubulin                                           171   7e-49   
gb|AGO86913.1|  alpha tubulin                                           169   7e-49   
gb|AAW57309.1|  alpha-tubulin                                           173   7e-49   
gb|AGV54500.1|  tubulin A                                               178   7e-49   
ref|XP_002303998.1|  alpha-tubulin 2 family protein                     178   7e-49   
ref|XP_010044940.1|  PREDICTED: tubulin alpha-3 chain                   178   8e-49   
ref|XP_006286795.1|  hypothetical protein CARUB_v10003470mg             178   8e-49   
gb|AAD55353.1|AF119172_1  alpha-tubulin                                 172   8e-49   
ref|XP_011025144.1|  PREDICTED: tubulin alpha-3 chain                   178   8e-49   
emb|CAA52158.1|  alpha tubulin                                          172   8e-49   
gb|AFR42047.1|  alpha-tubulin                                           171   8e-49   
ref|XP_010112637.1|  Tubulin alpha-3 chain                              177   9e-49   
gb|ABO47738.1|  alpha-tubulin                                           177   9e-49   
gb|AHJ80819.1|  Tua1                                                    172   1e-48   
gb|KCW87065.1|  hypothetical protein EUGRSUZ_B03604                     177   1e-48   
ref|XP_008223650.1|  PREDICTED: tubulin alpha-3 chain-like              177   1e-48   
ref|XP_007205189.1|  hypothetical protein PRUPE_ppa005642mg             177   1e-48   
ref|XP_009622332.1|  PREDICTED: tubulin alpha-3 chain                   177   1e-48   
ref|XP_009126391.1|  PREDICTED: tubulin alpha-3 chain-like              177   1e-48   
ref|XP_009126388.1|  PREDICTED: tubulin alpha-3 chain-like              177   1e-48   
ref|XP_009126389.1|  PREDICTED: tubulin alpha-3 chain-like              177   1e-48   
emb|CDY44941.1|  BnaA02g04460D                                          177   1e-48   
emb|CAB76917.1|  alpha-tubulin 4                                        173   1e-48   
ref|XP_009120857.1|  PREDICTED: tubulin alpha-3 chain                   177   1e-48   
gb|ABR25574.1|  tubulin alpha-3 chain                                   173   1e-48   
gb|AGO86856.1|  alpha tubulin                                           168   1e-48   
ref|XP_006443441.1|  hypothetical protein CICLE_v10020128mg             177   1e-48   
gb|AGG37284.1|  alpha-tubulin 2                                         177   2e-48   
emb|CAJ44872.1|  alpha-tubulin                                          125   2e-48   
ref|XP_006433708.1|  hypothetical protein CICLE_v100015522mg            171   2e-48   
emb|CDP14299.1|  unnamed protein product                                177   2e-48   
emb|CAD24766.1|  alpha-tubulin                                          177   2e-48   
gb|KJB58759.1|  hypothetical protein B456_009G224800                    174   2e-48   
ref|XP_008464962.1|  PREDICTED: tubulin alpha-3 chain-like              177   2e-48   
ref|XP_004141134.1|  PREDICTED: tubulin alpha-3 chain-like              177   2e-48   
gb|AGO86879.1|  alpha tubulin                                           167   2e-48   
ref|XP_003554022.1|  PREDICTED: tubulin alpha-6 chain-like              177   2e-48   
gb|EYU34085.1|  hypothetical protein MIMGU_mgv1a0196712mg               170   2e-48   
gb|AAW57305.1|  alpha-tubulin                                           173   2e-48   
gb|ABD92943.1|  alpha tubulin-1B                                        176   2e-48   
gb|ABO61436.1|  alpha tubulin                                           153   2e-48   
gb|AGO86868.1|  alpha tubulin                                           167   3e-48   
gb|AGO86877.1|  alpha tubulin                                           167   3e-48   
gb|AAX96763.1|  Tubulin/FtsZ family, GTPase domain, putative            174   3e-48   
gb|AIC33057.1|  tubulin alpha-1 chain                                   176   3e-48   
emb|CAB77672.1|  alpha-tubulin                                          176   3e-48   
gb|ETM53002.1|  tubulin alpha chain                                     169   3e-48   
gb|KJB34154.1|  hypothetical protein B456_006G050600                    170   4e-48   
gb|EYU20672.1|  hypothetical protein MIMGU_mgv1a004180mg                177   4e-48   
gb|AGG37286.1|  alpha-tubulin 4                                         176   4e-48   
gb|KEH34574.1|  tubulin alpha-1 chain                                   167   4e-48   
emb|CAD26892.1|  alpha-tubulin                                          176   4e-48   
gb|KDP42087.1|  hypothetical protein JCGZ_01875                         176   4e-48   
gb|AGV54721.1|  tubulin alpha-3 chain-like protein                      176   4e-48   
gb|AHM94148.1|  alpha-tubulin                                           173   4e-48   
gb|AGO86860.1|  alpha tubulin                                           167   4e-48   
ref|XP_011048194.1|  PREDICTED: tubulin alpha-6 chain-like              176   4e-48   
ref|XP_007161955.1|  hypothetical protein PHAVU_001G111700g             176   4e-48   
emb|CAJ38386.1|  alpha tubulin                                          171   5e-48   
ref|XP_010528739.1|  PREDICTED: tubulin alpha-6 chain-like              176   5e-48   
gb|ABH06366.1|  alpha-tubulin                                           171   5e-48   
ref|XP_002297631.1|  alpha-tubulin 2 family protein                     176   5e-48   
gb|AAD11425.1|  alpha tubulin                                           174   5e-48   
ref|XP_004252814.1|  PREDICTED: tubulin alpha-2 chain-like              170   5e-48   
gb|ABR67425.1|  alpha-tubulin 4                                         176   5e-48   
gb|KEH34573.1|  tubulin alpha-1 chain                                   169   5e-48   
emb|CAJ44844.1|  alpha-tubulin                                          122   5e-48   
gb|AAM73995.1|  alpha-tubulin 2                                         114   5e-48   
dbj|BAH97102.1|  alpha tubulin                                          171   6e-48   
gb|KJB32211.1|  hypothetical protein B456_005G229600                    173   6e-48   
ref|XP_003624633.1|  Alpha-tubulin                                      175   6e-48   
ref|XP_734888.1|  alpha-tubulin ii                                      169   6e-48   
gb|KIY91712.1|  Tubulin alpha chain                                     170   7e-48   
ref|XP_004493170.1|  PREDICTED: tubulin alpha-3 chain-like              175   7e-48   
gb|AAP93568.1|  alpha-tubulin                                           168   8e-48   
gb|AFP25243.1|  alpha-tubulin                                           172   8e-48   
ref|XP_002959708.1|  alpha tubulin                                      170   8e-48   
pir||A54506  tubulin alpha-1 chain - Plasmodium yoelii (fragment)       168   8e-48
gb|AGO86871.1|  alpha tubulin                                           166   8e-48   
gb|AFP25242.1|  alpha-tubulin                                           172   8e-48   
ref|XP_011078787.1|  PREDICTED: tubulin alpha-1 chain-like              175   8e-48   
gb|KDO25258.1|  hypothetical protein SPRG_09506                         168   9e-48   
gb|AGO86889.1|  alpha tubulin                                           166   9e-48   
gb|AGO86857.1|  alpha tubulin                                           166   1e-47   
gb|AFP25260.1|  alpha-tubulin                                           172   1e-47   
ref|XP_007014666.1|  Tubulin alpha-5                                    175   1e-47   
gb|AFW67749.1|  alpha tubulin4                                          172   1e-47   
gb|KHG19627.1|  Tubulin alpha-3/alpha-5 chain -like protein             175   1e-47   
gb|AGO86894.1|  alpha tubulin                                           166   1e-47   
ref|XP_010693818.1|  PREDICTED: tubulin alpha-3 chain-like              175   1e-47   
gb|ADJ00012.1|  tubulin alpha chain                                     169   1e-47   
gb|AGV54497.1|  tubulin alpha-3 chain-like protein                      174   1e-47   
gb|AGO86855.1|  alpha tubulin                                           166   1e-47   
ref|XP_002281667.1|  PREDICTED: tubulin alpha-3 chain                   174   1e-47   
emb|CBH08953.1|  alpha tubulin, (fragment)                              167   1e-47   
gb|AGO86853.1|  alpha tubulin                                           166   1e-47   
gb|AGO86865.1|  alpha tubulin                                           166   1e-47   
dbj|BAG99724.1|  unnamed protein product                                174   1e-47   
gb|ADK26608.1|  alpha-tubulin                                           172   1e-47   
emb|CAB77671.1|  alpha-tubulin                                          174   1e-47   
gb|ABF98641.1|  Tubulin alpha-1 chain, putative, expressed              174   1e-47   
gb|AFP25256.1|  alpha-tubulin                                           171   2e-47   
gb|AFP25213.1|  alpha-tubulin                                           172   2e-47   
gb|AEO92378.1|  alpha-tubulin                                           172   2e-47   
gb|EKF29047.1|  epsilon tubulin, putative                               169   2e-47   
gb|ABO61400.1|  alpha tubulin                                           170   2e-47   
gb|AHM93474.1|  alpha-tubulin                                           171   2e-47   
gb|AGO86859.1|  alpha tubulin                                           165   2e-47   
gb|AFP25238.1|  alpha-tubulin                                           171   2e-47   
ref|XP_010414865.1|  PREDICTED: tubulin alpha-1 chain                   174   2e-47   
gb|AAW57306.1|  alpha-tubulin                                           169   2e-47   
gb|AGO86887.1|  alpha tubulin                                           165   2e-47   
gb|AAO63773.2|  alpha-tubulin 2                                         174   2e-47   
gb|AAL33706.1|  alpha-tubulin                                           172   2e-47   
gb|AFP25261.1|  alpha-tubulin                                           172   2e-47   
emb|CAJ44851.1|  alpha-tubulin                                          117   2e-47   
gb|AHM94154.1|  alpha-tubulin                                           172   2e-47   
gb|AFO69620.1|  alpha-tubulin                                           171   2e-47   
gb|AFP25212.1|  alpha-tubulin                                           172   2e-47   
gb|AHM94150.1|  alpha-tubulin                                           172   2e-47   
gb|AFP25239.1|  alpha-tubulin                                           171   2e-47   
gb|AFP25259.1|  alpha-tubulin                                           171   2e-47   
gb|KFV38875.1|  Tubulin alpha-1 chain                                   152   2e-47   
gb|AFW67748.1|  alpha tubulin4                                          172   2e-47   
gb|ABE01246.1|  alpha tubulin                                           174   2e-47   
gb|KFV43983.1|  Tubulin alpha chain, testis-specific                    152   2e-47   
gb|AAL33688.1|  alpha-tubulin                                           172   2e-47   
gb|ETM53018.1|  tubulin alpha chain                                     169   2e-47   
gb|AHM94149.1|  alpha-tubulin                                           172   2e-47   
gb|KFP05172.1|  Tubulin alpha-1 chain                                   152   2e-47   
ref|XP_006728334.1|  PREDICTED: LOW QUALITY PROTEIN: tubulin alph...    113   2e-47   
gb|ACL53551.1|  unknown                                                 167   2e-47   
gb|AAP32191.1|  alpha-tubulin                                           172   2e-47   
gb|AFO69619.1|  alpha-tubulin                                           171   2e-47   



>gb|AAT09064.1| alpha tubulin 2 [Bigelowiella natans]
Length=453

 Score =   166 bits (421),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 74/83 (89%), Positives = 79/83 (95%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQLSV EIT++ FEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT
Sbjct  278  AEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  337

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            +RT+QFVDW PTGFKCGINYQPP
Sbjct  338  QRTLQFVDWSPTGFKCGINYQPP  360


 Score =   158 bits (399),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 72/81 (89%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
              G+   PPTVVPGGDLAKVQRAVCMISN+TA+AEVFSRIDHKFDLMY+KRAFVHWYVGE
Sbjct  352  KCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRIDHKFDLMYAKRAFVHWYVGE  411

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GMEEGEFSEAREDLAALEKDY
Sbjct  412  GMEEGEFSEAREDLAALEKDY  432



>gb|ABL61203.1| alpha-tubulin [Oxymonadida environmental sample]
Length=299

 Score =   168 bits (425),  Expect(2) = 7e-79, Method: Compositional matrix adjust.
 Identities = 73/83 (88%), Positives = 80/83 (96%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQLSV EIT++ FEP++MMAKCDPRHGKYMACC+MYRGDVVPKDVNAAVATIKT
Sbjct  126  AEKAYHEQLSVAEITNSSFEPANMMAKCDPRHGKYMACCMMYRGDVVPKDVNAAVATIKT  185

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            +RT+QFVDWCPTGFKCGINYQPP
Sbjct  186  QRTIQFVDWCPTGFKCGINYQPP  208


 Score =   154 bits (388),  Expect(2) = 7e-79, Method: Compositional matrix adjust.
 Identities = 70/79 (89%), Positives = 75/79 (95%), Gaps = 0/79 (0%)
 Frame = -1

Query  526  GLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGM  347
            G+   PPTVVPGGDLAKVQRAVCMISN+TA+AEVFSRID KFDL+Y+KRAFVHWYVGEGM
Sbjct  202  GINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRIDRKFDLVYAKRAFVHWYVGEGM  261

Query  346  EEGEFSEAREDLAALEKDY  290
            EEGEFSEAREDLAALEKDY
Sbjct  262  EEGEFSEAREDLAALEKDY  280



>gb|ABE68666.1| alpha tubulin [Trypanosoma cyclops]
Length=451

 Score =   162 bits (411),  Expect(2) = 4e-78, Method: Compositional matrix adjust.
 Identities = 73/83 (88%), Positives = 77/83 (93%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQLSV EI++AVFEP+SMM KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT
Sbjct  278  AEKAYHEQLSVSEISNAVFEPASMMTKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  337

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
             RT+QFVDW PTGFK GINYQPP
Sbjct  338  XRTIQFVDWSPTGFKWGINYQPP  360


 Score =   157 bits (396),  Expect(2) = 4e-78, Method: Compositional matrix adjust.
 Identities = 71/79 (90%), Positives = 76/79 (96%), Gaps = 0/79 (0%)
 Frame = -1

Query  526  GLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGM  347
            G+   PPTVVPGGDLAKVQRAVCMI+N+TA+AEVF+RIDHKFDLMYSKRAFVHWYVGEGM
Sbjct  354  GINYQPPTVVPGGDLAKVQRAVCMIANSTAIAEVFARIDHKFDLMYSKRAFVHWYVGEGM  413

Query  346  EEGEFSEAREDLAALEKDY  290
            EEGEFSEAREDLAALEKDY
Sbjct  414  EEGEFSEAREDLAALEKDY  432



>gb|KHG25610.1| Tubulin alpha-3/alpha-5 chain -like protein [Gossypium arboreum]
Length=450

 Score =   164 bits (415),  Expect(2) = 4e-78, Method: Compositional matrix adjust.
 Identities = 73/82 (89%), Positives = 75/82 (91%), Gaps = 0/82 (0%)
 Frame = -3

Query  752  AKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTK  573
            AKAYHE LSV +ITS VFEP SMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAV  IKT+
Sbjct  279  AKAYHENLSVAQITSGVFEPGSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVRNIKTR  338

Query  572  RTVQFVDWCPTGFKCGINYQPP  507
            R VQFVDWCPTGFKCGINYQPP
Sbjct  339  RAVQFVDWCPTGFKCGINYQPP  360


 Score =   155 bits (391),  Expect(2) = 4e-78, Method: Compositional matrix adjust.
 Identities = 70/79 (89%), Positives = 76/79 (96%), Gaps = 0/79 (0%)
 Frame = -1

Query  526  GLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGM  347
            G+   PPTVVPGGDLA+V+RAVCMISNNTAVAEVF+RIDHKFDLMY+KRAFVHWY+GEGM
Sbjct  354  GINYQPPTVVPGGDLAEVRRAVCMISNNTAVAEVFARIDHKFDLMYAKRAFVHWYIGEGM  413

Query  346  EEGEFSEAREDLAALEKDY  290
            EEGEFSEAREDLAALEKDY
Sbjct  414  EEGEFSEAREDLAALEKDY  432



>gb|KJB46051.1| hypothetical protein B456_007G346000 [Gossypium raimondii]
Length=376

 Score =   163 bits (412),  Expect(2) = 2e-77, Method: Compositional matrix adjust.
 Identities = 72/82 (88%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = -3

Query  752  AKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTK  573
            AKAYHE LSV +IT  VFEP SMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAV  IKT+
Sbjct  205  AKAYHENLSVAQITGGVFEPGSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVRNIKTR  264

Query  572  RTVQFVDWCPTGFKCGINYQPP  507
            R VQFVDWCPTGFKCGINYQPP
Sbjct  265  RAVQFVDWCPTGFKCGINYQPP  286


 Score =   154 bits (389),  Expect(2) = 2e-77, Method: Compositional matrix adjust.
 Identities = 69/79 (87%), Positives = 76/79 (96%), Gaps = 0/79 (0%)
 Frame = -1

Query  526  GLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGM  347
            G+   PPTVVPGGDLA+V+RAVCMISNNTAVAEVF+RIDHKFDLMY+KRAFVHWY+GEGM
Sbjct  280  GINYQPPTVVPGGDLAEVRRAVCMISNNTAVAEVFARIDHKFDLMYAKRAFVHWYIGEGM  339

Query  346  EEGEFSEAREDLAALEKDY  290
            EEGEFSEAREDL+ALEKDY
Sbjct  340  EEGEFSEAREDLSALEKDY  358



>gb|KJB46050.1| hypothetical protein B456_007G346000 [Gossypium raimondii]
Length=450

 Score =   162 bits (411),  Expect(2) = 3e-77, Method: Compositional matrix adjust.
 Identities = 72/82 (88%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = -3

Query  752  AKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTK  573
            AKAYHE LSV +IT  VFEP SMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAV  IKT+
Sbjct  279  AKAYHENLSVAQITGGVFEPGSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVRNIKTR  338

Query  572  RTVQFVDWCPTGFKCGINYQPP  507
            R VQFVDWCPTGFKCGINYQPP
Sbjct  339  RAVQFVDWCPTGFKCGINYQPP  360


 Score =   154 bits (388),  Expect(2) = 3e-77, Method: Compositional matrix adjust.
 Identities = 69/79 (87%), Positives = 76/79 (96%), Gaps = 0/79 (0%)
 Frame = -1

Query  526  GLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGM  347
            G+   PPTVVPGGDLA+V+RAVCMISNNTAVAEVF+RIDHKFDLMY+KRAFVHWY+GEGM
Sbjct  354  GINYQPPTVVPGGDLAEVRRAVCMISNNTAVAEVFARIDHKFDLMYAKRAFVHWYIGEGM  413

Query  346  EEGEFSEAREDLAALEKDY  290
            EEGEFSEAREDL+ALEKDY
Sbjct  414  EEGEFSEAREDLSALEKDY  432



>gb|AES75164.2| tubulin beta-1 chain [Medicago truncatula]
Length=448

 Score =   163 bits (412),  Expect(2) = 4e-77, Method: Compositional matrix adjust.
 Identities = 71/83 (86%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            + K YHEQLSVPEIT AVFEPSSMM KCDPRHGKYMACCLMYRGD+VPKDVN AV+ IK 
Sbjct  279  SVKVYHEQLSVPEITRAVFEPSSMMVKCDPRHGKYMACCLMYRGDIVPKDVNVAVSHIKK  338

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
             RTVQFVDWCPTGFKCGIN+QPP
Sbjct  339  MRTVQFVDWCPTGFKCGINFQPP  361


 Score =   153 bits (386),  Expect(2) = 4e-77, Method: Compositional matrix adjust.
 Identities = 70/79 (89%), Positives = 75/79 (95%), Gaps = 0/79 (0%)
 Frame = -1

Query  526  GLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGM  347
            G+   PPTVVPGGDLA+V+RAVCMISNNTAV+EVFSRIDHKFDLMY+KRAFVHWYV EGM
Sbjct  355  GINFQPPTVVPGGDLAEVRRAVCMISNNTAVSEVFSRIDHKFDLMYAKRAFVHWYVSEGM  414

Query  346  EEGEFSEAREDLAALEKDY  290
            EEGEFSEAREDLAALEKDY
Sbjct  415  EEGEFSEAREDLAALEKDY  433



>tpg|DAA32343.1| TPA: tubulin alpha-1C chain-like [Bos taurus]
Length=449

 Score =   160 bits (404),  Expect(2) = 1e-75, Method: Compositional matrix adjust.
 Identities = 70/83 (84%), Positives = 77/83 (93%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQLSV EIT+A FEP++ M KCDPRHGKYMACCL+YRGDVVPKDVNAA+ATIKT
Sbjct  278  AEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKT  337

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            +RT+QFVDWCPTGFK GINYQPP
Sbjct  338  ERTIQFVDWCPTGFKVGINYQPP  360


 Score =   151 bits (382),  Expect(2) = 1e-75, Method: Compositional matrix adjust.
 Identities = 68/81 (84%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+   PPTVVPGGDLAKVQRAVCM+SN TAVAE ++R+DHKFDLMY+KRAFVHWYVGE
Sbjct  352  KVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAVAEAWARLDHKFDLMYAKRAFVHWYVGE  411

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GMEEGEFSEARED+AALEKDY
Sbjct  412  GMEEGEFSEAREDMAALEKDY  432



>ref|XP_008183459.1| PREDICTED: tubulin alpha-1 chain-like [Acyrthosiphon pisum]
Length=283

 Score =   157 bits (397),  Expect(2) = 3e-75, Method: Compositional matrix adjust.
 Identities = 69/83 (83%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQLSV EIT+A FEP++ M KCDPRHGKYMACC++YRGDVVPKDVNAA+ATIKT
Sbjct  110  AEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKT  169

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            KRT+ FVDWCPTGFK GINYQPP
Sbjct  170  KRTIVFVDWCPTGFKVGINYQPP  192


 Score =   152 bits (384),  Expect(2) = 3e-75, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            VG+   PPTVVPGGDLAKVQRAVCM+SN TA+AE ++R+DHKFDLMY+KRAFVHWYVGEG
Sbjct  185  VGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG  244

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEEGEFSEAREDLAALEKDY
Sbjct  245  MEEGEFSEAREDLAALEKDY  264



>ref|XP_005680058.1| PREDICTED: tubulin alpha-1C chain [Capra hircus]
Length=449

 Score =   158 bits (399),  Expect(2) = 4e-75, Method: Compositional matrix adjust.
 Identities = 69/83 (83%), Positives = 77/83 (93%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQLSV EIT+A FEP++ M KCDPRHGKYMACCL+YRGDVVPKDVNAA+ATIKT
Sbjct  278  AEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKT  337

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            KR+++FVDWCPTGFK GINYQPP
Sbjct  338  KRSIRFVDWCPTGFKVGINYQPP  360


 Score =   151 bits (381),  Expect(2) = 4e-75, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+   PPTVVPGGDLAKVQRAVCM+SN TA+AE ++R+DHKFDLMY+KRAFVHWYVGE
Sbjct  352  KVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGE  411

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GMEEGEFSEARED+AALEKDY
Sbjct  412  GMEEGEFSEAREDMAALEKDY  432



>ref|XP_001947108.2| PREDICTED: tubulin alpha-1 chain-like isoform X1 [Acyrthosiphon 
pisum]
 ref|XP_003244769.1| PREDICTED: tubulin alpha-1 chain-like isoform X2 [Acyrthosiphon 
pisum]
Length=451

 Score =   157 bits (397),  Expect(2) = 4e-75, Method: Compositional matrix adjust.
 Identities = 69/83 (83%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQLSV EIT+A FEP++ M KCDPRHGKYMACC++YRGDVVPKDVNAA+ATIKT
Sbjct  278  AEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKT  337

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            KRT+ FVDWCPTGFK GINYQPP
Sbjct  338  KRTIVFVDWCPTGFKVGINYQPP  360


 Score =   152 bits (383),  Expect(2) = 4e-75, Method: Compositional matrix adjust.
 Identities = 68/81 (84%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+   PPTVVPGGDLAKVQRAVCM+SN TA+AE ++R+DHKFDLMY+KRAFVHWYVGE
Sbjct  352  KVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGE  411

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GMEEGEFSEAREDLAALEKDY
Sbjct  412  GMEEGEFSEAREDLAALEKDY  432



>emb|CDQ68041.1| unnamed protein product [Oncorhynchus mykiss]
Length=435

 Score =   157 bits (397),  Expect(2) = 6e-75, Method: Compositional matrix adjust.
 Identities = 67/83 (81%), Positives = 77/83 (93%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A +AYHEQLSVPEIT+A FEP++ M KCDPRHGKYMACCL+YRGDVVPKDVNAA+A IKT
Sbjct  263  AERAYHEQLSVPEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIAHIKT  322

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            ++++QFVDWCPTGFK GINYQPP
Sbjct  323  RKSIQFVDWCPTGFKVGINYQPP  345


 Score =   151 bits (382),  Expect(2) = 6e-75, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+   PPTVVPGGDLAKVQRAVCM+SN TA+AE +SR+DHKFDLMY++RAFVHWYVGE
Sbjct  337  KVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWSRLDHKFDLMYARRAFVHWYVGE  396

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GMEEGEFSEARED+AALEKDY
Sbjct  397  GMEEGEFSEAREDMAALEKDY  417



>ref|XP_008580941.1| PREDICTED: tubulin alpha-1C chain [Galeopterus variegatus]
Length=449

 Score =   157 bits (396),  Expect(2) = 8e-75, Method: Compositional matrix adjust.
 Identities = 69/83 (83%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQLSV EIT+A FEP++ M KCDPRHGKYMACCL+YRGDVVPKDVNAA+ATIKT
Sbjct  278  AEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKT  337

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            K ++QFVDWCPTGFK GINYQPP
Sbjct  338  KHSLQFVDWCPTGFKVGINYQPP  360


 Score =   151 bits (382),  Expect(2) = 8e-75, Method: Compositional matrix adjust.
 Identities = 68/81 (84%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+   PPTVVPGGDLAKVQRAVCM+SN TAVAE ++R+DHKFDLMY+KRAFVHWYVGE
Sbjct  352  KVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAVAEAWARLDHKFDLMYAKRAFVHWYVGE  411

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GMEEGEFSEARED+AALEKDY
Sbjct  412  GMEEGEFSEAREDMAALEKDY  432



>ref|XP_009692736.1| tubulin subunit alpha [Theileria orientalis strain Shintoku]
 dbj|BAM42435.1| tubulin subunit alpha [Theileria orientalis strain Shintoku]
Length=442

 Score =   155 bits (391),  Expect(2) = 2e-74, Method: Compositional matrix adjust.
 Identities = 67/83 (81%), Positives = 77/83 (93%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A+KAYHEQLSV EIT++ FEP +MMAKCDPRHGKYMA C++YRGDVVPKDVNAAVA IKT
Sbjct  277  ASKAYHEQLSVAEITNSAFEPHNMMAKCDPRHGKYMASCILYRGDVVPKDVNAAVAGIKT  336

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            K++++FVDWCPTGFK GINYQPP
Sbjct  337  KKSIRFVDWCPTGFKVGINYQPP  359


 Score =   152 bits (385),  Expect(2) = 2e-74, Method: Compositional matrix adjust.
 Identities = 70/80 (88%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            VG+   PPTVVPGGDLAKV RAVCMISN+TA+AEVFSR+++KFDLMYSKRAFVHWYVGEG
Sbjct  352  VGINYQPPTVVPGGDLAKVARAVCMISNSTAIAEVFSRMNYKFDLMYSKRAFVHWYVGEG  411

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEEGEFSEAREDLAALEKDY
Sbjct  412  MEEGEFSEAREDLAALEKDY  431



>ref|XP_001712353.1| tubA [Hemiselmis andersenii]
 gb|ABW98028.1| tubA [Hemiselmis andersenii]
Length=447

 Score =   159 bits (401),  Expect(2) = 2e-74, Method: Compositional matrix adjust.
 Identities = 68/83 (82%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            + KA+HEQLSV EIT++ FEP+SMMAKCDPRHGKYMACCLMYRGDV PKDVN AVA IKT
Sbjct  278  SEKAFHEQLSVSEITNSAFEPTSMMAKCDPRHGKYMACCLMYRGDVAPKDVNGAVAAIKT  337

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            K+ +QFVDWCPTGFKCGINYQ P
Sbjct  338  KKEIQFVDWCPTGFKCGINYQAP  360


 Score =   148 bits (374),  Expect(2) = 2e-74, Method: Compositional matrix adjust.
 Identities = 67/79 (85%), Positives = 73/79 (92%), Gaps = 0/79 (0%)
 Frame = -1

Query  526  GLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGM  347
            G+    PTVVPGGDLAKVQRAVCMISNNT ++EVFSRI+ KFDLMYSKRAFVHWYVGEGM
Sbjct  354  GINYQAPTVVPGGDLAKVQRAVCMISNNTGISEVFSRINKKFDLMYSKRAFVHWYVGEGM  413

Query  346  EEGEFSEAREDLAALEKDY  290
            EEGEF+EAREDLAALE+DY
Sbjct  414  EEGEFNEAREDLAALERDY  432



>emb|CAD26889.1| alpha-tubulin [Miscanthus transmorrisonensis]
Length=438

 Score =   156 bits (395),  Expect(2) = 6e-74, Method: Compositional matrix adjust.
 Identities = 72/74 (97%), Positives = 74/74 (100%), Gaps = 0/74 (0%)
 Frame = -1

Query  511  PPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEF  332
            PP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMY+KRAFVHWYVGEGMEEGEF
Sbjct  347  PPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEF  406

Query  331  SEAREDLAALEKDY  290
            SEAREDLAALEKDY
Sbjct  407  SEAREDLAALEKDY  420


 Score =   149 bits (375),  Expect(2) = 6e-74, Method: Compositional matrix adjust.
 Identities = 69/72 (96%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT
Sbjct  278  AEKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  337

Query  575  KRTVQFVDWCPT  540
            KRTVQFVDW P+
Sbjct  338  KRTVQFVDWPPS  349



>ref|NP_001291079.1| tubulin alpha chain [Esox lucius]
 gb|ACO14042.1| Tubulin alpha chain [Esox lucius]
Length=450

 Score =   152 bits (385),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQLSV +IT+A FEP++ M KCDPRHGKYMACCL+YRGDVVPKDVN+A+A IKT
Sbjct  278  AEKAYHEQLSVADITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNSAIAAIKT  337

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
             R++QFVDWCPTGFK GINYQPP
Sbjct  338  IRSIQFVDWCPTGFKVGINYQPP  360


 Score =   151 bits (381),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+   PPTVVPGGDLAKVQRAVCM+SN TA+AE ++R+DHKFDLMY+KRAFVHWYVGE
Sbjct  352  KVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGE  411

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GMEEGEFSEARED+AALEKDY
Sbjct  412  GMEEGEFSEAREDMAALEKDY  432



>ref|XP_004718096.1| PREDICTED: LOW QUALITY PROTEIN: tubulin, alpha 1c [Echinops telfairi]
Length=477

 Score =   151 bits (382),  Expect(2) = 5e-73, Method: Compositional matrix adjust.
 Identities = 68/81 (84%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+   PPTVVPGGDLAKVQRAVCM+SN TAVAE ++R+DHKFDLMY+KRAFVHWYVGE
Sbjct  380  KVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAVAEAWARLDHKFDLMYAKRAFVHWYVGE  439

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GMEEGEFSEARED+AALEKDY
Sbjct  440  GMEEGEFSEAREDMAALEKDY  460


 Score =   151 bits (381),  Expect(2) = 5e-73, Method: Compositional matrix adjust.
 Identities = 67/83 (81%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQL+V EIT+A FEP++ M KCDPRHGKYMACCL+Y GDVVPKDVNAA+ATIKT
Sbjct  306  AEKAYHEQLTVAEITNACFEPANQMVKCDPRHGKYMACCLLYCGDVVPKDVNAAIATIKT  365

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            K ++QFVDWCPTGFK GINYQPP
Sbjct  366  KGSIQFVDWCPTGFKVGINYQPP  388



>ref|XP_002613005.1| hypothetical protein BRAFLDRAFT_58199 [Branchiostoma floridae]
 gb|EEN69014.1| hypothetical protein BRAFLDRAFT_58199 [Branchiostoma floridae]
Length=450

 Score =   152 bits (383),  Expect(2) = 6e-73, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A +AYHEQL V EIT+A FEP + M KCDPRHGKYMACCL+YRGDVVPK+VN A+A IKT
Sbjct  278  AERAYHEQLEVGEITAACFEPGNQMVKCDPRHGKYMACCLLYRGDVVPKNVNTAIARIKT  337

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            +RT+QFVDWCPTGFK GINYQPP
Sbjct  338  QRTIQFVDWCPTGFKVGINYQPP  360


 Score =   150 bits (379),  Expect(2) = 6e-73, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            VG+   PPTVVPGGDLAKVQRAVCM+SN TA+AE ++R+DHKFDLMY+KRAFVHW+VGEG
Sbjct  353  VGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWFVGEG  412

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEEGEFSEAREDLAALEKDY
Sbjct  413  MEEGEFSEAREDLAALEKDY  432



>ref|XP_002735588.1| PREDICTED: tubulin alpha-1D chain-like [Saccoglossus kowalevskii]
Length=453

 Score =   152 bits (383),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            +G+   PPTVVPGGDLAKVQRAVCM+SN TAVAE ++R+DHKFDLMY+KRAFVHWYVGEG
Sbjct  354  IGINYQPPTVVPGGDLAKVQRAVCMLSNTTAVAEAWARLDHKFDLMYAKRAFVHWYVGEG  413

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEEGEFSEAREDLAALEKDY
Sbjct  414  MEEGEFSEAREDLAALEKDY  433


 Score =   149 bits (377),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            + KAYHE LSV EIT+A FEP++ M KCDPRHGKYM+CCL++RGDV PKD NAA+A+IKT
Sbjct  279  SEKAYHESLSVAEITNACFEPANQMVKCDPRHGKYMSCCLLFRGDVTPKDTNAAIASIKT  338

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            KRT+ FVDWCPTGFK GINYQPP
Sbjct  339  KRTIHFVDWCPTGFKIGINYQPP  361



>gb|EHH21696.1| hypothetical protein EGK_04820, partial [Macaca mulatta]
Length=448

 Score =   153 bits (386),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 68/83 (82%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQLSV EIT+A FEP++ M KCDPRHGKYMACCL+YRGDVVPKDVNAA+A IKT
Sbjct  278  AEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIAAIKT  337

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            KR++Q VDWCPTGFK GINYQPP
Sbjct  338  KRSIQCVDWCPTGFKVGINYQPP  360


 Score =   148 bits (373),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+   PPTVVPGGDLAKVQRAVCM+SN TA+AE ++R+DHK DLMY+KRAFVHWYVGE
Sbjct  352  KVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKCDLMYAKRAFVHWYVGE  411

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GMEEGEFSEARED+AALEKDY
Sbjct  412  GMEEGEFSEAREDMAALEKDY  432



>ref|XP_010891518.1| PREDICTED: tubulin alpha chain-like [Esox lucius]
Length=448

 Score =   152 bits (385),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 68/81 (84%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+   PPTVVPGGDLAKVQRAVCM+SN TA+AE +SR+DHKFDLMY+KRAFVHWYVGE
Sbjct  352  KVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWSRLDHKFDLMYAKRAFVHWYVGE  411

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GMEEGEFSEARED+AALEKDY
Sbjct  412  GMEEGEFSEAREDMAALEKDY  432


 Score =   148 bits (374),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A +AYHEQLSVPEIT+A FE ++ M KCDPR GKYMACCL+YRGDVVPKDVNAA+A IKT
Sbjct  278  AERAYHEQLSVPEITNACFETANQMVKCDPRRGKYMACCLLYRGDVVPKDVNAAIAHIKT  337

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
             +++QFVDWCPTGFK GINYQPP
Sbjct  338  CKSIQFVDWCPTGFKVGINYQPP  360



>gb|AAK94059.1|AF401481_1 pi-tubulin [Helianthus annuus]
Length=441

 Score =   154 bits (390),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            +++AYHE  SVPEIT+AVF+PS+MMAKCDPR GKYMACCLMYRGD+ PKDVN +V +IKT
Sbjct  274  SSRAYHELNSVPEITNAVFDPSNMMAKCDPRKGKYMACCLMYRGDIAPKDVNTSVGSIKT  333

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            K+TVQFVDWCPTGFKCGINYQ P
Sbjct  334  KKTVQFVDWCPTGFKCGINYQAP  356


 Score =   146 bits (369),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
             G+    PT VPGGDLAKV+RAVCMISNNTAV+EVFSRIDHKFD M++KRAFVHWY+GEG
Sbjct  349  CGINYQAPTFVPGGDLAKVKRAVCMISNNTAVSEVFSRIDHKFDTMFAKRAFVHWYLGEG  408

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEEGEF+EAREDLAALEKDY
Sbjct  409  MEEGEFTEAREDLAALEKDY  428



>emb|CCF76062.1| unnamed protein product [Babesia microti strain RI]
Length=452

 Score =   157 bits (397),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 67/83 (81%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A +A+HEQLSV EIT+  FEP++MM KCDPR+GKYMACCLMYRGDVVPKDVNAAVATIKT
Sbjct  278  AERAFHEQLSVAEITNWAFEPNNMMVKCDPRNGKYMACCLMYRGDVVPKDVNAAVATIKT  337

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            +++++FVDWCPTGFKCGINYQPP
Sbjct  338  RKSIKFVDWCPTGFKCGINYQPP  360


 Score =   143 bits (360),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
             G+   PPTVVPGG+LAKV RAVCMISN+TA++EVFSR++ KFDLMYSKRAFVHWYVGEG
Sbjct  353  CGINYQPPTVVPGGNLAKVMRAVCMISNSTAISEVFSRMNKKFDLMYSKRAFVHWYVGEG  412

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEEGEF+EAREDLA LE DY
Sbjct  413  MEEGEFNEAREDLATLENDY  432



>ref|XP_005399002.1| PREDICTED: tubulin alpha-1C chain-like [Chinchilla lanigera]
Length=414

 Score =   153 bits (386),  Expect(2) = 3e-72, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQ S+ E+T+A FEP++ M KCDPRHGKYMACCL+YRGDVVPKDVNAA+ATIK 
Sbjct  243  AEKAYHEQFSIAEMTNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKA  302

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            KR++ FVDWCPTGFK GINYQPP
Sbjct  303  KRSIHFVDWCPTGFKVGINYQPP  325


 Score =   146 bits (369),  Expect(2) = 3e-72, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+   PPTVVPGGDLAKVQRA C++SN TA+AE + R++HKFDLMY+KRAFVHWYVGE
Sbjct  317  KVGINYQPPTVVPGGDLAKVQRAACLLSNTTAIAEAWGRLNHKFDLMYAKRAFVHWYVGE  376

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GMEEGEFSEAREDLAALEKDY
Sbjct  377  GMEEGEFSEAREDLAALEKDY  397



>gb|EPQ12942.1| Tubulin alpha-1C chain [Myotis brandtii]
Length=270

 Score =   151 bits (382),  Expect(2) = 5e-72, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            VG+   PPTVVPGGDLAKVQRAVCM+SN TA+AE ++R+DHKFDLMY+KRAFVHWYVGEG
Sbjct  151  VGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG  210

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEEGEFSEARED+AALEKDY
Sbjct  211  MEEGEFSEAREDMAALEKDY  230


 Score =   147 bits (372),  Expect(2) = 5e-72, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            AAKAYHEQL+V EI++A FEP++ M K DP HGKYMACCL+YRGDVVPKDVNAA+ATIKT
Sbjct  76   AAKAYHEQLTVAEISNACFEPANQMVKWDPCHGKYMACCLLYRGDVVPKDVNAAIATIKT  135

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            K ++QFVDWCPTGFK GINYQPP
Sbjct  136  KHSIQFVDWCPTGFKVGINYQPP  158



>ref|XP_002735587.1| PREDICTED: tubulin alpha-1B chain-like [Saccoglossus kowalevskii]
Length=452

 Score =   152 bits (383),  Expect(2) = 7e-72, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            +G+   PPTVVPGGDLAKVQRAVCM+SN+TA+AE ++R+DHKFDLMY+KRAFVHWYVGEG
Sbjct  354  IGINYQPPTVVPGGDLAKVQRAVCMLSNSTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG  413

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEEGEFSEAREDLAALEKDY
Sbjct  414  MEEGEFSEAREDLAALEKDY  433


 Score =   147 bits (370),  Expect(2) = 7e-72, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            + KAYHE LSV EIT+A FEP++ M KCDPRHGKYM+CCL++RGDV PKD NAA+A IKT
Sbjct  279  SEKAYHESLSVAEITNACFEPANQMVKCDPRHGKYMSCCLLFRGDVTPKDTNAAIANIKT  338

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            KR + FVDWCPTGFK GINYQPP
Sbjct  339  KRMIHFVDWCPTGFKIGINYQPP  361



>ref|XP_003963615.1| PREDICTED: tubulin alpha-1C chain-like [Takifugu rubripes]
Length=462

 Score =   151 bits (381),  Expect(2) = 9e-72, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            VG+   PPTVVPGGDLAKVQRAVCM+SN TA+AE ++R+DHKFDLMY+KRAFVHWYVGEG
Sbjct  366  VGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG  425

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEEGEFSEARED+AALEKDY
Sbjct  426  MEEGEFSEAREDMAALEKDY  445


 Score =   147 bits (371),  Expect(2) = 9e-72, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQL+V EITSA FEP++ M KCDPR GKYMACC++YRGDV PKDVNAA+A +KT
Sbjct  291  AEKAYHEQLTVTEITSACFEPTNQMVKCDPRRGKYMACCMLYRGDVTPKDVNAAIANVKT  350

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            + +VQFVDWCPTGFK GINYQPP
Sbjct  351  RCSVQFVDWCPTGFKVGINYQPP  373



>ref|XP_005622233.1| PREDICTED: tubulin alpha chain-like [Canis lupus familiaris]
Length=470

 Score =   151 bits (382),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQLSV EIT+A FE S+ M KCDPRHGKYMACC++Y+G+VVPKDVNAA+ATIKT
Sbjct  299  AEKAYHEQLSVAEITNACFESSNHMVKCDPRHGKYMACCMLYQGEVVPKDVNAAIATIKT  358

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            K ++QFVDWCPTGFK GINYQPP
Sbjct  359  KHSIQFVDWCPTGFKVGINYQPP  381


 Score =   146 bits (369),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            VG+   PPTVVPGGDLAKVQ+AVCM+SN TA+AE ++R++HKFDLMY+KRAFVHWYVGEG
Sbjct  374  VGINYQPPTVVPGGDLAKVQQAVCMLSNTTAIAEAWARLNHKFDLMYAKRAFVHWYVGEG  433

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEEGEF EAREDLAALEKDY
Sbjct  434  MEEGEFLEAREDLAALEKDY  453



>ref|XP_001713198.1| tubulin alpha-1 chain [Guillardia theta]
 sp|Q9SCC8.1|TBAN_GUITH RecName: Full=Tubulin alpha chain, nucleomorph; AltName: Full=Nucleomorph 
alpha-tubulin [Guillardia theta]
 emb|CAB40411.1| tubulin alpha-1 chain [Guillardia theta]
Length=448

 Score =   151 bits (381),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = -3

Query  746  AYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRT  567
            A HEQ S  EIT+A FEP+SMMAKCDPR GKYMACCLM+RGDV PKDVN +VA IKTK+T
Sbjct  281  ANHEQYSTAEITNAAFEPNSMMAKCDPRRGKYMACCLMFRGDVAPKDVNGSVAAIKTKKT  340

Query  566  VQFVDWCPTGFKCGINYQPP  507
            +QFVDWCPTGFKCGINYQPP
Sbjct  341  IQFVDWCPTGFKCGINYQPP  360


 Score =   146 bits (368),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
             G+   PPTVVP GDLAKV RAVCMISN+TA++EVFSRI+ KFDLMYSKRAFVHWYVGEG
Sbjct  353  CGINYQPPTVVPDGDLAKVDRAVCMISNSTAISEVFSRINKKFDLMYSKRAFVHWYVGEG  412

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEEGEF+EARED+AALEKDY
Sbjct  413  MEEGEFNEAREDMAALEKDY  432



>ref|XP_003474749.2| PREDICTED: tubulin alpha-2/alpha-4 chain-like [Cavia porcellus]
Length=449

 Score =   156 bits (395),  Expect(2) = 4e-71, Method: Compositional matrix adjust.
 Identities = 69/83 (83%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQLSVP+ITSA FEP + M KCDPRHGKYMACC++YRGDVV KDVNAA+ATIKT
Sbjct  278  AEKAYHEQLSVPQITSACFEPCNQMVKCDPRHGKYMACCMLYRGDVVAKDVNAAIATIKT  337

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            K T+QFVDWCPTGFK GINYQPP
Sbjct  338  KHTIQFVDWCPTGFKVGINYQPP  360


 Score =   139 bits (351),  Expect(2) = 4e-71, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            VG+   PPTVVPGGDLA VQRAVCM+SN TA+ E +SR++HKFDLM++KRAFVHWYVGEG
Sbjct  353  VGINYQPPTVVPGGDLAPVQRAVCMLSNTTAIVEAWSRLNHKFDLMFAKRAFVHWYVGEG  412

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEE +FSEARE+LAALE+DY
Sbjct  413  MEEADFSEARENLAALERDY  432



>ref|XP_007883118.1| PREDICTED: tubulin alpha-1 chain-like [Callorhinchus milii]
Length=417

 Score =   154 bits (389),  Expect(2) = 4e-71, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQLSV EIT+A FEP++ M KCDPR GKYMACC++YRGDVVPKDVNA++ATIKT
Sbjct  243  AEKAYHEQLSVAEITNACFEPANQMVKCDPRRGKYMACCMLYRGDVVPKDVNASIATIKT  302

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            KR+++FVDWCPTGFK GINYQPP
Sbjct  303  KRSIEFVDWCPTGFKVGINYQPP  325


 Score =   142 bits (357),  Expect(2) = 4e-71, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+   PPTVVPGGDLAKVQRAVCM+SN TA+AE ++R+D KFD MY+KRAFVHWYVGE
Sbjct  317  KVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDLKFDKMYAKRAFVHWYVGE  376

Query  352  GMEEGEFSEAREDLAALEKDY  290
            G+EEGEFS+AREDLA+LEKDY
Sbjct  377  GLEEGEFSDAREDLASLEKDY  397



>dbj|GAA48838.1| tubulin alpha-1 chain [Clonorchis sinensis]
Length=360

 Score =   148 bits (374),  Expect(2) = 5e-71, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            VGL   PPTVVPGGDLAKV RA+CM+SN TA+AE ++R+DHKFDLMY+KRAFVHWYVGEG
Sbjct  264  VGLNYQPPTVVPGGDLAKVPRALCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG  323

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEEGEFSEARED+AALEKDY
Sbjct  324  MEEGEFSEAREDMAALEKDY  343


 Score =   147 bits (371),  Expect(2) = 5e-71, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KA+HEQL+V EIT++ FEP++ M KCDPR GKYMACCL+YRGDVVPKDVNAA+  IKT
Sbjct  189  AEKAFHEQLNVNEITNSCFEPANQMVKCDPRRGKYMACCLLYRGDVVPKDVNAAITKIKT  248

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            ++TVQFVDWCPTGFK G+NYQPP
Sbjct  249  QKTVQFVDWCPTGFKVGLNYQPP  271



>gb|EPY78320.1| hypothetical protein CB1_001108068 [Camelus ferus]
Length=861

 Score =   150 bits (379),  Expect(2) = 6e-71, Method: Composition-based stats.
 Identities = 64/83 (77%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQLSV EIT+  FEP++ + KCDP HG+YMACCL+YRGDVV KDVNAA+ATIK 
Sbjct  242  AEKAYHEQLSVAEITNTCFEPTNQIVKCDPHHGRYMACCLLYRGDVVLKDVNAAIATIKI  301

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            K T+QFVDWCPTGFK GINYQPP
Sbjct  302  KHTIQFVDWCPTGFKVGINYQPP  324


 Score =   145 bits (366),  Expect(2) = 6e-71, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            VG+   PPTVVPGGDLAKVQRAVCM+SN TA+AE ++ +DHKFDLMY+KRAFVHWYVGEG
Sbjct  317  VGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWAGLDHKFDLMYAKRAFVHWYVGEG  376

Query  349  MEEGEFSEAREDLAALEKDY  290
            +EEGEFSEARED+AALE+DY
Sbjct  377  VEEGEFSEAREDMAALEEDY  396



>dbj|GAA48839.1| tubulin alpha-1 chain [Clonorchis sinensis]
Length=248

 Score =   148 bits (373),  Expect(2) = 6e-71, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            VGL   PPTVVPGGDLAKV RA+CM+SN TA+AE ++R+DHKFDLMY+KRAFVHWYVGEG
Sbjct  151  VGLNYQPPTVVPGGDLAKVPRALCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG  210

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEEGEFSEARED+AALEKDY
Sbjct  211  MEEGEFSEAREDMAALEKDY  230


 Score =   147 bits (371),  Expect(2) = 6e-71, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KA+HEQL+V EIT++ FEP++ M KCDPR GKYMACCL+YRGDVVPKDVNAA+  IKT
Sbjct  76   AEKAFHEQLNVNEITNSCFEPANQMVKCDPRRGKYMACCLLYRGDVVPKDVNAAITKIKT  135

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            ++TVQFVDWCPTGFK G+NYQPP
Sbjct  136  QKTVQFVDWCPTGFKVGLNYQPP  158



>dbj|GAA48837.1| tubulin alpha-1 chain [Clonorchis sinensis]
Length=247

 Score =   148 bits (373),  Expect(2) = 7e-71, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            VGL   PPTVVPGGDLAKV RA+CM+SN TA+AE ++R+DHKFDLMY+KRAFVHWYVGEG
Sbjct  151  VGLNYQPPTVVPGGDLAKVPRALCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG  210

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEEGEFSEARED+AALEKDY
Sbjct  211  MEEGEFSEAREDMAALEKDY  230


 Score =   147 bits (371),  Expect(2) = 7e-71, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KA+HEQL+V EIT++ FEP++ M KCDPR GKYMACCL+YRGDVVPKDVNAA+  IKT
Sbjct  76   AEKAFHEQLNVNEITNSCFEPANQMVKCDPRRGKYMACCLLYRGDVVPKDVNAAITKIKT  135

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            ++TVQFVDWCPTGFK G+NYQPP
Sbjct  136  QKTVQFVDWCPTGFKVGLNYQPP  158



>dbj|GAA32775.2| tubulin alpha [Clonorchis sinensis]
Length=430

 Score =   148 bits (373),  Expect(2) = 8e-71, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            VGL   PPTVVPGGDLAKV RA+CM+SN TA+AE ++R+DHKFDLMY+KRAFVHWYVGEG
Sbjct  338  VGLNYQPPTVVPGGDLAKVPRALCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG  397

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEEGEFSEARED+AALEKDY
Sbjct  398  MEEGEFSEAREDMAALEKDY  417


 Score =   147 bits (370),  Expect(2) = 8e-71, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KA+HEQL+V EIT++ FEP++ M KCDPR GKYMACCL+YRGDVVPKDVNAA+  IKT
Sbjct  263  AEKAFHEQLNVNEITNSCFEPANQMVKCDPRRGKYMACCLLYRGDVVPKDVNAAITKIKT  322

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            ++TVQFVDWCPTGFK G+NYQPP
Sbjct  323  QKTVQFVDWCPTGFKVGLNYQPP  345



>ref|XP_010744593.1| PREDICTED: tubulin alpha-1C chain-like [Larimichthys crocea]
Length=454

 Score =   150 bits (380),  Expect(2) = 8e-71, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            VG+   PPTVVPGGDLAKVQRAVCM+SN TA+AE ++R+DHKFDLMY+KRAFVHWYVGEG
Sbjct  353  VGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYNKRAFVHWYVGEG  412

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEEGEFSEARED+AALEKDY
Sbjct  413  MEEGEFSEAREDMAALEKDY  432


 Score =   144 bits (363),  Expect(2) = 8e-71, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -3

Query  749  KAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  570
            K YHEQL+V EIT+A FEP++ M KCDP   KYMACCL+YRGDVV KDVNAA+ATIKTK 
Sbjct  280  KVYHEQLTVGEITNACFEPANQMVKCDPHRSKYMACCLLYRGDVVSKDVNAAIATIKTKH  339

Query  569  TVQFVDWCPTGFKCGINYQPP  507
            T+QFVDWCPTGFK GINYQPP
Sbjct  340  TIQFVDWCPTGFKVGINYQPP  360



>gb|EPY85690.1| tubulin alpha-1A chain, partial [Camelus ferus]
Length=388

 Score =   150 bits (378),  Expect(2) = 8e-71, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            VG+   PPTVVPGGDLAKVQRAVCM+SN TA+AE ++R+DHKFDLMY+KRAFVHWYVGEG
Sbjct  307  VGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG  366

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEEGEF+EARED+AALEKDY
Sbjct  367  MEEGEFAEAREDMAALEKDY  386


 Score =   145 bits (365),  Expect(2) = 8e-71, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAY +QLSV EIT+  FEP++ + KCDP HG+YMACCL+YRGDVVPKDVNAA+ATIK 
Sbjct  232  AEKAYRKQLSVAEITNTCFEPTNQIVKCDPHHGRYMACCLLYRGDVVPKDVNAAIATIKI  291

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            K T+QFVDWCPTGFK GINYQPP
Sbjct  292  KHTIQFVDWCPTGFKVGINYQPP  314



>ref|XP_009177221.1| hypothetical protein T265_12043 [Opisthorchis viverrini]
 gb|KER19036.1| hypothetical protein T265_12043 [Opisthorchis viverrini]
Length=435

 Score =   147 bits (372),  Expect(2) = 9e-71, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            VGL   PPTVVPGGDLAKV RA+CM+SN TA+AE ++R+DHKFDLMY+KRAFVHWYVGEG
Sbjct  338  VGLNYQPPTVVPGGDLAKVPRALCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG  397

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEEGEFSEARED+AALEKDY
Sbjct  398  MEEGEFSEAREDMAALEKDY  417


 Score =   147 bits (371),  Expect(2) = 9e-71, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KA+HEQL+V EIT++ FEP++ M KCDPR GKYMACCL+YRGDVVPKDVNAA+  IKT
Sbjct  263  AEKAFHEQLNVNEITNSCFEPANQMVKCDPRRGKYMACCLLYRGDVVPKDVNAAITRIKT  322

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            ++TVQFVDWCPTGFK G+NYQPP
Sbjct  323  QKTVQFVDWCPTGFKVGLNYQPP  345



>ref|XP_008402109.1| PREDICTED: tubulin alpha chain-like [Poecilia reticulata]
Length=448

 Score =   150 bits (380),  Expect(2) = 9e-71, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+   PPTVVPGGDLAKVQRAVCM+SN TA+AE ++R++HKFDLMY+KRAFVHWYVGE
Sbjct  351  KVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLBHKFDLMYAKRAFVHWYVGE  410

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GMEEGEFSEARED+AALEKDY
Sbjct  411  GMEEGEFSEAREDMAALEKDY  431


 Score =   144 bits (362),  Expect(2) = 9e-71, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            + KAYHEQLSV EIT+A FE ++ M KCDP  GKYMACCL+YRGDVVPKDVN A++ IKT
Sbjct  277  SEKAYHEQLSVAEITNACFEAANQMVKCDPCRGKYMACCLLYRGDVVPKDVNVAISNIKT  336

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            KRT+ FVDWCPTGFK GINYQPP
Sbjct  337  KRTIHFVDWCPTGFKVGINYQPP  359



>ref|XP_006135531.1| PREDICTED: tubulin alpha-8 chain-like [Pelodiscus sinensis]
Length=451

 Score =   149 bits (375),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 74/86 (86%), Gaps = 3/86 (3%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            + +AYHEQLSV EITS+ FEP++ M KCDPRHGKYMACC++YRGDVVPKDVN A+A IKT
Sbjct  277  SERAYHEQLSVAEITSSCFEPNNQMVKCDPRHGKYMACCMLYRGDVVPKDVNVAIAAIKT  336

Query  575  K---RTVQFVDWCPTGFKCGINYQPP  507
            K   R VQFVDWCPTGFK GINYQPP
Sbjct  337  KRAVRAVQFVDWCPTGFKVGINYQPP  362


 Score =   145 bits (367),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+   PPT+ PGGDLA+V+RAVCM+SN TA+AE ++R+DHKFDLMY+KRAFVHWYVGE
Sbjct  354  KVGINYQPPTITPGGDLAQVERAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGE  413

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GMEEGEF+EAREDLAALEKDY
Sbjct  414  GMEEGEFAEAREDLAALEKDY  434



>ref|XP_009050464.1| hypothetical protein LOTGIDRAFT_187046 [Lottia gigantea]
 gb|ESO98832.1| hypothetical protein LOTGIDRAFT_187046 [Lottia gigantea]
Length=454

 Score =   149 bits (376),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+   PPT+VPGGDLAKV RAVCM+SN TAVAE ++R+DHKFDLMY+KRAFVHWYVGE
Sbjct  352  KVGINYQPPTIVPGGDLAKVTRAVCMLSNTTAVAEAWARLDHKFDLMYAKRAFVHWYVGE  411

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GMEEGEFSEAREDLAALEKDY
Sbjct  412  GMEEGEFSEAREDLAALEKDY  432


 Score =   145 bits (365),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KA+HEQ SV ++TSA F+P++ M KCDPR GKYMACCL+YRGD+VPKD+NAA+  IKT
Sbjct  278  AEKAHHEQHSVADLTSACFDPANQMVKCDPRKGKYMACCLLYRGDIVPKDINAAIGAIKT  337

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            K+T+QFVDWCPTGFK GINYQPP
Sbjct  338  KKTIQFVDWCPTGFKVGINYQPP  360



>gb|EPQ13502.1| Tubulin alpha-3 chain [Myotis brandtii]
Length=409

 Score =   148 bits (373),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 66/75 (88%), Positives = 72/75 (96%), Gaps = 0/75 (0%)
 Frame = -1

Query  514  NPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGE  335
             PPTVVPGGDLAKVQRAVCM+SN TA+AE ++R+DHKFDLMY+KRAFVHWYVGEGMEEGE
Sbjct  317  KPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGE  376

Query  334  FSEAREDLAALEKDY  290
            FSEAREDLAALEKDY
Sbjct  377  FSEAREDLAALEKDY  391


 Score =   145 bits (365),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 63/75 (84%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQLSV EIT+A FEP++ M KCDPRHGKYMACC++YRGDVVPKDVNAA+ATIKT
Sbjct  243  AEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKT  302

Query  575  KRTVQFVDWCPTGFK  531
            KRT+QFVDWCPTGFK
Sbjct  303  KRTIQFVDWCPTGFK  317



>ref|XP_003792393.1| PREDICTED: tubulin alpha chain-like [Otolemur garnettii]
Length=397

 Score =   148 bits (373),  Expect(2) = 5e-70, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQLSV E+TSA FEPS+ M KCDPRHGKYMACC+ YRGDVVPKDVNAA+  IK 
Sbjct  226  AEKAYHEQLSVAEMTSACFEPSNQMVKCDPRHGKYMACCMFYRGDVVPKDVNAAIVAIKA  285

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            K ++QFVDWC TGFK GINYQPP
Sbjct  286  KHSIQFVDWCSTGFKVGINYQPP  308


 Score =   144 bits (363),  Expect(2) = 5e-70, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            VG+   PPTVVPG DLAK+QRA+C++SN TA+AE ++R++HKFDLMY+KRAFVHWYVGEG
Sbjct  301  VGINYQPPTVVPGDDLAKMQRAICVLSNTTAIAEAWARLNHKFDLMYAKRAFVHWYVGEG  360

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEEGEFSEAREDLAALEKDY
Sbjct  361  MEEGEFSEAREDLAALEKDY  380



>ref|XP_009809251.1| PREDICTED: LOW QUALITY PROTEIN: tubulin alpha-3 chain-like [Gavia 
stellata]
Length=437

 Score =   152 bits (383),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 68/81 (84%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+   PPTVVPGGDLAKVQRAVCM+SN TA+AE ++R+DHKFDLMY+KRAFVHWYVGE
Sbjct  341  KVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGE  400

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GMEEGEFSEAREDLAALEKDY
Sbjct  401  GMEEGEFSEAREDLAALEKDY  421


 Score =   139 bits (350),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 70/83 (84%), Gaps = 3/83 (4%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQLSVPEIT+A FE S+ M KCDPR GKYMACCL+YRGDVVPKDVNAA+A IKT
Sbjct  270  AEKAYHEQLSVPEITNACFEFSNQMVKCDPRRGKYMACCLLYRGDVVPKDVNAAIAGIKT  329

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            +R +    WCPTGFK GINYQPP
Sbjct  330  RRAIX---WCPTGFKVGINYQPP  349



>ref|XP_006044076.1| PREDICTED: tubulin alpha-1A chain-like isoform X1 [Bubalus bubalis]
Length=451

 Score =   147 bits (372),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 67/83 (81%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQLSV EIT+A F P++ M KCDP HGKYMACCL+Y GDVVPKDVNAA+ATIKT
Sbjct  278  AEKAYHEQLSVAEITNACFGPANQMVKCDPCHGKYMACCLLYHGDVVPKDVNAAIATIKT  337

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            K T+QFVDWCPTGFK GINYQPP
Sbjct  338  KCTIQFVDWCPTGFKVGINYQPP  360


 Score =   144 bits (362),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            VG+   PPTVVPGGDLAKVQRA+CM+SN TA++E ++R+DHKFDLMY+ RAFVHWYVGEG
Sbjct  353  VGINYQPPTVVPGGDLAKVQRAMCMLSNTTAISEAWARLDHKFDLMYANRAFVHWYVGEG  412

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEEGEFSEA ED+AALEKDY
Sbjct  413  MEEGEFSEALEDMAALEKDY  432



>ref|XP_006044077.1| PREDICTED: tubulin alpha-1A chain-like isoform X2 [Bubalus bubalis]
Length=464

 Score =   147 bits (371),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 67/83 (81%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQLSV EIT+A F P++ M KCDP HGKYMACCL+Y GDVVPKDVNAA+ATIKT
Sbjct  291  AEKAYHEQLSVAEITNACFGPANQMVKCDPCHGKYMACCLLYHGDVVPKDVNAAIATIKT  350

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            K T+QFVDWCPTGFK GINYQPP
Sbjct  351  KCTIQFVDWCPTGFKVGINYQPP  373


 Score =   144 bits (362),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            VG+   PPTVVPGGDLAKVQRA+CM+SN TA++E ++R+DHKFDLMY+ RAFVHWYVGEG
Sbjct  366  VGINYQPPTVVPGGDLAKVQRAMCMLSNTTAISEAWARLDHKFDLMYANRAFVHWYVGEG  425

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEEGEFSEA ED+AALEKDY
Sbjct  426  MEEGEFSEALEDMAALEKDY  445



>ref|XP_001751395.1| predicted protein [Physcomitrella patens]
 gb|EDQ83712.1| predicted protein [Physcomitrella patens]
Length=362

 Score =   155 bits (391),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 68/79 (86%), Positives = 74/79 (94%), Gaps = 0/79 (0%)
 Frame = -3

Query  749  KAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  570
            +AYHEQLSV  IT++ F+PSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN AV+TIKTKR
Sbjct  173  RAYHEQLSVARITNSCFDPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNQAVSTIKTKR  232

Query  569  TVQFVDWCPTGFKCGINYQ  513
            T+QFVDWCPTGFKC INYQ
Sbjct  233  TIQFVDWCPTGFKCHINYQ  251


 Score =   132 bits (331),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 67/82 (82%), Gaps = 10/82 (12%)
 Frame = -1

Query  505  TVVPGGDLAK----------VQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVG  356
            TVVPGGDLAK          VQR VCMIS  T +AEVFSR+DHKFDLMYSKRAFVHWYVG
Sbjct  254  TVVPGGDLAKTDVYFDHYWHVQRGVCMISKTTRIAEVFSRLDHKFDLMYSKRAFVHWYVG  313

Query  355  EGMEEGEFSEAREDLAALEKDY  290
            E MEEGEFSEAR+DLAALEKDY
Sbjct  314  EDMEEGEFSEARKDLAALEKDY  335



>ref|XP_009171069.1| hypothetical protein T265_14255, partial [Opisthorchis viverrini]
 gb|KER25187.1| hypothetical protein T265_14255, partial [Opisthorchis viverrini]
Length=904

 Score =   148 bits (373),  Expect(2) = 5e-68, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            VG+   PPTV+PGGDLAKV RAVCM+SN TAVAE ++RIDHKFDLMY+KRAFVHW+VGEG
Sbjct  353  VGINYQPPTVIPGGDLAKVPRAVCMLSNTTAVAECWARIDHKFDLMYTKRAFVHWFVGEG  412

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEEGEFSEAREDLAALE+DY
Sbjct  413  MEEGEFSEAREDLAALERDY  432


 Score =   137 bits (346),  Expect(2) = 5e-68, Method: Composition-based stats.
 Identities = 56/81 (69%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = -3

Query  749  KAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  570
            +AYHE +SV EIT+  FEPS+ +  CDPR GKYM+CCL+YRGDV PKDVN A+A +K  R
Sbjct  280  RAYHEPMSVSEITNTCFEPSNQLVLCDPRRGKYMSCCLLYRGDVTPKDVNLAIANVKASR  339

Query  569  TVQFVDWCPTGFKCGINYQPP  507
             +QFVDWCPTGFK GINYQPP
Sbjct  340  VIQFVDWCPTGFKVGINYQPP  360


 Score =   122 bits (305),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 69/97 (71%), Gaps = 0/97 (0%)
 Frame = -1

Query  580  KRNAQFSLLTGAQPASNVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKF  401
            +R      +        VG++  PP+ VP GDLAKV R++C+ SN TAV E +SR+  KF
Sbjct  793  RRKRSIHFVDWCPTGFKVGISFQPPSAVPAGDLAKVPRSLCLFSNTTAVGESWSRLAEKF  852

Query  400  DLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            DLMYSKRAFVHW+VGEGMEE EF+EAR+ +A LEKDY
Sbjct  853  DLMYSKRAFVHWFVGEGMEENEFTEARDFMACLEKDY  889


 Score =   114 bits (286),  Expect = 6e-25, Method: Composition-based stats.
 Identities = 44/87 (51%), Positives = 67/87 (77%), Gaps = 0/87 (0%)
 Frame = -3

Query  749  KAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  570
            +AY ++ +  ++T   F+  + + +CDPR GK+MACCL+YRGDV P+DVNAA+ +++ KR
Sbjct  737  QAYKQKPTTMKLTIDAFKQENQLLRCDPRRGKFMACCLLYRGDVFPQDVNAAIDSVRRKR  796

Query  569  TVQFVDWCPTGFKCGINYQPPNSCARG  489
            ++ FVDWCPTGFK GI++QPP++   G
Sbjct  797  SIHFVDWCPTGFKVGISFQPPSAVPAG  823



>ref|XP_005451973.1| PREDICTED: tubulin alpha chain-like isoform X2 [Oreochromis niloticus]
Length=412

 Score =   145 bits (365),  Expect(2) = 7e-68, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            +G+   PPTVVPGGDLAKVQRAVCM+SN TA+AE ++R+DHKFDLMY+K+AFVHWYVGEG
Sbjct  318  MGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKKAFVHWYVGEG  377

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEEGEF EARED+A LEKDY
Sbjct  378  MEEGEFLEAREDMATLEKDY  397


 Score =   140 bits (352),  Expect(2) = 7e-68, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A K YHEQLSV EI++  FEPS+ M KCD RHGKYM CCLMYRGDVV +D+N+A+  IKT
Sbjct  243  AEKPYHEQLSVAEISNECFEPSNQMLKCDTRHGKYMLCCLMYRGDVVSRDINSAIRAIKT  302

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            KRT+QFVDW PT FK GINYQPP
Sbjct  303  KRTIQFVDWLPTNFKMGINYQPP  325



>ref|XP_005451972.1| PREDICTED: tubulin alpha chain-like isoform X1 [Oreochromis niloticus]
Length=447

 Score =   145 bits (365),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            +G+   PPTVVPGGDLAKVQRAVCM+SN TA+AE ++R+DHKFDLMY+K+AFVHWYVGEG
Sbjct  353  MGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKKAFVHWYVGEG  412

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEEGEF EARED+A LEKDY
Sbjct  413  MEEGEFLEAREDMATLEKDY  432


 Score =   139 bits (350),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A K YHEQLSV EI++  FEPS+ M KCD RHGKYM CCLMYRGDVV +D+N+A+  IKT
Sbjct  278  AEKPYHEQLSVAEISNECFEPSNQMLKCDTRHGKYMLCCLMYRGDVVSRDINSAIRAIKT  337

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            KRT+QFVDW PT FK GINYQPP
Sbjct  338  KRTIQFVDWLPTNFKMGINYQPP  360



>ref|XP_006802409.1| PREDICTED: tubulin alpha chain-like [Neolamprologus brichardi]
Length=571

 Score =   144 bits (364),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            +G+   PPTVVPGGDLAKVQRAVCM+SN TA+AE ++R+DHKFDLMY+K+AFVHWYVGEG
Sbjct  477  MGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKKAFVHWYVGEG  536

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEEGEF EARED+A LEKDY
Sbjct  537  MEEGEFLEAREDMATLEKDY  556


 Score =   138 bits (348),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQLSV EI++  FEPS+ M KCD RHGKYM CCL+YRG+VV +D+N+A+  IKT
Sbjct  402  AEKAYHEQLSVAEISNECFEPSNQMLKCDTRHGKYMLCCLLYRGNVVSRDINSAIRAIKT  461

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            KRT+QFVDW PT FK GINYQPP
Sbjct  462  KRTIQFVDWLPTNFKMGINYQPP  484



>gb|ERE68863.1| tubulin alpha-1C chain [Cricetulus griseus]
Length=383

 Score =   145 bits (367),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQ ++ EIT+A FEP++ M KCD RHGKYMACCL+Y GDVVPKDVNAA+ATIKT
Sbjct  212  AEKAYHEQFTIAEITNACFEPANQMVKCDLRHGKYMACCLLYHGDVVPKDVNAAIATIKT  271

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            K T+QFVDW PTGFK GINYQPP
Sbjct  272  KHTIQFVDWWPTGFKVGINYQPP  294


 Score =   137 bits (345),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            VG+   PPTVVPG DLAKVQRAVCM+SN TA+ E ++R+DHKFDL+Y+KRAFVHWYV EG
Sbjct  287  VGINYQPPTVVPGRDLAKVQRAVCMLSNTTAIVEAWARLDHKFDLIYAKRAFVHWYVDEG  346

Query  349  MEEGEFSEAREDLAALEKDY  290
            ME+GEFSEA ED+AALEKDY
Sbjct  347  MEDGEFSEACEDMAALEKDY  366



>gb|EFA86605.1| alpha tubulin [Polysphondylium pallidum PN500]
Length=449

 Score =   147 bits (372),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 74/79 (94%), Gaps = 0/79 (0%)
 Frame = -1

Query  526  GLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGM  347
            G+   PPTVVPGGDLAKV+RAVCM+SN TA+++VF+RI+HKFDLMY+KRAFVHWYVGEGM
Sbjct  356  GINHEPPTVVPGGDLAKVERAVCMLSNTTAISQVFTRINHKFDLMYTKRAFVHWYVGEGM  415

Query  346  EEGEFSEAREDLAALEKDY  290
            EEGEF+EAREDL ALEKDY
Sbjct  416  EEGEFAEAREDLNALEKDY  434


 Score =   135 bits (339),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = -3

Query  749  KAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  570
            KA HEQ SV  +T+AVFE  +MMAKCDPR GKYMACCLMYRG VVPKD   AVA +KTK+
Sbjct  282  KAGHEQFSVGALTNAVFEQQNMMAKCDPREGKYMACCLMYRGTVVPKDAQKAVADLKTKK  341

Query  569  TVQFVDWCPTGFKCGINYQPP  507
            T+ FVDW PTGFKCGIN++PP
Sbjct  342  TISFVDWSPTGFKCGINHEPP  362



>gb|ABO61405.1| alpha tubulin, partial [Mallomonas papillosa]
Length=378

 Score =   167 bits (423),  Expect(2) = 5e-67, Method: Compositional matrix adjust.
 Identities = 75/83 (90%), Positives = 79/83 (95%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQLSV EIT++VFEPS+MM KCDPRHGKYMACCLMYRGDVVPKDVNA+VATIKT
Sbjct  243  AEKAYHEQLSVAEITNSVFEPSNMMTKCDPRHGKYMACCLMYRGDVVPKDVNASVATIKT  302

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            KRTV FVDWCPTGFKCGINYQPP
Sbjct  303  KRTVLFVDWCPTGFKCGINYQPP  325


 Score =   115 bits (287),  Expect(2) = 5e-67, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = -1

Query  526  GLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGM  347
            G+   PPTVVPGGDLA+VQRAVCM+SN TA+AE  SRIDHKFDLMY+KRAFVHWYVGEGM
Sbjct  319  GINYQPPTVVPGGDLARVQRAVCMVSNTTAIAEALSRIDHKFDLMYAKRAFVHWYVGEGM  378



>ref|XP_005723349.1| PREDICTED: tubulin alpha chain-like isoform X2 [Pundamilia nyererei]
Length=447

 Score =   145 bits (366),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            +G+   PPTVVPGGDLAKVQRAVCM+SN TA+AE ++R+DHKFDLMY+K+AFVHWYVGEG
Sbjct  353  MGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKKAFVHWYVGEG  412

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEEGEF EARED+A LEKDY
Sbjct  413  MEEGEFLEAREDMATLEKDY  432


 Score =   136 bits (342),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQLSV EI++  FEPS+ M KCD R GKYM CCL+YRG+VV +D+N+A+  IKT
Sbjct  278  AEKAYHEQLSVAEISNECFEPSNQMLKCDTRQGKYMLCCLLYRGNVVSRDINSAIRAIKT  337

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            KRT+QFVDW PT FK GINYQPP
Sbjct  338  KRTIQFVDWLPTNFKMGINYQPP  360



>ref|XP_004712699.1| PREDICTED: tubulin alpha chain-like 3 [Echinops telfairi]
Length=469

 Score =   143 bits (360),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG++  PPTVVPGGDLA+VQ+AVCM+SN TA+AE ++R+DHKFDLMY+KRAFVHWY+ E
Sbjct  382  KVGISHQPPTVVPGGDLARVQQAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYIKE  441

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GM+EGEF EAREDLAALEKDY
Sbjct  442  GMDEGEFIEAREDLAALEKDY  462


 Score =   138 bits (347),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A K YHEQ SVP+IT+A FE S+ + KCDP+ GKYMACCL+YRGDVVPKDVNAA+A +K+
Sbjct  308  AEKVYHEQFSVPDITAACFESSNQLVKCDPQLGKYMACCLLYRGDVVPKDVNAAIAALKS  367

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            + ++QFVDWCPTGFK GI++QPP
Sbjct  368  RNSIQFVDWCPTGFKVGISHQPP  390



>gb|ABL61111.1| alpha-tubulin [Saccinobaculus environmental sample]
Length=391

 Score =   165 bits (418),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 73/83 (88%), Positives = 79/83 (95%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQLSV EIT++ FEP++MMAKCDPRHGKYMACC+MYRGDVVPKDVNAAVATIKT
Sbjct  257  AEKAYHEQLSVAEITNSSFEPANMMAKCDPRHGKYMACCMMYRGDVVPKDVNAAVATIKT  316

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            K T+QFVDWCPTGFKCGINYQPP
Sbjct  317  KSTIQFVDWCPTGFKCGINYQPP  339


 Score =   115 bits (289),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
             G+   PPTVVPGGDLAKVQRAVCMISN+TA+AEVFSRID KFDLMY+KRAFVHWYVGEG
Sbjct  332  CGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRIDRKFDLMYAKRAFVHWYVGEG  391



>gb|AFM80089.1| alpha-tubulin, partial [Teleopsis dalmanni]
Length=433

 Score =   142 bits (359),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = -3

Query  749  KAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  570
            KAYHEQLSV EIT+A FEP++ M KCDPR+GKY+ACC++YRGDV PKDVN+AV  IKTKR
Sbjct  263  KAYHEQLSVAEITNACFEPANQMVKCDPRNGKYIACCMLYRGDVAPKDVNSAVGAIKTKR  322

Query  569  TVQFVDWCPTGFKCGINYQPP  507
             V+FVDWCPTGFK G++YQPP
Sbjct  323  AVKFVDWCPTGFKVGVSYQPP  343


 Score =   137 bits (346),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            VG++  PPT VPGGDL KVQRAVCM SN+TA+AE ++R+D KFDL++SKRAFVHWYVG+G
Sbjct  336  VGVSYQPPTYVPGGDLPKVQRAVCMTSNSTAIAEAWARLDRKFDLLFSKRAFVHWYVGQG  395

Query  349  MEEGEFSEAREDLAALEKDY  290
            M+E EFSEAREDLAALEKDY
Sbjct  396  MDENEFSEAREDLAALEKDY  415



>ref|XP_004555568.1| PREDICTED: tubulin alpha chain-like isoform X5 [Maylandia zebra]
Length=412

 Score =   145 bits (366),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            +G+   PPTVVPGGDLAKVQRAVCM+SN TA+AE ++R+DHKFDLMY+K+AFVHWYVGEG
Sbjct  318  MGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKKAFVHWYVGEG  377

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEEGEF EARED+A LEKDY
Sbjct  378  MEEGEFLEAREDMATLEKDY  397


 Score =   135 bits (340),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQLSV EI++  FEPS+ M KCD R GKYM CCL+YRG+V  +D+N+A+  IKT
Sbjct  243  AEKAYHEQLSVAEISNECFEPSNQMLKCDTRQGKYMLCCLLYRGNVASRDINSAIRAIKT  302

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            KRT+QFVDW PT FK GINYQPP
Sbjct  303  KRTIQFVDWLPTNFKMGINYQPP  325



>ref|XP_005723348.1| PREDICTED: tubulin alpha chain-like isoform X1 [Pundamilia nyererei]
Length=571

 Score =   144 bits (364),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            +G+   PPTVVPGGDLAKVQRAVCM+SN TA+AE ++R+DHKFDLMY+K+AFVHWYVGEG
Sbjct  477  MGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKKAFVHWYVGEG  536

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEEGEF EARED+A LEKDY
Sbjct  537  MEEGEFLEAREDMATLEKDY  556


 Score =   135 bits (341),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQLSV EI++  FEPS+ M KCD R GKYM CCL+YRG+VV +D+N+A+  IKT
Sbjct  402  AEKAYHEQLSVAEISNECFEPSNQMLKCDTRQGKYMLCCLLYRGNVVSRDINSAIRAIKT  461

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            KRT+QFVDW PT FK GINYQPP
Sbjct  462  KRTIQFVDWLPTNFKMGINYQPP  484



>gb|ABO61431.1| alpha tubulin, partial [Thalassiosira tumida]
Length=378

 Score =   166 bits (420),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 74/83 (89%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQLSV EIT++VFEP+ MM KCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT
Sbjct  243  AEKAYHEQLSVAEITNSVFEPAGMMTKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  302

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            K T+QFVDWCPTGFKCGINYQPP
Sbjct  303  KGTIQFVDWCPTGFKCGINYQPP  325


 Score =   114 bits (284),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
              G+   PPTVVPGGDLA+VQRAVCM++N TA+AE  SRIDHKFDLMY+KRAFVHWYVGE
Sbjct  317  KCGINYQPPTVVPGGDLARVQRAVCMVANTTAIAEALSRIDHKFDLMYAKRAFVHWYVGE  376

Query  352  GM  347
            GM
Sbjct  377  GM  378



>ref|XP_011331850.1| PREDICTED: tubulin alpha-2/alpha-4 chain-like [Cerapachys biroi]
Length=431

 Score =   151 bits (382),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = -3

Query  749  KAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  570
            KAYHEQL+V E+TSA FEP+  M KCDPR+GKYMACCL+YRGDVVPKDVNA++ATIKTKR
Sbjct  263  KAYHEQLTVMELTSACFEPAMQMVKCDPRNGKYMACCLLYRGDVVPKDVNASIATIKTKR  322

Query  569  TVQFVDWCPTGFKCGINYQPP  507
            +++FVDWCPTGFK GINYQPP
Sbjct  323  SIRFVDWCPTGFKVGINYQPP  343


 Score =   128 bits (322),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            VG+   PPTVVPGGDLAKVQRA+ M++N TA++EV++R++ KFDLM+SKRAFVHWYV E 
Sbjct  336  VGINYQPPTVVPGGDLAKVQRAMVMLANTTAISEVWNRLNRKFDLMFSKRAFVHWYVAEN  395

Query  349  MEEGEFSEAREDLAALEKDY  290
            M+E EF+EARED+A LEKDY
Sbjct  396  MDESEFNEAREDMAVLEKDY  415



>ref|XP_004555567.1| PREDICTED: tubulin alpha chain-like isoform X4 [Maylandia zebra]
Length=447

 Score =   145 bits (365),  Expect(2) = 4e-66, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            +G+   PPTVVPGGDLAKVQRAVCM+SN TA+AE ++R+DHKFDLMY+K+AFVHWYVGEG
Sbjct  353  MGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKKAFVHWYVGEG  412

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEEGEF EARED+A LEKDY
Sbjct  413  MEEGEFLEAREDMATLEKDY  432


 Score =   134 bits (337),  Expect(2) = 4e-66, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQLSV EI++  FEPS+ M KCD R GKYM CCL+YRG+V  +D+N+A+  IKT
Sbjct  278  AEKAYHEQLSVAEISNECFEPSNQMLKCDTRQGKYMLCCLLYRGNVASRDINSAIRAIKT  337

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            KRT+QFVDW PT FK GINYQPP
Sbjct  338  KRTIQFVDWLPTNFKMGINYQPP  360



>gb|EFA79340.1| Tubulin alpha-1B chain [Polysphondylium pallidum PN500]
Length=456

 Score =   149 bits (376),  Expect(2) = 4e-66, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
             G+   PPTVVPGGDLAKV+RAVCM+SN TA+++VFSRI+HKFDLMY+KRAFVHWYVGEG
Sbjct  363  CGINHEPPTVVPGGDLAKVERAVCMLSNTTAISQVFSRINHKFDLMYTKRAFVHWYVGEG  422

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEEGEF+EAREDL+ALEKDY
Sbjct  423  MEEGEFAEAREDLSALEKDY  442


 Score =   130 bits (326),  Expect(2) = 4e-66, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 65/81 (80%), Gaps = 0/81 (0%)
 Frame = -3

Query  749  KAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  570
            KA HEQ SV  +T+AVFE  +MMAKCDPR GKYMACCLMYRG VVPKD   AV  +KTK+
Sbjct  290  KAGHEQFSVSALTNAVFEQQNMMAKCDPREGKYMACCLMYRGTVVPKDAQKAVNDLKTKK  349

Query  569  TVQFVDWCPTGFKCGINYQPP  507
            T+ FVDW P GFKCGIN++PP
Sbjct  350  TISFVDWSPCGFKCGINHEPP  370



>ref|XP_004555564.1| PREDICTED: tubulin alpha chain-like isoform X1 [Maylandia zebra]
Length=455

 Score =   145 bits (366),  Expect(2) = 4e-66, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            +G+   PPTVVPGGDLAKVQRAVCM+SN TA+AE ++R+DHKFDLMY+K+AFVHWYVGEG
Sbjct  361  MGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKKAFVHWYVGEG  420

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEEGEF EARED+A LEKDY
Sbjct  421  MEEGEFLEAREDMATLEKDY  440


 Score =   134 bits (337),  Expect(2) = 4e-66, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQLSV EI++  FEPS+ M KCD R GKYM CCL+YRG+V  +D+N+A+  IKT
Sbjct  286  AEKAYHEQLSVAEISNECFEPSNQMLKCDTRQGKYMLCCLLYRGNVASRDINSAIRAIKT  345

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            KRT+QFVDW PT FK GINYQPP
Sbjct  346  KRTIQFVDWLPTNFKMGINYQPP  368



>ref|XP_001917047.2| PREDICTED: tubulin, alpha-like 3 [Equus caballus]
Length=462

 Score =   142 bits (357),  Expect(2) = 4e-66, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+   PP  +PGGDLAKVQRAVCM+SN TA+ E ++R+DHKFDLMY+KRAF+HWY+ E
Sbjct  375  KVGINNQPPVAMPGGDLAKVQRAVCMLSNTTAIVEAWARLDHKFDLMYAKRAFLHWYIRE  434

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GMEEGEFSEAREDLAALEKDY
Sbjct  435  GMEEGEFSEAREDLAALEKDY  455


 Score =   137 bits (345),  Expect(2) = 4e-66, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHE+LSV +IT+A FE S+ + KCDPR GKYMACCL+YRGDVVPKDVNAA+A +K+
Sbjct  301  ADKAYHEELSVSDITAACFEFSNQLVKCDPRLGKYMACCLLYRGDVVPKDVNAAIAAMKS  360

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            + +V+FVDWCPTGFK GIN QPP
Sbjct  361  RNSVRFVDWCPTGFKVGINNQPP  383



>ref|XP_008515092.1| PREDICTED: tubulin alpha chain-like 3 [Equus przewalskii]
Length=446

 Score =   142 bits (357),  Expect(2) = 4e-66, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+   PP  +PGGDLAKVQRAVCM+SN TA+ E ++R+DHKFDLMY+KRAF+HWY+ E
Sbjct  359  KVGINNQPPVAMPGGDLAKVQRAVCMLSNTTAIVEAWARLDHKFDLMYAKRAFLHWYIRE  418

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GMEEGEFSEAREDLAALEKDY
Sbjct  419  GMEEGEFSEAREDLAALEKDY  439


 Score =   137 bits (345),  Expect(2) = 4e-66, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHE+LSV +IT+A FE S+ + KCDPR GKYMACCL+YRGDVVPKDVNAA+A +K+
Sbjct  285  ADKAYHEELSVSDITAACFEFSNQLVKCDPRLGKYMACCLLYRGDVVPKDVNAAIAAMKS  344

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            + +V+FVDWCPTGFK GIN QPP
Sbjct  345  RNSVRFVDWCPTGFKVGINNQPP  367



>gb|EGV95091.1| Tubulin alpha chain-like 3 [Cricetulus griseus]
 gb|ERE80711.1| tubulin alpha chain-like 3 [Cricetulus griseus]
Length=376

 Score =   140 bits (352),  Expect(2) = 5e-66, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAY EQLSVP+IT+A FE S+ + KCDPR GKYMACCL+YRGDVVPKDVN A+A +K+
Sbjct  215  ADKAYQEQLSVPDITAACFEYSNQLVKCDPRLGKYMACCLLYRGDVVPKDVNTAIAAMKS  274

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            + +VQFVDWCPTGFK GIN+QPP
Sbjct  275  RTSVQFVDWCPTGFKVGINHQPP  297


 Score =   139 bits (349),  Expect(2) = 5e-66, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+   PPTV+PGGDLA+VQR VCM+SN TA+ E ++R+DHKFDLMY+K+AF+HWY+ E
Sbjct  289  KVGINHQPPTVMPGGDLARVQRTVCMLSNTTAIVEAWARLDHKFDLMYAKKAFLHWYITE  348

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GME+GEF EAREDLAALEKDY
Sbjct  349  GMEQGEFVEAREDLAALEKDY  369



>ref|XP_011224672.1| PREDICTED: tubulin alpha chain-like 3 [Ailuropoda melanoleuca]
Length=395

 Score =   146 bits (368),  Expect(2) = 5e-66, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+   PPTV+PGGDLAKVQRAVCM+SN TAV E ++R+DHKFDLMY+KRAF+HWY+ E
Sbjct  308  KVGINNQPPTVMPGGDLAKVQRAVCMLSNTTAVVEAWARLDHKFDLMYAKRAFLHWYIRE  367

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GMEEGEFSEAREDLAALEKDY
Sbjct  368  GMEEGEFSEAREDLAALEKDY  388


 Score =   133 bits (334),  Expect(2) = 5e-66, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A  AY E+LSV +IT+A F+ S+ + KCDPR GKYMACCL+YRGDVVPKDVNAA+A +K+
Sbjct  234  ADNAYREELSVSDITAACFDFSNQLVKCDPRLGKYMACCLLYRGDVVPKDVNAAIAAMKS  293

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            + +VQFVDWCPTGFK GIN QPP
Sbjct  294  RNSVQFVDWCPTGFKVGINNQPP  316



>ref|XP_006990263.1| PREDICTED: tubulin alpha chain-like 3 [Peromyscus maniculatus 
bairdii]
Length=382

 Score =   139 bits (351),  Expect(2) = 6e-66, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAY EQLSVP+IT+A FE S+ + KCDPR GKYMACCL+YRGDVVPKDVNAA+  +K+
Sbjct  221  ADKAYQEQLSVPDITAACFEFSNQLVKCDPRLGKYMACCLLYRGDVVPKDVNAAITAMKS  280

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            + +VQFVDWCPTGFK GIN+QPP
Sbjct  281  RTSVQFVDWCPTGFKVGINHQPP  303


 Score =   139 bits (350),  Expect(2) = 6e-66, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+   PPTV+PGGDLA+VQRAVCM+SN TA+ E ++R+DHKFDLMY+K+AF+HWY+ E
Sbjct  295  KVGINHQPPTVIPGGDLARVQRAVCMLSNTTAIVEAWARLDHKFDLMYAKKAFLHWYITE  354

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GME+GEF +AREDLAALEKDY
Sbjct  355  GMEQGEFIDAREDLAALEKDY  375



>gb|EKC29904.1| Tubulin alpha-1C chain [Crassostrea gigas]
Length=482

 Score =   150 bits (378),  Expect(2) = 7e-66, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            +G+   PPTVVPGGDLAKVQRAVCM+SN TA+AE ++R+DHKFDLMY+KRAFVHWYVGEG
Sbjct  384  IGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG  443

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEEGEFSEAREDLA LEKDY
Sbjct  444  MEEGEFSEAREDLAVLEKDY  463


 Score =   128 bits (322),  Expect(2) = 7e-66, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 66/81 (81%), Gaps = 1/81 (1%)
 Frame = -3

Query  749  KAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  570
            KAYHEQLS+ EIT+A F P++ M KCD   GKYMACC++YRGDVVPKDVN A+A IKTKR
Sbjct  312  KAYHEQLSIAEITNACFAPANQMVKCDTHRGKYMACCMLYRGDVVPKDVNDAIANIKTKR  371

Query  569  TVQFVDWCPTGFKCGINYQPP  507
            T+ FVDW   GFK GINYQPP
Sbjct  372  TIPFVDWSK-GFKIGINYQPP  391



>gb|ETE69211.1| Tubulin alpha-1A chain, partial [Ophiophagus hannah]
Length=215

 Score =   151 bits (382),  Expect(2) = 7e-66, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 75/81 (93%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+   PPTVVPGGDLAKVQRAVCM+SN TA+AE ++R+DHKFDLMY+KRAFVHWYVGE
Sbjct  112  KVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGE  171

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GMEEGEFSEARED+AALEKDY
Sbjct  172  GMEEGEFSEAREDMAALEKDY  192


 Score =   127 bits (319),  Expect(2) = 7e-66, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 65/80 (81%), Gaps = 10/80 (13%)
 Frame = -3

Query  746  AYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRT  567
            AYHEQLSV EIT+A FEP++ M KCDPRHGKYMACCL+YRGDVVPKDVNAA+ATIKTKR 
Sbjct  51   AYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKR-  109

Query  566  VQFVDWCPTGFKCGINYQPP  507
                     GFK GINYQPP
Sbjct  110  ---------GFKVGINYQPP  120



>gb|EFB23088.1| hypothetical protein PANDA_009124 [Ailuropoda melanoleuca]
Length=444

 Score =   145 bits (367),  Expect(2) = 7e-66, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+   PPTV+PGGDLAKVQRAVCM+SN TAV E ++R+DHKFDLMY+KRAF+HWY+ E
Sbjct  357  KVGINNQPPTVMPGGDLAKVQRAVCMLSNTTAVVEAWARLDHKFDLMYAKRAFLHWYIRE  416

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GMEEGEFSEAREDLAALEKDY
Sbjct  417  GMEEGEFSEAREDLAALEKDY  437


 Score =   132 bits (333),  Expect(2) = 7e-66, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A  AY E+LSV +IT+A F+ S+ + KCDPR GKYMACCL+YRGDVVPKDVNAA+A +K+
Sbjct  283  ADNAYREELSVSDITAACFDFSNQLVKCDPRLGKYMACCLLYRGDVVPKDVNAAIAAMKS  342

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            + +VQFVDWCPTGFK GIN QPP
Sbjct  343  RNSVQFVDWCPTGFKVGINNQPP  365



>ref|XP_007606261.1| PREDICTED: tubulin alpha chain-like 3 [Cricetulus griseus]
 ref|XP_007619577.1| PREDICTED: tubulin alpha chain-like 3 [Cricetulus griseus]
Length=446

 Score =   139 bits (351),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAY EQLSVP+IT+A FE S+ + KCDPR GKYMACCL+YRGDVVPKDVN A+A +K+
Sbjct  285  ADKAYQEQLSVPDITAACFEYSNQLVKCDPRLGKYMACCLLYRGDVVPKDVNTAIAAMKS  344

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            + +VQFVDWCPTGFK GIN+QPP
Sbjct  345  RTSVQFVDWCPTGFKVGINHQPP  367


 Score =   138 bits (348),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+   PPTV+PGGDLA+VQR VCM+SN TA+ E ++R+DHKFDLMY+K+AF+HWY+ E
Sbjct  359  KVGINHQPPTVMPGGDLARVQRTVCMLSNTTAIVEAWARLDHKFDLMYAKKAFLHWYITE  418

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GME+GEF EAREDLAALEKDY
Sbjct  419  GMEQGEFVEAREDLAALEKDY  439



>gb|ABA41239.1| alpha-tubulin, partial [Cyanophora paradoxa]
Length=403

 Score =   167 bits (424),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 75/83 (90%), Positives = 79/83 (95%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQLSV EIT++ FEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT
Sbjct  266  AEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  325

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            KRT+Q VDWCPTGFKCGINYQPP
Sbjct  326  KRTIQSVDWCPTGFKCGINYQPP  348


 Score =   110 bits (275),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = -1

Query  526  GLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGM  347
            G+   PPTVVPGGDLAKVQRAVCMISN+TA+A VFSRIDHKFDLMY+KRAFVH  VGEGM
Sbjct  342  GINYQPPTVVPGGDLAKVQRAVCMISNSTAIAXVFSRIDHKFDLMYAKRAFVHXKVGEGM  401



>ref|XP_006158532.1| PREDICTED: tubulin alpha chain-like 3 [Tupaia chinensis]
Length=465

 Score =   139 bits (349),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+ T PP V+PGG LA+VQRAVCM+SN TA+ E ++R+DHKFDLMY+KRAFVHWY+ E
Sbjct  378  KVGINTQPPMVIPGGALAEVQRAVCMLSNTTAIMEAWARLDHKFDLMYAKRAFVHWYIKE  437

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GM+EGEF EAREDLAALEKDY
Sbjct  438  GMDEGEFLEAREDLAALEKDY  458


 Score =   138 bits (348),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQLSV +IT+A FE S+ + KCDPR GKYMACCL+YRGDVVPKDVNAA+A +K+
Sbjct  304  ADKAYHEQLSVSDITAACFEFSNQLVKCDPRLGKYMACCLLYRGDVVPKDVNAAIAAMKS  363

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
              +VQFVDWCPTGFK GIN QPP
Sbjct  364  GSSVQFVDWCPTGFKVGINTQPP  386



>gb|AIA82439.1| alpha-tubulin-like protein 08 [Stentor coeruleus]
Length=438

 Score =   142 bits (358),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = -3

Query  749  KAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  570
            K YHE LSV EIT  +F+PSS++AKCDPRHGKY++CC MYRGDVVPK++N+A++ +K K+
Sbjct  280  KIYHETLSVREITDYLFQPSSLLAKCDPRHGKYVSCCTMYRGDVVPKEINSAISGLKNKK  339

Query  569  TVQFVDWCPTGFKCGINYQPP  507
            T++FVDWCPTGFKCGINY+PP
Sbjct  340  TLEFVDWCPTGFKCGINYEPP  360


 Score =   134 bits (338),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
             G+   PP VVPGGDLAKV RA CMI N+TA+ +VFS ID KFD+MY+KRAF+HW+VGEG
Sbjct  353  CGINYEPPMVVPGGDLAKVSRAACMICNSTAIQDVFSMIDKKFDMMYAKRAFIHWFVGEG  412

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEEGE +EAREDLAALEKDY
Sbjct  413  MEEGELTEAREDLAALEKDY  432



>gb|ELW48334.1| Tubulin alpha chain-like 3, partial [Tupaia chinensis]
Length=446

 Score =   139 bits (349),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+ T PP V+PGG LA+VQRAVCM+SN TA+ E ++R+DHKFDLMY+KRAFVHWY+ E
Sbjct  359  KVGINTQPPMVIPGGALAEVQRAVCMLSNTTAIMEAWARLDHKFDLMYAKRAFVHWYIKE  418

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GM+EGEF EAREDLAALEKDY
Sbjct  419  GMDEGEFLEAREDLAALEKDY  439


 Score =   138 bits (348),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQLSV +IT+A FE S+ + KCDPR GKYMACCL+YRGDVVPKDVNAA+A +K+
Sbjct  285  ADKAYHEQLSVSDITAACFEFSNQLVKCDPRLGKYMACCLLYRGDVVPKDVNAAIAAMKS  344

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
              +VQFVDWCPTGFK GIN QPP
Sbjct  345  GSSVQFVDWCPTGFKVGINTQPP  367



>ref|XP_006734821.1| PREDICTED: tubulin alpha chain-like 3 [Leptonychotes weddellii]
Length=398

 Score =   144 bits (363),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+   PPTV+PGGDLA+VQRAVCM+SN TAV E ++R+DHKFDLMY+KRAF+HWY+ E
Sbjct  311  KVGINNQPPTVMPGGDLARVQRAVCMLSNTTAVVEAWARLDHKFDLMYAKRAFLHWYLRE  370

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GMEEGEFSEAREDLAALEKDY
Sbjct  371  GMEEGEFSEAREDLAALEKDY  391


 Score =   132 bits (333),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A  AY E+LSV +IT+A F+ S+ + KCDPR GKYMACCL+YRGDVVPKDVNAA+A +K+
Sbjct  237  ADHAYREELSVSDITAACFDFSNQLVKCDPRLGKYMACCLLYRGDVVPKDVNAAIAAMKS  296

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            + +VQFVDWCPTGFK GIN QPP
Sbjct  297  RNSVQFVDWCPTGFKVGINNQPP  319



>gb|ABL61124.1| alpha-tubulin [Saccinobaculus environmental sample]
Length=391

 Score =   160 bits (405),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 72/83 (87%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQLSV EIT++ FEP++MMAKCDPR GKYMACC+MYRGDVVPKDVNAAVATIKT
Sbjct  257  AEKAYHEQLSVAEITNSSFEPANMMAKCDPRPGKYMACCMMYRGDVVPKDVNAAVATIKT  316

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            K T+QFVDWCPTGFKCGINYQPP
Sbjct  317  KGTIQFVDWCPTGFKCGINYQPP  339


 Score =   115 bits (289),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
             G+   PPTVVPGGDLAKVQRAVCMISN+TA+AEVFSRID KFDLMY+KRAFVHWYVGEG
Sbjct  332  CGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRIDRKFDLMYAKRAFVHWYVGEG  391



>ref|XP_006516544.1| PREDICTED: tubulin alpha chain-like 3 isoform X2 [Mus musculus]
Length=315

 Score =   138 bits (348),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+   PP VVPGGDLA+VQRAVCM+SN TA+ E ++R+DHKFDLMY+K+AF+HWY+ E
Sbjct  228  KVGINYQPPAVVPGGDLARVQRAVCMLSNTTAIVEAWARLDHKFDLMYAKKAFLHWYITE  287

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GME GEF EAREDLAALEKDY
Sbjct  288  GMELGEFVEAREDLAALEKDY  308


 Score =   137 bits (346),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAY EQLSV ++T++ FE S+ + KCDPR GKYMACCL+YRGDVVPKDVN A+A +K+
Sbjct  154  AEKAYQEQLSVSDVTASCFEVSNQLVKCDPRLGKYMACCLLYRGDVVPKDVNEAIAAMKS  213

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            + +VQFVDWCPTGFK GINYQPP
Sbjct  214  RTSVQFVDWCPTGFKVGINYQPP  236



>ref|XP_008703668.1| PREDICTED: tubulin alpha chain-like 3 [Ursus maritimus]
Length=461

 Score =   142 bits (359),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+   PPTV+PGGDLAKVQRAVCM+SN TA+ E ++R+DHKFDLMY+KRAF+HWY+ E
Sbjct  374  KVGINNQPPTVMPGGDLAKVQRAVCMLSNTTAIVEAWARLDHKFDLMYAKRAFLHWYIRE  433

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GMEE EFSEAREDLAALEKDY
Sbjct  434  GMEEDEFSEAREDLAALEKDY  454


 Score =   133 bits (334),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A  AY E+LSV +IT+A F+ S+ + KCDPR GKYMACCL+YRGDVVPKDVNAA+A +K+
Sbjct  300  ADNAYREELSVSDITAACFDFSNQLVKCDPRLGKYMACCLLYRGDVVPKDVNAAIAAMKS  359

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            + +VQFVDWCPTGFK GIN QPP
Sbjct  360  RNSVQFVDWCPTGFKVGINNQPP  382



>ref|XP_008821462.1| PREDICTED: tubulin alpha chain-like 3 [Nannospalax galili]
Length=453

 Score =   140 bits (352),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHE LSVP+IT+A FE S+ + +CDPR GKYMACCL+YRGDVVPKDVN A+A++K+
Sbjct  295  ADKAYHEHLSVPDITAACFEFSNQLVRCDPRLGKYMACCLLYRGDVVPKDVNVAIASMKS  354

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            + +VQFVDWCPTGFK GIN+QPP
Sbjct  355  RTSVQFVDWCPTGFKVGINHQPP  377


 Score =   135 bits (341),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+   PP V+PGGDLA VQRAVCM+SN TA+ E ++R+DHKFDLM++K+AF+HWY+ E
Sbjct  369  KVGINHQPPMVMPGGDLAPVQRAVCMLSNTTAIVEAWARLDHKFDLMFAKKAFLHWYITE  428

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GME+GEF+EAREDLAALEKDY
Sbjct  429  GMEQGEFTEAREDLAALEKDY  449



>dbj|GAA36475.2| tubulin alpha [Clonorchis sinensis]
Length=559

 Score =   149 bits (375),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            VG+   PPTV+PGGDLAKV RAVCM+SN TAVAE ++RIDHKFDLMY+KRAFVHW+VGEG
Sbjct  462  VGINCQPPTVIPGGDLAKVPRAVCMLSNTTAVAECWARIDHKFDLMYTKRAFVHWFVGEG  521

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEEGEFSEAREDLAALE+DY
Sbjct  522  MEEGEFSEAREDLAALERDY  541


 Score =   127 bits (318),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 64/81 (79%), Gaps = 0/81 (0%)
 Frame = -3

Query  749  KAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  570
            +A HE +SV EIT+  FEPS+ +  CDPR GKYM+CCL+YRGDV PKDVN A+A +K  R
Sbjct  389  RACHEPMSVAEITNTCFEPSNQLVLCDPRRGKYMSCCLLYRGDVTPKDVNLAIANVKASR  448

Query  569  TVQFVDWCPTGFKCGINYQPP  507
             +QFVDWCPTGFK GIN QPP
Sbjct  449  VIQFVDWCPTGFKVGINCQPP  469



>ref|XP_006516542.1| PREDICTED: tubulin alpha chain-like 3 isoform X1 [Mus musculus]
Length=326

 Score =   138 bits (347),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+   PP VVPGGDLA+VQRAVCM+SN TA+ E ++R+DHKFDLMY+K+AF+HWY+ E
Sbjct  239  KVGINYQPPAVVPGGDLARVQRAVCMLSNTTAIVEAWARLDHKFDLMYAKKAFLHWYITE  298

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GME GEF EAREDLAALEKDY
Sbjct  299  GMELGEFVEAREDLAALEKDY  319


 Score =   137 bits (346),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAY EQLSV ++T++ FE S+ + KCDPR GKYMACCL+YRGDVVPKDVN A+A +K+
Sbjct  165  AEKAYQEQLSVSDVTASCFEVSNQLVKCDPRLGKYMACCLLYRGDVVPKDVNEAIAAMKS  224

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            + +VQFVDWCPTGFK GINYQPP
Sbjct  225  RTSVQFVDWCPTGFKVGINYQPP  247



>ref|XP_005320457.1| PREDICTED: tubulin alpha chain-like 3 [Ictidomys tridecemlineatus]
Length=521

 Score =   139 bits (349),  Expect(2) = 6e-65, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+   PP V+PGGDLA+VQRAVCM+SN TA+AE ++R+D+KFDLMY+K+AF+HWY+ E
Sbjct  434  KVGINHQPPAVMPGGDLARVQRAVCMLSNTTAIAEAWARLDYKFDLMYAKKAFLHWYITE  493

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GME+GEFSEAREDLAALEKDY
Sbjct  494  GMEQGEFSEAREDLAALEKDY  514


 Score =   137 bits (344),  Expect(2) = 6e-65, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHE  SVP+IT+A FE S+ M KCDP+ GKYMACCL+YRGDVVP+DVNAA+A +K 
Sbjct  360  ADKAYHEHPSVPDITAACFELSNQMVKCDPQLGKYMACCLLYRGDVVPRDVNAAIAAMKL  419

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            + +VQFVDWCPTGFK GIN+QPP
Sbjct  420  RNSVQFVDWCPTGFKVGINHQPP  442



>ref|XP_008705617.1| PREDICTED: LOW QUALITY PROTEIN: tubulin alpha chain-like [Ursus 
maritimus]
Length=291

 Score =   144 bits (362),  Expect(2) = 6e-65, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQLSV EIT+A FEP+S M KCDP HGKYMAC L+Y G++VPKDV+AA+ TIKT
Sbjct  85   AEKAYHEQLSVAEITTACFEPASQMVKCDPHHGKYMACYLLYSGNIVPKDVSAAIVTIKT  144

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            K T+QF+DWCPTGF+ GINYQPP
Sbjct  145  KHTIQFMDWCPTGFRVGINYQPP  167


 Score =   131 bits (330),  Expect(2) = 6e-65, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            VG+   PPTVVP GDLA+VQRAVC+ISN T ++E ++ +DHKFDLMY++ AFVHWYVGEG
Sbjct  160  VGINYQPPTVVPVGDLARVQRAVCVISNITDISEAWAFLDHKFDLMYARLAFVHWYVGEG  219

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEEGEFSEA ED+AALEKDY
Sbjct  220  MEEGEFSEACEDMAALEKDY  239



>ref|XP_009493580.1| tubulin alpha-1C chain [Fonticula alba]
 gb|KCV72002.1| tubulin alpha-1C chain [Fonticula alba]
Length=417

 Score =   137 bits (346),  Expect(2) = 8e-65, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = -3

Query  749  KAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  570
            KA HE++SV EI+ A FEP S M KCDPR GKYMACC++YRGDVVPKDVN A+A IK++ 
Sbjct  248  KAIHEKMSVAEISYACFEPHSQMVKCDPRRGKYMACCMLYRGDVVPKDVNTAIANIKSRS  307

Query  569  TVQFVDWCPTGFKCGINYQPP  507
            TVQFVDW PTGFK G+NYQPP
Sbjct  308  TVQFVDWSPTGFKVGLNYQPP  328


 Score =   137 bits (345),  Expect(2) = 8e-65, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            VGL   PPTVVPGGDLA+V R++C++SN TA+AE + R++ KFDL+Y+KRAFVHWYVGEG
Sbjct  321  VGLNYQPPTVVPGGDLARVPRSLCLLSNTTAIAEAWQRLNDKFDLLYAKRAFVHWYVGEG  380

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEEGEF+EAREDLAALE+DY
Sbjct  381  MEEGEFAEAREDLAALERDY  400



>ref|XP_004757979.1| PREDICTED: tubulin alpha chain-like 3 isoform X2 [Mustela putorius 
furo]
 ref|XP_004806634.1| PREDICTED: tubulin alpha chain-like 3 isoform X2 [Mustela putorius 
furo]
Length=494

 Score =   141 bits (356),  Expect(2) = 9e-65, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+   PP V+PGGDLAK+QRAVCM+SN TAV E ++R+DHKFDLMY+KRAF+HWY  E
Sbjct  407  KVGINNRPPMVMPGGDLAKIQRAVCMMSNTTAVVEAWARLDHKFDLMYAKRAFLHWYSRE  466

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GMEEGEFSEAREDLAALEKDY
Sbjct  467  GMEEGEFSEAREDLAALEKDY  487


 Score =   133 bits (335),  Expect(2) = 9e-65, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A  AYHE+LSV +IT+A F+ S  + KCDPR GKYMACCL+YRGDVVPKDVNAA+A +K+
Sbjct  333  ADHAYHEELSVSDITAACFDFSHQLVKCDPRLGKYMACCLLYRGDVVPKDVNAAIAAMKS  392

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            + +VQFVDWCPTGFK GIN +PP
Sbjct  393  RNSVQFVDWCPTGFKVGINNRPP  415



>ref|XP_004757978.1| PREDICTED: tubulin alpha chain-like 3 isoform X1 [Mustela putorius 
furo]
 ref|XP_004806633.1| PREDICTED: tubulin alpha chain-like 3 isoform X1 [Mustela putorius 
furo]
Length=494

 Score =   141 bits (356),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+   PP V+PGGDLAK+QRAVCM+SN TAV E ++R+DHKFDLMY+KRAF+HWY  E
Sbjct  407  KVGINNRPPMVMPGGDLAKIQRAVCMMSNTTAVVEAWARLDHKFDLMYAKRAFLHWYSRE  466

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GMEEGEFSEAREDLAALEKDY
Sbjct  467  GMEEGEFSEAREDLAALEKDY  487


 Score =   133 bits (335),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A  AYHE+LSV +IT+A F+ S  + KCDPR GKYMACCL+YRGDVVPKDVNAA+A +K+
Sbjct  333  ADHAYHEELSVSDITAACFDFSHQLVKCDPRLGKYMACCLLYRGDVVPKDVNAAIAAMKS  392

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            + +VQFVDWCPTGFK GIN +PP
Sbjct  393  RNSVQFVDWCPTGFKVGINNRPP  415



>ref|NP_001029051.2| tubulin alpha chain-like 3 [Mus musculus]
 sp|Q3UX10.2|TBAL3_MOUSE RecName: Full=Tubulin alpha chain-like 3 [Mus musculus]
 gb|AAI47508.1| Tubal3 protein [Mus musculus]
Length=446

 Score =   137 bits (345),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAY EQLSV ++T++ FE S+ + KCDPR GKYMACCL+YRGDVVPKDVN A+A +K+
Sbjct  285  AEKAYQEQLSVSDVTASCFEVSNQLVKCDPRLGKYMACCLLYRGDVVPKDVNEAIAAMKS  344

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            + +VQFVDWCPTGFK GINYQPP
Sbjct  345  RTSVQFVDWCPTGFKVGINYQPP  367


 Score =   137 bits (345),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+   PP VVPGGDLA+VQRAVCM+SN TA+ E ++R+DHKFDLMY+K+AF+HWY+ E
Sbjct  359  KVGINYQPPAVVPGGDLARVQRAVCMLSNTTAIVEAWARLDHKFDLMYAKKAFLHWYITE  418

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GME GEF EAREDLAALEKDY
Sbjct  419  GMELGEFVEAREDLAALEKDY  439



>dbj|BAE22753.1| unnamed protein product [Mus musculus]
Length=446

 Score =   137 bits (345),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAY EQLSV ++T++ FE S+ + KCDPR GKYMACCL+YRGDVVPKDVN A+A +K+
Sbjct  285  AEKAYQEQLSVSDVTASCFEVSNQLVKCDPRLGKYMACCLLYRGDVVPKDVNEAIAAMKS  344

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            + +VQFVDWCPTGFK GINYQPP
Sbjct  345  RTSVQFVDWCPTGFKVGINYQPP  367


 Score =   137 bits (345),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+   PP VVPGGDLA+VQRAVCM+SN TA+ E ++R+DHKFDLMY+K+AF+HWY+ E
Sbjct  359  KVGINYQPPAVVPGGDLARVQRAVCMLSNTTAIVEAWARLDHKFDLMYAKKAFLHWYITE  418

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GME GEF EAREDLAALEKDY
Sbjct  419  GMELGEFVEAREDLAALEKDY  439



>gb|EDL32234.1| mCG1728 [Mus musculus]
Length=429

 Score =   137 bits (345),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+   PP VVPGGDLA+VQRAVCM+SN TA+ E ++R+DHKFDLMY+K+AF+HWY+ E
Sbjct  342  KVGINYQPPAVVPGGDLARVQRAVCMLSNTTAIVEAWARLDHKFDLMYAKKAFLHWYITE  401

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GME GEF EAREDLAALEKDY
Sbjct  402  GMELGEFVEAREDLAALEKDY  422


 Score =   137 bits (344),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAY EQLSV ++T++ FE S+ + KCDPR GKYMACCL+YRGDVVPKDVN A+A +K+
Sbjct  268  AEKAYQEQLSVSDVTASCFEVSNQLVKCDPRLGKYMACCLLYRGDVVPKDVNEAIAAMKS  327

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            + +VQFVDWCPTGFK GINYQPP
Sbjct  328  RTSVQFVDWCPTGFKVGINYQPP  350



>ref|XP_005071798.1| PREDICTED: tubulin alpha chain-like 3 [Mesocricetus auratus]
Length=382

 Score =   139 bits (349),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+   PPTV+PGGDLA+VQR VCM+SN+TA+ E ++R+DHKFDLMY+K+AF+HWY+ E
Sbjct  295  KVGINHQPPTVMPGGDLARVQRTVCMLSNSTAIVEAWARLDHKFDLMYAKKAFLHWYITE  354

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GME+GEF EAREDLAALEKDY
Sbjct  355  GMEQGEFIEAREDLAALEKDY  375


 Score =   135 bits (340),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAY E LSV +IT+A FE S+ + KCDPR GKYMACCL+YRGDVVPKDVN A+A +K+
Sbjct  221  AEKAYQEHLSVTDITAACFEYSNQLVKCDPRLGKYMACCLLYRGDVVPKDVNTAIAAMKS  280

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            + +VQFVDWCPTGFK GIN+QPP
Sbjct  281  RTSVQFVDWCPTGFKVGINHQPP  303



>ref|XP_005617236.1| PREDICTED: tubulin, alpha-like 3 [Canis lupus familiaris]
Length=446

 Score =   145 bits (365),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+ + PPTV+PGGDLAKVQRAVCM+SNNTAV E ++R+DHKFDLMY+KRAF+HWY  E
Sbjct  359  KVGINSQPPTVMPGGDLAKVQRAVCMLSNNTAVVEAWARLDHKFDLMYAKRAFLHWYTRE  418

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GMEE EFSEAREDLAALEKDY
Sbjct  419  GMEEDEFSEAREDLAALEKDY  439


 Score =   129 bits (323),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A  AY E+LSV +IT+A F+ S+ + KC+PR GKYMACCL+YRGDVVPKDVN+A+A +K+
Sbjct  285  AESAYREELSVCDITAACFDFSNQLVKCNPRLGKYMACCLLYRGDVVPKDVNSAIAAMKS  344

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            + +VQFVDWCPTGFK GIN QPP
Sbjct  345  RNSVQFVDWCPTGFKVGINSQPP  367



>gb|EHB16400.1| Tubulin alpha chain-like 3, partial [Heterocephalus glaber]
Length=441

 Score =   139 bits (349),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQ+SVP+ITSA FE S+ + KCDP+ GKY+ACCL+YRGDVVPKDVN+A+A +K+
Sbjct  284  ADKAYHEQISVPDITSACFEFSNQLVKCDPQLGKYIACCLLYRGDVVPKDVNSAIAAMKS  343

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            K ++QFVDWCPTGFK GIN QPP
Sbjct  344  KGSIQFVDWCPTGFKVGINSQPP  366


 Score =   135 bits (339),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+ + PP V PGGDLA+VQRA CM+SN TA+ E +SR++HKFDLMY+K+AF+HWY+ E
Sbjct  358  KVGINSQPPMVTPGGDLAQVQRAACMLSNTTAIVEAWSRLNHKFDLMYAKKAFLHWYITE  417

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GME+ EFSEAREDLAALEKDY
Sbjct  418  GMEQEEFSEAREDLAALEKDY  438



>ref|XP_011281904.1| PREDICTED: tubulin alpha chain-like 3 [Felis catus]
Length=468

 Score =   140 bits (354),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+ + PPTV PGGDLAK +RAVCM+SN TAV E ++R+DHKFDLMY+KRAF+HWYVGE
Sbjct  381  KVGINSQPPTVTPGGDLAKARRAVCMLSNTTAVVEAWARLDHKFDLMYAKRAFLHWYVGE  440

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GM+EGEF EAR+DLAALEKDY
Sbjct  441  GMDEGEFLEARKDLAALEKDY  461


 Score =   132 bits (333),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A  AYHE+LSV +IT+A F+ S+ + KCDPR GKYMACCL+YRGDVVPKDVNAA+A  K 
Sbjct  307  ADSAYHEELSVSDITAACFDFSNQLIKCDPRLGKYMACCLLYRGDVVPKDVNAAIAATKL  366

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            + +VQF+DWCPTGFK GIN QPP
Sbjct  367  RSSVQFIDWCPTGFKVGINSQPP  389



>ref|XP_004906049.1| PREDICTED: tubulin alpha chain-like 3 [Heterocephalus glaber]
 ref|XP_004860052.1| PREDICTED: tubulin alpha chain-like 3 [Heterocephalus glaber]
Length=545

 Score =   138 bits (348),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQ+SVP+ITSA FE S+ + KCDP+ GKY+ACCL+YRGDVVPKDVN+A+A +K+
Sbjct  381  ADKAYHEQISVPDITSACFEFSNQLVKCDPQLGKYIACCLLYRGDVVPKDVNSAIAAMKS  440

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            K ++QFVDWCPTGFK GIN QPP
Sbjct  441  KGSIQFVDWCPTGFKVGINSQPP  463


 Score =   134 bits (338),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+ + PP V PGGDLA+VQRA CM+SN TA+ E +SR++HKFDLMY+K+AF+HWY+ E
Sbjct  455  KVGINSQPPMVTPGGDLAQVQRAACMLSNTTAIVEAWSRLNHKFDLMYAKKAFLHWYITE  514

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GME+ EFSEAREDLAALEKDY
Sbjct  515  GMEQEEFSEAREDLAALEKDY  535



>ref|XP_008216918.1| PREDICTED: tubulin alpha-8 chain-like [Nasonia vitripennis]
Length=246

 Score =   144 bits (362),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHE +SV EITS  FEP + M KCDPR GKYMACCL+YRGDVVPKDVN+A+A++K+
Sbjct  76   ADKAYHEGMSVGEITSECFEPGNQMVKCDPREGKYMACCLLYRGDVVPKDVNSAIASVKS  135

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            K +V+FVDWCPTGFK GINYQPP
Sbjct  136  KSSVRFVDWCPTGFKVGINYQPP  158


 Score =   129 bits (324),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            VG+   PPT+VPGGDLAK+QRAV M+ N TA+ E +S+++ KFDLM++KRAFVHWYVGEG
Sbjct  151  VGINYQPPTIVPGGDLAKIQRAVSMLCNTTAIGEAWSKLNLKFDLMFNKRAFVHWYVGEG  210

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEE EF EAREDLAALE+DY
Sbjct  211  MEEVEFIEAREDLAALERDY  230



>ref|XP_004588609.1| PREDICTED: tubulin alpha chain-like 3 [Ochotona princeps]
Length=500

 Score =   140 bits (352),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+  +PP V+PGGDLAK+QRAVCM+SN TA+ E ++R+DHKFDLMY+KRAF+HWY+ E
Sbjct  413  KVGINNHPPKVMPGGDLAKIQRAVCMLSNTTAIVEAWARLDHKFDLMYAKRAFLHWYIQE  472

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GME+ EFSEAREDLAALEKDY
Sbjct  473  GMEQSEFSEAREDLAALEKDY  493


 Score =   132 bits (333),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A +AYHE  SV +IT+A FE S+ + KCDP  GKYMACCL+YRGDVVPKDVNAA+AT+K+
Sbjct  339  AERAYHEHPSVSDITAACFEFSNQLVKCDPHLGKYMACCLLYRGDVVPKDVNAAIATLKS  398

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            + +VQFVDWCPTGFK GIN  PP
Sbjct  399  RNSVQFVDWCPTGFKVGINNHPP  421



>ref|NP_001165335.1| tubulin alpha chain-like 3 isoform 2 [Homo sapiens]
 gb|AAH98247.1| TUBAL3 protein [Homo sapiens]
 gb|AIC52326.1| TUBAL3, partial [synthetic construct]
Length=406

 Score =   136 bits (342),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQ SV +IT+A FE S+ + KCDPR GKYMACCL+YRGDVVPK+VNAA+A  K+
Sbjct  245  ADKAYHEQFSVSDITTACFESSNQLVKCDPRLGKYMACCLLYRGDVVPKEVNAAIAATKS  304

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            + +VQFVDWCPTGFK GIN +PP
Sbjct  305  RHSVQFVDWCPTGFKVGINNRPP  327


 Score =   136 bits (342),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+   PPTV+PGGDLAKV R++CM+SN TA+ E ++R+DHKFDLMY+KRAF+HWY+ E
Sbjct  319  KVGINNRPPTVMPGGDLAKVHRSICMLSNTTAIVEAWARLDHKFDLMYAKRAFLHWYLRE  378

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GMEE EF EAREDLAALE+DY
Sbjct  379  GMEEAEFLEAREDLAALERDY  399



>dbj|BAG59224.1| unnamed protein product [Homo sapiens]
Length=406

 Score =   136 bits (342),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQ SV +IT+A FE S+ + KCDPR GKYMACCL+YRGDVVPK+VNAA+A  K+
Sbjct  245  ADKAYHEQFSVSDITTACFESSNQLVKCDPRLGKYMACCLLYRGDVVPKEVNAAIAATKS  304

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            + +VQFVDWCPTGFK GIN +PP
Sbjct  305  RHSVQFVDWCPTGFKVGINNRPP  327


 Score =   136 bits (342),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+   PPTV+PGGDLAKV R++CM+SN TA+ E ++R+DHKFDLMY+KRAF+HWY+ E
Sbjct  319  KVGINNRPPTVMPGGDLAKVHRSICMLSNTTAIVEAWARLDHKFDLMYAKRAFLHWYLRE  378

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GMEE EF EAREDLAALE+DY
Sbjct  379  GMEEAEFLEAREDLAALERDY  399



>ref|XP_004411887.1| PREDICTED: tubulin alpha chain-like 3 [Odobenus rosmarus divergens]
Length=453

 Score =   145 bits (365),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+   PPTV+PGGDLAKVQRAVCM+SN TAV E ++R+DHKFDLMY+KRAF+HWY+ E
Sbjct  366  KVGINNQPPTVMPGGDLAKVQRAVCMLSNTTAVVEAWARLDHKFDLMYAKRAFLHWYLRE  425

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GMEEGEFSEAREDLAALEKDY
Sbjct  426  GMEEGEFSEAREDLAALEKDY  446


 Score =   127 bits (319),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A  AY E+ SV +IT+A F+ S+ + KC+PR GKYMACCL+YRGDVVPKDVNAA+A +K+
Sbjct  292  ADHAYREEPSVSDITAACFDFSNQLVKCNPRLGKYMACCLLYRGDVVPKDVNAAIAAMKS  351

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            + +VQFVDWCPTGFK GIN QPP
Sbjct  352  RNSVQFVDWCPTGFKVGINNQPP  374



>ref|NP_079079.1| tubulin alpha chain-like 3 isoform 1 [Homo sapiens]
 sp|A6NHL2.2|TBAL3_HUMAN RecName: Full=Tubulin alpha chain-like 3 [Homo sapiens]
 dbj|BAB15110.1| unnamed protein product [Homo sapiens]
 gb|AAH99716.1| Tubulin, alpha-like 3 [Homo sapiens]
 gb|AAI05635.1| Tubulin, alpha-like 3 [Homo sapiens]
 gb|AIC57122.1| TUBAL3, partial [synthetic construct]
Length=446

 Score =   135 bits (341),  Expect(2) = 8e-64, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQ SV +IT+A FE S+ + KCDPR GKYMACCL+YRGDVVPK+VNAA+A  K+
Sbjct  285  ADKAYHEQFSVSDITTACFESSNQLVKCDPRLGKYMACCLLYRGDVVPKEVNAAIAATKS  344

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            + +VQFVDWCPTGFK GIN +PP
Sbjct  345  RHSVQFVDWCPTGFKVGINNRPP  367


 Score =   135 bits (341),  Expect(2) = 8e-64, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+   PPTV+PGGDLAKV R++CM+SN TA+ E ++R+DHKFDLMY+KRAF+HWY+ E
Sbjct  359  KVGINNRPPTVMPGGDLAKVHRSICMLSNTTAIVEAWARLDHKFDLMYAKRAFLHWYLRE  418

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GMEE EF EAREDLAALE+DY
Sbjct  419  GMEEAEFLEAREDLAALERDY  439



>ref|XP_003786941.1| PREDICTED: tubulin alpha chain-like 3 [Otolemur garnettii]
Length=468

 Score =   138 bits (347),  Expect(2) = 8e-64, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+ + PP V+PGGDLA VQRAVCM+SN+TA+ E ++R+DHKFDLMY+KRAF+HWY+ E
Sbjct  373  KVGINSQPPAVMPGGDLASVQRAVCMLSNSTAIMEAWARLDHKFDLMYAKRAFLHWYLRE  432

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GMEEGEF EAREDLAALE+DY
Sbjct  433  GMEEGEFLEAREDLAALERDY  453


 Score =   133 bits (335),  Expect(2) = 8e-64, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KA+HE  SV +IT+A F+PSS + +CDPR G+YMACCL+YRGDVVPK+VNAA+  +K+
Sbjct  299  ANKAFHEHFSVEDITAACFQPSSQLVECDPRRGRYMACCLLYRGDVVPKEVNAAITAVKS  358

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            + +V+FVDWCPTGFK GIN QPP
Sbjct  359  RNSVRFVDWCPTGFKVGINSQPP  381



>gb|EAW86447.1| tubulin, alpha-like 3 [Homo sapiens]
Length=446

 Score =   135 bits (341),  Expect(2) = 9e-64, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQ SV +IT+A FE S+ + KCDPR GKYMACCL+YRGDVVPK+VNAA+A  K+
Sbjct  285  ADKAYHEQFSVSDITTACFESSNQLVKCDPRLGKYMACCLLYRGDVVPKEVNAAIAATKS  344

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            + +VQFVDWCPTGFK GIN +PP
Sbjct  345  RHSVQFVDWCPTGFKVGINNRPP  367


 Score =   135 bits (341),  Expect(2) = 9e-64, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+   PPTV+PGGDLAKV R++CM+SN TA+ E ++R+DHKFDLMY+KRAF+HWY+ E
Sbjct  359  KVGINNRPPTVMPGGDLAKVHRSICMLSNTTAIVEAWARLDHKFDLMYAKRAFLHWYLRE  418

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GMEE EF EAREDLAALE+DY
Sbjct  419  GMEEAEFLEAREDLAALERDY  439



>ref|XP_003777558.1| PREDICTED: tubulin alpha chain-like 3 isoform X2 [Pongo abelii]
Length=406

 Score =   136 bits (343),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+   PPTV+PGGDLAKV R+VCM+SN TA+ E ++R+DHKFDLMY+KRAF+HWY+ E
Sbjct  319  KVGINNRPPTVMPGGDLAKVHRSVCMLSNTTAIVEAWARLDHKFDLMYAKRAFLHWYLRE  378

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GMEE EF EAREDLAALE+DY
Sbjct  379  GMEEAEFLEAREDLAALERDY  399


 Score =   135 bits (339),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQ SV +IT+A FE S+ + KCDPR GKYMACCL+YRGDVVPK+VNAA+A  K+
Sbjct  245  AEKAYHEQFSVSDITTACFESSNQLVKCDPRLGKYMACCLLYRGDVVPKEVNAAIAATKS  304

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
              +VQFVDWCPTGFK GIN +PP
Sbjct  305  GHSVQFVDWCPTGFKVGINNRPP  327



>ref|XP_003827830.1| PREDICTED: tubulin alpha chain-like 3 isoform X2 [Pan paniscus]
Length=406

 Score =   136 bits (342),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+   PPTV+PGGDLAKV R++CM+SN TA+ E ++R+DHKFDLMY+KRAF+HWY+ E
Sbjct  319  KVGINNRPPTVMPGGDLAKVHRSICMLSNTTAIVEAWARLDHKFDLMYAKRAFLHWYLRE  378

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GMEE EF EAREDLAALE+DY
Sbjct  379  GMEEAEFLEAREDLAALERDY  399


 Score =   135 bits (339),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQ SV +IT+A FE S+ + KCDPR GKYMACCL+YRGDV+PK+VNAA+A  K+
Sbjct  245  ADKAYHEQFSVSDITTACFEFSNQLVKCDPRLGKYMACCLLYRGDVIPKEVNAAIAATKS  304

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            + +VQFVDWCPTGFK GIN +PP
Sbjct  305  RHSVQFVDWCPTGFKVGINNRPP  327



>ref|XP_002820535.2| PREDICTED: tubulin alpha chain-like 3 isoform X1 [Pongo abelii]
Length=446

 Score =   136 bits (342),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+   PPTV+PGGDLAKV R+VCM+SN TA+ E ++R+DHKFDLMY+KRAF+HWY+ E
Sbjct  359  KVGINNRPPTVMPGGDLAKVHRSVCMLSNTTAIVEAWARLDHKFDLMYAKRAFLHWYLRE  418

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GMEE EF EAREDLAALE+DY
Sbjct  419  GMEEAEFLEAREDLAALERDY  439


 Score =   134 bits (338),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQ SV +IT+A FE S+ + KCDPR GKYMACCL+YRGDVVPK+VNAA+A  K+
Sbjct  285  AEKAYHEQFSVSDITTACFESSNQLVKCDPRLGKYMACCLLYRGDVVPKEVNAAIAATKS  344

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
              +VQFVDWCPTGFK GIN +PP
Sbjct  345  GHSVQFVDWCPTGFKVGINNRPP  367



>ref|XP_003410795.1| PREDICTED: LOW QUALITY PROTEIN: tubulin alpha chain-like 3 [Loxodonta 
africana]
Length=479

 Score =   140 bits (352),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+   PPTVVPGGDLAKVQRAVCM+SN TA+AE ++ +DHKFDLMY+KR F+HWY+ E
Sbjct  392  KVGINNQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWAXLDHKFDLMYTKRVFLHWYIKE  451

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GMEEGEFS AREDLA LEKDY
Sbjct  452  GMEEGEFSMAREDLAVLEKDY  472


 Score =   130 bits (328),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A K YHEQ SV +IT+A FE SS + KCDP  GKYMACCL+YRGDVV KD+N+A+A +K+
Sbjct  318  ADKPYHEQFSVQDITAACFEFSSQLVKCDPHLGKYMACCLLYRGDVVSKDINSAIAAMKS  377

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            + +VQFVDWCPTGFK GIN QPP
Sbjct  378  RNSVQFVDWCPTGFKVGINNQPP  400



>ref|XP_009212160.1| PREDICTED: tubulin alpha chain-like 3 isoform X2 [Papio anubis]
Length=360

 Score =   137 bits (346),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+   PPTV+PGGDLAKV RAVCM+SN TA+ E ++R+DHKFDLMY+KRAF+HWY+ E
Sbjct  273  KVGINNRPPTVMPGGDLAKVHRAVCMLSNTTAIVEAWARLDHKFDLMYAKRAFLHWYLRE  332

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GMEE EF EAREDLAALE+DY
Sbjct  333  GMEEAEFLEAREDLAALERDY  353


 Score =   133 bits (334),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAY EQ SV +IT+A FE S+ + KCDPR GKYMACCL+YRGDVVPK+VNAA+A  K+
Sbjct  199  ADKAYREQFSVSDITTACFESSNQLVKCDPRLGKYMACCLLYRGDVVPKEVNAAIAATKS  258

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            + +VQFVDWCPTGFK GIN +PP
Sbjct  259  RHSVQFVDWCPTGFKVGINNRPP  281



>ref|XP_796279.1| PREDICTED: tubulin alpha-1C chain-like [Strongylocentrotus purpuratus]
Length=466

 Score =   139 bits (350),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            VG+ + PP++VPGGDLAKVQR  CM+SN TA+   ++R++HKFDLMY+KRAFVHW+VGEG
Sbjct  369  VGINSTPPSIVPGGDLAKVQRGACMLSNTTAIVSAWARVNHKFDLMYAKRAFVHWFVGEG  428

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEEGEFSE+R+DLAALEKDY
Sbjct  429  MEEGEFSESRDDLAALEKDY  448


 Score =   131 bits (329),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = -3

Query  749  KAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  570
            K++HE+ SV EIT++ FEP + M KCDPR GKYM+CCL+YRG++VPKD+ +A++ IKT R
Sbjct  296  KSHHERFSVAEITNSCFEPGNQMVKCDPREGKYMSCCLLYRGEIVPKDIASAISKIKTMR  355

Query  569  TVQFVDWCPTGFKCGINYQPPN  504
            T+QFVDWCPTGFK GIN  PP+
Sbjct  356  TIQFVDWCPTGFKVGINSTPPS  377



>ref|XP_003827829.1| PREDICTED: tubulin alpha chain-like 3 isoform X1 [Pan paniscus]
Length=446

 Score =   136 bits (342),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+   PPTV+PGGDLAKV R++CM+SN TA+ E ++R+DHKFDLMY+KRAF+HWY+ E
Sbjct  359  KVGINNRPPTVMPGGDLAKVHRSICMLSNTTAIVEAWARLDHKFDLMYAKRAFLHWYLRE  418

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GMEE EF EAREDLAALE+DY
Sbjct  419  GMEEAEFLEAREDLAALERDY  439


 Score =   134 bits (338),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQ SV +IT+A FE S+ + KCDPR GKYMACCL+YRGDV+PK+VNAA+A  K+
Sbjct  285  ADKAYHEQFSVSDITTACFEFSNQLVKCDPRLGKYMACCLLYRGDVIPKEVNAAIAATKS  344

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            + +VQFVDWCPTGFK GIN +PP
Sbjct  345  RHSVQFVDWCPTGFKVGINNRPP  367



>ref|XP_003903391.2| PREDICTED: tubulin alpha chain-like 3 isoform X1 [Papio anubis]
Length=395

 Score =   137 bits (346),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+   PPTV+PGGDLAKV RAVCM+SN TA+ E ++R+DHKFDLMY+KRAF+HWY+ E
Sbjct  308  KVGINNRPPTVMPGGDLAKVHRAVCMLSNTTAIVEAWARLDHKFDLMYAKRAFLHWYLRE  367

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GMEE EF EAREDLAALE+DY
Sbjct  368  GMEEAEFLEAREDLAALERDY  388


 Score =   133 bits (334),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAY EQ SV +IT+A FE S+ + KCDPR GKYMACCL+YRGDVVPK+VNAA+A  K+
Sbjct  234  ADKAYREQFSVSDITTACFESSNQLVKCDPRLGKYMACCLLYRGDVVPKEVNAAIAATKS  293

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            + +VQFVDWCPTGFK GIN +PP
Sbjct  294  RHSVQFVDWCPTGFKVGINNRPP  316



>gb|EPY82418.1| tubulin alpha-1A chain [Camelus ferus]
Length=463

 Score =   147 bits (370),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A K Y EQLSV EIT+A FEP++ M KCDP HGKY+ACCL+YRGDVVPKDVNAA+ATIKT
Sbjct  242  AEKTYQEQLSVAEITNACFEPANEMVKCDPHHGKYIACCLLYRGDVVPKDVNAAIATIKT  301

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            K ++QFVDWCPTGFK GINYQPP
Sbjct  302  KCSIQFVDWCPTGFKVGINYQPP  324


 Score =   123 bits (309),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+   PPTVVPGGDLAK Q AVCM+ N TA AE ++ +DHK +LM +K AFVH YVGE
Sbjct  316  KVGINYQPPTVVPGGDLAKAQEAVCMLRNTTATAEAWAHLDHKSELMCAKHAFVHCYVGE  375

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GMEEGEF+EAR+D+AALEKDY
Sbjct  376  GMEEGEFAEARKDMAALEKDY  396


 Score =   103 bits (257),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = -1

Query  487  DLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLA  308
            D  +V +AVCM+SN TA+ E ++ +DHKFDLMY+K AFVHWYVGEGMEEGEFSEARED++
Sbjct  395  DYEEVVKAVCMLSNTTAIVEAWAHLDHKFDLMYAKSAFVHWYVGEGMEEGEFSEAREDMS  454

Query  307  ALEK  296
            AL +
Sbjct  455  ALRR  458



>ref|XP_003951632.1| PREDICTED: tubulin alpha chain-like 3 isoform X2 [Pan troglodytes]
Length=406

 Score =   136 bits (342),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQ SV +IT+A FE S+ + KCDPR GKYMACCL+YRGDVVPK+VNAA+A  K+
Sbjct  245  ADKAYHEQFSVSDITTACFESSNQLVKCDPRLGKYMACCLLYRGDVVPKEVNAAIAATKS  304

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            + +VQFVDWCPTGFK GIN +PP
Sbjct  305  RHSVQFVDWCPTGFKVGINNRPP  327


 Score =   134 bits (337),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+   PPTV+PGGDLAKV +++CM+SN TA+ E ++R+DHKFDLMY+KRAF+HWY+ E
Sbjct  319  KVGINNRPPTVMPGGDLAKVHQSICMLSNTTAIVEAWARLDHKFDLMYAKRAFLHWYLRE  378

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GMEE EF EAREDLAALE+DY
Sbjct  379  GMEEAEFLEAREDLAALERDY  399



>ref|XP_001118645.2| PREDICTED: tubulin alpha chain-like 3-like [Macaca mulatta]
Length=481

 Score =   137 bits (346),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+   PPTV+PGGDLAKV RAVCM+SN TA+ E ++R+DHKFDLMY+KRAF+HWY+ E
Sbjct  394  KVGINNRPPTVMPGGDLAKVHRAVCMLSNTTAIVEAWARLDHKFDLMYAKRAFLHWYLRE  453

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GMEE EF EAREDLAALE+DY
Sbjct  454  GMEEAEFLEAREDLAALERDY  474


 Score =   132 bits (333),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAY EQ SV +IT+A FE S+ + KCDPR GKYMACCL+YRGDVVPK+VNAA+A  K+
Sbjct  320  ADKAYREQFSVSDITTACFESSNQLVKCDPRLGKYMACCLLYRGDVVPKEVNAAIAATKS  379

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            + +VQFVDWCPTGFK GIN +PP
Sbjct  380  RHSVQFVDWCPTGFKVGINNRPP  402



>gb|EHH18859.1| hypothetical protein EGK_19421, partial [Macaca mulatta]
 gb|EHH64526.1| hypothetical protein EGM_17767, partial [Macaca fascicularis]
Length=446

 Score =   137 bits (345),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+   PPTV+PGGDLAKV RAVCM+SN TA+ E ++R+DHKFDLMY+KRAF+HWY+ E
Sbjct  359  KVGINNRPPTVMPGGDLAKVHRAVCMLSNTTAIVEAWARLDHKFDLMYAKRAFLHWYLRE  418

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GMEE EF EAREDLAALE+DY
Sbjct  419  GMEEAEFLEAREDLAALERDY  439


 Score =   132 bits (333),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAY EQ SV +IT+A FE S+ + KCDPR GKYMACCL+YRGDVVPK+VNAA+A  K+
Sbjct  285  ADKAYREQFSVSDITTACFESSNQLVKCDPRLGKYMACCLLYRGDVVPKEVNAAIAATKS  344

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            + +VQFVDWCPTGFK GIN +PP
Sbjct  345  RHSVQFVDWCPTGFKVGINNRPP  367



>ref|XP_521409.4| PREDICTED: tubulin alpha chain-like 3 isoform X1 [Pan troglodytes]
Length=446

 Score =   135 bits (341),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQ SV +IT+A FE S+ + KCDPR GKYMACCL+YRGDVVPK+VNAA+A  K+
Sbjct  285  ADKAYHEQFSVSDITTACFESSNQLVKCDPRLGKYMACCLLYRGDVVPKEVNAAIAATKS  344

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            + +VQFVDWCPTGFK GIN +PP
Sbjct  345  RHSVQFVDWCPTGFKVGINNRPP  367


 Score =   134 bits (336),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+   PPTV+PGGDLAKV +++CM+SN TA+ E ++R+DHKFDLMY+KRAF+HWY+ E
Sbjct  359  KVGINNRPPTVMPGGDLAKVHQSICMLSNTTAIVEAWARLDHKFDLMYAKRAFLHWYLRE  418

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GMEE EF EAREDLAALE+DY
Sbjct  419  GMEEAEFLEAREDLAALERDY  439



>ref|XP_010364789.1| PREDICTED: tubulin alpha chain-like 3 [Rhinopithecus roxellana]
Length=446

 Score =   137 bits (345),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+   PPTV+PGGDLAKV RAVCM+SN TA+ E ++R+DHKFDLMY+KRAF+HWY+ E
Sbjct  359  KVGINNRPPTVMPGGDLAKVHRAVCMLSNTTAIVEAWARLDHKFDLMYAKRAFLHWYLRE  418

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GMEE EF EAREDLAALE+DY
Sbjct  419  GMEEAEFLEAREDLAALERDY  439


 Score =   132 bits (333),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAY EQ SV +IT+A FE S+ + KCDPR GKYMACCL+YRGDVVPK+VNAA+A  K+
Sbjct  285  ADKAYREQFSVSDITTACFESSNQLVKCDPRLGKYMACCLLYRGDVVPKEVNAAIAATKS  344

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            + +VQFVDWCPTGFK GIN +PP
Sbjct  345  RHSVQFVDWCPTGFKVGINNRPP  367



>ref|XP_005564608.1| PREDICTED: tubulin alpha chain-like 3 [Macaca fascicularis]
Length=446

 Score =   137 bits (345),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+   PPTV+PGGDLAKV RAVCM+SN TA+ E ++R+DHKFDLMY+KRAF+HWY+ E
Sbjct  359  KVGINNRPPTVMPGGDLAKVHRAVCMLSNTTAIVEAWARLDHKFDLMYAKRAFLHWYLRE  418

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GMEE EF EAREDLAALE+DY
Sbjct  419  GMEEAEFLEAREDLAALERDY  439


 Score =   132 bits (333),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAY EQ SV +IT+A FE S+ + KCDPR GKYMACCL+YRGDVVPK+VNAA+A  K+
Sbjct  285  ADKAYREQFSVSDITTACFESSNQLVKCDPRLGKYMACCLLYRGDVVPKEVNAAIAATKS  344

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            + +VQFVDWCPTGFK GIN +PP
Sbjct  345  RHSVQFVDWCPTGFKVGINNRPP  367



>gb|AHM94171.1| alpha-tubulin, partial [Menoidium bibacillatum]
Length=353

 Score =   168 bits (425),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 75/83 (90%), Positives = 79/83 (95%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQLSV EIT+AVFEP+SMM KCDPRHGKYMACCLMYRGDVVPKDVNA+VATIKT
Sbjct  225  AEKAYHEQLSVAEITNAVFEPASMMTKCDPRHGKYMACCLMYRGDVVPKDVNASVATIKT  284

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            K T+QFVDWCPTGFKCGINYQPP
Sbjct  285  KHTIQFVDWCPTGFKCGINYQPP  307


 Score =   101 bits (252),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = -1

Query  526  GLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVH  368
            G+   PPTVVPGGDLAKVQR+VCM+SN+TA+AEVF+RIDHKFDLMYSKRAFVH
Sbjct  301  GINYQPPTVVPGGDLAKVQRSVCMVSNSTAIAEVFARIDHKFDLMYSKRAFVH  353



>ref|XP_008000339.1| PREDICTED: tubulin alpha chain-like 3 [Chlorocebus sabaeus]
Length=446

 Score =   134 bits (338),  Expect(2) = 5e-63, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAY EQ SV +IT+A FE S+ + KCDPR GKYMACCL+YRGDVVPK+VNAA+A  K+
Sbjct  285  ADKAYREQFSVSDITTACFESSNQLVKCDPRLGKYMACCLLYRGDVVPKEVNAAIAATKS  344

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            + +VQFVDWCPTGFK GIN QPP
Sbjct  345  RHSVQFVDWCPTGFKVGINNQPP  367


 Score =   134 bits (338),  Expect(2) = 5e-63, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+   PPTV+P GDLAKV RAVCM+SN TA+ E ++R+DHKFDLMY+KRAF+HWY+ E
Sbjct  359  KVGINNQPPTVMPDGDLAKVHRAVCMLSNTTAIVEAWARLDHKFDLMYAKRAFLHWYLRE  418

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GMEE EF EAREDLAALE+DY
Sbjct  419  GMEEAEFLEAREDLAALERDY  439



>ref|XP_007081245.1| PREDICTED: tubulin alpha chain-like 3 [Panthera tigris altaica]
Length=830

 Score =   136 bits (343),  Expect(2) = 6e-63, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+ + PPTV PGGDLA+ +RAVCM+SN TAV E ++R+D KFDLMY+KRAF+HWYVGE
Sbjct  743  KVGINSRPPTVTPGGDLAEARRAVCMLSNTTAVVEAWARLDRKFDLMYAKRAFLHWYVGE  802

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GM+EGEF EAR+DLAALEKDY
Sbjct  803  GMDEGEFLEARKDLAALEKDY  823


 Score =   132 bits (333),  Expect(2) = 6e-63, Method: Composition-based stats.
 Identities = 58/83 (70%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A  AYHE+LSV +IT+A F+ S+ + KCDPR GKYMACCL+YRGDVVPKDVNAA+A  K 
Sbjct  669  ADSAYHEELSVSDITAACFDFSNQLIKCDPRLGKYMACCLLYRGDVVPKDVNAAIAATKL  728

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            + +VQFVDWCPTGFK GIN +PP
Sbjct  729  RSSVQFVDWCPTGFKVGINSRPP  751



>gb|AAN40716.1| alpha-tubulin [Strobilidium sp.]
Length=369

 Score =   167 bits (424),  Expect(2) = 6e-63, Method: Compositional matrix adjust.
 Identities = 74/83 (89%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQLSV EIT++ FEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT
Sbjct  241  AEKAYHEQLSVAEITNSTFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  300

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
             RT+ FVDWCPTGFKCGINYQPP
Sbjct  301  XRTIXFVDWCPTGFKCGINYQPP  323


 Score =   101 bits (251),  Expect(2) = 6e-63, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = -1

Query  526  GLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVH  368
            G+   PPTVVPGGDLAKV RAVCMISN+TA+AEVFSRIDHKFDLMY+KRAFVH
Sbjct  317  GINYQPPTVVPGGDLAKVMRAVCMISNSTAIAEVFSRIDHKFDLMYAKRAFVH  369



>dbj|GAM26554.1| hypothetical protein SAMD00019534_097290 [Acytostelium subglobosum 
LB1]
Length=458

 Score =   138 bits (348),  Expect(2) = 8e-63, Method: Compositional matrix adjust.
 Identities = 61/79 (77%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = -1

Query  526  GLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGM  347
            G+    PTV+P GDLAKV+RAVCM+SN TA+++VFSRI+ KFDLMY+KRAFVHWYVGEGM
Sbjct  365  GINHEAPTVIPDGDLAKVERAVCMLSNTTAISQVFSRINTKFDLMYTKRAFVHWYVGEGM  424

Query  346  EEGEFSEAREDLAALEKDY  290
            EEGEF+EAREDL ALEKDY
Sbjct  425  EEGEFAEAREDLMALEKDY  443


 Score =   130 bits (326),  Expect(2) = 8e-63, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = -3

Query  749  KAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  570
            KA HEQ SV  +T+AVF+ S+MMAKCDP+ GKYMACCLMYRG+VVP D   AV+ +KTKR
Sbjct  291  KAAHEQFSVNALTNAVFDQSNMMAKCDPKLGKYMACCLMYRGNVVPNDAQKAVSDLKTKR  350

Query  569  TVQFVDWCPTGFKCGINYQPP  507
            TV FVDW P+GFKCGIN++ P
Sbjct  351  TVSFVDWSPSGFKCGINHEAP  371



>ref|XP_954407.1| tubulin alpha chain [Theileria annulata]
 emb|CAI73730.1| tubulin alpha chain, putative [Theileria annulata]
Length=440

 Score =   137 bits (346),  Expect(2) = 9e-63, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -3

Query  749  KAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  570
            KA HEQ+SV EIT + F+P SMMA+CDPR G YM+CCLMYRGDVVPKDVN A+A +K K+
Sbjct  282  KAKHEQMSVSEITFSAFDPKSMMAECDPRTGYYMSCCLMYRGDVVPKDVNNAIAAVKNKK  341

Query  569  TVQFVDWCPTGFKCGINYQPP  507
            TV+FVDW PTGFK GINYQPP
Sbjct  342  TVRFVDWSPTGFKFGINYQPP  362


 Score =   130 bits (328),  Expect(2) = 9e-63, Method: Compositional matrix adjust.
 Identities = 56/79 (71%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = -1

Query  526  GLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGM  347
            G+   PP VVPG D+++  RAVCMISN+T++AEVF+R+D KFDLMY+KRAFVHWY+ EGM
Sbjct  356  GINYQPPCVVPGDDISRPSRAVCMISNSTSIAEVFTRMDKKFDLMYAKRAFVHWYISEGM  415

Query  346  EEGEFSEAREDLAALEKDY  290
            EE EF EARED+AALEKDY
Sbjct  416  EECEFQEAREDVAALEKDY  434



>ref|XP_001846203.1| tubulin alpha chain [Culex quinquefasciatus]
 gb|EDS42983.1| tubulin alpha chain [Culex quinquefasciatus]
Length=437

 Score =   136 bits (342),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A+KA HE  SV EIT+A FEP++MM KCDPRHGKYMACC++YRGDVVPKD+N+A+ +IK 
Sbjct  260  ASKAQHEFSSVAEITNACFEPANMMVKCDPRHGKYMACCMLYRGDVVPKDINSAITSIKA  319

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            KR + FVDWCPTGFK GIN Q P
Sbjct  320  KRHITFVDWCPTGFKIGINQQAP  342


 Score =   132 bits (331),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            +G+    PTV+PGGDLAK +RAVCM+SN TA+++ ++R++ +FDLMY KRAFVHWYVGEG
Sbjct  335  IGINQQAPTVMPGGDLAKPKRAVCMLSNTTAISDAWARVNQQFDLMYKKRAFVHWYVGEG  394

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEEGEFSEAREDLA LE+DY
Sbjct  395  MEEGEFSEAREDLAVLERDY  414



>ref|XP_009175670.1| hypothetical protein T265_10896 [Opisthorchis viverrini]
 gb|KER20572.1| hypothetical protein T265_10896 [Opisthorchis viverrini]
Length=479

 Score =   138 bits (348),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            +GL   PPTVVPG  LA V+RA+CM+SN T+++E ++RIDHKFDLM++KRAFVHW+VGEG
Sbjct  383  IGLNCQPPTVVPGSQLAPVKRALCMLSNTTSISEAWTRIDHKFDLMHAKRAFVHWFVGEG  442

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEEGEF+EAREDLAALEKDY
Sbjct  443  MEEGEFTEAREDLAALEKDY  462


 Score =   129 bits (325),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 53/83 (64%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A K +HEQL+V E+T+  FEP + M KCDPR GKYMACCL+YRGDV+PKDVN A+  +K 
Sbjct  308  ADKVHHEQLNVMELTNTCFEPVNQMVKCDPRRGKYMACCLLYRGDVIPKDVNNALTRVKA  367

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            ++++QFV+WCPTGFK G+N QPP
Sbjct  368  QKSIQFVEWCPTGFKIGLNCQPP  390



>ref|XP_008057665.1| PREDICTED: tubulin alpha chain-like 3, partial [Tarsius syrichta]
Length=445

 Score =   136 bits (343),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+   PP VVPGGDLA+VQRAVCM+SN TAV   ++R+DHKFDLMY+KRAF+HWY+ E
Sbjct  358  KVGINNQPPAVVPGGDLARVQRAVCMLSNTTAVVAAWARLDHKFDLMYAKRAFLHWYLRE  417

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GMEEGEF +AREDLAALE+DY
Sbjct  418  GMEEGEFLDAREDLAALERDY  438


 Score =   131 bits (329),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQ SV +IT+A F  S  + KCDPR G+YMACCL+YRGDVVPK+VNAA+A  K+
Sbjct  284  ADKAYHEQFSVADITAACFGSSHQLVKCDPRLGRYMACCLLYRGDVVPKEVNAAIAATKS  343

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            + +V+FVDWCPTGFK GIN QPP
Sbjct  344  RNSVRFVDWCPTGFKVGINNQPP  366



>dbj|GAA31772.2| tubulin alpha [Clonorchis sinensis]
Length=474

 Score =   136 bits (343),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            +GL   PPTVVPG  LA V+RA+CM+SN T+++E ++RI+HKFDLM++KRAFVHW+VGEG
Sbjct  378  IGLNCQPPTVVPGSQLAPVKRALCMLSNTTSISEAWTRINHKFDLMHAKRAFVHWFVGEG  437

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEEGEF+EAREDLAALEKDY
Sbjct  438  MEEGEFTEAREDLAALEKDY  457


 Score =   130 bits (328),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A K +HEQL+V E+T+  FEP + M KCDPR GKYMACCL+YRGDV+PKDVN A+  +K 
Sbjct  303  ADKVHHEQLNVMELTNTCFEPVNQMVKCDPRRGKYMACCLLYRGDVIPKDVNNALTRVKA  362

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            ++++QFVDWCPTGFK G+N QPP
Sbjct  363  QKSIQFVDWCPTGFKIGLNCQPP  385



>ref|XP_008585572.1| PREDICTED: tubulin alpha chain-like 3 [Galeopterus variegatus]
Length=398

 Score =   135 bits (340),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+    PTV+PGGDLAKVQRAVCM+S+ TA+ E ++R++HKFDLMY+KRAF+HWY+ E
Sbjct  311  KVGINNQLPTVMPGGDLAKVQRAVCMLSSTTAIVEAWARLNHKFDLMYAKRAFLHWYIRE  370

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GMEEGEF EAREDLAALEKDY
Sbjct  371  GMEEGEFVEAREDLAALEKDY  391


 Score =   132 bits (331),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A K YHEQLSV +IT+A FE S+ + KCDPR GKYMACCL+YRGDVVPKDVN A+A +K+
Sbjct  237  AHKGYHEQLSVSDITTACFEYSNQLVKCDPRLGKYMACCLLYRGDVVPKDVNVAIAAMKS  296

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            + +V FVDWCPTGFK GIN Q P
Sbjct  297  RNSVHFVDWCPTGFKVGINNQLP  319



>emb|CDO68137.1| hypothetical protein BN946_scf185003.g9 [Trametes cinnabarina]
Length=447

 Score =   139 bits (351),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            +G+   PP  +PGGDLAKV R++CM+SN TA++  +SR+DHKFDL+YSKRAFVHWYVGEG
Sbjct  352  LGICNEPPAHIPGGDLAKVTRSLCMLSNTTAISSAWSRLDHKFDLLYSKRAFVHWYVGEG  411

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEEGEFSEAREDLAALEKDY
Sbjct  412  MEEGEFSEAREDLAALEKDY  431


 Score =   127 bits (320),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KA+HEQ SV ++T + FE  + M KCDPR GKYMAC L+YRGDVVPKD NAAV+ IKT
Sbjct  277  AEKAHHEQNSVIDMTFSCFEAGNQMVKCDPREGKYMACALLYRGDVVPKDTNAAVSLIKT  336

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            K+T+QFVDWCPTGFK GI  +PP
Sbjct  337  KKTIQFVDWCPTGFKLGICNEPP  359



>dbj|GAM26553.1| hypothetical protein SAMD00019534_097280 [Acytostelium subglobosum 
LB1]
Length=447

 Score =   138 bits (348),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 61/79 (77%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = -1

Query  526  GLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGM  347
            G+    PTV+P GDLAKV+RAVCM+SN TA+++VFSRI+ KFDLMY+KRAFVHWYVGEGM
Sbjct  354  GINHEAPTVIPDGDLAKVERAVCMLSNTTAISQVFSRINTKFDLMYTKRAFVHWYVGEGM  413

Query  346  EEGEFSEAREDLAALEKDY  290
            EEGEF+EAREDL ALEKDY
Sbjct  414  EEGEFAEAREDLMALEKDY  432


 Score =   128 bits (322),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = -3

Query  749  KAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  570
            KA HEQ SV  +T+AVFE ++MMAKCDP+ GKYMACCLMYRG+VVPKD   AV  +KTK+
Sbjct  280  KADHEQFSVNALTNAVFEQANMMAKCDPKLGKYMACCLMYRGNVVPKDAQKAVNDLKTKK  339

Query  569  TVQFVDWCPTGFKCGINYQPP  507
            TV FVDW P+GFKCGIN++ P
Sbjct  340  TVTFVDWSPSGFKCGINHEAP  360



>ref|XP_008246815.1| PREDICTED: tubulin alpha chain-like 3 [Oryctolagus cuniculus]
Length=446

 Score =   139 bits (351),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            VG+  +PP V+PGGDLAK++RAVCM+SN TA+ E ++R+DHKFDLMY+KRAF+HWY+ EG
Sbjct  360  VGVNNHPPEVMPGGDLAKLRRAVCMLSNTTAIVEAWARLDHKFDLMYAKRAFLHWYIQEG  419

Query  349  MEEGEFSEAREDLAALEKDY  290
            ME+GEFSEAREDLAALEKDY
Sbjct  420  MEQGEFSEAREDLAALEKDY  439


 Score =   127 bits (318),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A K YH Q SV +IT+A FE S+ + KC+P+ GKYMACCL+YRGDV+PKDVNAA+A +K+
Sbjct  285  AEKTYHVQPSVSDITAACFELSNQLVKCNPQLGKYMACCLLYRGDVIPKDVNAAIAAVKS  344

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            + +VQFVDWCPTGFK G+N  PP
Sbjct  345  RNSVQFVDWCPTGFKVGVNNHPP  367



>ref|XP_004829933.1| tubulin alpha chain, putative [Babesia equi]
 gb|AFZ80267.1| tubulin alpha chain, putative [Babesia equi strain WA]
Length=438

 Score =   139 bits (350),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            + KA HEQ+SV +IT + F+P+SMMA+CDPR+G YMACCLMYRGDVVPKDVN+A++ +K 
Sbjct  278  SRKAKHEQMSVADITYSAFDPNSMMAQCDPRNGYYMACCLMYRGDVVPKDVNSAISVVKN  337

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            K+TV+FVDW PTGFK GINYQPP
Sbjct  338  KKTVRFVDWSPTGFKFGINYQPP  360


 Score =   127 bits (318),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 55/79 (70%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = -1

Query  526  GLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGM  347
            G+   PP VV G + +K  RAVCMISN+T++AEVF R+D KFD+MY+KRAFVHWY+GEGM
Sbjct  354  GINYQPPCVVSGEEFSKTSRAVCMISNSTSIAEVFIRMDKKFDIMYAKRAFVHWYIGEGM  413

Query  346  EEGEFSEAREDLAALEKDY  290
            EE EF EARED+AALEKDY
Sbjct  414  EEAEFQEAREDVAALEKDY  432



>gb|ABO61435.1| alpha tubulin, partial [Cryptophyceae sp. SL64/78sp]
Length=346

 Score =   153 bits (386),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = -3

Query  749  KAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  570
            KA HEQLS  EIT++ FEPSSMMAKCDPR GKYMACCLMYRG++ PKDVN AVA IKTK+
Sbjct  213  KATHEQLSASEITNSAFEPSSMMAKCDPRRGKYMACCLMYRGNIAPKDVNGAVAAIKTKK  272

Query  569  TVQFVDWCPTGFKCGINYQPP  507
            T+QFVDWCPTGFKCGINYQ P
Sbjct  273  TIQFVDWCPTGFKCGINYQAP  293


 Score =   112 bits (281),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = -1

Query  526  GLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGM  347
            G+    PT+VPGGDLAKVQRAVCMISN+TA+A+VFSRI+ KFDLMYSKRAFVHWYVGEGM
Sbjct  287  GINYQAPTLVPGGDLAKVQRAVCMISNSTAIADVFSRINQKFDLMYSKRAFVHWYVGEGM  346



>ref|XP_004049058.1| PREDICTED: tubulin alpha chain-like 3 isoform 2 [Gorilla gorilla 
gorilla]
Length=406

 Score =   133 bits (334),  Expect(2) = 6e-62, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQ SV +IT+A FE S+ + KC+PR GKYMACCL+YRGDVVPK+VNAA+A  K+
Sbjct  245  ADKAYHEQFSVSDITTACFESSNQLVKCNPRLGKYMACCLLYRGDVVPKEVNAAIAATKS  304

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            + +VQFVDWCPTGFK GIN  PP
Sbjct  305  RHSVQFVDWCPTGFKVGINNWPP  327


 Score =   132 bits (333),  Expect(2) = 6e-62, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+   PP V+PGGDLAKV R++CM+SN TA+ E ++R+DHKFDLMY+KRAF+HWY+ E
Sbjct  319  KVGINNWPPMVMPGGDLAKVHRSICMLSNTTAIVEAWARLDHKFDLMYAKRAFLHWYLRE  378

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GMEE EF EAREDLAALE+DY
Sbjct  379  GMEEAEFLEAREDLAALERDY  399



>ref|XP_009689130.1| tubulin subunit alpha [Theileria orientalis strain Shintoku]
 dbj|BAM38829.1| tubulin subunit alpha [Theileria orientalis strain Shintoku]
Length=451

 Score =   133 bits (335),  Expect(2) = 8e-62, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = -3

Query  749  KAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  570
            KA HEQ+SV +IT + F+P SMMA+CDPR G YM+CCLMYRGDVVPKDVN A+A +K K+
Sbjct  282  KARHEQMSVADITYSAFDPKSMMAECDPRTGYYMSCCLMYRGDVVPKDVNYAIAAVKNKK  341

Query  569  TVQFVDWCPTGFKCGINYQPP  507
             V+FVDW PTGFK GINYQPP
Sbjct  342  AVKFVDWSPTGFKFGINYQPP  362


 Score =   131 bits (330),  Expect(2) = 8e-62, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = -1

Query  526  GLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGM  347
            G+   PP VVPG D++K  RAVCMISN+T++ EVF+R+D KFDLMY+KRAFVHWY+GEGM
Sbjct  356  GINYQPPCVVPGDDISKPSRAVCMISNSTSIREVFTRMDKKFDLMYAKRAFVHWYMGEGM  415

Query  346  EEGEFSEAREDLAALEKDY  290
            EE EF EARED+AALEKDY
Sbjct  416  EESEFQEAREDVAALEKDY  434



>ref|XP_004049057.1| PREDICTED: tubulin alpha chain-like 3 isoform 1 [Gorilla gorilla 
gorilla]
Length=446

 Score =   132 bits (333),  Expect(2) = 9e-62, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQ SV +IT+A FE S+ + KC+PR GKYMACCL+YRGDVVPK+VNAA+A  K+
Sbjct  285  ADKAYHEQFSVSDITTACFESSNQLVKCNPRLGKYMACCLLYRGDVVPKEVNAAIAATKS  344

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            + +VQFVDWCPTGFK GIN  PP
Sbjct  345  RHSVQFVDWCPTGFKVGINNWPP  367


 Score =   132 bits (332),  Expect(2) = 9e-62, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+   PP V+PGGDLAKV R++CM+SN TA+ E ++R+DHKFDLMY+KRAF+HWY+ E
Sbjct  359  KVGINNWPPMVMPGGDLAKVHRSICMLSNTTAIVEAWARLDHKFDLMYAKRAFLHWYLRE  418

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GMEE EF EAREDLAALE+DY
Sbjct  419  GMEEAEFLEAREDLAALERDY  439



>gb|AFP25236.1| alpha-tubulin, partial [Apodiophrys ovalis]
Length=357

 Score =   170 bits (431),  Expect(2) = 9e-62, Method: Compositional matrix adjust.
 Identities = 75/83 (90%), Positives = 80/83 (96%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQLSV EIT++ FEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT
Sbjct  232  AEKAYHEQLSVAEITNSSFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  291

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            +RT+QFVDWCPTGFKCGINYQPP
Sbjct  292  RRTIQFVDWCPTGFKCGINYQPP  314


 Score = 94.4 bits (233),  Expect(2) = 9e-62, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -1

Query  526  GLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRA  377
            G+   PPTVVPGGDLAKV RAVCMISN+TA+AEVFSRIDHKFDLMY+KRA
Sbjct  308  GINYQPPTVVPGGDLAKVMRAVCMISNSTAIAEVFSRIDHKFDLMYAKRA  357



>ref|XP_004862266.1| PREDICTED: LOW QUALITY PROTEIN: tubulin alpha-2/alpha-4 chain-like 
[Heterocephalus glaber]
Length=452

 Score =   149 bits (377),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQLSVP+IT A FEPS+ M KCDPR GKYMACC++YRG+V  KDVNAA+ATIKT
Sbjct  279  AEKAYHEQLSVPQITHACFEPSNQMVKCDPRRGKYMACCMLYRGNVAAKDVNAAIATIKT  338

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            K ++QFVDWCPTGFK GINYQPP
Sbjct  339  KHSIQFVDWCPTGFKVGINYQPP  361


 Score =   115 bits (287),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 72/82 (88%), Gaps = 2/82 (2%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYV--G  356
            VG+   PPTVVPGGDLA+VQRAVCM+SN TA+ E + R+++KFDLM++KRAFVHWYV  G
Sbjct  354  VGINYQPPTVVPGGDLAQVQRAVCMLSNTTAIVEAWCRLNYKFDLMFAKRAFVHWYVGEG  413

Query  355  EGMEEGEFSEAREDLAALEKDY  290
            EGMEEG+F EARE++AALEKDY
Sbjct  414  EGMEEGDFXEARENMAALEKDY  435



>dbj|GAA93509.1| hypothetical protein E5Q_00150 [Mixia osmundae IAM 14324]
 gb|KEI37996.1| hypothetical protein L969DRAFT_52136 [Mixia osmundae IAM 14324]
Length=567

 Score =   133 bits (335),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            +G+   PP  VPGGDLAKV R++CM+SN TA+A  +S I  KFDL+YSKRAFVHWYVGEG
Sbjct  474  LGICNEPPCQVPGGDLAKVSRSLCMLSNTTAIASAWSNITKKFDLLYSKRAFVHWYVGEG  533

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEEGEFSEAREDLAALE+DY
Sbjct  534  MEEGEFSEAREDLAALERDY  553


 Score =   130 bits (327),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A+KA HEQ S  E+ ++ F+P++ M KCDPR+GKYMAC L++RGDVVPKDVNAAVA+IKT
Sbjct  399  ASKAMHEQNSTAEMVNSCFDPNNQMVKCDPRNGKYMACALLFRGDVVPKDVNAAVASIKT  458

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            KRT+ FVDWCPTGFK GI  +PP
Sbjct  459  KRTISFVDWCPTGFKLGICNEPP  481



>ref|XP_004357077.1| alpha tubulin [Dictyostelium fasciculatum]
 gb|EGG18254.1| alpha tubulin [Dictyostelium fasciculatum]
Length=461

 Score =   141 bits (355),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 62/79 (78%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = -1

Query  526  GLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGM  347
            G+    P+VVPGGDLAKV+R+VCM+SN TA+A+VFSRI+ KFDLMY+KRAFVHWYVGEGM
Sbjct  367  GINHEAPSVVPGGDLAKVERSVCMLSNTTAIAQVFSRINRKFDLMYTKRAFVHWYVGEGM  426

Query  346  EEGEFSEAREDLAALEKDY  290
            EEGEF+EAREDL ALEKDY
Sbjct  427  EEGEFAEAREDLHALEKDY  445


 Score =   123 bits (308),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 68/83 (82%), Gaps = 1/83 (1%)
 Frame = -3

Query  749  KAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTK-  573
            KA HEQ+SV  IT+AVF+  +MMAKCDP  GKYMACCLMYRG+VVPK+ + AV+ +KTK 
Sbjct  292  KADHEQISVSAITNAVFDQENMMAKCDPTQGKYMACCLMYRGNVVPKEAHKAVSDLKTKS  351

Query  572  RTVQFVDWCPTGFKCGINYQPPN  504
            + V FVDW PTGFKCGIN++ P+
Sbjct  352  KAVSFVDWSPTGFKCGINHEAPS  374



>ref|XP_004886012.1| PREDICTED: LOW QUALITY PROTEIN: tubulin alpha-2/alpha-4 chain-like 
[Heterocephalus glaber]
Length=444

 Score =   149 bits (375),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQLSVP+IT A FEPS+ M KCDPR GKYMACC++YRG+V  KDVNAA+ATIKT
Sbjct  271  AEKAYHEQLSVPQITHACFEPSNQMVKCDPRRGKYMACCMLYRGNVAAKDVNAAIATIKT  330

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            K ++QFVDWCPTGFK GINYQPP
Sbjct  331  KHSIQFVDWCPTGFKVGINYQPP  353


 Score =   114 bits (286),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 72/82 (88%), Gaps = 2/82 (2%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYV--G  356
            VG+   PPTVVPGGDLA+VQRAVCM+SN TA+ E + R+++KFDLM++KRAFVHWYV  G
Sbjct  346  VGINYQPPTVVPGGDLAQVQRAVCMLSNTTAIVEAWCRLNYKFDLMFAKRAFVHWYVGEG  405

Query  355  EGMEEGEFSEAREDLAALEKDY  290
            EGMEEG+F EARE++AALEKDY
Sbjct  406  EGMEEGDFXEARENMAALEKDY  427



>gb|KIP10686.1| hypothetical protein PHLGIDRAFT_125385 [Phlebiopsis gigantea 
11061_1 CR5-6]
Length=447

 Score =   136 bits (343),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             +G+   P   VPGGDLAK  R++CM+SN T++A  +SR+DHKFDLMYSKRAFVHWYVGE
Sbjct  351  KLGICNEPAANVPGGDLAKTSRSLCMLSNTTSIAAAWSRLDHKFDLMYSKRAFVHWYVGE  410

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GMEEGEFSEAREDLAALEKDY
Sbjct  411  GMEEGEFSEAREDLAALEKDY  431


 Score =   127 bits (318),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KA HEQ SV E+T + FEP + M KCDPR GKYMACCL+YRGDV PK+V +A+A+IKT
Sbjct  277  ADKARHEQNSVAEMTLSCFEPGTQMVKCDPREGKYMACCLLYRGDVAPKEVQSAIASIKT  336

Query  575  KRTVQFVDWCPTGFKCGINYQP  510
            ++T+QFVDWCPTGFK GI  +P
Sbjct  337  RKTIQFVDWCPTGFKLGICNEP  358



>gb|AAL04106.2|AF405439_1 alpha tubulin IV [Homarus americanus]
Length=462

 Score =   133 bits (334),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            VG+   PPTVVPG DLAKV+RAVC +SN TA+ + + R+D KFDLM+SKRAFVHWYVGEG
Sbjct  361  VGINYQPPTVVPGTDLAKVERAVCALSNTTAIKDAWERLDRKFDLMFSKRAFVHWYVGEG  420

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEEGEFSEARED AALE DY
Sbjct  421  MEEGEFSEAREDTAALEMDY  440


 Score =   128 bits (321),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = -3

Query  749  KAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  570
             A+HE  SV +IT+  F+ +  M KCDPR+GKYMACCL++RGDVVPKDV+AA+A  +TK+
Sbjct  288  NAFHEDFSVRDITANCFDTTYQMVKCDPRNGKYMACCLLFRGDVVPKDVSAAIAETRTKK  347

Query  569  TVQFVDWCPTGFKCGINYQPP  507
             + FVDWCPTGFK GINYQPP
Sbjct  348  NITFVDWCPTGFKVGINYQPP  368



>gb|AAD02572.1| nucleomorph alpha-tubulin [Guillardia theta]
Length=390

 Score =   150 bits (380),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = -3

Query  746  AYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRT  567
            A HEQ S  EIT+A FEP+SMMAKCDPR GKYMACCLM+RGDV PKDVN +VA IKTK+T
Sbjct  259  ANHEQYSTAEITNAAFEPNSMMAKCDPRRGKYMACCLMFRGDVAPKDVNGSVAAIKTKKT  318

Query  566  VQFVDWCPTGFKCGINYQPP  507
            +QFVDWCPTGFKCGINYQPP
Sbjct  319  IQFVDWCPTGFKCGINYQPP  338


 Score =   109 bits (272),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 48/59 (81%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = -1

Query  526  GLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            G+   PPTVVP GDLAKV RAVCMISN+TA++EVFSRI+ KFDLMYSKRAFVHWYVGEG
Sbjct  332  GINYQPPTVVPDGDLAKVDRAVCMISNSTAISEVFSRINKKFDLMYSKRAFVHWYVGEG  390



>gb|AAN40715.1| alpha-tubulin [Strobilidium sp.]
Length=365

 Score =   165 bits (418),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 73/83 (88%), Positives = 77/83 (93%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQLSV EIT++ FEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT
Sbjct  240  AEKAYHEQLSVAEITNSTFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  299

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
             RT+ FVDWCPTGF CGINYQPP
Sbjct  300  XRTIXFVDWCPTGFXCGINYQPP  322


 Score = 94.4 bits (233),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -1

Query  526  GLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRA  377
            G+   PPTVVPGGDLAKV RAVCMISN+TA+AEVFSRIDHKFDLMY+KRA
Sbjct  316  GINYQPPTVVPGGDLAKVMRAVCMISNSTAIAEVFSRIDHKFDLMYAKRA  365



>gb|KFH62597.1| tubulin alpha chain [Mortierella verticillata NRRL 6337]
Length=444

 Score =   131 bits (330),  Expect(2) = 9e-60, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 66/77 (86%), Gaps = 0/77 (0%)
 Frame = -3

Query  749  KAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  570
            KA+HEQ SV +IT+A F+ S+ M KCDPRH KYMACCL+YRGDV+PKDVNAA+ +IK K 
Sbjct  277  KAFHEQSSVQDITAACFDRSNQMVKCDPRHSKYMACCLLYRGDVIPKDVNAAITSIKNKS  336

Query  569  TVQFVDWCPTGFKCGIN  519
            T+QFVDWCPTGFK GIN
Sbjct  337  TIQFVDWCPTGFKVGIN  353


 Score =   126 bits (317),  Expect(2) = 9e-60, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            VG+ +    VVP  ++A   R+VCM+SN TA++E + R+DHKFDLMY+KRAFVHWYVGEG
Sbjct  350  VGINSKEAVVVPESEVAAAPRSVCMLSNTTAISEAWCRLDHKFDLMYAKRAFVHWYVGEG  409

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEEGEFSEAREDLAALEKDY
Sbjct  410  MEEGEFSEAREDLAALEKDY  429



>gb|KIH59504.1| tubulin/FtsZ family protein [Ancylostoma duodenale]
Length=274

 Score =   137 bits (345),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQLSV EIT+  FEP + M KCDPRHGKYMA CL++RGDVVPKDVNAA+ATIKT
Sbjct  76   AEKAYHEQLSVAEITNMCFEPHNQMVKCDPRHGKYMAVCLLFRGDVVPKDVNAAIATIKT  135

Query  575  KRTVQFVDWCPTGFK  531
            KR++QFVDWCPTGFK
Sbjct  136  KRSIQFVDWCPTGFK  150


 Score =   120 bits (302),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 65/80 (81%), Gaps = 9/80 (11%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            VG+   PPTVVPGGDLAKV RAVCM+SN TA+AE ++R+DHKFDLM         YVGEG
Sbjct  186  VGINYQPPTVVPGGDLAKVPRAVCMLSNTTAIAEAWARLDHKFDLM---------YVGEG  236

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEEGEFSEAREDLAALEKDY
Sbjct  237  MEEGEFSEAREDLAALEKDY  256



>gb|ETN61230.1| tubulin alpha-2 chain [Anopheles darlingi]
Length=450

 Score =   130 bits (328),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A+KA HE  SV EIT+A F   + M KCDPR GKYMACCL++RGDV+PKD N+AVA IKT
Sbjct  275  ASKASHESSSVAEITNACFTAENTMVKCDPRMGKYMACCLLFRGDVMPKDTNSAVAAIKT  334

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            KR + FVDWCPTGFK GIN+QPP
Sbjct  335  KRHINFVDWCPTGFKIGINHQPP  357


 Score =   127 bits (318),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            +G+   PP V+PG +LA+ +RAVCM+SN+TA++  ++R+ HK+DLMY KRAFVHWYVGEG
Sbjct  350  IGINHQPPWVLPGSELARPKRAVCMLSNSTAISTAWARLSHKYDLMYRKRAFVHWYVGEG  409

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEEGEF+EAR+DLA LE+DY
Sbjct  410  MEEGEFAEARDDLACLERDY  429



>gb|ETN62715.1| tubulin alpha-2 chain [Anopheles darlingi]
 gb|ETN63881.1| tubulin alpha-2 chain [Anopheles darlingi]
Length=450

 Score =   130 bits (327),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A+KA HE  SV EIT+A F   + M KCDPR GKYMACCL++RGDV+PKD N+AVA IKT
Sbjct  275  ASKASHESSSVAEITNACFTAENTMVKCDPRMGKYMACCLLFRGDVMPKDTNSAVAAIKT  334

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            KR + FVDWCPTGFK GIN+QPP
Sbjct  335  KRHINFVDWCPTGFKIGINHQPP  357


 Score =   127 bits (318),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             +G+   PP V+PG +LA+ +RAVCM+SN+TA++  ++R+ HK+DLMY KRAFVHWYVGE
Sbjct  349  KIGINHQPPWVLPGSELARPKRAVCMLSNSTAISTAWARLSHKYDLMYRKRAFVHWYVGE  408

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GMEEGEF+EAR+DLA LE+DY
Sbjct  409  GMEEGEFAEARDDLACLERDY  429



>ref|XP_008998177.1| PREDICTED: tubulin alpha chain-like 3 [Callithrix jacchus]
Length=501

 Score =   134 bits (336),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+ + PPTV+PGGDLAK  +A+CM+SN TA+ E ++R+DHKFDLMY+KRAF+HWY+ E
Sbjct  414  KVGINSQPPTVMPGGDLAKAHQALCMLSNTTAIVEAWARLDHKFDLMYAKRAFLHWYIRE  473

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GMEE EF EAREDLAALE+DY
Sbjct  474  GMEEAEFLEAREDLAALERDY  494


 Score =   123 bits (308),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHE+ SVP+IT+A FE S+ + KCDPR GKYMACCL+YRGDVVP++ +AA+A +K 
Sbjct  340  ADKAYHERFSVPDITTACFESSNQLVKCDPRLGKYMACCLLYRGDVVPREASAAIAAMKA  399

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            + +VQFVDWCPTGFK GIN QPP
Sbjct  400  RHSVQFVDWCPTGFKVGINSQPP  422



>gb|EDL10326.1| mCG50536 [Mus musculus]
Length=196

 Score =   133 bits (334),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = -3

Query  749  KAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  570
            KAYH QLSV +IT+A FEPS  M KCDP HGK MACCL++ G+ VPKDVN  +ATIKTK 
Sbjct  49   KAYHGQLSVVDITNACFEPSIQMVKCDPHHGKCMACCLLFHGNEVPKDVNVVIATIKTKH  108

Query  569  TVQFVDWCPTGFKCGINYQP  510
            T+QFVDWCPTGFK GINYQP
Sbjct  109  TIQFVDWCPTGFKVGINYQP  128


 Score =   123 bits (309),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+   P TVVPG DLA+V RAVCM+SN  A+AE ++R+DHKFDLMY+KRAFVHWY+ E
Sbjct  121  KVGINYQPTTVVPGSDLARVHRAVCMLSNTMAIAEAWARLDHKFDLMYAKRAFVHWYMSE  180

Query  352  GMEEGEFSEAREDLA  308
            GMEEGEFSEA ED+A
Sbjct  181  GMEEGEFSEAHEDMA  195



>ref|XP_002431213.1| tubulin alpha-1 chain, putative [Pediculus humanus corporis]
 gb|EEB18475.1| tubulin alpha-1 chain, putative [Pediculus humanus corporis]
Length=488

 Score =   133 bits (334),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A K +HE ++V EIT+  F+P + M KCDPR GKY+ACCL+YRGDVVPKDVNAA+A +K 
Sbjct  313  ADKVFHEGMTVAEITAQCFDPVNQMVKCDPRDGKYIACCLLYRGDVVPKDVNAAIAAMKK  372

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            K  V+FVDWCPTGFK GINYQPP
Sbjct  373  KSAVRFVDWCPTGFKVGINYQPP  395


 Score =   123 bits (308),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            VG+   PPTVVPG +LA VQRAV M+SN TA+ E + +++ KFDLMY+KRAF+HW+V EG
Sbjct  388  VGINYQPPTVVPGSNLATVQRAVAMLSNTTAIVEAWGKLNQKFDLMYNKRAFIHWFVSEG  447

Query  349  MEEGEFSEAREDLAALEKDY  290
            +EE EFSEAREDLA LEKDY
Sbjct  448  LEECEFSEAREDLATLEKDY  467



>ref|XP_765851.1| tubulin subunit alpha [Theileria parva strain Muguga]
 gb|EAN33568.1| tubulin alpha chain, putative [Theileria parva]
Length=457

 Score =   131 bits (329),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 56/79 (71%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = -1

Query  526  GLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGM  347
            G+   PP VVPG D+++  RAVCMISN+T++AEVF+R+D KFDLMY+KRAF+HWYV EGM
Sbjct  373  GINYQPPCVVPGDDISRPSRAVCMISNSTSIAEVFTRMDKKFDLMYAKRAFIHWYVSEGM  432

Query  346  EEGEFSEAREDLAALEKDY  290
            EE EF EARED+AALEKDY
Sbjct  433  EECEFQEAREDVAALEKDY  451


 Score =   125 bits (313),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 69/98 (70%), Gaps = 17/98 (17%)
 Frame = -3

Query  749  KAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMY-----------------RGD  621
            KA HEQ+SV EIT + F+P SMMA+CDPR G YM+CCLMY                 RGD
Sbjct  282  KAKHEQMSVSEITFSAFDPKSMMAECDPRTGYYMSCCLMYSILPILPILKMVCKCMCRGD  341

Query  620  VVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  507
            VVPKDVN A++ +K K+TV+FVDW PTGFK GINYQPP
Sbjct  342  VVPKDVNHAISVVKNKKTVKFVDWSPTGFKFGINYQPP  379



>gb|ERG79399.1| tubulin alpha-3 chain [Ascaris suum]
Length=479

 Score =   130 bits (327),  Expect(2) = 5e-59, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 63/81 (78%), Gaps = 0/81 (0%)
 Frame = -3

Query  749  KAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  570
            KAYHE LSV EITS  FE  + M KCD R GKYMA CL+YRGDVVPKDVN+A+ +IK KR
Sbjct  312  KAYHESLSVSEITSMCFESHNQMVKCDARKGKYMAICLLYRGDVVPKDVNSAINSIKRKR  371

Query  569  TVQFVDWCPTGFKCGINYQPP  507
               FVDWCPTGFK GINYQ P
Sbjct  372  VCDFVDWCPTGFKVGINYQAP  392


 Score =   125 bits (315),  Expect(2) = 5e-59, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            VG+    P VV G D+A+V+R+VC ++N TA+AE +SR++ KFDLMY KRAFVHWYVGEG
Sbjct  385  VGINYQAPVVVDGSDMARVERSVCTLANTTAIAEAWSRLNVKFDLMYKKRAFVHWYVGEG  444

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEEGEF+EARED+AALEKDY
Sbjct  445  MEEGEFAEAREDMAALEKDY  464



>ref|XP_004379779.1| PREDICTED: LOW QUALITY PROTEIN: tubulin alpha chain-like 3 [Trichechus 
manatus latirostris]
Length=406

 Score =   129 bits (323),  Expect(2) = 6e-59, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            VG+   PP VVPGGDLAK+Q+AVCM+SN TA+AE ++ +DHKFDLMY+K AF+HW V E 
Sbjct  320  VGINNQPPIVVPGGDLAKIQQAVCMLSNTTAIAEAWAHLDHKFDLMYAKLAFLHWXVKED  379

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEEGEFSEA  DLAALEKDY
Sbjct  380  MEEGEFSEASXDLAALEKDY  399


 Score =   127 bits (318),  Expect(2) = 6e-59, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQ S+ +IT+A FE S+ +  CDP  GKYMACCL+YR DVVPKD++AA+A IK 
Sbjct  245  ADKAYHEQFSMLDITAACFEFSNQLVNCDPWLGKYMACCLLYREDVVPKDIHAAIAAIKL  304

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            + +VQFVDWCPTGFK GIN QPP
Sbjct  305  RNSVQFVDWCPTGFKVGINNQPP  327



>ref|XP_001846298.1| tubulin alpha-2 chain [Culex quinquefasciatus]
 gb|EDS43216.1| tubulin alpha-2 chain [Culex quinquefasciatus]
Length=448

 Score =   131 bits (329),  Expect(2) = 6e-59, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            +G+    P+++PGGDLAK +RAVCM+SN+TA++  + R++ KFDLMY KRAFVHWYVGEG
Sbjct  350  IGINQQAPSIMPGGDLAKPKRAVCMLSNSTAISGAWERLNQKFDLMYRKRAFVHWYVGEG  409

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEEGEFSEAREDLAALE+DY
Sbjct  410  MEEGEFSEAREDLAALERDY  429


 Score =   124 bits (311),  Expect(2) = 6e-59, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A+KA HE  SV EIT A F   + + KCDPR GKYMACCL+YRGDVVPKD+N+AV+ IK 
Sbjct  275  ASKAQHEFSSVSEITHAAFSQENTLVKCDPRTGKYMACCLLYRGDVVPKDINSAVSAIKA  334

Query  575  KRTVQFVDWCPTGFKCGINYQPPN  504
            KR + FV+WCPTGFK GIN Q P+
Sbjct  335  KRHITFVEWCPTGFKIGINQQAPS  358



>emb|CBK21156.2| unnamed protein product [Blastocystis hominis]
Length=436

 Score =   138 bits (348),  Expect(2) = 7e-59, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = -3

Query  749  KAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  570
            KA  E +SV E T+ VF+ SSMM KCDPR GK+MACCLMYRGDV PKDV AAV TIK K+
Sbjct  277  KALMENMSVAETTNQVFDSSSMMCKCDPRRGKFMACCLMYRGDVTPKDVTAAVTTIKNKK  336

Query  569  TVQFVDWCPTGFKCGINYQPP  507
            TVQFVDWCPTGFKCGIN QPP
Sbjct  337  TVQFVDWCPTGFKCGINSQPP  357


 Score =   116 bits (291),  Expect(2) = 7e-59, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 65/80 (81%), Gaps = 7/80 (9%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
             G+ + PP       + +V RAVCM+SNNTA+A+VF R++ KFDLMY+KRAFVH+YV EG
Sbjct  350  CGINSQPP-------MGRVPRAVCMLSNNTAIADVFGRMNQKFDLMYAKRAFVHYYVSEG  402

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEEGEF+EAREDLAALEKDY
Sbjct  403  MEEGEFAEAREDLAALEKDY  422



>ref|XP_003959948.1| hypothetical protein KAFR_0L02020 [Kazachstania africana CBS 
2517]
 emb|CCF60813.1| hypothetical protein KAFR_0L02020 [Kazachstania africana CBS 
2517]
Length=446

 Score =   135 bits (339),  Expect(2) = 8e-59, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            +G+   PPTV+P   LA VQRAVCM+SN TA+A+ + RID KFDLMY+KRAFVHWYVGEG
Sbjct  354  IGICYEPPTVIPDSQLASVQRAVCMLSNTTAIADAWKRIDAKFDLMYAKRAFVHWYVGEG  413

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEEGEF+EAREDLAALE+DY
Sbjct  414  MEEGEFTEAREDLAALERDY  433


 Score =   120 bits (300),  Expect(2) = 8e-59, Method: Compositional matrix adjust.
 Identities = 54/82 (66%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = -3

Query  752  AKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTK  573
            +KA+HE  SV EIT+A FEP + M KCDP  GKYMA CL+YRGDVV +DV  AV  +K K
Sbjct  280  SKAHHEANSVTEITNACFEPGNQMVKCDPSAGKYMANCLLYRGDVVTRDVQTAVTQVKNK  339

Query  572  RTVQFVDWCPTGFKCGINYQPP  507
            +TVQ VDWCPTGFK GI Y+PP
Sbjct  340  KTVQMVDWCPTGFKIGICYEPP  361



>ref|XP_003883425.1| hypothetical protein NCLIV_031800 [Neospora caninum Liverpool]
 emb|CBZ53393.1| hypothetical protein NCLIV_031800 [Neospora caninum Liverpool]
Length=333

 Score =   134 bits (337),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A+K  HEQ++V EIT A FE  +MMAKC P  GKYMACCLMYRGDV PKDVNAA+ TIK 
Sbjct  155  ASKYKHEQMNVREITVAAFEERNMMAKCRPSMGKYMACCLMYRGDVTPKDVNAAMGTIKA  214

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            +R + FVDWCPTGFK G+NYQPP
Sbjct  215  RRDINFVDWCPTGFKTGLNYQPP  237


 Score =   120 bits (301),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 63/79 (80%), Gaps = 0/79 (0%)
 Frame = -1

Query  526  GLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGM  347
            GL   PPT VP   LA   R+VCM+SN+TA+ EV  RID KFD MYSKRAFVHW+VGEGM
Sbjct  231  GLNYQPPTFVPDSHLAAAPRSVCMMSNSTAIKEVIDRIDTKFDKMYSKRAFVHWFVGEGM  290

Query  346  EEGEFSEAREDLAALEKDY  290
            EEG+ +EAR+DLAALE+DY
Sbjct  291  EEGQLTEARDDLAALERDY  309



>emb|CCF73348.1| unnamed protein product [Babesia microti strain RI]
Length=440

 Score =   134 bits (336),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KA HE +SV EIT + F+ +SMMA+CDP +GKYMACCLMYRGDVVPKDVN+A+A +K 
Sbjct  280  ARKAKHEYMSVSEITFSAFDVNSMMAECDPYNGKYMACCLMYRGDVVPKDVNSAIAAVKK  339

Query  575  KRTVQFVDWCPTGFKCGINYQPPNS  501
            K++VQFVDW PTGFK GINYQ P S
Sbjct  340  KKSVQFVDWSPTGFKFGINYQAPAS  364


 Score =   120 bits (302),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = -1

Query  526  GLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGM  347
            G+    P  +P  D+A V RAVCMISN+T++A+VF R+D KFDLMY+KRAF HWYVGEGM
Sbjct  356  GINYQAPASLPDQDMANVSRAVCMISNSTSIADVFFRMDKKFDLMYAKRAFTHWYVGEGM  415

Query  346  EEGEFSEAREDLAALEKDY  290
            +E EF EARED+AALEKDY
Sbjct  416  DESEFEEAREDVAALEKDY  434



>ref|XP_007391813.1| hypothetical protein PHACADRAFT_249557 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM59245.1| hypothetical protein PHACADRAFT_249557 [Phanerochaete carnosa 
HHB-10118-sp]
Length=447

 Score =   130 bits (326),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            +G+       VPGGDLA+  R++CM+SN TA+A  +SR+D KFDLMYSKRAFVHWYVGEG
Sbjct  352  LGICNEASANVPGGDLARTSRSLCMLSNTTAIASAWSRLDFKFDLMYSKRAFVHWYVGEG  411

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEEGEFSEAREDLAALEKDY
Sbjct  412  MEEGEFSEAREDLAALEKDY  431


 Score =   124 bits (312),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            + K  HEQ SV E+T + FEP + M KCDPR GKYMACCL+YRGDV PK+V AA+A+IKT
Sbjct  277  SEKVSHEQNSVAEMTLSCFEPGTQMVKCDPREGKYMACCLLYRGDVAPKEVQAAIASIKT  336

Query  575  KRTVQFVDWCPTGFKCGI  522
            ++T+QFVDWCPTGFK GI
Sbjct  337  RKTIQFVDWCPTGFKLGI  354



>ref|XP_008885683.1| alpha-tubulin I, putative [Hammondia hammondi]
 gb|KEP63746.1| alpha-tubulin I, putative [Hammondia hammondi]
Length=459

 Score =   134 bits (336),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A+K  HEQ++V EIT A FE  +MMAKC P  GKYMACCLMYRGDV PKDVNAA+ TIK+
Sbjct  281  ASKYRHEQMNVREITVAAFEERNMMAKCCPSKGKYMACCLMYRGDVTPKDVNAAMGTIKS  340

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            +R + FVDWCPTGFK G+NYQPP
Sbjct  341  RRDINFVDWCPTGFKTGLNYQPP  363


 Score =   120 bits (302),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 63/79 (80%), Gaps = 0/79 (0%)
 Frame = -1

Query  526  GLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGM  347
            GL   PPT VP   LA   R+VCM+SN+TA+ EV  RID KFD MYSKRAFVHW+VGEGM
Sbjct  357  GLNYQPPTFVPDSHLAAAPRSVCMMSNSTAIKEVIQRIDTKFDKMYSKRAFVHWFVGEGM  416

Query  346  EEGEFSEAREDLAALEKDY  290
            EEG+ +EAR+DLAALE+DY
Sbjct  417  EEGQLTEARDDLAALERDY  435



>gb|KFG63712.1| putative alpha-tubulin I [Toxoplasma gondii RUB]
Length=390

 Score =   134 bits (336),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A+K  HEQ++V EIT A FE  +MMAKC P  GKYMACCLMYRGDV PKDVNAA+ TIK+
Sbjct  212  ASKYRHEQMNVREITVAAFEERNMMAKCCPSKGKYMACCLMYRGDVTPKDVNAAMGTIKS  271

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            +R + FVDWCPTGFK G+NYQPP
Sbjct  272  RRDINFVDWCPTGFKTGLNYQPP  294


 Score =   120 bits (302),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 63/79 (80%), Gaps = 0/79 (0%)
 Frame = -1

Query  526  GLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGM  347
            GL   PPT VP   LA   R+VCM+SN+TA+ EV  RID KFD MYSKRAFVHW+VGEGM
Sbjct  288  GLNYQPPTFVPDSHLAAAPRSVCMMSNSTAIKEVIQRIDIKFDKMYSKRAFVHWFVGEGM  347

Query  346  EEGEFSEAREDLAALEKDY  290
            EEG+ +EAR+DLAALE+DY
Sbjct  348  EEGQLTEARDDLAALERDY  366



>gb|KHN82210.1| Tubulin alpha-2 chain [Toxocara canis]
Length=463

 Score =   127 bits (319),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 63/81 (78%), Gaps = 0/81 (0%)
 Frame = -3

Query  749  KAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  570
            KAYH+ LSV EIT   FEP + M KC+ R+GKYMA CL+YRGDVVPKDVN A+ +IK +R
Sbjct  295  KAYHQSLSVSEITGMCFEPHNQMVKCNSRNGKYMAICLLYRGDVVPKDVNTAINSIKQRR  354

Query  569  TVQFVDWCPTGFKCGINYQPP  507
               FVDWCPTGFK GINYQ P
Sbjct  355  VCDFVDWCPTGFKVGINYQAP  375


 Score =   127 bits (319),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            VG+    P VV G ++A+V R+VCM++N TA+AE +SR+D KFDLMY KRAF+HWYVGEG
Sbjct  368  VGINYQAPVVVEGSEMARVDRSVCMLANTTAIAEAWSRLDAKFDLMYKKRAFIHWYVGEG  427

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEEGEF+EARED+AALEKDY
Sbjct  428  MEEGEFAEAREDMAALEKDY  447



>ref|XP_007611418.1| PREDICTED: tubulin alpha chain-like [Cricetulus griseus]
 gb|ERE68273.1| tubulin alpha-1C chain [Cricetulus griseus]
Length=284

 Score =   129 bits (323),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 68/84 (81%), Gaps = 2/84 (2%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLM-YRGDVVPKDVNAAVATIK  579
            A KAY EQL V EIT+A FE ++ M KCDP HGKYMACCL+ Y GD VPKD NAA+ATIK
Sbjct  114  AEKAYLEQLMVAEITNACFESANQMVKCDPHHGKYMACCLLLYHGDAVPKDANAAIATIK  173

Query  578  TKRTVQFVDWCPTGFKCGINYQPP  507
            TK T+QFVDWCPTGFK GIN QPP
Sbjct  174  TKHTIQFVDWCPTGFKVGIN-QPP  196


 Score =   125 bits (313),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 68/80 (85%), Gaps = 2/80 (3%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            VG+   PPTVVPGGDLAKVQRAVCM+SN T + E ++ +DHKFDLMY+K AFVHWYV EG
Sbjct  190  VGIN-QPPTVVPGGDLAKVQRAVCMLSNTT-ITEAWAHLDHKFDLMYAKCAFVHWYVCEG  247

Query  349  MEEGEFSEAREDLAALEKDY  290
            ME GEFSEA ED+AALEKDY
Sbjct  248  MEVGEFSEACEDMAALEKDY  267



>gb|KFG51077.1| putative alpha-tubulin I, partial [Toxoplasma gondii p89]
Length=395

 Score =   133 bits (335),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A+K  HEQ++V EIT A FE  +MMAKC P  GKYMACCLMYRGDV PKDVNAA+ TIK+
Sbjct  217  ASKYRHEQMNVREITVAAFEERNMMAKCCPSKGKYMACCLMYRGDVTPKDVNAAMGTIKS  276

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            +R + FVDWCPTGFK G+NYQPP
Sbjct  277  RRDINFVDWCPTGFKTGLNYQPP  299


 Score =   120 bits (301),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 63/79 (80%), Gaps = 0/79 (0%)
 Frame = -1

Query  526  GLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGM  347
            GL   PPT VP   LA   R+VCM+SN+TA+ EV  RID KFD MYSKRAFVHW+VGEGM
Sbjct  293  GLNYQPPTFVPDSHLAAAPRSVCMMSNSTAIKEVIQRIDIKFDKMYSKRAFVHWFVGEGM  352

Query  346  EEGEFSEAREDLAALEKDY  290
            EEG+ +EAR+DLAALE+DY
Sbjct  353  EEGQLTEARDDLAALERDY  371



>ref|XP_002368048.1| tubulin alpha chain, putative [Toxoplasma gondii ME49]
 gb|EPR64302.1| putative alpha-tubulin I [Toxoplasma gondii GT1]
 gb|EPT28924.1| alpha-tubulin I, putative [Toxoplasma gondii ME49]
 gb|ESS35710.1| putative alpha-tubulin I [Toxoplasma gondii VEG]
 gb|KFG48575.1| putative alpha-tubulin I [Toxoplasma gondii GAB2-2007-GAL-DOM2]
 gb|KFG55381.1| putative alpha-tubulin I [Toxoplasma gondii FOU]
 gb|KFH17414.1| putative alpha-tubulin I [Toxoplasma gondii MAS]
Length=459

 Score =   134 bits (336),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A+K  HEQ++V EIT A FE  +MMAKC P  GKYMACCLMYRGDV PKDVNAA+ TIK+
Sbjct  281  ASKYRHEQMNVREITVAAFEERNMMAKCCPSKGKYMACCLMYRGDVTPKDVNAAMGTIKS  340

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            +R + FVDWCPTGFK G+NYQPP
Sbjct  341  RRDINFVDWCPTGFKTGLNYQPP  363


 Score =   120 bits (300),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 63/79 (80%), Gaps = 0/79 (0%)
 Frame = -1

Query  526  GLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGM  347
            GL   PPT VP   LA   R+VCM+SN+TA+ EV  RID KFD MYSKRAFVHW+VGEGM
Sbjct  357  GLNYQPPTFVPDSHLAAAPRSVCMMSNSTAIKEVIQRIDIKFDKMYSKRAFVHWFVGEGM  416

Query  346  EEGEFSEAREDLAALEKDY  290
            EEG+ +EAR+DLAALE+DY
Sbjct  417  EEGQLTEARDDLAALERDY  435



>ref|XP_007624041.1| PREDICTED: tubulin alpha chain isoform X2 [Cricetulus griseus]
Length=148

 Score =   143 bits (360),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+   PPTVVP GDLAKVQRAVCM+SN TA+ E ++ +DHKFDLMY+KRAFVHWYVGE
Sbjct  51   KVGINYQPPTVVPCGDLAKVQRAVCMLSNTTAIGEAWAPLDHKFDLMYAKRAFVHWYVGE  110

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GMEEGEFSEARED+AALEKDY
Sbjct  111  GMEEGEFSEAREDMAALEKDY  131


 Score =   110 bits (276),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 49/59 (83%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = -3

Query  683  MAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  507
            M KCDP HGKYMACCL+Y GDVVPKDVNAA+ATI TK  +QFVDWCPTGFK GINYQPP
Sbjct  1    MVKCDPCHGKYMACCLLYCGDVVPKDVNAAIATINTKSPIQFVDWCPTGFKVGINYQPP  59



>gb|EFX80594.1| hypothetical protein DAPPUDRAFT_318433 [Daphnia pulex]
Length=465

 Score =   130 bits (327),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            VG+   PP V+P GDLA+V RAVC +SN TA+AE ++R+D KFDLM++KRAFVHWYVGEG
Sbjct  370  VGINYQPPFVIPNGDLAQVTRAVCCLSNTTAIAEAWARLDRKFDLMFAKRAFVHWYVGEG  429

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEEGEF EAREDLAALE DY
Sbjct  430  MEEGEFVEAREDLAALELDY  449


 Score =   123 bits (309),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = -3

Query  752  AKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTK  573
             +A HE++SV +IT + F+P   M KC+P  GKYMA CL+YRGDV PKDVN A+A IK  
Sbjct  296  GRANHEKMSVDDITKSCFDPGHQMVKCNPASGKYMAVCLLYRGDVAPKDVNFAIAQIKAM  355

Query  572  RTVQFVDWCPTGFKCGINYQPP  507
            +TV FVDWCPTGFK GINYQPP
Sbjct  356  KTVHFVDWCPTGFKVGINYQPP  377



>ref|XP_009986403.1| PREDICTED: LOW QUALITY PROTEIN: tubulin alpha-8 chain-like [Tauraco 
erythrolophus]
Length=423

 Score =   140 bits (352),  Expect(2) = 7e-58, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
            +VG+   PPTVVPGGDLA V+RAVCM+SN TA+A+ ++R+DHKFDLM++KRAFVHWYV E
Sbjct  326  SVGINYQPPTVVPGGDLAPVERAVCMLSNTTAIADAWARLDHKFDLMFAKRAFVHWYVNE  385

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GMEEGEF+EAREDL ALEKDY
Sbjct  386  GMEEGEFAEAREDLFALEKDY  406


 Score =   112 bits (279),  Expect(2) = 7e-58, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 62/83 (75%), Gaps = 11/83 (13%)
 Frame = -3

Query  734  QLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFV  555
            QLSV EITSA FEPS+ M KCDPRHGKYMACC++YRGD+VPKDVN A+A IKT R++   
Sbjct  256  QLSVAEITSACFEPSNQMVKCDPRHGKYMACCMLYRGDIVPKDVNVAIAAIKTNRSL---  312

Query  554  DW--CPTGFK-----CGINYQPP  507
             W  C  GF+      GINYQPP
Sbjct  313  -WKACIXGFRFCMFSVGINYQPP  334



>gb|EDZ70339.1| YML124Cp-like protein [Saccharomyces cerevisiae AWRI1631]
Length=240

 Score =   134 bits (336),  Expect(2) = 9e-58, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            +G+   PP+V+P  +LA V RAVCM+SN TA+A+ + RID KFDLMY+KRAFVHWYVGEG
Sbjct  149  IGICYEPPSVIPSSELANVDRAVCMLSNTTAIADAWKRIDQKFDLMYAKRAFVHWYVGEG  208

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEEGEF+EAREDLAALE+DY
Sbjct  209  MEEGEFTEAREDLAALERDY  228


 Score =   117 bits (294),  Expect(2) = 9e-58, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = -3

Query  749  KAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  570
            +A HE  SV EIT+A FEP + M KCDP  GKYMA CL+YRGDVV +DV  AV  +K K+
Sbjct  76   RATHESNSVSEITNACFEPGNQMVKCDPTKGKYMANCLLYRGDVVTRDVQRAVEQVKNKK  135

Query  569  TVQFVDWCPTGFKCGINYQPPN  504
            TVQ VDWCPTGFK GI Y+PP+
Sbjct  136  TVQMVDWCPTGFKIGICYEPPS  157



>ref|XP_007933654.1| PREDICTED: LOW QUALITY PROTEIN: tubulin alpha chain-like 3 [Orycteropus 
afer afer]
Length=406

 Score =   135 bits (339),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            VG+    PTVVPGGDLAKVQ+AVCM+SN  A+AE ++R+DHKFDLMY+K+AF+HWY  EG
Sbjct  320  VGINNXRPTVVPGGDLAKVQQAVCMLSNTMAIAEAWARLDHKFDLMYAKQAFLHWYFREG  379

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEEGEF EAREDLAALEKDY
Sbjct  380  MEEGEFIEAREDLAALEKDY  399


 Score =   116 bits (290),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 64/81 (79%), Gaps = 0/81 (0%)
 Frame = -3

Query  749  KAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  570
            KAY+EQ S+P+ITSA F+ S+ + KC  + GKYMACC++YR DV PKDVNAA+A +K + 
Sbjct  247  KAYYEQFSMPDITSACFQFSNQLVKCATQLGKYMACCILYRRDVAPKDVNAAIAAMKPRN  306

Query  569  TVQFVDWCPTGFKCGINYQPP  507
            +VQFVDWCPTGFK GIN   P
Sbjct  307  SVQFVDWCPTGFKVGINNXRP  327



>gb|ABE68662.1| alpha tubulin [Herpetomonas megaseliae]
Length=403

 Score =   154 bits (389),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQLSV EIT++VFEP+ M+ KCDPRHGKYM+CCLMYRGDVVPKDVNA++ATIKT
Sbjct  278  AEKAYHEQLSVAEITNSVFEPAGMLTKCDPRHGKYMSCCLMYRGDVVPKDVNASIATIKT  337

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            KR++ F DW PTGFK GINYQPP
Sbjct  338  KRSISFCDWSPTGFKVGINYQPP  360


 Score = 97.1 bits (240),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 48/52 (92%), Gaps = 0/52 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRA  377
             VG+   PPTVVPGGDLAKVQRAVCMI+N+TA+AEVF+RIDHKFDLMYSKRA
Sbjct  352  KVGINYQPPTVVPGGDLAKVQRAVCMIANSTAIAEVFARIDHKFDLMYSKRA  403



>ref|XP_004033314.1| PREDICTED: tubulin alpha-4A chain [Gorilla gorilla gorilla]
Length=432

 Score =   155 bits (393),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 70/88 (80%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQLSV EIT+A FEP++ M KCDPRHGKYMACCL+Y GDVVPKDVNAA+A IKT
Sbjct  287  AEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYCGDVVPKDVNAAIAAIKT  346

Query  575  KRTVQFVDWCPTGFKCGINYQPPNSCAR  492
            KR++QFVDWCPTGFK GINYQPP   AR
Sbjct  347  KRSIQFVDWCPTGFKVGINYQPPTVWAR  374


 Score = 95.5 bits (236),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 41/46 (89%), Positives = 46/46 (100%), Gaps = 0/46 (0%)
 Frame = -1

Query  427  VFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            V++R+DHKFDLMY+KRAFVHWYVGEGMEEGEFSEARED+AALEKDY
Sbjct  371  VWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDY  416



>ref|NP_013582.1| alpha-tubulin TUB3 [Saccharomyces cerevisiae S288c]
 sp|P09734.1|TBA3_YEAST RecName: Full=Tubulin alpha-3 chain [Saccharomyces cerevisiae 
S288c]
 gb|AAA35181.1| alpha tubulin [Saccharomyces cerevisiae]
 emb|CAA89156.1| Tub3p [Saccharomyces cerevisiae]
 gb|EDN64271.1| alpha-tubulin [Saccharomyces cerevisiae YJM789]
 gb|EDV11389.1| tubulin alpha-3 chain [Saccharomyces cerevisiae RM11-1a]
 emb|CAY81694.1| Tub3p [Saccharomyces cerevisiae EC1118]
 tpg|DAA09775.1| TPA: alpha-tubulin TUB3 [Saccharomyces cerevisiae S288c]
 gb|EIW08636.1| Tub3p [Saccharomyces cerevisiae CEN.PK113-7D]
 gb|EWG83810.1| Tub3p [Saccharomyces cerevisiae R008]
 gb|EWG89198.1| Tub3p [Saccharomyces cerevisiae P301]
 gb|EWH16521.1| Tub3p [Saccharomyces cerevisiae P283]
 gb|AHY76345.1| Tub3p [Saccharomyces cerevisiae YJM993]
 gb|AJP40590.1| Tub3p [Saccharomyces cerevisiae YJM1078]
 gb|AJS61770.1| Tub3p [Saccharomyces cerevisiae YJM189]
 gb|AJS62197.1| Tub3p [Saccharomyces cerevisiae YJM193]
 gb|AJS62631.1| Tub3p [Saccharomyces cerevisiae YJM195]
 gb|AJS63067.1| Tub3p [Saccharomyces cerevisiae YJM244]
 gb|AJS63506.1| Tub3p [Saccharomyces cerevisiae YJM248]
 gb|AJS63941.1| Tub3p [Saccharomyces cerevisiae YJM270]
 gb|AJS64378.1| Tub3p [Saccharomyces cerevisiae YJM271]
 gb|AJS64811.1| Tub3p [Saccharomyces cerevisiae YJM320]
 gb|AJS65247.1| Tub3p [Saccharomyces cerevisiae YJM326]
 gb|AJS65682.1| Tub3p [Saccharomyces cerevisiae YJM428]
 gb|AJS66119.1| Tub3p [Saccharomyces cerevisiae YJM450]
 gb|AJS66558.1| Tub3p [Saccharomyces cerevisiae YJM451]
 gb|AJS66995.1| Tub3p [Saccharomyces cerevisiae YJM453]
 gb|AJS67437.1| Tub3p [Saccharomyces cerevisiae YJM456]
 gb|AJS67874.1| Tub3p [Saccharomyces cerevisiae YJM470]
 gb|AJS68316.1| Tub3p [Saccharomyces cerevisiae YJM541]
 gb|AJS68750.1| Tub3p [Saccharomyces cerevisiae YJM554]
 gb|AJS69187.1| Tub3p [Saccharomyces cerevisiae YJM555]
 gb|AJS69624.1| Tub3p [Saccharomyces cerevisiae YJM627]
 gb|AJS70064.1| Tub3p [Saccharomyces cerevisiae YJM681]
 gb|AJS70504.1| Tub3p [Saccharomyces cerevisiae YJM682]
 gb|AJS70941.1| Tub3p [Saccharomyces cerevisiae YJM683]
 gb|AJS71375.1| Tub3p [Saccharomyces cerevisiae YJM689]
 gb|AJS71810.1| Tub3p [Saccharomyces cerevisiae YJM693]
 gb|AJS72250.1| Tub3p [Saccharomyces cerevisiae YJM969]
 gb|AJS72684.1| Tub3p [Saccharomyces cerevisiae YJM972]
 gb|AJS73122.1| Tub3p [Saccharomyces cerevisiae YJM975]
 gb|AJS73557.1| Tub3p [Saccharomyces cerevisiae YJM978]
 gb|AJS73998.1| Tub3p [Saccharomyces cerevisiae YJM981]
 gb|AJS74441.1| Tub3p [Saccharomyces cerevisiae YJM984]
 gb|AJS74865.1| Tub3p [Saccharomyces cerevisiae YJM987]
 gb|AJS75302.1| Tub3p [Saccharomyces cerevisiae YJM990]
 gb|AJS75746.1| Tub3p [Saccharomyces cerevisiae YJM996]
 gb|AJS76185.1| Tub3p [Saccharomyces cerevisiae YJM1083]
 gb|AJS76622.1| Tub3p [Saccharomyces cerevisiae YJM1129]
 gb|AJS77061.1| Tub3p [Saccharomyces cerevisiae YJM1133]
 gb|AJS77499.1| Tub3p [Saccharomyces cerevisiae YJM1190]
 gb|AJS77934.1| Tub3p [Saccharomyces cerevisiae YJM1199]
 gb|AJS78371.1| Tub3p [Saccharomyces cerevisiae YJM1202]
 gb|AJS78795.1| Tub3p [Saccharomyces cerevisiae YJM1208]
 gb|AJS79236.1| Tub3p [Saccharomyces cerevisiae YJM1242]
 gb|AJS79675.1| Tub3p [Saccharomyces cerevisiae YJM1244]
 gb|AJS80111.1| Tub3p [Saccharomyces cerevisiae YJM1248]
 gb|AJS80545.1| Tub3p [Saccharomyces cerevisiae YJM1250]
 gb|AJS80978.1| Tub3p [Saccharomyces cerevisiae YJM1252]
 gb|AJS81410.1| Tub3p [Saccharomyces cerevisiae YJM1273]
 gb|AJS81849.1| Tub3p [Saccharomyces cerevisiae YJM1304]
 gb|AJS82292.1| Tub3p [Saccharomyces cerevisiae YJM1307]
 gb|AJS82716.1| Tub3p [Saccharomyces cerevisiae YJM1311]
 gb|AJS83148.1| Tub3p [Saccharomyces cerevisiae YJM1326]
 gb|AJS83586.1| Tub3p [Saccharomyces cerevisiae YJM1332]
 gb|AJS85326.1| Tub3p [Saccharomyces cerevisiae YJM1342]
 gb|AJS84887.1| Tub3p [Saccharomyces cerevisiae YJM1341]
 gb|AJS84461.1| Tub3p [Saccharomyces cerevisiae YJM1338]
 gb|AJS85765.1| Tub3p [Saccharomyces cerevisiae YJM1355]
 gb|AJS86639.1| Tub3p [Saccharomyces cerevisiae YJM1381]
 gb|AJS87072.1| Tub3p [Saccharomyces cerevisiae YJM1383]
 gb|AJS87510.1| Tub3p [Saccharomyces cerevisiae YJM1385]
 gb|AJS87947.1| Tub3p [Saccharomyces cerevisiae YJM1386]
 gb|AJS88375.1| Tub3p [Saccharomyces cerevisiae YJM1387]
 gb|AJS88818.1| Tub3p [Saccharomyces cerevisiae YJM1388]
 gb|AJS89255.1| Tub3p [Saccharomyces cerevisiae YJM1389]
 gb|AJS89695.1| Tub3p [Saccharomyces cerevisiae YJM1399]
 gb|AJS90129.1| Tub3p [Saccharomyces cerevisiae YJM1400]
 gb|AJS90563.1| Tub3p [Saccharomyces cerevisiae YJM1401]
 gb|AJS90998.1| Tub3p [Saccharomyces cerevisiae YJM1402]
 gb|AJS91438.1| Tub3p [Saccharomyces cerevisiae YJM1415]
 gb|AJS91876.1| Tub3p [Saccharomyces cerevisiae YJM1417]
 gb|AJS92315.1| Tub3p [Saccharomyces cerevisiae YJM1418]
 gb|AJS92755.1| Tub3p [Saccharomyces cerevisiae YJM1419]
 gb|AJS93191.1| Tub3p [Saccharomyces cerevisiae YJM1433]
 gb|AJS93628.1| Tub3p [Saccharomyces cerevisiae YJM1434]
 gb|AJS94069.1| Tub3p [Saccharomyces cerevisiae YJM1439]
 gb|AJS94493.1| Tub3p [Saccharomyces cerevisiae YJM1443]
 gb|AJS94923.1| Tub3p [Saccharomyces cerevisiae YJM1444]
 gb|AJS95362.1| Tub3p [Saccharomyces cerevisiae YJM1447]
 gb|AJS95782.1| Tub3p [Saccharomyces cerevisiae YJM1450]
 gb|AJS96219.1| Tub3p [Saccharomyces cerevisiae YJM1460]
 gb|AJS96658.1| Tub3p [Saccharomyces cerevisiae YJM1463]
 gb|AJS97527.1| Tub3p [Saccharomyces cerevisiae YJM1478]
 gb|AJS97091.1| Tub3p [Saccharomyces cerevisiae YJM1477]
 gb|AJS97964.1| Tub3p [Saccharomyces cerevisiae YJM1479]
 gb|AJS98398.1| Tub3p [Saccharomyces cerevisiae YJM1526]
 gb|AJS98830.1| Tub3p [Saccharomyces cerevisiae YJM1527]
 gb|AJS99266.1| Tub3p [Saccharomyces cerevisiae YJM1549]
 gb|AJS99707.1| Tub3p [Saccharomyces cerevisiae YJM1573]
 gb|AJT00148.1| Tub3p [Saccharomyces cerevisiae YJM1574]
 gb|AJT00585.1| Tub3p [Saccharomyces cerevisiae YJM1592]
 gb|AJT01025.1| Tub3p [Saccharomyces cerevisiae YJM1615]
Length=445

 Score =   133 bits (334),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            +G+   PP+V+P  +LA V RAVCM+SN TA+A+ + RID KFDLMY+KRAFVHWYVGEG
Sbjct  354  IGICYEPPSVIPSSELANVDRAVCMLSNTTAIADAWKRIDQKFDLMYAKRAFVHWYVGEG  413

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEEGEF+EAREDLAALE+DY
Sbjct  414  MEEGEFTEAREDLAALERDY  433


 Score =   117 bits (294),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = -3

Query  749  KAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  570
            +A HE  SV EIT+A FEP + M KCDP  GKYMA CL+YRGDVV +DV  AV  +K K+
Sbjct  281  RATHESNSVSEITNACFEPGNQMVKCDPTKGKYMANCLLYRGDVVTRDVQRAVEQVKNKK  340

Query  569  TVQFVDWCPTGFKCGINYQPPN  504
            TVQ VDWCPTGFK GI Y+PP+
Sbjct  341  TVQMVDWCPTGFKIGICYEPPS  362



>dbj|GAA25326.1| K7_Tub3p [Saccharomyces cerevisiae Kyokai no. 7]
Length=445

 Score =   133 bits (334),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            +G+   PP+V+P  +LA V RAVCM+SN TA+A+ + RID KFDLMY+KRAFVHWYVGEG
Sbjct  354  IGICYEPPSVIPSSELANVDRAVCMLSNTTAIADAWKRIDQKFDLMYAKRAFVHWYVGEG  413

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEEGEF+EAREDLAALE+DY
Sbjct  414  MEEGEFTEAREDLAALERDY  433


 Score =   117 bits (294),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = -3

Query  749  KAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  570
            +A HE  SV EIT+A FEP + M KCDP  GKYMA CL+YRGDVV +DV  AV  +K K+
Sbjct  281  RATHESNSVSEITNACFEPGNQMVKCDPTKGKYMANCLLYRGDVVTRDVQRAVEQVKNKK  340

Query  569  TVQFVDWCPTGFKCGINYQPPN  504
            TVQ VDWCPTGFK GI Y+PP+
Sbjct  341  TVQMVDWCPTGFKIGICYEPPS  362



>gb|EEU05259.1| Tub3p [Saccharomyces cerevisiae JAY291]
Length=446

 Score =   133 bits (334),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            +G+   PP+V+P  +LA V RAVCM+SN TA+A+ + RID KFDLMY+KRAFVHWYVGEG
Sbjct  355  IGICYEPPSVIPSSELANVDRAVCMLSNTTAIADAWKRIDQKFDLMYAKRAFVHWYVGEG  414

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEEGEF+EAREDLAALE+DY
Sbjct  415  MEEGEFTEAREDLAALERDY  434


 Score =   117 bits (294),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = -3

Query  749  KAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  570
            +A HE  SV EIT+A FEP + M KCDP  GKYMA CL+YRGDVV +DV  AV  +K K+
Sbjct  282  RATHESNSVSEITNACFEPGNQMVKCDPTKGKYMANCLLYRGDVVTRDVQRAVEQVKNKK  341

Query  569  TVQFVDWCPTGFKCGINYQPPN  504
            TVQ VDWCPTGFK GI Y+PP+
Sbjct  342  TVQMVDWCPTGFKIGICYEPPS  363



>gb|AJS86201.1| Tub3p [Saccharomyces cerevisiae YJM1356]
Length=445

 Score =   133 bits (334),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            +G+   PP+V+P  +LA V RAVCM+SN TA+A+ + RID KFDLMY+KRAFVHWYVGEG
Sbjct  354  IGICYEPPSVIPSSELANVDRAVCMLSNTTAIADAWKRIDQKFDLMYAKRAFVHWYVGEG  413

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEEGEF+EAREDLAALE+DY
Sbjct  414  MEEGEFTEAREDLAALERDY  433


 Score =   117 bits (294),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = -3

Query  749  KAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  570
            +A HE  SV EIT+A FEP + M KCDP  GKYMA CL+YRGDVV +DV  AV  +K K+
Sbjct  281  RATHESNSVSEITNACFEPGNQMVKCDPTKGKYMANCLLYRGDVVTRDVQRAVEQVKNKK  340

Query  569  TVQFVDWCPTGFKCGINYQPPN  504
            TVQ VDWCPTGFK GI Y+PP+
Sbjct  341  TVQMVDWCPTGFKIGICYEPPS  362



>gb|AJS84023.1| Tub3p [Saccharomyces cerevisiae YJM1336]
Length=445

 Score =   133 bits (334),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            +G+   PP+V+P  +LA V RAVCM+SN TA+A+ + RID KFDLMY+KRAFVHWYVGEG
Sbjct  354  IGICYEPPSVIPSSELANVDRAVCMLSNTTAIADAWKRIDQKFDLMYAKRAFVHWYVGEG  413

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEEGEF+EAREDLAALE+DY
Sbjct  414  MEEGEFTEAREDLAALERDY  433


 Score =   117 bits (294),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = -3

Query  749  KAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  570
            +A HE  SV EIT+A FEP + M KCDP  GKYMA CL+YRGDVV +DV  AV  +K K+
Sbjct  281  RATHESNSVSEITNACFEPGNQMVKCDPTKGKYMANCLLYRGDVVTRDVQRAVEQVKNKK  340

Query  569  TVQFVDWCPTGFKCGINYQPPN  504
            TVQ VDWCPTGFK GI Y+PP+
Sbjct  341  TVQMVDWCPTGFKIGICYEPPS  362



>gb|EGA73633.1| Tub3p [Saccharomyces cerevisiae AWRI796]
 gb|EGA77401.1| Tub3p [Saccharomyces cerevisiae Vin13]
 gb|EGA81524.1| Tub3p [Saccharomyces cerevisiae Lalvin QA23]
 gb|EGA85218.1| Tub3p [Saccharomyces cerevisiae VL3]
 gb|EHN05165.1| Tub3p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii 
VIN7]
Length=461

 Score =   133 bits (334),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            +G+   PP+V+P  +LA V RAVCM+SN TA+A+ + RID KFDLMY+KRAFVHWYVGEG
Sbjct  370  IGICYEPPSVIPSSELANVDRAVCMLSNTTAIADAWKRIDQKFDLMYAKRAFVHWYVGEG  429

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEEGEF+EAREDLAALE+DY
Sbjct  430  MEEGEFTEAREDLAALERDY  449


 Score =   117 bits (294),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = -3

Query  749  KAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  570
            +A HE  SV EIT+A FEP + M KCDP  GKYMA CL+YRGDVV +DV  AV  +K K+
Sbjct  297  RATHESNSVSEITNACFEPGNQMVKCDPTKGKYMANCLLYRGDVVTRDVQRAVEQVKNKK  356

Query  569  TVQFVDWCPTGFKCGINYQPPN  504
            TVQ VDWCPTGFK GI Y+PP+
Sbjct  357  TVQMVDWCPTGFKIGICYEPPS  378



>gb|KFU99907.1| Tubulin alpha-2 chain, partial [Pterocles gutturalis]
Length=443

 Score =   125 bits (315),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = -3

Query  749  KAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  570
            +AY   LSV E+TS+ FEP++ + KCD   GKYMACC++YRGDVVPKDVN A+A IKTKR
Sbjct  276  RAYDRPLSVAELTSSCFEPNNQLLKCDLGRGKYMACCMLYRGDVVPKDVNEAIAAIKTKR  335

Query  569  TVQFVDWCPTGFKCGINYQPP  507
            T++FVDWCPTGFK GI+ +PP
Sbjct  336  TIRFVDWCPTGFKVGISSRPP  356


 Score =   124 bits (311),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+++ PP VVPG  LA V R VCM+SN TAVAE ++R++ +FDL+++K+AFVHWY GE
Sbjct  348  KVGISSRPPAVVPGRALAPVPRTVCMLSNTTAVAEAWARLNRRFDLLFTKKAFVHWYEGE  407

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GMEE EF+EAREDLAALEKDY
Sbjct  408  GMEEAEFTEAREDLAALEKDY  428



>ref|XP_010077816.1| PREDICTED: tubulin alpha-8 chain-like, partial [Pterocles gutturalis]
Length=446

 Score =   125 bits (315),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = -3

Query  749  KAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  570
            +AY   LSV E+TS+ FEP++ + KCD   GKYMACC++YRGDVVPKDVN A+A IKTKR
Sbjct  276  RAYDRPLSVAELTSSCFEPNNQLLKCDLGRGKYMACCMLYRGDVVPKDVNEAIAAIKTKR  335

Query  569  TVQFVDWCPTGFKCGINYQPP  507
            T++FVDWCPTGFK GI+ +PP
Sbjct  336  TIRFVDWCPTGFKVGISSRPP  356


 Score =   124 bits (310),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+++ PP VVPG  LA V R VCM+SN TAVAE ++R++ +FDL+++K+AFVHWY GE
Sbjct  348  KVGISSRPPAVVPGRALAPVPRTVCMLSNTTAVAEAWARLNRRFDLLFTKKAFVHWYEGE  407

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GMEE EF+EAREDLAALEKDY
Sbjct  408  GMEEAEFTEAREDLAALEKDY  428



>ref|XP_009070713.1| PREDICTED: LOW QUALITY PROTEIN: tubulin alpha chain-like, partial 
[Acanthisitta chloris]
Length=163

 Score =   126 bits (316),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 63/65 (97%), Gaps = 0/65 (0%)
 Frame = -1

Query  484  LAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAA  305
            LAKVQRAVCM+SN TA+AE ++R+DHKFDLMY+KRAFVHWYVGEGMEEGEFSEARED+AA
Sbjct  80   LAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAA  139

Query  304  LEKDY  290
            LEKDY
Sbjct  140  LEKDY  144


 Score =   120 bits (302),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = -3

Query  719  EITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPT  540
            EIT+A FEP++ M KCDPRHGKYMACCL+YRGDVVPKDVNAA+ATIKTKRT+QFVDW P 
Sbjct  2    EITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWXPQ  61

Query  539  GFK  531
            GFK
Sbjct  62   GFK  64



>ref|XP_004009167.1| PREDICTED: LOW QUALITY PROTEIN: tubulin alpha chain-like [Ovis 
aries]
Length=465

 Score =   127 bits (320),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            VG+   PPT+VPG DLAK++ AVCM SN TA+ E ++ +DHKFDLM++K   VHWYVGEG
Sbjct  363  VGINYQPPTMVPGEDLAKIKXAVCMPSNTTAITEAWACLDHKFDLMHAKHVLVHWYVGEG  422

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEEGEFSEARED+AALEKDY
Sbjct  423  MEEGEFSEAREDMAALEKDY  442


 Score =   119 bits (297),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 65/83 (78%), Gaps = 3/83 (4%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAY EQLSV EI +A FE ++ M +C+P HG+YMAC L+Y GDVVPKDVNAA A   T
Sbjct  291  AEKAYPEQLSVAEIANACFELANQMGECNPHHGEYMACSLLYCGDVVPKDVNAATA---T  347

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            K ++QFVDWC TGFK GINYQPP
Sbjct  348  KHSIQFVDWCSTGFKVGINYQPP  370



>ref|XP_003939104.1| PREDICTED: tubulin alpha chain-like 3 isoform X2 [Saimiri boliviensis 
boliviensis]
Length=406

 Score =   129 bits (324),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+    PTV+PGGDLAK  +A+CM+SN TA+ E ++R+DHKFDLMY+KRAF+HWY+ E
Sbjct  319  KVGINNRLPTVMPGGDLAKAHQALCMLSNTTAIVEAWARLDHKFDLMYAKRAFLHWYIRE  378

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GMEE EF EAREDLAALE+DY
Sbjct  379  GMEEAEFLEAREDLAALERDY  399


 Score =   117 bits (292),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHE+ SV +IT+A FE S+ + KCDPR GKYMACCL+YRGDVVP++ NAA+A +K 
Sbjct  245  ADKAYHERFSVSDITAACFESSNQLVKCDPRRGKYMACCLLYRGDVVPREANAAIAAMKA  304

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            + +VQFVDWCPTGFK GIN + P
Sbjct  305  RHSVQFVDWCPTGFKVGINNRLP  327



>ref|XP_005713293.1| alpha-tubulin [Chondrus crispus]
 emb|CDF33490.1| alpha-tubulin [Chondrus crispus]
Length=447

 Score =   125 bits (315),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            +G+ + PPT VP   LAK  RAVC I+N+TA+AEVF+R++ KFDLMY KRAFVHWYVGEG
Sbjct  354  LGINSRPPTKVPDDPLAKTHRAVCSIANSTAIAEVFARVNAKFDLMYMKRAFVHWYVGEG  413

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEEGEF+EARE+LA LE DY
Sbjct  414  MEEGEFAEARENLAMLEHDY  433


 Score =   120 bits (300),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 68/84 (81%), Gaps = 1/84 (1%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRG-DVVPKDVNAAVATIK  579
            A +AYHE+ SV EIT++VFEP++  AKCDPR G+Y+A  L YRG D+ PKDVNAAVA +K
Sbjct  278  AEQAYHEESSVAEITNSVFEPNASFAKCDPRSGRYIAVSLTYRGADIFPKDVNAAVAAVK  337

Query  578  TKRTVQFVDWCPTGFKCGINYQPP  507
            T+++VQFV+W PTG K GIN +PP
Sbjct  338  TRKSVQFVEWSPTGVKLGINSRPP  361



>ref|XP_003939105.1| PREDICTED: tubulin alpha chain-like 3 isoform X1 [Saimiri boliviensis 
boliviensis]
Length=446

 Score =   129 bits (324),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+    PTV+PGGDLAK  +A+CM+SN TA+ E ++R+DHKFDLMY+KRAF+HWY+ E
Sbjct  359  KVGINNRLPTVMPGGDLAKAHQALCMLSNTTAIVEAWARLDHKFDLMYAKRAFLHWYIRE  418

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GMEE EF EAREDLAALE+DY
Sbjct  419  GMEEAEFLEAREDLAALERDY  439


 Score =   116 bits (291),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHE+ SV +IT+A FE S+ + KCDPR GKYMACCL+YRGDVVP++ NAA+A +K 
Sbjct  285  ADKAYHERFSVSDITAACFESSNQLVKCDPRRGKYMACCLLYRGDVVPREANAAIAAMKA  344

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            + +VQFVDWCPTGFK GIN + P
Sbjct  345  RHSVQFVDWCPTGFKVGINNRLP  367



>ref|XP_001843131.1| tubulin alpha chain [Culex quinquefasciatus]
 gb|EDS30755.1| tubulin alpha chain [Culex quinquefasciatus]
Length=425

 Score =   128 bits (321),  Expect(2) = 6e-56, Method: Compositional matrix adjust.
 Identities = 54/77 (70%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = -3

Query  749  KAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  570
            KA H  L++ ++TS +FEP + M KCD R GKYMACCL+YRGD+VPKDVNAA+A IK +R
Sbjct  251  KANHATLTISDLTSQLFEPDNQMVKCDLRSGKYMACCLLYRGDIVPKDVNAAIAAIKNRR  310

Query  569  TVQFVDWCPTGFKCGIN  519
            TVQFVDWCPTGFK GIN
Sbjct  311  TVQFVDWCPTGFKVGIN  327


 Score =   117 bits (293),  Expect(2) = 6e-56, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            VG+    P +VPGGDLA + R V M+++NTA+AE + ++DHKFD+MY+KRAFVHW+V EG
Sbjct  324  VGINPKCPVMVPGGDLAPIHRGVSMLASNTAIAEAWRKLDHKFDMMYAKRAFVHWFVNEG  383

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEE  F+EARE+LAALE DY
Sbjct  384  MEEAMFAEARENLAALEMDY  403



>gb|EPY75602.1| protein disulfide-isomerase A6 [Camelus ferus]
Length=551

 Score =   129 bits (325),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+  + PTVVPGGDL K Q+AVCM+SN+TA AE ++R+DHK DL+ +KRAFVHWYVGE
Sbjct  51   KVGINYHSPTVVPGGDLVKAQQAVCMLSNSTATAEAWARLDHKSDLVCAKRAFVHWYVGE  110

Query  352  GMEEGEFSEAREDLAALEKDY  290
            G EEGEFSEARED+ ALEKDY
Sbjct  111  GAEEGEFSEAREDMDALEKDY  131


 Score =   114 bits (284),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 48/59 (81%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = -3

Query  683  MAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPP  507
            M KCDPRHGKYMACCL+Y GDVVPKDV+AA ATIKTKR++Q VDWCPTGFK GINY  P
Sbjct  1    MVKCDPRHGKYMACCLLYHGDVVPKDVSAATATIKTKRSIQSVDWCPTGFKVGINYHSP  59



>gb|EPQ09739.1| Tubulin alpha chain-like 3 [Myotis brandtii]
Length=484

 Score =   133 bits (335),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A  AYH+  SV +IT+A FE S+ + KCDPR GKYMACCL+YRGDVVPKDVNAA+A +K+
Sbjct  323  ADNAYHKDFSVADITTACFEVSNQLVKCDPRLGKYMACCLLYRGDVVPKDVNAAIAAMKS  382

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            + +VQFVDWCPTGFK GIN QPP
Sbjct  383  RNSVQFVDWCPTGFKVGINSQPP  405


 Score =   109 bits (273),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+ + PP ++PGG++AKVQ+AVCM+SN TAV E ++R++HKFDLMY+KRAF+HWY+ E
Sbjct  397  KVGINSQPPMMMPGGEMAKVQQAVCMLSNTTAVVEAWARLNHKFDLMYAKRAFLHWYIRE  456

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GMEE EFSEAR+DLA LEKDY
Sbjct  457  GMEEEEFSEARKDLACLEKDY  477



>ref|XP_005869572.1| PREDICTED: tubulin alpha chain-like 3 [Myotis brandtii]
Length=446

 Score =   133 bits (334),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A  AYH+  SV +IT+A FE S+ + KCDPR GKYMACCL+YRGDVVPKDVNAA+A +K+
Sbjct  285  ADNAYHKDFSVADITTACFEVSNQLVKCDPRLGKYMACCLLYRGDVVPKDVNAAIAAMKS  344

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            + +VQFVDWCPTGFK GIN QPP
Sbjct  345  RNSVQFVDWCPTGFKVGINSQPP  367


 Score =   109 bits (273),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+ + PP ++PGG++AKVQ+AVCM+SN TAV E ++R++HKFDLMY+KRAF+HWY+ E
Sbjct  359  KVGINSQPPMMMPGGEMAKVQQAVCMLSNTTAVVEAWARLNHKFDLMYAKRAFLHWYIRE  418

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GMEE EFSEAR+DLA LEKDY
Sbjct  419  GMEEEEFSEARKDLACLEKDY  439



>gb|ABJ80981.1| alpha tubulin, partial [Pyropia yezoensis]
Length=389

 Score =   147 bits (371),  Expect(2) = 9e-55, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KA+HE LSV EITS+ FEP+ MMA+C+P  GKYM+CCLMYRGD+VPKDVNAAVA IKT
Sbjct  261  ADKAHHESLSVSEITSSAFEPADMMAECNPNIGKYMSCCLMYRGDIVPKDVNAAVAAIKT  320

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            ++++QFVDWCPTGFKCGIN QPP
Sbjct  321  RKSIQFVDWCPTGFKCGINNQPP  343


 Score = 94.0 bits (232),  Expect(2) = 9e-55, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -1

Query  526  GLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVH  368
            G+   PPTVVPGGDLA V RAVCMISN+TA+AEVF RID KFDL+YSKRAFVH
Sbjct  337  GINNQPPTVVPGGDLAPVNRAVCMISNSTAIAEVFGRIDAKFDLLYSKRAFVH  389



>ref|XP_001610358.1| tubulin alpha chain [Babesia bovis T2Bo]
 gb|EDO06790.1| tubulin alpha chain [Babesia bovis]
Length=440

 Score =   137 bits (345),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KA HE +SV EIT++ F+P+SMMA+CDPR G YMACCLMYRGDVVPKDVN+A+A +K+
Sbjct  280  ARKAKHEFMSVGEITNSAFDPASMMAECDPRLGHYMACCLMYRGDVVPKDVNSAIAHVKS  339

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            K++V+FVDW PTGFK GINYQPP
Sbjct  340  KKSVRFVDWSPTGFKFGINYQPP  362


 Score =   104 bits (259),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 56/79 (71%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = -1

Query  526  GLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGM  347
            G+   PP VVPG DLAK+ RAVCMISN+T++++VF R+D KFD+MY+K+AFVHWY+GEGM
Sbjct  356  GINYQPPCVVPGDDLAKISRAVCMISNSTSISDVFVRMDSKFDVMYAKKAFVHWYMGEGM  415

Query  346  EEGEFSEAREDLAALEKDY  290
            EE EF EARED+AALEKDY
Sbjct  416  EESEFEEAREDVAALEKDY  434



>ref|XP_008153569.1| PREDICTED: tubulin alpha chain-like 3 [Eptesicus fuscus]
Length=395

 Score =   132 bits (332),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A  +YH+  SV +IT+A FE S+ + KCDPR GKYMACCL+YRGDVVPKDVNAA+A +K+
Sbjct  234  ADNSYHKDFSVSDITTACFEVSNQLVKCDPRLGKYMACCLLYRGDVVPKDVNAAIAAMKS  293

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            + ++QFVDWCPTGFK GIN QPP
Sbjct  294  RNSIQFVDWCPTGFKVGINSQPP  316


 Score =   108 bits (271),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            VG+ + PP ++PGG++AKVQ+AVCM+SN TAV E ++R++HKFDLMY+K+AF+HWY+ EG
Sbjct  309  VGINSQPPMMMPGGEMAKVQQAVCMLSNTTAVVEAWARLNHKFDLMYAKKAFLHWYIREG  368

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEE EFSEAR+DLA+LEKDY
Sbjct  369  MEEEEFSEARKDLASLEKDY  388



>emb|CAG03832.1| unnamed protein product [Tetraodon nigroviridis]
Length=477

 Score =   129 bits (323),  Expect(3) = 1e-54, Method: Compositional matrix adjust.
 Identities = 57/66 (86%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = -1

Query  487  DLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLA  308
            DLAKVQRAVCM+SN TA+AE ++R+DHKFDLMY+KRAFVHWYVGEGMEEGEFSEARED+A
Sbjct  393  DLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMA  452

Query  307  ALEKDY  290
            ALEKDY
Sbjct  453  ALEKDY  458


 Score =   109 bits (272),  Expect(3) = 1e-54, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A K YHEQLSV EIT+A FEP++ M KCDPRHGKYMACCL++RGDVVPKDVNAA+ATIKT
Sbjct  318  AEKPYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLFRGDVVPKDVNAAIATIKT  377

Query  575  K  573
            +
Sbjct  378  Q  378


 Score = 23.9 bits (50),  Expect(3) = 1e-54, Method: Compositional matrix adjust.
 Identities = 10/17 (59%), Positives = 13/17 (76%), Gaps = 0/17 (0%)
 Frame = -2

Query  582  QNETHSSVC*LVPNRLQ  532
            + +TH  VC LVP+RLQ
Sbjct  376  KTQTHHPVCGLVPHRLQ  392



>ref|XP_007604829.1| tubulin alpha chain [Vittaforma corneae ATCC 50505]
 gb|ELA41519.1| tubulin alpha chain [Vittaforma corneae ATCC 50505]
Length=440

 Score =   128 bits (321),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            +G+    P V+PG  +A V RAVC +SN TA+AE +SR++HKFDLM++KRAFVHWYVGEG
Sbjct  349  IGINEKKPAVLPGSAMAAVSRAVCALSNTTAIAEAWSRLNHKFDLMFAKRAFVHWYVGEG  408

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEEGEFSEAREDLAALE DY
Sbjct  409  MEEGEFSEAREDLAALENDY  428


 Score =   113 bits (282),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KA HE LSV EIT+  FEPS+ M KC+ + GK++ACCL++RGDV PK+ N A A IK 
Sbjct  274  AQKASHEGLSVQEITNNCFEPSNQMVKCNIKKGKFIACCLLFRGDVKPKEANQATANIKA  333

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            K+  QFV+WCPTGFK GIN + P
Sbjct  334  KKASQFVEWCPTGFKIGINEKKP  356



>gb|ETN78534.1| tubulin/FtsZ family protein [Necator americanus]
Length=338

 Score =   129 bits (323),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            VG+    P  VPG DL ++ RAVCM+SN TA+++ ++R+++KFD+MYSKRAFVHWYVGEG
Sbjct  244  VGINYQRPNHVPGDDLGQLTRAVCMLSNTTAISDAWARLNYKFDVMYSKRAFVHWYVGEG  303

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEEGEFSEAREDLAALEKDY
Sbjct  304  MEEGEFSEAREDLAALEKDY  323


 Score =   110 bits (276),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 61/93 (66%), Gaps = 9/93 (10%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYR---------GDVVPKDV  603
            A KAY E L V +IT+   E SS M KCD   GKYMA CL+YR         GDVVPKDV
Sbjct  160  AEKAYRESLLVKDITTMCLETSSQMVKCDATSGKYMAVCLLYRCHKTSKVFRGDVVPKDV  219

Query  602  NAAVATIKTKRTVQFVDWCPTGFKCGINYQPPN  504
            N A+ +++T+  + FV WCPTGFK GINYQ PN
Sbjct  220  NEAITSLRTRSGLDFVSWCPTGFKVGINYQRPN  252



>emb|CAJ44848.1| alpha-tubulin [Polysphondylium tenuissimum]
Length=410

 Score =   134 bits (338),  Expect(2) = 6e-54, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = -3

Query  749  KAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  570
            KA HEQ SV  +T+AVFE  +MMAKCDPR GKYMACCLMYRG VVPKD   AVA +KTK+
Sbjct  270  KAAHEQFSVGALTNAVFEQQNMMAKCDPREGKYMACCLMYRGTVVPKDAQKAVADLKTKK  329

Query  569  TVQFVDWCPTGFKCGINYQPP  507
            T+ FVDW PTGFKCGIN++PP
Sbjct  330  TISFVDWSPTGFKCGINHEPP  350


 Score =   104 bits (259),  Expect(2) = 6e-54, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 54/58 (93%), Gaps = 0/58 (0%)
 Frame = -1

Query  526  GLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
            G+   PPTVVPGGDLAKV+RAVCM+SN TA+++VF+RI+HKFDLMY+KRAFVHWYVGE
Sbjct  344  GINHEPPTVVPGGDLAKVERAVCMLSNTTAISQVFTRINHKFDLMYTKRAFVHWYVGE  401



>ref|XP_002155700.1| PREDICTED: tubulin alpha-1C chain-like [Hydra vulgaris]
Length=447

 Score =   122 bits (305),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            VG+       V G D+A V+RA+CM+SN TA+  +++R+DHKFDLMY KRAFVHWYVGEG
Sbjct  352  VGINNQTIVTVNGSDMAPVKRALCMLSNTTAMGTLWARLDHKFDLMYQKRAFVHWYVGEG  411

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEEGEF+EARE++AALEKDY
Sbjct  412  MEEGEFTEARENMAALEKDY  431


 Score =   116 bits (290),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 61/81 (75%), Gaps = 0/81 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYH+ L   E+T +VFE  + M KCDP  GKYM+CC++YRGDV P++VN A++ IK 
Sbjct  277  AEKAYHQTLDTLELTRSVFELKNQMVKCDPSAGKYMSCCMLYRGDVQPRNVNEAISKIKA  336

Query  575  KRTVQFVDWCPTGFKCGINYQ  513
             + +QFVDWCPTGFK GIN Q
Sbjct  337  TKNIQFVDWCPTGFKVGINNQ  357



>ref|XP_007538925.1| PREDICTED: tubulin alpha-8 chain-like [Erinaceus europaeus]
Length=307

 Score =   143 bits (361),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 65/81 (80%), Positives = 73/81 (90%), Gaps = 1/81 (1%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQLSVPEIT+A FEP++ M KCDP HGKYMACCL+YRGDVVPKDVNAA+A+IK 
Sbjct  166  AEKAYHEQLSVPEITNACFEPANQMVKCDPCHGKYMACCLLYRGDVVPKDVNAAIASIKN  225

Query  575  KRTVQFVDWCPTGFKCGINYQ  513
            +R +QFVDWCPTGFK GINYQ
Sbjct  226  RR-IQFVDWCPTGFKVGINYQ  245


 Score = 94.4 bits (233),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = -1

Query  523  LTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGME  344
            L   PPTVVPGGDLAKVQ AVC++SN TA+AE ++ ++HKFD M++K AF+HWYVGE ME
Sbjct  247  LGCAPPTVVPGGDLAKVQWAVCLLSNTTAIAEAWAWLNHKFDQMFAKCAFLHWYVGERME  306

Query  343  E  341
            E
Sbjct  307  E  307



>emb|CAJ44857.1| alpha-tubulin [Polysphondylium luridum]
Length=328

 Score =   131 bits (330),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = -3

Query  749  KAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  570
            KA HEQ SV  +T+AVF+ ++MMAKCDPR GKYMACCLMYRG VVPKD   AV  +KTK+
Sbjct  189  KATHEQFSVGALTNAVFDQANMMAKCDPREGKYMACCLMYRGTVVPKDAQKAVNDLKTKK  248

Query  569  TVQFVDWCPTGFKCGINYQPP  507
            T+ FVDW PTGFKCGIN++PP
Sbjct  249  TISFVDWSPTGFKCGINHEPP  269


 Score =   105 bits (261),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 54/58 (93%), Gaps = 0/58 (0%)
 Frame = -1

Query  526  GLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
            G+   PPTVVPGGDLAKV+RAVCM+SN TA+++VFSRI+HKFDLMY+KRAFVHWYVGE
Sbjct  263  GINHEPPTVVPGGDLAKVERAVCMLSNTTAISQVFSRINHKFDLMYTKRAFVHWYVGE  320



>ref|XP_004605507.1| PREDICTED: tubulin alpha chain-like 3 [Sorex araneus]
Length=445

 Score =   119 bits (298),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+++  P VVPGG+LA V +AVC +SN+TAV E ++R++HKFDLM++KRAFVHWY+ E
Sbjct  358  KVGISSPAPAVVPGGELAPVPQAVCTLSNSTAVLEAWARLNHKFDLMFAKRAFVHWYLRE  417

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GMEE EF EAR DLAAL++DY
Sbjct  418  GMEEAEFWEARHDLAALQRDY  438


 Score =   117 bits (293),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KA +E+LSV +IT+A FE    + +CDPRHGK+MACCL+YRGDV PK VNAA+A +K+
Sbjct  284  ADKARYEELSVADITTACFEGPHQLVQCDPRHGKHMACCLLYRGDVAPKQVNAAIADVKS  343

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            + +VQFVDWCPTGFK GI+   P
Sbjct  344  RCSVQFVDWCPTGFKVGISSPAP  366



>gb|KGK39289.1| hypothetical protein JL09_g1598 [Pichia kudriavzevii]
Length=320

 Score =   122 bits (305),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            +G+    PT  P   +A V RAVCM+SN TA+A+ + +ID KFDLMY KRAFVHWYV EG
Sbjct  229  IGICYEKPTQSPDSQMADVDRAVCMLSNTTAIADAWKKIDEKFDLMYRKRAFVHWYVSEG  288

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEEGEF+EAREDLAALEKDY
Sbjct  289  MEEGEFAEAREDLAALEKDY  308


 Score =   114 bits (286),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = -3

Query  740  HEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQ  561
            HE  SV EITSA FEPS+ M KC+P++GKYMA CL+YRGDVV  DV  AVAT K K+ VQ
Sbjct  159  HESNSVNEITSACFEPSNQMVKCNPKNGKYMANCLLYRGDVVSNDVKNAVATAKVKKGVQ  218

Query  560  FVDWCPTGFKCGINYQPP  507
             VDWCPTGFK GI Y+ P
Sbjct  219  MVDWCPTGFKIGICYEKP  236



>emb|CDR95936.1| TUBULIN protein,putative [Babesia bigemina]
Length=440

 Score =   132 bits (332),  Expect(2) = 6e-53, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -3

Query  749  KAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  570
            KA HE +SV EIT++ F+ +SMMA+CDPR G YMACCLMYRGDVVPKDVN+A+  +K+K+
Sbjct  282  KAKHEFMSVAEITNSAFDTASMMAECDPRLGHYMACCLMYRGDVVPKDVNSAIGHVKSKK  341

Query  569  TVQFVDWCPTGFKCGINYQPP  507
             V+FVDW PTGFK GINYQPP
Sbjct  342  AVRFVDWSPTGFKFGINYQPP  362


 Score =   103 bits (256),  Expect(2) = 6e-53, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 70/79 (89%), Gaps = 0/79 (0%)
 Frame = -1

Query  526  GLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGM  347
            G+   PP VVPG DLAKV RAVCMISN+T+++EVF R+D KFD+MY+K+AFVHWY+GEGM
Sbjct  356  GINYQPPCVVPGDDLAKVSRAVCMISNSTSISEVFIRMDSKFDVMYAKKAFVHWYLGEGM  415

Query  346  EEGEFSEAREDLAALEKDY  290
            EEGEF EARED+AALEKDY
Sbjct  416  EEGEFEEAREDVAALEKDY  434



>gb|AII72207.1| alpha-tubulin [Endoreticulatus sp. Zhenjiang]
Length=439

 Score =   122 bits (306),  Expect(2) = 8e-53, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            +G+    PTV+PG  +A+V RAVC +SN TA+AE +SR++HKFDLM++KRAFVHWYVGEG
Sbjct  349  IGINEKRPTVLPGSAMAEVSRAVCALSNTTAIAEAWSRLNHKFDLMFAKRAFVHWYVGEG  408

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEEGEFSEAREDL AL  +Y
Sbjct  409  MEEGEFSEAREDLDALVGNY  428


 Score =   112 bits (281),  Expect(2) = 8e-53, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 64/83 (77%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KA HE L+V EIT++ FE S+ M KC+ ++GK+MACCL++RGDV PK+ N A A+IK 
Sbjct  274  AQKASHEGLAVQEITNSCFESSNQMVKCNIKNGKFMACCLLFRGDVKPKEANQATASIKA  333

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            K+  QFV+WCPTGFK GIN + P
Sbjct  334  KKASQFVEWCPTGFKIGINEKRP  356



>emb|CDK28648.1| unnamed protein product [Kuraishia capsulata CBS 1993]
Length=449

 Score =   118 bits (296),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            +G+     T  PG +LA V+R VCM+SN TA+A  +++ID KFDLMY KRAFVHWYV EG
Sbjct  354  IGICFQKATPTPGSELADVERNVCMLSNTTAIASAWNKIDAKFDLMYKKRAFVHWYVSEG  413

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEEGEF+EAREDLAALE DY
Sbjct  414  MEEGEFAEAREDLAALENDY  433


 Score =   116 bits (291),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = -3

Query  752  AKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTK  573
            +++ HE  SV EIT+A FEP + M KCDP+ GKYMA CL+YRGDVV +DV  AVA +KTK
Sbjct  280  SRSTHEANSVQEITNACFEPGNQMVKCDPKQGKYMATCLLYRGDVVNRDVQTAVAHVKTK  339

Query  572  RTVQFVDWCPTGFKCGINYQ  513
            ++VQ VDWCPTGFK GI +Q
Sbjct  340  KSVQLVDWCPTGFKIGICFQ  359



>ref|XP_007647867.1| PREDICTED: LOW QUALITY PROTEIN: tubulin alpha chain-like [Cricetulus 
griseus]
Length=279

 Score =   125 bits (313),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 68/80 (85%), Gaps = 2/80 (3%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            VG+   PPTVVPGGDLAKVQRAVCM+SN T + E ++ +DHKFDLMY+K AFVHWYV EG
Sbjct  185  VGIN-QPPTVVPGGDLAKVQRAVCMLSNTT-ITEAWAHLDHKFDLMYAKCAFVHWYVCEG  242

Query  349  MEEGEFSEAREDLAALEKDY  290
            ME GEFSEA ED+AALEKDY
Sbjct  243  MEVGEFSEACEDMAALEKDY  262


 Score =   108 bits (270),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 61/83 (73%), Gaps = 5/83 (6%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAY EQL V EIT+A FE ++ M KCDP       C L+Y GD VPKD NAA+ATIKT
Sbjct  114  AEKAYLEQLMVAEITNACFESANQMVKCDPXP----CCLLLYHGDAVPKDANAAIATIKT  169

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            K T+QFVDWCPTGFK GIN QPP
Sbjct  170  KHTIQFVDWCPTGFKVGIN-QPP  191



>ref|XP_002995388.1| hypothetical protein NCER_101746 [Nosema ceranae BRL01]
 gb|EEQ81717.1| hypothetical protein NCER_101746 [Nosema ceranae BRL01]
Length=452

 Score =   119 bits (298),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            VG+ +  PTV+ G  +A+V RAVC +SN TA+AE + R++ KFDLMY+KRAFVHWYVGEG
Sbjct  363  VGINSRKPTVLEGQAMAEVSRAVCTLSNTTAIAEAWKRLNQKFDLMYAKRAFVHWYVGEG  422

Query  349  MEEGEFSEAREDLAALEKDY  290
            MEEGEFSEARE+LA LE +Y
Sbjct  423  MEEGEFSEARENLAMLEDEY  442


 Score =   114 bits (285),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 62/81 (77%), Gaps = 0/81 (0%)
 Frame = -3

Query  749  KAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  570
            KA HE+LSV EIT+A FEP + M KCD + GKYMACCL++RGDV  ++ N A A IK K 
Sbjct  290  KASHEKLSVQEITNACFEPQNQMVKCDTKKGKYMACCLLFRGDVNSQEANKATANIKAKS  349

Query  569  TVQFVDWCPTGFKCGINYQPP  507
            +++FV+WCPTGFK GIN + P
Sbjct  350  SIKFVEWCPTGFKVGINSRKP  370



>gb|AFR46106.1| alpha tubulin, partial [Macrotrachela quadricornifera]
Length=391

 Score =   140 bits (352),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KA HE  SV +IT+A FEP++ M KCDPR+GKYMACCL+YRGDVVPKDVN+A++ IKT
Sbjct  263  AEKAAHEAFSVQDITNACFEPANQMVKCDPRNGKYMACCLLYRGDVVPKDVNSAISVIKT  322

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            K  +QFVDWCPTGFK GINYQPP
Sbjct  323  KPAIQFVDWCPTGFKVGINYQPP  345


 Score = 92.8 bits (229),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVH  368
             VG+   PP VVPGGD+AKV RAVCM+SN TA+AE ++R+DHKFDLMYSKRAFVH
Sbjct  337  KVGINYQPPVVVPGGDVAKVPRAVCMLSNTTAIAEAWARLDHKFDLMYSKRAFVH  391



>gb|AEW08142.1| hypothetical protein 2_945_01, partial [Pinus taeda]
 gb|AEW08143.1| hypothetical protein 2_945_01, partial [Pinus radiata]
 gb|AFG70651.1| hypothetical protein 2_945_01, partial [Pinus taeda]
 gb|AFG70652.1| hypothetical protein 2_945_01, partial [Pinus taeda]
 gb|AFG70653.1| hypothetical protein 2_945_01, partial [Pinus taeda]
 gb|AFG70654.1| hypothetical protein 2_945_01, partial [Pinus taeda]
 gb|AFG70655.1| hypothetical protein 2_945_01, partial [Pinus taeda]
 gb|AFG70656.1| hypothetical protein 2_945_01, partial [Pinus taeda]
 gb|AFG70657.1| hypothetical protein 2_945_01, partial [Pinus taeda]
 gb|AFG70658.1| hypothetical protein 2_945_01, partial [Pinus taeda]
 gb|AFG70659.1| hypothetical protein 2_945_01, partial [Pinus taeda]
 gb|AFG70660.1| hypothetical protein 2_945_01, partial [Pinus taeda]
 gb|AFG70661.1| hypothetical protein 2_945_01, partial [Pinus taeda]
Length=145

 Score =   177 bits (448),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 81/83 (98%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT
Sbjct  63   AEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  122

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            KRTVQFVDWCPTGFKCGINYQPP
Sbjct  123  KRTVQFVDWCPTGFKCGINYQPP  145



>emb|CDW53125.1| tubulin alpha chain [Trichuris trichiura]
Length=468

 Score =   120 bits (301),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 64/81 (79%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+++ PPT VP   LA V RAVCM+ N TA+ E + R++ KF LMY+KRAFVHWYVGE
Sbjct  370  KVGISSQPPTRVPESHLADVSRAVCMVCNTTAIVEAWRRLNKKFALMYAKRAFVHWYVGE  429

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GMEE EF+EAR+DL ALEKDY
Sbjct  430  GMEEAEFAEARDDLLALEKDY  450


 Score =   109 bits (273),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -3

Query  752  AKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTK  573
            +KA  E+L+  +IT   F+P S   KCDPR GKY+ACCL+YRGDVV ++VNAA+  IK +
Sbjct  297  SKARLEKLTTKQITDMCFKPESQAVKCDPRIGKYIACCLLYRGDVVTREVNAAIQHIKLQ  356

Query  572  RTVQFVDWCPTGFKCGINYQPP  507
            R + FVDW PTGFK GI+ QPP
Sbjct  357  RGINFVDWSPTGFKVGISSQPP  378



>gb|KFD48716.1| hypothetical protein M513_10427 [Trichuris suis]
 gb|KFD69306.1| hypothetical protein M514_10427 [Trichuris suis]
 gb|KHJ41837.1| Tubulin/FtsZ family, GTPase domain protein [Trichuris suis]
Length=468

 Score =   120 bits (301),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 64/81 (79%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+++ PPT VP   LA V RAVCM+ N TA+ E + R++ KF LMY+KRAFVHWYVGE
Sbjct  370  KVGISSQPPTRVPESHLADVSRAVCMVCNTTAIVEAWRRLNKKFALMYAKRAFVHWYVGE  429

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GMEE EF+EAR+DL ALEKDY
Sbjct  430  GMEEAEFAEARDDLLALEKDY  450


 Score =   109 bits (273),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -3

Query  752  AKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTK  573
            +KA  E+L+  +IT   F+P S   KCDPR GKY+ACCL+YRGDVV ++VNAA+  IK +
Sbjct  297  SKARLEKLTTKQITDMCFKPESQAVKCDPRIGKYIACCLLYRGDVVTREVNAAIQHIKLQ  356

Query  572  RTVQFVDWCPTGFKCGINYQPP  507
            R + FVDW PTGFK GI+ QPP
Sbjct  357  RGINFVDWSPTGFKVGISSQPP  378



>emb|CAJ44847.1| alpha-tubulin [Dictyostelium microsporum]
Length=415

 Score =   117 bits (293),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 63/79 (80%), Gaps = 1/79 (1%)
 Frame = -3

Query  740  HEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTK-RTV  564
            H+Q+SV  IT+AVF   +MMAKCDP  GKYMACCLMYRG+VVPKD + AV+ +KT  + V
Sbjct  282  HQQISVSAITNAVFAQENMMAKCDPHQGKYMACCLMYRGNVVPKDAHKAVSDLKTNSKAV  341

Query  563  QFVDWCPTGFKCGINYQPP  507
             FVDW PTGFKCGIN++ P
Sbjct  342  SFVDWSPTGFKCGINHEAP  360


 Score =   112 bits (280),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = -1

Query  526  GLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEGM  347
            G+    PTVVPGGDLAKV+RAVCM+SN TA+A+VFSRI+ KFDLMY+KRAFVHWYVGEGM
Sbjct  354  GINHEAPTVVPGGDLAKVERAVCMLSNTTAIAQVFSRINRKFDLMYTKRAFVHWYVGEGM  413

Query  346  EE  341
            EE
Sbjct  414  EE  415



>emb|CAD20820.1| alpha tubulin [Zea mays]
Length=200

 Score =   177 bits (449),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 82/89 (92%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT
Sbjct  28   AEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  87

Query  575  KRTVQFVDWCPTGFKCGINYQPPNSCARG  489
            KRTVQFVDWCPTGFKCGINYQPP+    G
Sbjct  88   KRTVQFVDWCPTGFKCGINYQPPSVVPGG  116


 Score =   161 bits (407),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 82/98 (84%), Gaps = 2/98 (2%)
 Frame = -1

Query  583  SKRNAQFSLLTGAQPASNVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHK  404
            +KR  QF  +         G+   PP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHK
Sbjct  87   TKRTVQF--VDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHK  144

Query  403  FDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            FDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  145  FDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  182



>emb|CAD20821.1| alpha tubulin [Zea mays]
Length=274

 Score =   179 bits (454),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 82/89 (92%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT
Sbjct  102  AEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  161

Query  575  KRTVQFVDWCPTGFKCGINYQPPNSCARG  489
            KRTVQFVDWCPTGFKCGINYQPP+    G
Sbjct  162  KRTVQFVDWCPTGFKCGINYQPPSVVPGG  190


 Score =   162 bits (410),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 82/98 (84%), Gaps = 2/98 (2%)
 Frame = -1

Query  583  SKRNAQFSLLTGAQPASNVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHK  404
            +KR  QF  +         G+   PP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHK
Sbjct  161  TKRTVQF--VDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHK  218

Query  403  FDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            FDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  219  FDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  256



>gb|ABR25510.1| tubulin alpha-1 chain [Oryza sativa Indica Group]
Length=255

 Score =   178 bits (452),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 82/89 (92%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT
Sbjct  83   AEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  142

Query  575  KRTVQFVDWCPTGFKCGINYQPPNSCARG  489
            KRTVQFVDWCPTGFKCGINYQPP+    G
Sbjct  143  KRTVQFVDWCPTGFKCGINYQPPSVVPGG  171


 Score =   161 bits (407),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 82/98 (84%), Gaps = 2/98 (2%)
 Frame = -1

Query  583  SKRNAQFSLLTGAQPASNVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHK  404
            +KR  QF  +         G+   PP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHK
Sbjct  142  TKRTVQF--VDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHK  199

Query  403  FDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            FDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  200  FDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  237



>ref|XP_010420792.1| PREDICTED: tubulin alpha-3 chain-like [Camelina sativa]
Length=183

 Score =   176 bits (446),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 80/83 (96%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            AAKAYHEQLSVPEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAV TIKT
Sbjct  11   AAKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKT  70

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            KRTVQFVDWCPTGFKCGINYQPP
Sbjct  71   KRTVQFVDWCPTGFKCGINYQPP  93


 Score =   162 bits (411),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 82/98 (84%), Gaps = 2/98 (2%)
 Frame = -1

Query  583  SKRNAQFSLLTGAQPASNVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHK  404
            +KR  QF  +         G+   PPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHK
Sbjct  70   TKRTVQF--VDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHK  127

Query  403  FDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            FDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  128  FDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  165



>ref|XP_008384431.1| PREDICTED: tubulin alpha-3 chain-like [Malus domestica]
Length=282

 Score =   179 bits (454),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            AAKAYHEQ+S+PEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT
Sbjct  111  AAKAYHEQISIPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  170

Query  575  KRTVQFVDWCPTGFKCGINYQPPNSCARG  489
            KRTVQFVDWCPTGFKCGINYQPP     G
Sbjct  171  KRTVQFVDWCPTGFKCGINYQPPTVVPGG  199


 Score =   164 bits (415),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 82/98 (84%), Gaps = 2/98 (2%)
 Frame = -1

Query  583  SKRNAQFSLLTGAQPASNVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHK  404
            +KR  QF  +         G+   PPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHK
Sbjct  170  TKRTVQF--VDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHK  227

Query  403  FDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            FDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  228  FDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  265



>sp|P33624.1|TBA2_ANEPH RecName: Full=Tubulin alpha-2 chain, partial [Anemia phyllitidis]
 emb|CAA48928.1| alpha tubulin 2, partial [Anemia phyllitidis]
Length=364

 Score =   181 bits (460),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 83/89 (93%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            AAKAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT
Sbjct  194  AAKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  253

Query  575  KRTVQFVDWCPTGFKCGINYQPPNSCARG  489
            KRTVQFVDWCPTGFKCGINYQPP+    G
Sbjct  254  KRTVQFVDWCPTGFKCGINYQPPSVVPGG  282


 Score =   158 bits (400),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 81/98 (83%), Gaps = 2/98 (2%)
 Frame = -1

Query  583  SKRNAQFSLLTGAQPASNVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHK  404
            +KR  QF  +         G+   PP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHK
Sbjct  253  TKRTVQF--VDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHK  310

Query  403  FDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            FDLMY+K AFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  311  FDLMYAKLAFVHWYVGEGMEEGEFSEAREDLAALEKDY  348



>emb|CAJ44871.1| alpha-tubulin [Dictyostelium gloeosporum]
Length=417

 Score =   127 bits (319),  Expect(2) = 7e-51, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 64/81 (79%), Gaps = 0/81 (0%)
 Frame = -3

Query  749  KAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  570
            KA HEQ SV  +T+AVFE  +MMAKCDPR GKYMACCLMYRGDVVPKD   AV  ++ K+
Sbjct  278  KAGHEQFSVGALTNAVFEQQNMMAKCDPREGKYMACCLMYRGDVVPKDAQKAVTDLRAKK  337

Query  569  TVQFVDWCPTGFKCGINYQPP  507
            T+ FVDW P GFKCGIN++ P
Sbjct  338  TISFVDWSPCGFKCGINHEAP  358


 Score =   101 bits (251),  Expect(2) = 7e-51, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = -1

Query  526  GLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
            G+    PTVVPGGDLAKV+RAVCM+SN TA+++VFSRI+HKFDLMY+KRAFVHWYVGE
Sbjct  352  GINHEAPTVVPGGDLAKVERAVCMLSNTTAISQVFSRINHKFDLMYTKRAFVHWYVGE  409



>ref|XP_005154151.1| PREDICTED: LOW QUALITY PROTEIN: tubulin alpha-4A chain [Melopsittacus 
undulatus]
Length=402

 Score =   148 bits (374),  Expect(2) = 8e-51, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = -1

Query  532  NVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
             VG+   PPTVVPG DLAKVQRAVCM+SN TA+AE ++R+DHKFDLMY+KRAFVHWYVGE
Sbjct  306  KVGINYQPPTVVPGXDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGE  365

Query  352  GMEEGEFSEAREDLAALEKDY  290
            GMEEGEFSEARED+AALEKDY
Sbjct  366  GMEEGEFSEAREDMAALEKDY  386


 Score = 80.1 bits (196),  Expect(2) = 8e-51, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 45/83 (54%), Gaps = 31/83 (37%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A +AYHEQLSV EIT++ FEPS+ M KCDPRHGKYMACCL+Y                  
Sbjct  263  AERAYHEQLSVAEITNSCFEPSNQMVKCDPRHGKYMACCLLY------------------  304

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
                          K GINYQPP
Sbjct  305  -------------LKVGINYQPP  314



>emb|CAJ44856.1| alpha-tubulin [Polysphondylium pallidum]
Length=329

 Score =   128 bits (321),  Expect(2) = 9e-51, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = -3

Query  749  KAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKR  570
            KA HEQ SV  +T+AVF+ ++MMAKC+P+ GKYMACCLMYRGDVVPKD   AV+ +K K+
Sbjct  189  KAEHEQFSVNALTNAVFDQANMMAKCEPKEGKYMACCLMYRGDVVPKDAQKAVSDLKNKK  248

Query  569  TVQFVDWCPTGFKCGINYQPP  507
            TV FVDW PTGFKCGIN++ P
Sbjct  249  TVSFVDWSPTGFKCGINHEAP  269


 Score =   100 bits (248),  Expect(2) = 9e-51, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = -1

Query  526  GLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
            G+    PTVVPGGDLAKV+RAVCM+SN TA+++VFSRI+HKFDLM++KRAFVHWYVGE
Sbjct  263  GINHEAPTVVPGGDLAKVKRAVCMLSNTTAISQVFSRINHKFDLMFTKRAFVHWYVGE  320



>emb|CAK55183.2| alpha-tubulin 4 [Quercus ilex]
Length=153

 Score =   174 bits (440),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/89 (90%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQLS+PEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAV TIKT
Sbjct  16   AEKAYHEQLSIPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKT  75

Query  575  KRTVQFVDWCPTGFKCGINYQPPNSCARG  489
            KRTVQFVDWCPTGFKCGINYQPP     G
Sbjct  76   KRTVQFVDWCPTGFKCGINYQPPTVVPGG  104


 Score =   126 bits (316),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 65/81 (80%), Gaps = 2/81 (2%)
 Frame = -1

Query  583  SKRNAQFSLLTGAQPASNVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHK  404
            +KR  QF  +         G+   PPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRIDHK
Sbjct  75   TKRTVQF--VDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHK  132

Query  403  FDLMYSKRAFVHWYVGEGMEE  341
            FDLMY+KRAFVHWYVGEGMEE
Sbjct  133  FDLMYAKRAFVHWYVGEGMEE  153



>gb|KDP39691.1| hypothetical protein JCGZ_02711 [Jatropha curcas]
Length=449

 Score =   182 bits (462),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/83 (100%), Positives = 83/83 (100%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT
Sbjct  278  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  337

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            KRTVQFVDWCPTGFKCGINYQPP
Sbjct  338  KRTVQFVDWCPTGFKCGINYQPP  360


 Score =   162 bits (410),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 82/98 (84%), Gaps = 2/98 (2%)
 Frame = -1

Query  583  SKRNAQFSLLTGAQPASNVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHK  404
            +KR  QF  +         G+   PPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHK
Sbjct  337  TKRTVQF--VDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHK  394

Query  403  FDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            FDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  395  FDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>dbj|BAH20267.1| AT5G19780 [Arabidopsis thaliana]
Length=284

 Score =   178 bits (451),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            AAKAYHEQLSVPEIT+AVFEP+SMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAV TIKT
Sbjct  112  AAKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKT  171

Query  575  KRTVQFVDWCPTGFKCGINYQPPNSCARG  489
            KRTVQFVDWCPTGFKCGINYQPP     G
Sbjct  172  KRTVQFVDWCPTGFKCGINYQPPTVVPGG  200


 Score =   163 bits (413),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 82/98 (84%), Gaps = 2/98 (2%)
 Frame = -1

Query  583  SKRNAQFSLLTGAQPASNVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHK  404
            +KR  QF  +         G+   PPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHK
Sbjct  171  TKRTVQF--VDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHK  228

Query  403  FDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            FDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  229  FDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  266



>emb|CAK55182.1| alpha-tubulin 3 [Quercus ilex]
 emb|CAK55185.1| alpha-tubulin 6, partial [Quercus ilex]
Length=153

 Score =   174 bits (440),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/89 (90%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQLS+PEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAV TIKT
Sbjct  16   AEKAYHEQLSIPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKT  75

Query  575  KRTVQFVDWCPTGFKCGINYQPPNSCARG  489
            KRTVQFVDWCPTGFKCGINYQPP     G
Sbjct  76   KRTVQFVDWCPTGFKCGINYQPPTVVPGG  104


 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 65/81 (80%), Gaps = 2/81 (2%)
 Frame = -1

Query  583  SKRNAQFSLLTGAQPASNVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHK  404
            +KR  QF  +         G+   PPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHK
Sbjct  75   TKRTVQF--VDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHK  132

Query  403  FDLMYSKRAFVHWYVGEGMEE  341
            FDLMYSKRAFVHWYVGEGMEE
Sbjct  133  FDLMYSKRAFVHWYVGEGMEE  153



>gb|EGW10116.1| Tubulin alpha-1C chain [Cricetulus griseus]
 gb|ERE85261.1| tubulin alpha-1C chain [Cricetulus griseus]
Length=239

 Score =   115 bits (287),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 62/77 (81%), Gaps = 0/77 (0%)
 Frame = -1

Query  529  VGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGEG  350
            VG+    PTVVPGGDLAKVQR VCM SN TA+AE ++ +DHKFDLMY+K  FVHWY GEG
Sbjct  143  VGINYQLPTVVPGGDLAKVQRTVCMPSNTTAIAEAWAPLDHKFDLMYAKHDFVHWYSGEG  202

Query  349  MEEGEFSEAREDLAALE  299
             +E +FSEA ED+AALE
Sbjct  203  RDERKFSEACEDMAALE  219


 Score =   112 bits (279),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = -3

Query  746  AYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRT  567
            ++ EQLSV ++T+A FEP++ M KC   HGKYMACCL+Y GDVVPKDVN A  TIKTK  
Sbjct  71   SFDEQLSVADLTNACFEPANQMVKCGNCHGKYMACCLLYHGDVVPKDVNDATVTIKTKCR  130

Query  566  VQFVDWCPTGFKCGINYQPP  507
             +FVDW P GF+ GINYQ P
Sbjct  131  TRFVDWYPIGFRVGINYQLP  150



>emb|CAL69464.1| a-tubulin [Quercus robur]
Length=145

 Score =   173 bits (439),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 87/105 (83%), Gaps = 0/105 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQLS+PEIT+AVFEPSSMMAKCDPRHGKYMA CLMYRGDVVPKDVNAAV TIKT
Sbjct  7    AEKAYHEQLSIPEITNAVFEPSSMMAKCDPRHGKYMAWCLMYRGDVVPKDVNAAVGTIKT  66

Query  575  KRTVQFVDWCPTGFKCGINYQPPNSCARG*SCQGAESCLYDQQQH  441
            KRTVQFVDWCPTGFKCGINYQPP     G   +   +    +QQH
Sbjct  67   KRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIKQQH  111


 Score = 53.5 bits (127),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 33/57 (58%), Gaps = 2/57 (4%)
 Frame = -1

Query  583  SKRNAQFSLLTGAQPASNVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRI  413
            +KR  QF  +         G+   PPTVVPGGDLAKVQRAVCMI    + +  FS +
Sbjct  66   TKRTVQF--VDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMIKQQHSSSLRFSHV  120


 Score = 42.0 bits (97),  Expect(2) = 4e-11, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = -2

Query  429  RCSHASTTSLISCIPRGRSFTGM*VKAWKK  340
            R SH  TT+LISCIP+   FTGM V+AW+K
Sbjct  116  RFSHVLTTNLISCIPKEHLFTGMLVRAWRK  145



>dbj|BAD94893.1| tubulin alpha-5 chain-like protein [Arabidopsis thaliana]
Length=183

 Score =   174 bits (442),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/89 (90%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            AAKAYHEQLSVPEIT+AVFEP+SMMAKCDP+HGKYMACCLMYRGDVVPKDVNAAV TIKT
Sbjct  11   AAKAYHEQLSVPEITNAVFEPASMMAKCDPKHGKYMACCLMYRGDVVPKDVNAAVGTIKT  70

Query  575  KRTVQFVDWCPTGFKCGINYQPPNSCARG  489
            KRTVQFVDWCPTGFKCGINYQPP     G
Sbjct  71   KRTVQFVDWCPTGFKCGINYQPPTVVPGG  99


 Score =   162 bits (411),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 82/98 (84%), Gaps = 2/98 (2%)
 Frame = -1

Query  583  SKRNAQFSLLTGAQPASNVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHK  404
            +KR  QF  +         G+   PPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHK
Sbjct  70   TKRTVQF--VDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHK  127

Query  403  FDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            FDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  128  FDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  165



>ref|XP_001777110.1| predicted protein [Physcomitrella patens]
 gb|EDQ58103.1| predicted protein [Physcomitrella patens]
Length=344

 Score =   179 bits (454),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/83 (98%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT
Sbjct  173  AEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  232

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            KRTVQFVDWCPTGFKCGINYQPP
Sbjct  233  KRTVQFVDWCPTGFKCGINYQPP  255


 Score =   163 bits (412),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 82/98 (84%), Gaps = 2/98 (2%)
 Frame = -1

Query  583  SKRNAQFSLLTGAQPASNVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHK  404
            +KR  QF  +         G+   PPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHK
Sbjct  232  TKRTVQF--VDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHK  289

Query  403  FDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            FDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  290  FDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  327



>ref|XP_010054663.1| PREDICTED: tubulin alpha-3 chain-like [Eucalyptus grandis]
 gb|KCW89881.1| hypothetical protein EUGRSUZ_A02108 [Eucalyptus grandis]
Length=450

 Score =   181 bits (460),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 83/89 (93%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            AAKAYHEQLSVPEITSAVFEPS+MMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT
Sbjct  278  AAKAYHEQLSVPEITSAVFEPSNMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  337

Query  575  KRTVQFVDWCPTGFKCGINYQPPNSCARG  489
            KRTVQFVDWCPTGFKCGINYQPP+    G
Sbjct  338  KRTVQFVDWCPTGFKCGINYQPPSVVPSG  366


 Score =   157 bits (398),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 75/98 (77%), Positives = 80/98 (82%), Gaps = 2/98 (2%)
 Frame = -1

Query  583  SKRNAQFSLLTGAQPASNVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHK  404
            +KR  QF  +         G+   PP+VVP GDLAKVQRAVCMISNNTAV EVFSRIDHK
Sbjct  337  TKRTVQF--VDWCPTGFKCGINYQPPSVVPSGDLAKVQRAVCMISNNTAVVEVFSRIDHK  394

Query  403  FDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            FDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  395  FDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CAL35827.1| alpha-2 tubulin [Plantago major]
Length=249

 Score =   176 bits (446),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 81/83 (98%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQLS+PEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAV TIKT
Sbjct  77   AEKAYHEQLSIPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKT  136

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            KRTVQFVDWCPTGFKCGINYQPP
Sbjct  137  KRTVQFVDWCPTGFKCGINYQPP  159


 Score =   163 bits (412),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 82/98 (84%), Gaps = 2/98 (2%)
 Frame = -1

Query  583  SKRNAQFSLLTGAQPASNVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHK  404
            +KR  QF  +         G+   PPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHK
Sbjct  136  TKRTVQF--VDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHK  193

Query  403  FDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            FDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  194  FDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  231



>gb|KHG26159.1| Tubulin alpha-6 chain [Gossypium arboreum]
Length=449

 Score =   181 bits (460),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 83/83 (100%), Positives = 83/83 (100%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT
Sbjct  278  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  337

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            KRTVQFVDWCPTGFKCGINYQPP
Sbjct  338  KRTVQFVDWCPTGFKCGINYQPP  360


 Score =   160 bits (405),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 82/98 (84%), Gaps = 2/98 (2%)
 Frame = -1

Query  583  SKRNAQFSLLTGAQPASNVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHK  404
            +KR  QF  +         G+   PPTVVPGGDLA+VQRAVCMISNNT+VAEVFSRIDHK
Sbjct  337  TKRTVQF--VDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMISNNTSVAEVFSRIDHK  394

Query  403  FDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            FDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  395  FDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AET80381.1| alpha-tubulin, partial [x Doritaenopsis hybrid cultivar]
Length=258

 Score =   176 bits (447),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 80/82 (98%), Positives = 81/82 (99%), Gaps = 0/82 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT
Sbjct  177  AEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  236

Query  575  KRTVQFVDWCPTGFKCGINYQP  510
            KRTVQFVDWCPTGFKCGINYQP
Sbjct  237  KRTVQFVDWCPTGFKCGINYQP  258



>tpg|DAA41189.1| TPA: alpha tubulin5 [Zea mays]
Length=320

 Score =   178 bits (451),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 82/89 (92%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT
Sbjct  148  AEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  207

Query  575  KRTVQFVDWCPTGFKCGINYQPPNSCARG  489
            KRTVQFVDWCPTGFKCGINYQPP+    G
Sbjct  208  KRTVQFVDWCPTGFKCGINYQPPSVVPGG  236


 Score =   161 bits (407),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 82/98 (84%), Gaps = 2/98 (2%)
 Frame = -1

Query  583  SKRNAQFSLLTGAQPASNVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHK  404
            +KR  QF  +         G+   PP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHK
Sbjct  207  TKRTVQF--VDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHK  264

Query  403  FDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            FDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  265  FDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  302



>emb|CAJ44859.1| alpha-tubulin [Dictyostelium multi-stipes]
Length=421

 Score =   127 bits (318),  Expect(2) = 4e-50, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 69/82 (84%), Gaps = 1/82 (1%)
 Frame = -3

Query  749  KAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTK-  573
            KA HEQ+SV  IT+AVF+  +MMAKCDPR GKYMACCLMYRG+VVPKD + AV+ +KTK 
Sbjct  281  KADHEQISVSAITNAVFDQENMMAKCDPRQGKYMACCLMYRGNVVPKDAHKAVSDLKTKS  340

Query  572  RTVQFVDWCPTGFKCGINYQPP  507
            ++V FVDW PTGFKCGIN++ P
Sbjct  341  KSVSFVDWSPTGFKCGINHEAP  362


 Score = 99.4 bits (246),  Expect(2) = 4e-50, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = -1

Query  526  GLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYVGE  353
            G+    PTVVPGGDLAKV+RAVCM+SN TA+A+VFSRI+ KFDLMY+KRAFVHWYVGE
Sbjct  356  GINHEAPTVVPGGDLAKVERAVCMLSNTTAIAQVFSRINRKFDLMYTKRAFVHWYVGE  413



>ref|XP_009353129.1| PREDICTED: tubulin alpha-3 chain-like [Pyrus x bretschneideri]
Length=449

 Score =   181 bits (459),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 82/83 (99%), Positives = 83/83 (100%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            AAKAYHEQLSVPEITS+VFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT
Sbjct  278  AAKAYHEQLSVPEITSSVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  337

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            KRTVQFVDWCPTGFKCGINYQPP
Sbjct  338  KRTVQFVDWCPTGFKCGINYQPP  360


 Score =   164 bits (414),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 82/98 (84%), Gaps = 2/98 (2%)
 Frame = -1

Query  583  SKRNAQFSLLTGAQPASNVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHK  404
            +KR  QF  +         G+   PPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHK
Sbjct  337  TKRTVQF--VDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHK  394

Query  403  FDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            FDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  395  FDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002319688.1| Tubulin alpha-1 chain family protein [Populus trichocarpa]
 gb|EEE95611.1| Tubulin alpha-1 chain family protein [Populus trichocarpa]
Length=449

 Score =   181 bits (459),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 82/83 (99%), Positives = 83/83 (100%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVN+AVATIKT
Sbjct  278  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNSAVATIKT  337

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            KRTVQFVDWCPTGFKCGINYQPP
Sbjct  338  KRTVQFVDWCPTGFKCGINYQPP  360


 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 82/98 (84%), Gaps = 2/98 (2%)
 Frame = -1

Query  583  SKRNAQFSLLTGAQPASNVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHK  404
            +KR  QF  +         G+   PPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRID+K
Sbjct  337  TKRTVQF--VDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDYK  394

Query  403  FDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            FDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  395  FDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>tpg|DAA63280.1| TPA: alpha tubulin6 [Zea mays]
Length=320

 Score =   178 bits (451),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 82/89 (92%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT
Sbjct  148  AEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  207

Query  575  KRTVQFVDWCPTGFKCGINYQPPNSCARG  489
            KRTVQFVDWCPTGFKCGINYQPP+    G
Sbjct  208  KRTVQFVDWCPTGFKCGINYQPPSVVPGG  236


 Score =   161 bits (407),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 82/98 (84%), Gaps = 2/98 (2%)
 Frame = -1

Query  583  SKRNAQFSLLTGAQPASNVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHK  404
            +KR  QF  +         G+   PP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHK
Sbjct  207  TKRTVQF--VDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHK  264

Query  403  FDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            FDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  265  FDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  302



>gb|KJB44614.1| hypothetical protein B456_007G261000 [Gossypium raimondii]
Length=449

 Score =   181 bits (459),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 82/83 (99%), Positives = 83/83 (100%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGD+VPKDVNAAVATIKT
Sbjct  278  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDIVPKDVNAAVATIKT  337

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            KRTVQFVDWCPTGFKCGINYQPP
Sbjct  338  KRTVQFVDWCPTGFKCGINYQPP  360


 Score =   160 bits (405),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 82/98 (84%), Gaps = 2/98 (2%)
 Frame = -1

Query  583  SKRNAQFSLLTGAQPASNVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHK  404
            +KR  QF  +         G+   PPTVVPGGDLA+VQRAVCMISNNT+VAEVFSRIDHK
Sbjct  337  TKRTVQF--VDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMISNNTSVAEVFSRIDHK  394

Query  403  FDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            FDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  395  FDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002525416.1| tubulin alpha chain, putative [Ricinus communis]
 gb|EEF36906.1| tubulin alpha chain, putative [Ricinus communis]
Length=449

 Score =   181 bits (459),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 82/83 (99%), Positives = 83/83 (100%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            AAKA+HEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT
Sbjct  278  AAKAFHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  337

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            KRTVQFVDWCPTGFKCGINYQPP
Sbjct  338  KRTVQFVDWCPTGFKCGINYQPP  360


 Score =   162 bits (411),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 82/98 (84%), Gaps = 2/98 (2%)
 Frame = -1

Query  583  SKRNAQFSLLTGAQPASNVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHK  404
            +KR  QF  +         G+   PPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHK
Sbjct  337  TKRTVQF--VDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHK  394

Query  403  FDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            FDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  395  FDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008386829.1| PREDICTED: tubulin alpha-3 chain-like [Malus domestica]
Length=449

 Score =   181 bits (459),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 82/83 (99%), Positives = 83/83 (100%), Gaps = 0/83 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            AAKA+HEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT
Sbjct  278  AAKAFHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  337

Query  575  KRTVQFVDWCPTGFKCGINYQPP  507
            KRTVQFVDWCPTGFKCGINYQPP
Sbjct  338  KRTVQFVDWCPTGFKCGINYQPP  360


 Score =   164 bits (414),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 82/98 (84%), Gaps = 2/98 (2%)
 Frame = -1

Query  583  SKRNAQFSLLTGAQPASNVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHK  404
            +KR  QF  +         G+   PPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHK
Sbjct  337  TKRTVQF--VDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHK  394

Query  403  FDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            FDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  395  FDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008240534.1| PREDICTED: tubulin alpha-3 chain isoform X2 [Prunus mume]
Length=424

 Score =   180 bits (457),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 82/89 (92%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNA+VATIKT
Sbjct  278  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNASVATIKT  337

Query  575  KRTVQFVDWCPTGFKCGINYQPPNSCARG  489
            KRTVQFVDWCPTGFKCGINY+PP+    G
Sbjct  338  KRTVQFVDWCPTGFKCGINYEPPSVVPGG  366


 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 37/53 (70%), Gaps = 2/53 (4%)
 Frame = -1

Query  583  SKRNAQFSLLTGAQPASNVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEV  425
            +KR  QF  +         G+   PP+VVPGGDLAKVQRAVCMISNNTAVAEV
Sbjct  337  TKRTVQF--VDWCPTGFKCGINYEPPSVVPGGDLAKVQRAVCMISNNTAVAEV  387



>gb|AHJ80821.1| Tua3, partial [Eragrostis tef]
Length=401

 Score =   179 bits (455),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 82/89 (92%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = -3

Query  755  AAKAYHEQLSVPEITSAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  576
            A KAYHEQLSVPEIT+AVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT
Sbjct  229  AEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKT  288

Query  575  KRTVQFVDWCPTGFKCGINYQPPNSCARG  489
            KRTVQFVDWCPTGFKCGINYQPP+    G
Sbjct  289  KRTVQFVDWCPTGFKCGINYQPPSVVPGG  317


 Score =   161 bits (407),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 82/98 (84%), Gaps = 2/98 (2%)
 Frame = -1

Query  583  SKRNAQFSLLTGAQPASNVGLTTNPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHK  404
            +KR  QF  +         G+   PP+VVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHK
Sbjct  288  TKRTVQF--VDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHK  345

Query  403  FDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  290
            FDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  346  FDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  383



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1414353888260