BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF008O01

Length=548
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KCW47234.1|  hypothetical protein EUGRSUZ_K01043                     225   3e-69   Eucalyptus grandis [rose gum]
gb|KCW47233.1|  hypothetical protein EUGRSUZ_K01043                     225   2e-68   Eucalyptus grandis [rose gum]
ref|XP_010035771.1|  PREDICTED: transmembrane E3 ubiquitin-protei...    226   3e-67   Eucalyptus grandis [rose gum]
emb|CDP14812.1|  unnamed protein product                                223   6e-66   Coffea canephora [robusta coffee]
ref|XP_010908981.1|  PREDICTED: DSC E3 ubiquitin ligase complex s...    223   1e-65   Elaeis guineensis
ref|XP_010908982.1|  PREDICTED: transmembrane E3 ubiquitin-protei...    221   4e-65   Elaeis guineensis
ref|XP_003543332.1|  PREDICTED: transmembrane E3 ubiquitin-protei...    219   2e-64   
gb|KDP24108.1|  hypothetical protein JCGZ_25765                         218   6e-64   Jatropha curcas
gb|KHN36649.1|  Transmembrane E3 ubiquitin-protein ligase 1             219   6e-64   Glycine soja [wild soybean]
ref|XP_009781658.1|  PREDICTED: transmembrane E3 ubiquitin-protei...    217   7e-64   Nicotiana sylvestris
ref|XP_009781642.1|  PREDICTED: transmembrane E3 ubiquitin-protei...    217   7e-64   Nicotiana sylvestris
ref|XP_009781650.1|  PREDICTED: transmembrane E3 ubiquitin-protei...    217   7e-64   Nicotiana sylvestris
ref|XP_007198952.1|  hypothetical protein PRUPE_ppa017961mg             217   8e-64   
ref|XP_006367478.1|  PREDICTED: DSC E3 ubiquitin ligase complex s...    217   8e-64   Solanum tuberosum [potatoes]
ref|XP_006367477.1|  PREDICTED: DSC E3 ubiquitin ligase complex s...    217   8e-64   Solanum tuberosum [potatoes]
ref|XP_006367479.1|  PREDICTED: DSC E3 ubiquitin ligase complex s...    217   9e-64   Solanum tuberosum [potatoes]
ref|XP_008229068.1|  PREDICTED: uncharacterized protein LOC103328453    217   1e-63   Prunus mume [ume]
ref|XP_002517888.1|  protein binding protein, putative                  216   2e-63   Ricinus communis
ref|XP_006447274.1|  hypothetical protein CICLE_v10014745mg             216   2e-63   Citrus clementina [clementine]
ref|XP_009781467.1|  PREDICTED: transmembrane E3 ubiquitin-protei...    216   3e-63   Nicotiana sylvestris
ref|XP_010313659.1|  PREDICTED: transmembrane E3 ubiquitin-protei...    215   3e-63   
ref|XP_004243364.1|  PREDICTED: DSC E3 ubiquitin ligase complex s...    215   6e-63   Solanum lycopersicum
ref|XP_010323745.1|  PREDICTED: DSC E3 ubiquitin ligase complex s...    215   6e-63   
ref|XP_011047660.1|  PREDICTED: transmembrane E3 ubiquitin-protei...    207   8e-63   Populus euphratica
ref|XP_006351940.1|  PREDICTED: transmembrane E3 ubiquitin-protei...    214   9e-63   Solanum tuberosum [potatoes]
ref|XP_009603544.1|  PREDICTED: transmembrane E3 ubiquitin-protei...    214   9e-63   Nicotiana tomentosiformis
ref|XP_009606918.1|  PREDICTED: transmembrane E3 ubiquitin-protei...    214   9e-63   Nicotiana tomentosiformis
ref|XP_004251496.1|  PREDICTED: transmembrane E3 ubiquitin-protei...    214   1e-62   Solanum lycopersicum
ref|XP_007149831.1|  hypothetical protein PHAVU_005G102100g             214   1e-62   Phaseolus vulgaris [French bean]
ref|XP_009606919.1|  PREDICTED: transmembrane E3 ubiquitin-protei...    214   1e-62   Nicotiana tomentosiformis
ref|XP_009606920.1|  PREDICTED: transmembrane E3 ubiquitin-protei...    214   1e-62   Nicotiana tomentosiformis
ref|XP_007149832.1|  hypothetical protein PHAVU_005G102100g             214   1e-62   Phaseolus vulgaris [French bean]
ref|XP_011047659.1|  PREDICTED: transmembrane E3 ubiquitin-protei...    207   2e-62   Populus euphratica
ref|XP_010928986.1|  PREDICTED: transmembrane E3 ubiquitin-protei...    213   2e-62   Elaeis guineensis
ref|XP_010928979.1|  PREDICTED: transmembrane E3 ubiquitin-protei...    213   3e-62   Elaeis guineensis
ref|XP_010928965.1|  PREDICTED: transmembrane E3 ubiquitin-protei...    213   3e-62   Elaeis guineensis
ref|XP_010928973.1|  PREDICTED: transmembrane E3 ubiquitin-protei...    213   3e-62   Elaeis guineensis
ref|XP_007043624.1|  RING/U-box superfamily protein isoform 1           213   3e-62   
gb|KJB31655.1|  hypothetical protein B456_005G200400                    212   4e-62   Gossypium raimondii
gb|KJB31656.1|  hypothetical protein B456_005G200400                    212   8e-62   Gossypium raimondii
gb|KJB31652.1|  hypothetical protein B456_005G200400                    212   9e-62   Gossypium raimondii
ref|XP_011100360.1|  PREDICTED: transmembrane E3 ubiquitin-protei...    212   9e-62   Sesamum indicum [beniseed]
ref|XP_010260250.1|  PREDICTED: DSC E3 ubiquitin ligase complex s...    211   1e-61   Nelumbo nucifera [Indian lotus]
ref|XP_003540369.1|  PREDICTED: transmembrane E3 ubiquitin-protei...    211   3e-61   Glycine max [soybeans]
ref|XP_011029040.1|  PREDICTED: uncharacterized protein LOC105128890    209   6e-61   Populus euphratica
ref|XP_006372722.1|  hypothetical protein POPTR_0017s04430g             209   7e-61   
ref|XP_004303099.1|  PREDICTED: transmembrane E3 ubiquitin-protei...    209   1e-60   Fragaria vesca subsp. vesca
ref|XP_010238000.1|  PREDICTED: uncharacterized protein LOC100834...    208   2e-60   Brachypodium distachyon [annual false brome]
ref|XP_008381598.1|  PREDICTED: uncharacterized protein LOC103444446    208   2e-60   
ref|XP_006853553.1|  hypothetical protein AMTR_s00032p00236910          207   2e-60   
ref|XP_002309743.2|  hypothetical protein POPTR_0007s00990g             207   4e-60   Populus trichocarpa [western balsam poplar]
ref|XP_010656989.1|  PREDICTED: DSC E3 ubiquitin ligase complex s...    207   6e-60   Vitis vinifera
ref|XP_004171171.1|  PREDICTED: transmembrane E3 ubiquitin-protei...    199   7e-60   
ref|XP_006285362.1|  hypothetical protein CARUB_v10006753mg             206   7e-60   Capsella rubella
ref|XP_009336232.1|  PREDICTED: uncharacterized protein LOC103928...    204   5e-59   Pyrus x bretschneideri [bai li]
ref|XP_009336231.1|  PREDICTED: uncharacterized protein LOC103928...    205   5e-59   Pyrus x bretschneideri [bai li]
ref|XP_008368649.1|  PREDICTED: DSC E3 ubiquitin ligase complex s...    204   7e-59   
ref|XP_003527424.1|  PREDICTED: transmembrane E3 ubiquitin-protei...    204   1e-58   Glycine max [soybeans]
ref|XP_004957788.1|  PREDICTED: DSC E3 ubiquitin ligase complex s...    203   1e-58   
ref|XP_004957785.1|  PREDICTED: DSC E3 ubiquitin ligase complex s...    203   2e-58   
ref|XP_004149272.1|  PREDICTED: DSC E3 ubiquitin ligase complex s...    201   1e-57   Cucumis sativus [cucumbers]
ref|XP_008448263.1|  PREDICTED: transmembrane E3 ubiquitin-protei...    201   1e-57   Cucumis melo [Oriental melon]
dbj|BAF01437.1|  hypothetical protein                                   191   2e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003539936.1|  PREDICTED: transmembrane E3 ubiquitin-protei...    201   2e-57   Glycine max [soybeans]
ref|XP_008448262.1|  PREDICTED: transmembrane E3 ubiquitin-protei...    201   2e-57   Cucumis melo [Oriental melon]
gb|KEH30698.1|  RING/U-box protein                                      200   2e-57   Medicago truncatula
ref|XP_008775556.1|  PREDICTED: transmembrane E3 ubiquitin-protei...    200   3e-57   Phoenix dactylifera
ref|XP_010689035.1|  PREDICTED: transmembrane E3 ubiquitin-protei...    200   3e-57   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU28208.1|  hypothetical protein MIMGU_mgv1a003930mg                199   3e-57   Erythranthe guttata [common monkey flower]
ref|XP_002869508.1|  zinc ion binding protein                           199   7e-57   Arabidopsis lyrata subsp. lyrata
ref|XP_004505562.1|  PREDICTED: transmembrane E3 ubiquitin-protei...    198   1e-56   
ref|XP_006412963.1|  hypothetical protein EUTSA_v10024798mg             197   4e-56   
ref|XP_010238002.1|  PREDICTED: transmembrane E3 ubiquitin-protei...    196   5e-56   Brachypodium distachyon [annual false brome]
ref|XP_010438470.1|  PREDICTED: transmembrane E3 ubiquitin-protei...    195   1e-55   Camelina sativa [gold-of-pleasure]
ref|NP_001059722.1|  Os07g0501900                                       188   1e-55   
ref|XP_010438471.1|  PREDICTED: transmembrane E3 ubiquitin-protei...    195   2e-55   Camelina sativa [gold-of-pleasure]
ref|XP_008664387.1|  PREDICTED: transmembrane E3 ubiquitin-protei...    185   2e-55   
ref|NP_194566.3|  E3 ubiquitin ligase FLY1                              194   3e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006658589.1|  PREDICTED: transmembrane E3 ubiquitin-protei...    193   5e-55   
ref|XP_009408647.1|  PREDICTED: transmembrane E3 ubiquitin-protei...    193   1e-54   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT26573.1|  Transmembrane E3 ubiquitin-protein ligase 1             189   1e-54   
gb|EEC82105.1|  hypothetical protein OsI_26121                          191   5e-54   Oryza sativa Indica Group [Indian rice]
gb|EEE67227.1|  hypothetical protein OsJ_24360                          191   5e-54   Oryza sativa Japonica Group [Japonica rice]
dbj|BAK00633.1|  predicted protein                                      190   1e-53   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010451148.1|  PREDICTED: uncharacterized protein LOC104733253    192   1e-53   
ref|XP_006297349.1|  hypothetical protein CARUB_v10013368mg             190   2e-53   Capsella rubella
ref|XP_010526511.1|  PREDICTED: transmembrane E3 ubiquitin-protei...    189   2e-53   Tarenaya hassleriana [spider flower]
emb|CDX97438.1|  BnaC08g13030D                                          189   3e-53   
ref|XP_009392841.1|  PREDICTED: transmembrane E3 ubiquitin-protei...    189   4e-53   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS65730.1|  Transmembrane E3 ubiquitin-protein ligase 1             188   5e-53   Triticum urartu
gb|AAM15208.1|  hypothetical protein                                    187   1e-52   Arabidopsis thaliana [mouse-ear cress]
emb|CDY14243.1|  BnaA08g13740D                                          187   1e-52   Brassica napus [oilseed rape]
ref|NP_179657.2|  putative RING E3 ubiquitin ligase                     187   1e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002886295.1|  zinc finger family protein                         187   1e-52   
ref|XP_006408999.1|  hypothetical protein EUTSA_v10002192mg             187   2e-52   
ref|XP_009109096.1|  PREDICTED: transmembrane E3 ubiquitin-protei...    186   4e-52   Brassica rapa
ref|XP_010467785.1|  PREDICTED: transmembrane E3 ubiquitin-protei...    185   7e-52   Camelina sativa [gold-of-pleasure]
emb|CDY61644.1|  BnaAnng17640D                                          185   8e-52   Brassica napus [oilseed rape]
ref|XP_004487270.1|  PREDICTED: transmembrane E3 ubiquitin-protei...    185   1e-51   Cicer arietinum [garbanzo]
ref|XP_004487269.1|  PREDICTED: transmembrane E3 ubiquitin-protei...    185   2e-51   Cicer arietinum [garbanzo]
ref|XP_001755692.1|  predicted protein                                  182   4e-51   
ref|XP_010555112.1|  PREDICTED: transmembrane E3 ubiquitin-protei...    182   3e-50   Tarenaya hassleriana [spider flower]
ref|XP_009102002.1|  PREDICTED: transmembrane E3 ubiquitin-protei...    179   9e-50   
emb|CDY31948.1|  BnaA07g00470D                                          179   1e-49   Brassica napus [oilseed rape]
gb|EPS63571.1|  hypothetical protein M569_11212                         172   3e-49   Genlisea aurea
ref|XP_001783682.1|  predicted protein                                  176   2e-48   
ref|XP_010555111.1|  PREDICTED: transmembrane E3 ubiquitin-protei...    177   2e-48   Tarenaya hassleriana [spider flower]
gb|KJB31654.1|  hypothetical protein B456_005G200400                    172   6e-47   Gossypium raimondii
gb|KJB31653.1|  hypothetical protein B456_005G200400                    170   1e-46   Gossypium raimondii
ref|XP_002971623.1|  hypothetical protein SELMODRAFT_147759             166   5e-45   
ref|XP_002965708.1|  hypothetical protein SELMODRAFT_143664             166   1e-44   
ref|XP_010433231.1|  PREDICTED: transmembrane E3 ubiquitin-protei...    165   1e-44   Camelina sativa [gold-of-pleasure]
ref|XP_007043625.1|  RING/U-box superfamily protein isoform 2           144   9e-37   
ref|XP_006372721.1|  hypothetical protein POPTR_0017s04430g             137   2e-34   
ref|XP_010928991.1|  PREDICTED: DSC E3 ubiquitin ligase complex s...    135   7e-34   
gb|KHN01116.1|  Transmembrane E3 ubiquitin-protein ligase 1             132   6e-33   Glycine soja [wild soybean]
gb|KHN28115.1|  Transmembrane E3 ubiquitin-protein ligase 1             129   7e-32   Glycine soja [wild soybean]
ref|XP_009533229.1|  hypothetical protein PHYSODRAFT_519898             120   4e-28   Phytophthora sojae
emb|CCI43701.1|  unnamed protein product                                119   1e-27   Albugo candida
gb|ETL29064.1|  hypothetical protein L916_17707                         119   2e-27   Phytophthora parasitica
ref|XP_009827875.1|  hypothetical protein H257_04916                    118   3e-27   Aphanomyces astaci
ref|XP_009827876.1|  hypothetical protein, variant 1                    118   3e-27   Aphanomyces astaci
gb|ETP33356.1|  hypothetical protein F442_18122                         117   6e-27   Phytophthora parasitica P10297
ref|XP_008912930.1|  hypothetical protein PPTG_16931                    117   6e-27   Phytophthora parasitica INRA-310
ref|XP_005839252.1|  hypothetical protein GUITHDRAFT_65446              113   2e-26   Guillardia theta CCMP2712
ref|XP_008867063.1|  hypothetical protein, variant 1                    115   2e-26   Aphanomyces invadans
ref|XP_005539543.1|  hypothetical protein, conserved                    115   5e-26   Cyanidioschyzon merolae strain 10D
ref|XP_004332975.1|  zinc finger family protein                         112   6e-26   Acanthamoeba castellanii str. Neff
emb|CCA18796.1|  conserved hypothetical protein                         113   2e-25   Albugo laibachii Nc14
ref|XP_002900523.1|  conserved hypothetical protein                     112   3e-25   Phytophthora infestans T30-4
ref|XP_003685010.1|  hypothetical protein TPHA_0C04260                  112   3e-25   Tetrapisispora phaffii CBS 4417
pir||T04607  hypothetical protein F20O9.50 - Arabidopsis thaliana       110   3e-25
emb|CEF97619.1|  Zinc finger, RING/FYVE/PHD-type                        111   5e-25   Ostreococcus tauri
ref|XP_005648496.1|  hypothetical protein COCSUDRAFT_36201              106   2e-24   Coccomyxa subellipsoidea C-169
ref|XP_008867064.1|  hypothetical protein, variant 2                    108   3e-24   Aphanomyces invadans
ref|XP_008867062.1|  hypothetical protein H310_04469                    109   4e-24   Aphanomyces invadans
ref|XP_008867065.1|  hypothetical protein, variant 3                    108   5e-24   Aphanomyces invadans
ref|WP_028830698.1|  hypothetical protein                               108   7e-24   
ref|XP_003060740.1|  predicted protein                                  105   1e-23   Micromonas pusilla CCMP1545
ref|XP_008616765.1|  hypothetical protein SDRG_12472                    107   2e-23   Saprolegnia diclina VS20
ref|XP_005712057.1|  unnamed protein product                            103   3e-22   Chondrus crispus [carageen]
ref|XP_003955580.1|  hypothetical protein KAFR_0B01460                  103   4e-22   Kazachstania africana CBS 2517
ref|XP_001417276.1|  predicted protein                                99.4    9e-22   Ostreococcus lucimarinus CCE9901
ref|XP_008883860.1|  zinc finger, C3HC4 type (RING finger) domain...    102   9e-22   
dbj|GAM19291.1|  hypothetical protein SAMD00019534_024660               102   1e-21   Acytostelium subglobosum LB1
ref|XP_001647220.1|  hypothetical protein Kpol_1002p7                   102   1e-21   Vanderwaltozyma polyspora DSM 70294
ref|XP_004343779.2|  hypothetical protein CAOG_07055                    102   1e-21   Capsaspora owczarzaki ATCC 30864
emb|CCK68363.1|  hypothetical protein KNAG_0A07090                      102   2e-21   Kazachstania naganishii CBS 8797
gb|EPT25011.1|  zinc finger, C3HC4 type (RING finger) domain-cont...    101   3e-21   Toxoplasma gondii ME49
gb|EPR63522.1|  zinc finger, C3HC4 type (RING finger) domain-cont...    101   3e-21   Toxoplasma gondii GT1
gb|KFG54083.1|  zinc finger, C3HC4 type (RING finger) domain-cont...    101   3e-21   Toxoplasma gondii FOU
gb|EFA85537.1|  hypothetical protein PPL_01495                        99.8    5e-21   Heterostelium album PN500
gb|KDO17998.1|  hypothetical protein SPRG_16480                       99.4    7e-21   Saprolegnia parasitica CBS 223.65
ref|XP_002504862.1|  predicted protein                                96.3    7e-21   Micromonas commoda
ref|XP_002546298.1|  predicted protein                                99.4    1e-20   Candida tropicalis MYA-3404
gb|KDO22722.1|  hypothetical protein SPRG_22291                       98.6    1e-20   Saprolegnia parasitica CBS 223.65
ref|XP_005847033.1|  hypothetical protein CHLNCDRAFT_23912            94.7    2e-20   Chlorella variabilis
ref|XP_002772757.1|  zinc finger protein, putative                    95.9    3e-20   Perkinsus marinus ATCC 50983
emb|CEG66833.1|  hypothetical protein RMATCC62417_03346               98.2    3e-20   Rhizopus microsporus
gb|EJY78944.1|  RING-finger-containing ubiquitin ligase               97.4    3e-20   Oxytricha trifallax
emb|CEG66834.1|  hypothetical protein RMATCC62417_03346               97.4    4e-20   Rhizopus microsporus
emb|CEI87116.1|  hypothetical protein RMCBS344292_01536               97.4    4e-20   Rhizopus microsporus
emb|CDO62547.1|  E3 ubiquitin-protein ligase, putative                97.8    5e-20   Plasmodium reichenowi
ref|XP_002769008.1|  zinc finger protein, putative                    96.3    6e-20   Perkinsus marinus ATCC 50983
emb|CEG84530.1|  hypothetical protein RMATCC62417_18319               93.2    8e-20   Rhizopus microsporus
ref|XP_011104303.1|  tul1p                                            97.1    9e-20   
gb|AJS48749.1|  Tul1p                                                 97.1    9e-20   Saccharomyces cerevisiae YJM1388
ref|NP_012890.1|  ubiquitin-protein ligase TUL1                       97.1    1e-19   Saccharomyces cerevisiae S288C
gb|AJS36445.1|  Tul1p                                                 97.1    1e-19   Saccharomyces cerevisiae YJM683
gb|AJS34343.1|  Tul1p                                                 97.1    1e-19   Saccharomyces cerevisiae YJM470
emb|CEG84529.1|  hypothetical protein RMATCC62417_18319               94.0    1e-19   Rhizopus microsporus
gb|AJS32896.1|  Tul1p                                                 96.7    1e-19   Saccharomyces cerevisiae YJM428
ref|NP_985822.1|  AFR275Wp                                            96.7    1e-19   Eremothecium gossypii ATCC 10895
gb|AJS30501.1|  Tul1p                                                 96.7    1e-19   Saccharomyces cerevisiae YJM193
gb|EHN01496.1|  Tul1p                                                 96.7    1e-19   Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7
gb|EHN06148.1|  Tul1p                                                 96.3    1e-19   Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7
gb|ETW30641.1|  hypothetical protein PFFCH_01943                      96.7    2e-19   Plasmodium falciparum FCH/4
gb|ETW52205.1|  hypothetical protein PFUGPA_05820                     96.7    2e-19   Plasmodium falciparum Palo Alto/Uganda
gb|EWC78793.1|  hypothetical protein C923_00560                       96.7    2e-19   Plasmodium falciparum UGT5.1
gb|AJS50171.1|  Tul1p                                                 96.3    2e-19   Saccharomyces cerevisiae YJM1402
gb|AJS46337.1|  Tul1p                                                 96.3    2e-19   Saccharomyces cerevisiae YJM1342
gb|AJS54066.1|  Tul1p                                                 96.3    2e-19   Saccharomyces cerevisiae YJM1463
gb|AJS40645.1|  Tul1p                                                 96.3    2e-19   Saccharomyces cerevisiae YJM1133
gb|AJS37040.1|  Tul1p                                                 96.3    2e-19   Saccharomyces cerevisiae YJM693
gb|AJS32294.1|  Tul1p                                                 96.3    2e-19   Saccharomyces cerevisiae YJM320
gb|EGA82064.1|  Tul1p                                                 96.3    2e-19   Saccharomyces cerevisiae Lalvin QA23
gb|EGA57882.1|  Tul1p                                                 96.3    2e-19   Saccharomyces cerevisiae FostersB
gb|EEU07447.1|  Tul1p                                                 96.3    2e-19   Saccharomyces cerevisiae JAY291
gb|EDN59873.1|  RING-domain E3 ubiquitin ligase                       96.3    2e-19   Saccharomyces cerevisiae YJM789
gb|AJS37340.1|  Tul1p                                                 96.3    2e-19   Saccharomyces cerevisiae YJM969
gb|AJS33436.1|  Tul1p                                                 96.3    2e-19   Saccharomyces cerevisiae YJM451
gb|AJS32594.1|  Tul1p                                                 96.3    2e-19   Saccharomyces cerevisiae YJM326
emb|CEP60852.1|  LALA0S02e01112g1_1                                   96.3    2e-19   Lachancea lanzarotensis
emb|CAY81051.1|  Tul1p                                                96.3    2e-19   Saccharomyces cerevisiae EC1118
gb|AJS48447.1|  Tul1p                                                 96.3    2e-19   Saccharomyces cerevisiae YJM1387
gb|AJS40038.1|  Tul1p                                                 96.3    2e-19   Saccharomyces cerevisiae YJM1083
gb|EDV13055.1|  transmembrane ubiquitin ligase 1                      96.3    2e-19   Saccharomyces cerevisiae RM11-1a
gb|EDZ70925.1|  YKL034Wp-like protein                                 96.3    2e-19   Saccharomyces cerevisiae AWRI1631
gb|ETW45203.1|  hypothetical protein PFNF135_00529                    96.3    2e-19   Plasmodium falciparum NF135/5.C10
gb|EUR80363.1|  hypothetical protein PFBG_00369                       96.3    2e-19   Plasmodium falciparum 7G8
gb|ETW38724.1|  hypothetical protein PFTANZ_00561                     96.3    2e-19   Plasmodium falciparum Tanzania (2000708)
gb|ETW20583.1|  hypothetical protein PFFVO_00494                      96.3    2e-19   Plasmodium falciparum Vietnam Oak-Knoll (FVO)
ref|XP_002367192.1|  zinc finger (C3HC4 RING finger) protein, put...  96.3    2e-19   
ref|XP_001351194.1|  RING zinc finger protein, putative               96.3    2e-19   Plasmodium falciparum 3D7
gb|ETW45712.1|  hypothetical protein PFMALIP_06251                    96.3    2e-19   Plasmodium falciparum MaliPS096_E11
emb|CEJ00621.1|  hypothetical protein RMCBS344292_14673               95.5    2e-19   Rhizopus microsporus
gb|AJS47240.1|  Tul1p                                                 95.9    2e-19   Saccharomyces cerevisiae YJM1381
gb|AJS30800.1|  Tul1p                                                 95.9    2e-19   Saccharomyces cerevisiae YJM195
gb|AJS56725.1|  Tul1p                                                 95.9    2e-19   Saccharomyces cerevisiae YJM1592
ref|XP_003647903.1|  hypothetical protein Ecym_7241                   95.9    2e-19   Eremothecium cymbalariae DBVPG#7215
gb|AJS49273.1|  Tul1p                                                 95.9    2e-19   Saccharomyces cerevisiae YJM1399
dbj|GAA24689.1|  K7_Tul1p                                             95.9    2e-19   Saccharomyces cerevisiae Kyokai no. 7
gb|KFH64130.1|  hypothetical protein MVEG_09955                       95.9    3e-19   Mortierella verticillata NRRL 6337
gb|EUD70830.1|  hypothetical protein YYG_03952                        95.5    3e-19   Plasmodium vinckei petteri
ref|XP_002289009.1|  hypothetical protein THAPSDRAFT_261916           92.0    3e-19   Thalassiosira pseudonana CCMP1335
ref|XP_001613139.1|  hypothetical protein                             95.5    3e-19   Plasmodium vivax
ref|XP_002785476.1|  zinc finger protein, putative                    94.4    3e-19   Perkinsus marinus ATCC 50983
ref|XP_009692712.1|  uncharacterized protein TOT_040000778            95.9    3e-19   Theileria orientalis strain Shintoku
ref|XP_004182327.1|  hypothetical protein TBLA_0I01490                95.1    4e-19   Tetrapisispora blattae CBS 6284
ref|XP_007510435.1|  predicted protein                                94.7    4e-19   Bathycoccus prasinos
emb|CEP15925.1|  hypothetical protein                                 94.7    5e-19   Parasitella parasitica
emb|CDR11290.1|  E3 ubiquitin-protein ligase, putative                94.4    8e-19   
ref|XP_003673421.1|  hypothetical protein NCAS_0A04760                94.0    1e-18   Naumovozyma castellii CBS 4309
ref|XP_008625954.1|  hypothetical protein YYE_04091                   93.6    1e-18   Plasmodium vinckei vinckei
ref|XP_003283597.1|  hypothetical protein DICPUDRAFT_74595            92.8    2e-18   Dictyostelium purpureum
ref|XP_004222160.1|  zinc finger protein                              93.2    2e-18   Plasmodium cynomolgi strain B
ref|XP_003886041.1|  hypothetical protein NCLIV_064410                93.2    2e-18   Neospora caninum Liverpool
ref|XP_448854.1|  hypothetical protein                                93.2    2e-18   [Candida] glabrata
gb|EPB85544.1|  hypothetical protein HMPREF1544_07633                 90.1    4e-18   Mucor circinelloides f. circinelloides 1006PhL
ref|XP_733999.1|  hypothetical protein                                88.2    5e-18   
ref|XP_745772.1|  zinc finger protein                                 89.0    6e-18   
ref|XP_456223.1|  hypothetical protein                                91.3    9e-18   Kluyveromyces lactis
dbj|BAO41609.1|  transmembrane E3 ubiquitin-protein ligase 1          90.9    1e-17   Kluyveromyces marxianus DMKU3-1042
emb|CDS07323.1|  hypothetical protein LRAMOSA01272                    90.5    2e-17   Lichtheimia ramosa
gb|AGO13409.1|  AaceriAFR275Wp                                        90.5    2e-17   Saccharomycetaceae sp. 'Ashbya aceri'
ref|XP_008817707.1|  hypothetical protein C922_03898                  90.5    2e-17   Plasmodium inui San Antonio 1
emb|CAA16876.2|  hypothetical protein                                 89.0    2e-17   Arabidopsis thaliana [mouse-ear cress]
gb|ACU45293.1|  zinc finger                                           87.0    2e-17   Karlodinium veneficum
gb|EAS01841.3|  zinc finger, C3HC4 type (RING finger) protein         89.7    2e-17   Tetrahymena thermophila SB210
emb|CDK24298.1|  unnamed protein product                              90.1    3e-17   Kuraishia capsulata CBS 1993
ref|XP_001022086.2|  zinc finger protein                              89.7    3e-17   
ref|XP_001694228.1|  predicted protein                                86.7    3e-17   Chlamydomonas reinhardtii
ref|XP_003679974.1|  hypothetical protein TDEL_0B06340                89.7    3e-17   Torulaspora delbrueckii
ref|XP_002499175.1|  ZYRO0E05632p                                     89.7    3e-17   Zygosaccharomyces rouxii
gb|EWM27231.1|  Zinc finger, RING-type                                89.0    5e-17   Nannochloropsis gaditana
ref|XP_005855273.1|  hypothetical protein NGA_0075710                 89.0    6e-17   Nannochloropsis gaditana CCMP526
emb|CDW89330.1|  ring-finger-containing ubiquitin ligase              87.8    6e-17   Stylonychia lemnae
ref|XP_002553035.1|  KLTH0D07216p                                     88.6    8e-17   Lachancea thermotolerans CBS 6340
ref|XP_004361781.1|  hypothetical protein DFA_06068                   88.2    1e-16   Cavenderia fasciculata
ref|XP_003672615.1|  hypothetical protein NDAI_0K01810                87.8    1e-16   Naumovozyma dairenensis CBS 421
ref|XP_008859789.1|  zinc finger domain containing protein            86.3    2e-16   Entamoeba nuttalli P19
ref|XP_657384.2|  zinc finger domain containing protein               86.3    2e-16   Entamoeba histolytica HM-1:IMSS
gb|EMS17250.1|  zinc finger domain containing protein                 86.3    2e-16   Entamoeba histolytica HM-3:IMSS
gb|EMD46610.1|  zinc finger domain containing protein                 86.3    2e-16   Entamoeba histolytica KU27
ref|XP_002258924.1|  zinc finger protein                              87.0    3e-16   Plasmodium knowlesi strain H
emb|CDH11681.1|  probable TUL1-RING-domain E3 ubiquitin ligase        86.7    3e-16   Zygosaccharomyces bailii ISA1307
dbj|BAN65842.1|  conserved hypothetical protein                       84.0    4e-16   Babesia bovis
ref|XP_001733796.1|  hypothetical protein                             85.1    5e-16   Entamoeba dispar SAW760
ref|XP_002492269.1|  Golgi-localized RING-finger ubiquitin ligase...  86.3    5e-16   Komagataella phaffii GS115
ref|XP_004830577.1|  hypothetical protein BEWA_003190                 85.9    6e-16   Theileria equi strain WA
ref|XP_001611494.1|  hypothetical protein                             85.5    7e-16   Babesia bovis T2Bo
emb|CCA40124.1|  putative membrane protein                            85.5    9e-16   
emb|CDF90099.1|  ZYBA0S06-00518g1_1                                   85.5    1e-15   Zygosaccharomyces bailii CLIB 213
emb|CDH16679.1|  probable TUL1-RING-domain E3 ubiquitin ligase        85.1    1e-15   Zygosaccharomyces bailii ISA1307
ref|XP_004182786.1|  hypothetical protein EIN_375350                  83.6    2e-15   Entamoeba invadens IP1
emb|CDR44476.1|  CYFA0S14e03114g1_1                                   83.2    6e-15   Cyberlindnera fabianii
ref|XP_007401317.1|  hypothetical protein PHACADRAFT_200969           83.2    6e-15   Phanerochaete carnosa HHB-10118-sp
ref|XP_002671827.1|  predicted protein                                82.4    8e-15   Naegleria gruberi strain NEG-M
ref|XP_001461897.1|  hypothetical protein                             81.6    9e-15   Paramecium tetraurelia strain d4-2
emb|CDS45021.1|  E3 ubiquitin-protein ligase, putative                82.4    9e-15   
ref|XP_011133116.1|  RING finger protein                              81.6    1e-14   Gregarina niphandrodes
emb|CDR97250.1|  ZN/RING FINGER PROTEIN 2 domain containing prote...  81.6    1e-14   Babesia bigemina
ref|XP_001307625.1|  hypothetical protein                             80.1    2e-14   Trichomonas vaginalis G3
ref|XP_010091487.1|  hypothetical protein L484_010329                 71.6    2e-14   
gb|KIY62720.1|  hypothetical protein CYLTODRAFT_426698                81.3    2e-14   Cylindrobasidium torrendii FP15055 ss-10
ref|XP_001437588.1|  hypothetical protein                             80.5    2e-14   Paramecium tetraurelia strain d4-2
ref|XP_001450563.1|  hypothetical protein                             80.5    3e-14   Paramecium tetraurelia strain d4-2
ref|XP_729508.1|  hypothetical protein                                80.5    4e-14   Plasmodium yoelii
gb|ETB59181.1|  hypothetical protein YYC_03433                        80.5    4e-14   Plasmodium yoelii 17X
emb|CCF72919.1|  unnamed protein product                              79.3    6e-14   
gb|KIP07099.1|  hypothetical protein PHLGIDRAFT_30180                 79.0    1e-13   
gb|KIK39315.1|  hypothetical protein CY34DRAFT_340837                 78.6    2e-13   
ref|XP_009035773.1|  hypothetical protein AURANDRAFT_71361            79.0    2e-13   
gb|EPS95715.1|  hypothetical protein FOMPIDRAFT_1038420               78.6    2e-13   
gb|EJK73332.1|  hypothetical protein THAOC_05051                      75.5    2e-13   
ref|XP_002841146.1|  hypothetical protein                             78.2    3e-13   
ref|XP_009496445.1|  hypothetical protein H696_04292                  78.2    3e-13   
ref|XP_003035780.1|  hypothetical protein SCHCODRAFT_81198            74.7    3e-13   
emb|CCJ28806.1|  unnamed protein product                              77.8    3e-13   
ref|XP_673661.1|  zinc finger protein                                 76.6    3e-13   
gb|EIF45353.1|  ring finger ubiquitin ligase                          74.7    3e-13   
emb|CBK25007.2|  unnamed protein product                              75.9    4e-13   
ref|XP_001430396.1|  hypothetical protein                             76.3    7e-13   
ref|XP_001427175.1|  hypothetical protein                             76.3    8e-13   
gb|KIM57226.1|  hypothetical protein SCLCIDRAFT_1219692               75.5    2e-12   
ref|XP_007322783.1|  hypothetical protein SERLADRAFT_373517           75.5    2e-12   
ref|XP_004203356.1|  Piso0_000963                                     75.5    2e-12   
ref|XP_505846.1|  YALI0F24915p                                        75.5    2e-12   
ref|XP_002620026.1|  hypothetical protein CLUG_01185                  75.5    2e-12   
gb|EAR95608.3|  zinc finger, C3HC4 type (RING finger) protein         74.7    2e-12   
ref|XP_628019.1|  RING-H2 finger containing membrane associated p...  74.7    3e-12   
gb|ESW95863.1|  E3 ubiquitin ligase                                   74.7    3e-12   
ref|XP_642403.1|  hypothetical protein DDB_G0278501                   74.7    3e-12   
gb|KIO34252.1|  hypothetical protein M407DRAFT_16786                  71.6    3e-12   
ref|XP_001321101.1|  hypothetical protein                             73.2    4e-12   
gb|KIW59795.1|  hypothetical protein PV05_00061                       74.3    4e-12   
ref|XP_001875199.1|  predicted protein                                74.3    4e-12   
ref|XP_006687685.1|  hypothetical protein CANTEDRAFT_124276           74.3    4e-12   
emb|CEJ81015.1|  hypothetical protein VHEMI01169                      73.9    7e-12   
gb|KIK08978.1|  hypothetical protein K443DRAFT_127958                 73.6    7e-12   
gb|KIM22842.1|  hypothetical protein M408DRAFT_332712                 73.6    8e-12   
ref|XP_658679.1|  hypothetical protein AN1075.2                       73.6    8e-12   
gb|KEF53590.1|  hypothetical protein A1O9_10565                       73.6    9e-12   
ref|XP_007874023.1|  hypothetical protein PNEG_02043                  73.2    1e-11   
gb|KIV87903.1|  hypothetical protein PV11_03419                       73.2    1e-11   
gb|EME47633.1|  hypothetical protein DOTSEDRAFT_69552                 73.2    1e-11   
gb|EDK38769.2|  hypothetical protein PGUG_02867                       73.2    1e-11   
gb|KIK20769.1|  hypothetical protein PISMIDRAFT_572745                72.8    1e-11   
ref|XP_001523843.1|  conserved hypothetical protein                   72.8    2e-11   
gb|KIM83157.1|  hypothetical protein PILCRDRAFT_819938                72.8    2e-11   
gb|EFQ28011.1|  hypothetical protein GLRG_03155                       72.4    2e-11   
gb|KDN63123.1|  hypothetical protein CSUB01_00197                     72.4    2e-11   
gb|KII87228.1|  hypothetical protein PLICRDRAFT_42865                 72.4    2e-11   
ref|XP_001485138.1|  hypothetical protein PGUG_02867                  72.4    2e-11   
gb|KIX08791.1|  hypothetical protein Z518_03448                       72.4    2e-11   
dbj|GAA93576.1|  hypothetical protein E5Q_00220                       72.4    2e-11   
ref|XP_002380303.1|  RING finger ubiquitin ligase (Tul1), putative    72.0    2e-11   
ref|XP_007749641.1|  hypothetical protein A1O5_10877                  72.0    3e-11   
gb|KHJ32611.1|  putative ring finger ubiquitin ligase                 72.0    3e-11   
gb|EPX75199.1|  ubiquitin-protein ligase E3                           72.0    3e-11   
gb|KDE83901.1|  putative E3 ubiquitin ligase                          72.0    3e-11   
ref|XP_001818869.1|  RING finger ubiquitin ligase (Tul1)              72.0    3e-11   
gb|KIV93330.1|  hypothetical protein PV10_04550                       72.0    3e-11   
ref|XP_002141828.1|  zinc finger, C3HC4 type domain-containing pr...  71.6    3e-11   
gb|KIJ55286.1|  hypothetical protein M422DRAFT_774359                 71.6    3e-11   
ref|XP_007800036.1|  hypothetical protein EPUS_02013                  71.6    3e-11   
ref|XP_001443213.1|  hypothetical protein                             71.2    4e-11   
gb|EMD38757.1|  hypothetical protein CERSUDRAFT_92794                 71.6    4e-11   
gb|EGN95275.1|  hypothetical protein SERLA73DRAFT_187593              68.6    4e-11   
ref|XP_008038956.1|  hypothetical protein TRAVEDRAFT_168658           71.2    4e-11   
gb|EJU04890.1|  hypothetical protein DACRYDRAFT_114212                71.2    4e-11   
gb|KIO00180.1|  hypothetical protein M404DRAFT_1004110                70.1    4e-11   
ref|XP_007382673.1|  hypothetical protein PUNSTDRAFT_85742            71.2    5e-11   
ref|XP_009153745.1|  hypothetical protein HMPREF1120_01478            71.2    5e-11   
ref|XP_008083671.1|  RING/U-box                                       71.2    5e-11   
emb|CCA76042.1|  hypothetical protein PIIN_10042                      70.9    6e-11   
ref|XP_006679033.1|  hypothetical protein BATDEDRAFT_25142            70.5    7e-11   
gb|KIW37255.1|  hypothetical protein PV06_10597                       70.5    7e-11   
gb|KIW86541.1|  hypothetical protein Z517_01939                       70.5    8e-11   
ref|XP_007343618.1|  hypothetical protein AURDEDRAFT_183534           70.5    8e-11   
ref|XP_007845858.1|  ring finger ubiquitin ligase                     70.5    8e-11   
ref|XP_007761278.1|  hypothetical protein A1O7_09099                  70.5    9e-11   
gb|EQK97712.1|  zinc finger domain-containing protein                 69.7    1e-10   
gb|KDQ26844.1|  hypothetical protein PLEOSDRAFT_1057327               70.1    1e-10   
gb|KIX92412.1|  hypothetical protein Z520_11887                       69.7    1e-10   
gb|KIW87832.1|  hypothetical protein Z519_11416                       69.7    1e-10   
ref|XP_007277430.1|  ring finger ubiquitin ligase                     69.7    2e-10   
gb|EQB44350.1|  hypothetical protein CGLO_16921                       69.7    2e-10   
gb|KIW33156.1|  hypothetical protein PV07_00027                       69.7    2e-10   
ref|XP_001384670.2|  hypothetical protein PICST_46942                 69.3    2e-10   
gb|KDQ14296.1|  hypothetical protein BOTBODRAFT_32766                 69.3    2e-10   
gb|KJE96785.1|  hypothetical protein CAOG_007055                      69.3    2e-10   
ref|XP_009548757.1|  hypothetical protein HETIRDRAFT_49725            68.9    2e-10   
ref|XP_007597505.1|  hypothetical protein CFIO01_12745                68.9    3e-10   
gb|KFY20560.1|  hypothetical protein V491_03622                       68.9    3e-10   
gb|KIL91116.1|  tul1 ring-domain e3 ubiquitin ligase                  68.9    3e-10   
gb|KIO10971.1|  hypothetical protein M404DRAFT_995402                 68.2    3e-10   
gb|KEY79594.1|  RING finger ubiquitin ligase Tul1                     68.9    3e-10   
ref|XP_752576.1|  RING finger ubiquitin ligase (Tul1)                 68.9    3e-10   
gb|EJY86822.1|  hypothetical protein OXYTRI_09877                     67.8    4e-10   
ref|XP_007881188.1|  hypothetical protein PFL1_05460                  68.6    4e-10   
gb|KIY45018.1|  hypothetical protein FISHEDRAFT_77045                 68.6    4e-10   
ref|XP_001210492.1|  hypothetical protein ATEG_00406                  68.6    4e-10   
gb|KFY48692.1|  hypothetical protein V495_01111                       68.6    4e-10   
ref|XP_008730593.1|  hypothetical protein G647_08059                  68.2    4e-10   
gb|KFX90471.1|  hypothetical protein V490_06432                       68.6    4e-10   
gb|KFX94538.1|  hypothetical protein O988_06234                       68.6    4e-10   
gb|KIN97366.1|  hypothetical protein M404DRAFT_1006153                67.4    5e-10   
gb|KIW64790.1|  hypothetical protein PV04_09699                       68.2    5e-10   
ref|XP_001264551.1|  RING finger ubiquitin ligase (Tul1), putative    68.2    5e-10   
ref|XP_666715.1|  zinc finger (C3HC4-type RING finger) protein fa...  68.2    5e-10   
gb|KJA28091.1|  hypothetical protein HYPSUDRAFT_34432                 67.8    7e-10   
gb|KFA49416.1|  hypothetical protein S40293_05777                     67.8    7e-10   
gb|KEY69767.1|  hypothetical protein S7711_03747                      67.8    7e-10   
emb|CCF47053.1|  transmembrane E3 ubiquitin-protein ligase            65.1    7e-10   
ref|XP_461839.2|  DEHA2G06710p                                        67.4    9e-10   
ref|XP_007674939.1|  hypothetical protein BAUCODRAFT_105318           67.4    9e-10   
ref|XP_006960999.1|  trans-membrane Golgi-localized RING-finger u...  67.4    1e-09   
dbj|GAC99219.1|  hypothetical protein PHSY_006819                     67.4    1e-09   
ref|XP_007727786.1|  hypothetical protein A1O1_08738                  67.0    1e-09   
gb|KIO05493.1|  hypothetical protein M404DRAFT_999680                 66.2    1e-09   
emb|CDW77339.1|  ring-finger-containing ubiquitin ligase              67.0    1e-09   
emb|CCW61765.1|  unnamed protein product                              67.0    1e-09   
gb|KIL69438.1|  hypothetical protein M378DRAFT_69521                  67.0    1e-09   
gb|KDN52815.1|  hypothetical protein K437DRAFT_253748                 67.0    1e-09   
gb|KGO42250.1|  Zinc finger, RING-type                                66.6    1e-09   
ref|XP_002848238.1|  conserved hypothetical protein                   66.6    1e-09   
gb|ELR02324.1|  hypothetical protein GMDG_05391                       66.6    2e-09   
gb|KDR80565.1|  hypothetical protein GALMADRAFT_61277                 66.6    2e-09   
dbj|GAN01107.1|  Ser/Thr kinase                                       66.6    2e-09   
gb|KIM44520.1|  hypothetical protein M413DRAFT_442488                 66.2    2e-09   
ref|XP_002421203.1|  RING-domain E3 ubiquitin ligase, putative        66.2    2e-09   
gb|KEP50684.1|  putative RING finger protein                          66.2    2e-09   
gb|EUC57165.1|  RING finger protein, putative                         66.2    2e-09   
gb|KFA63210.1|  hypothetical protein S40285_04919                     65.9    2e-09   
ref|XP_007377239.1|  hypothetical protein SPAPADRAFT_52369            65.9    2e-09   
dbj|GAD95075.1|  RING finger ubiquitin ligase (Tul1), putative        65.9    3e-09   
gb|EYB26577.1|  hypothetical protein FG05_07178                       65.9    3e-09   
ref|XP_011326900.1|  hypothetical protein FGSG_07178                  65.9    3e-09   
gb|EMT65164.1|  Transmembrane E3 ubiquitin-protein ligase 1           65.9    3e-09   
emb|CDM34144.1|  Zinc finger, RING/FYVE/PHD-type                      65.5    4e-09   
gb|EXL00037.1|  hypothetical protein FOQG_00370                       65.5    4e-09   
gb|EJY68409.1|  hypothetical protein OXYTRI_10977                     65.1    4e-09   
gb|EWY99235.1|  hypothetical protein FOYG_03337                       65.5    4e-09   
gb|EWG48054.1|  hypothetical protein FVEG_07983                       65.5    4e-09   
ref|XP_007865424.1|  hypothetical protein GLOTRDRAFT_138400           65.5    4e-09   
gb|EXM36042.1|  hypothetical protein FOTG_00357                       65.5    4e-09   
gb|EXM08014.1|  hypothetical protein FOIG_02881                       65.5    4e-09   
gb|EGU77670.1|  hypothetical protein FOXB_11845                       65.5    4e-09   
dbj|GAA92377.1|  RING finger ubiquitin ligase                         65.1    4e-09   
gb|EWZ45310.1|  hypothetical protein FOZG_05673                       65.1    5e-09   
gb|EXK42706.1|  hypothetical protein FOMG_05512                       65.1    5e-09   
gb|KDN48809.1|  LOW QUALITY PROTEIN: hypothetical protein RSAG8_0...  65.1    5e-09   
ref|XP_007004130.1|  hypothetical protein TREMEDRAFT_61650            65.1    5e-09   
gb|EXA50578.1|  hypothetical protein FOVG_03207                       65.1    5e-09   
emb|CCT66772.1|  related to TUL1 RING-domain E3 ubiquitin ligase      65.1    5e-09   
dbj|GAC75064.1|  predicted E3 ubiquitin ligase                        65.1    5e-09   
ref|XP_001390163.2|  RING finger ubiquitin ligase (Tul1)              65.1    5e-09   
gb|ETS59927.1|  hypothetical protein PaG_05904                        65.1    5e-09   
ref|XP_009254599.1|  hypothetical protein FPSE_03205                  65.1    5e-09   
gb|EHA21093.1|  hypothetical protein ASPNIDRAFT_51355                 65.1    6e-09   
ref|XP_001300307.1|  hypothetical protein                             64.3    6e-09   
dbj|GAK64641.1|  RING finger ubiquitin ligase                         64.7    6e-09   
emb|CDW79697.1|  ring-finger-containing ubiquitin ligase              64.3    6e-09   
ref|XP_001269060.1|  RING finger ubiquitin ligase (Tul1), putative    64.7    6e-09   
ref|XP_002182515.1|  predicted protein                                65.1    6e-09   
gb|KGO69502.1|  Zinc finger, RING-type                                64.7    6e-09   
gb|EJY66255.1|  RING-finger-containing ubiquitin ligase               64.7    7e-09   
ref|XP_003855701.1|  hypothetical protein MYCGRDRAFT_67987            64.7    7e-09   
gb|EYE95462.1|  hypothetical protein EURHEDRAFT_412281                64.7    7e-09   
gb|EGE04789.1|  RING finger ubiquitin ligase                          64.7    7e-09   
gb|EHK27321.1|  hypothetical protein TRIVIDRAFT_176061                64.7    8e-09   
gb|EGD97660.1|  RING finger ubiquitin ligase                          64.3    8e-09   
gb|EZF29779.1|  hypothetical protein H101_06567                       64.3    8e-09   
gb|KFX51127.1|  Transmembrane E3 ubiquitin-protein ligase 1           64.3    8e-09   
ref|XP_001330480.1|  hypothetical protein                             63.9    8e-09   
gb|KEI37928.1|  hypothetical protein L969DRAFT_95778                  64.3    9e-09   
ref|XP_002149348.1|  RING finger ubiquitin ligase (Tul1), putative    64.3    9e-09   
ref|XP_003010427.1|  hypothetical protein ARB_03128                   64.3    9e-09   
ref|XP_011272652.1|  Transmembrane E3 ubiquitin-protein ligase 1      64.3    9e-09   
ref|XP_002558310.1|  Pc12g15070                                       63.9    1e-08   
gb|EKV08888.1|  putative RING finger protein                          63.9    1e-08   
ref|XP_003018923.1|  hypothetical protein TRV_07055                   63.9    1e-08   
ref|XP_007366738.1|  hypothetical protein DICSQDRAFT_161991           63.9    1e-08   
gb|EMF16031.1|  hypothetical protein SEPMUDRAFT_61517                 63.9    1e-08   
ref|XP_002175269.2|  ubiquitin-protein ligase E3                      63.5    1e-08   
gb|EPY49441.1|  ubiquitin-protein ligase E3                           63.5    1e-08   
emb|CBQ73750.1|  conserved hypothetical protein                       63.9    1e-08   
gb|KIW03462.1|  hypothetical protein PV09_05231                       63.5    1e-08   
gb|EKV06775.1|  putative RING finger protein                          63.5    1e-08   
ref|XP_007732976.1|  hypothetical protein A1O3_04658                  63.5    1e-08   
dbj|GAM89045.1|  hypothetical protein ANO11243_070790                 63.5    1e-08   
emb|CAK44571.1|  unnamed protein product                              63.5    2e-08   
emb|CEL55558.1|  DSC E3 ubiquitin ligase complex subunit 1 OS=Sch...  63.5    2e-08   
ref|XP_007289764.1|  ring finger ubiquitin ligase                     63.5    2e-08   
ref|XP_001801045.1|  hypothetical protein SNOG_10786                  63.5    2e-08   
ref|XP_001487554.1|  hypothetical protein PGUG_00931                  62.4    2e-08   
ref|XP_001328387.1|  hypothetical protein                             62.8    2e-08   
gb|EDK36833.2|  hypothetical protein PGUG_00931                       62.4    2e-08   
gb|EEH07883.1|  conserved hypothetical protein                        63.2    2e-08   
gb|EGC42915.1|  RING finger ubiquitin ligase                          63.2    2e-08   
gb|KEQ64862.1|  hypothetical protein M437DRAFT_73780                  63.5    2e-08   
emb|CCU75070.1|  RING finger ubiquitin ligase (Tul1)/E3 ubiquitin...  63.2    2e-08   
ref|XP_003234589.1|  RING finger ubiquitin ligase                     63.2    2e-08   
gb|EER42843.1|  RING finger ubiquitin ligase                          63.2    2e-08   
ref|XP_007834632.1|  hypothetical protein PFICI_07860                 62.8    2e-08   
gb|KHC82114.1|  hypothetical protein I503_04990                       62.8    3e-08   
gb|KIW21601.1|  hypothetical protein PV08_02181                       62.8    3e-08   
gb|EPQ62064.1|  Golgi-localized RING-finger ubiquitin ligase E3       62.8    3e-08   
gb|EZF74167.1|  hypothetical protein H105_03875                       62.8    3e-08   
gb|KHC69629.1|  hypothetical protein MGS_04952                        62.0    3e-08   
ref|XP_001239390.1|  hypothetical protein CIMG_09011                  62.4    4e-08   
gb|KID74868.1|  Zinc finger, RING/FYVE/PHD-type                       62.4    4e-08   
gb|KID95229.1|  Zinc finger, RING/FYVE/PHD-type                       62.4    4e-08   
gb|KHC31414.1|  hypothetical protein MGQ_04902                        62.4    4e-08   
ref|XP_712406.1|  hypothetical protein CaO19.2131                     62.4    4e-08   
gb|KGQ87481.1|  hypothetical protein MG1_04949                        62.4    4e-08   
ref|XP_007814730.1|  RING finger ubiquitin ligase (Tul1), putative    62.4    4e-08   
gb|KHC32587.1|  hypothetical protein W5O_04949                        62.0    4e-08   
gb|KHC47360.1|  hypothetical protein MEW_04835                        62.0    4e-08   
gb|EEQ46578.1|  conserved hypothetical protein                        62.0    4e-08   
gb|KHC57756.1|  hypothetical protein MGE_04899                        62.0    4e-08   
gb|KGQ85627.1|  hypothetical protein MEU_04924                        62.0    4e-08   
gb|KGQ84427.1|  hypothetical protein MEO_04859                        62.0    5e-08   
gb|KFG78274.1|  putative RING finger ubiquitin ligase (Tul1)          62.0    5e-08   
gb|KID82972.1|  Zinc finger, RING/FYVE/PHD-type                       62.0    5e-08   
ref|XP_007825644.1|  trans-membrane Golgi-localized RING-finger u...  62.0    5e-08   
ref|XP_011116037.1|  hypothetical protein H072_10588                  62.0    5e-08   
gb|KGU21166.1|  hypothetical protein MG7_04937                        62.0    5e-08   
gb|EFW21219.1|  RING finger ubiquitin ligase                          62.0    5e-08   



>gb|KCW47234.1| hypothetical protein EUGRSUZ_K01043 [Eucalyptus grandis]
Length=334

 Score =   225 bits (573),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 99/115 (86%), Positives = 107/115 (93%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P+NFMRIE DK WCICLG+F+G+QASI  LQHYFGSRWFIPRQILPEKYSYYR+FDQD+ 
Sbjct  220  PYNFMRIEPDKSWCICLGVFLGLQASILLLQHYFGSRWFIPRQILPEKYSYYRRFDQDSS  279

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
               DCVICMT+IDL+QRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA
Sbjct  280  HSTDCVICMTSIDLTQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  334



>gb|KCW47233.1| hypothetical protein EUGRSUZ_K01043 [Eucalyptus grandis]
Length=392

 Score =   225 bits (573),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 99/115 (86%), Positives = 107/115 (93%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P+NFMRIE DK WCICLG+F+G+QASI  LQHYFGSRWFIPRQILPEKYSYYR+FDQD+ 
Sbjct  278  PYNFMRIEPDKSWCICLGVFLGLQASILLLQHYFGSRWFIPRQILPEKYSYYRRFDQDSS  337

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
               DCVICMT+IDL+QRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA
Sbjct  338  HSTDCVICMTSIDLTQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  392



>ref|XP_010035771.1| PREDICTED: transmembrane E3 ubiquitin-protein ligase 1-like [Eucalyptus 
grandis]
 gb|KCW47232.1| hypothetical protein EUGRSUZ_K01043 [Eucalyptus grandis]
Length=562

 Score =   226 bits (576),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 99/115 (86%), Positives = 107/115 (93%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P+NFMRIE DK WCICLG+F+G+QASI  LQHYFGSRWFIPRQILPEKYSYYR+FDQD+ 
Sbjct  448  PYNFMRIEPDKSWCICLGVFLGLQASILLLQHYFGSRWFIPRQILPEKYSYYRRFDQDSS  507

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
               DCVICMT+IDL+QRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA
Sbjct  508  HSTDCVICMTSIDLTQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  562



>emb|CDP14812.1| unnamed protein product [Coffea canephora]
Length=569

 Score =   223 bits (568),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 100/115 (87%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            PHNFMRI  DK WCICLGIFMG QASI  LQHY GSRWFIPRQILPEKYSYYR+FDQD  
Sbjct  455  PHNFMRIAPDKNWCICLGIFMGFQASILLLQHYLGSRWFIPRQILPEKYSYYRRFDQDPN  514

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
               DCVICMT+IDL+QRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA
Sbjct  515  HATDCVICMTSIDLTQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  569



>ref|XP_010908981.1| PREDICTED: DSC E3 ubiquitin ligase complex subunit 1-like isoform 
X1 [Elaeis guineensis]
Length=585

 Score =   223 bits (567),  Expect = 1e-65, Method: Composition-based stats.
 Identities = 93/118 (79%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P NFMRIE D  WCI LG+F+G+QASI  LQHY GSRWFIPRQILPEKYSYYR+ + DA 
Sbjct  450  PSNFMRIEVDTNWCISLGVFLGLQASILLLQHYLGSRWFIPRQILPEKYSYYRRLESDAT  509

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA*VD  193
            +  DCVICMT IDL+QRSND MVTPCDHFFHSGCLQRWMDIKMECPTCRR LPPA +D
Sbjct  510  RTTDCVICMTAIDLTQRSNDYMVTPCDHFFHSGCLQRWMDIKMECPTCRRSLPPAYMD  567



>ref|XP_010908982.1| PREDICTED: transmembrane E3 ubiquitin-protein ligase 1-like isoform 
X2 [Elaeis guineensis]
Length=564

 Score =   221 bits (562),  Expect = 4e-65, Method: Composition-based stats.
 Identities = 92/115 (80%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P NFMRIE D  WCI LG+F+G+QASI  LQHY GSRWFIPRQILPEKYSYYR+ + DA 
Sbjct  450  PSNFMRIEVDTNWCISLGVFLGLQASILLLQHYLGSRWFIPRQILPEKYSYYRRLESDAT  509

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
            +  DCVICMT IDL+QRSND MVTPCDHFFHSGCLQRWMDIKMECPTCRR LPPA
Sbjct  510  RTTDCVICMTAIDLTQRSNDYMVTPCDHFFHSGCLQRWMDIKMECPTCRRSLPPA  564



>ref|XP_003543332.1| PREDICTED: transmembrane E3 ubiquitin-protein ligase 1-like isoform 
X1 [Glycine max]
 ref|XP_006594848.1| PREDICTED: transmembrane E3 ubiquitin-protein ligase 1-like isoform 
X2 [Glycine max]
Length=570

 Score =   219 bits (558),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P+NFMRIE DK WC+CL +F+G+QA+I  LQHY GSRWFIPRQILPEKYSYYR+FDQD  
Sbjct  456  PNNFMRIEPDKSWCVCLAVFIGLQAAILLLQHYLGSRWFIPRQILPEKYSYYRRFDQDTR  515

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
               DCVICMT IDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA
Sbjct  516  HATDCVICMTAIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  570



>gb|KDP24108.1| hypothetical protein JCGZ_25765 [Jatropha curcas]
Length=570

 Score =   218 bits (554),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 104/115 (90%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P+NFMRIE DK WC CL +F+G+QASI  LQHY GSRWFIPRQILPEKYSYYR+FDQ   
Sbjct  456  PNNFMRIEPDKTWCTCLSVFIGLQASILLLQHYLGSRWFIPRQILPEKYSYYRRFDQATN  515

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
            Q +DCVICMT+IDL+QRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA
Sbjct  516  QAMDCVICMTSIDLTQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  570



>gb|KHN36649.1| Transmembrane E3 ubiquitin-protein ligase 1 [Glycine soja]
Length=633

 Score =   219 bits (557),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P+NFMRIE DK WC+CL +F+G+QA+I  LQHY GSRWFIPRQILPEKYSYYR+FDQD  
Sbjct  519  PNNFMRIEPDKSWCVCLAVFIGLQAAILLLQHYLGSRWFIPRQILPEKYSYYRRFDQDTR  578

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
               DCVICMT IDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA
Sbjct  579  HATDCVICMTAIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  633



>ref|XP_009781658.1| PREDICTED: transmembrane E3 ubiquitin-protein ligase 1 isoform 
X3 [Nicotiana sylvestris]
Length=556

 Score =   217 bits (553),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 98/115 (85%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            PHNFMRIE DK WCICLGIFM  QASI  LQHY GSRWFIPRQILPEKYSYYR+F+QDAV
Sbjct  442  PHNFMRIEPDKNWCICLGIFMAFQASILLLQHYLGSRWFIPRQILPEKYSYYRRFNQDAV  501

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
            +  DCVICMT IDL+QR+N  MVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA
Sbjct  502  RVSDCVICMTAIDLTQRANHWMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  556



>ref|XP_009781642.1| PREDICTED: transmembrane E3 ubiquitin-protein ligase 1 isoform 
X1 [Nicotiana sylvestris]
Length=557

 Score =   217 bits (553),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 98/115 (85%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            PHNFMRIE DK WCICLGIFM  QASI  LQHY GSRWFIPRQILPEKYSYYR+F+QDAV
Sbjct  443  PHNFMRIEPDKNWCICLGIFMAFQASILLLQHYLGSRWFIPRQILPEKYSYYRRFNQDAV  502

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
            +  DCVICMT IDL+QR+N  MVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA
Sbjct  503  RVSDCVICMTAIDLTQRANHWMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  557



>ref|XP_009781650.1| PREDICTED: transmembrane E3 ubiquitin-protein ligase 1 isoform 
X2 [Nicotiana sylvestris]
Length=556

 Score =   217 bits (553),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 98/115 (85%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            PHNFMRIE DK WCICLGIFM  QASI  LQHY GSRWFIPRQILPEKYSYYR+F+QDAV
Sbjct  442  PHNFMRIEPDKNWCICLGIFMAFQASILLLQHYLGSRWFIPRQILPEKYSYYRRFNQDAV  501

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
            +  DCVICMT IDL+QR+N  MVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA
Sbjct  502  RVSDCVICMTAIDLTQRANHWMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  556



>ref|XP_007198952.1| hypothetical protein PRUPE_ppa017961mg, partial [Prunus persica]
 gb|EMJ00151.1| hypothetical protein PRUPE_ppa017961mg, partial [Prunus persica]
Length=556

 Score =   217 bits (552),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 95/115 (83%), Positives = 104/115 (90%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P+NFMRIE DK WCICLG+F+G+QASI  LQHY GSRWFIPRQILPEKYSY+R++DQD  
Sbjct  442  PNNFMRIEPDKSWCICLGVFIGLQASILLLQHYLGSRWFIPRQILPEKYSYFRRYDQDTH  501

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
               DCVICMT +DL+QRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA
Sbjct  502  HTTDCVICMTAVDLTQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  556



>ref|XP_006367478.1| PREDICTED: DSC E3 ubiquitin ligase complex subunit 1-like isoform 
X2 [Solanum tuberosum]
Length=564

 Score =   217 bits (553),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            PHNFMRIE DK WCICLGIFM +QA +  LQHY GSRWFIPRQILPEKYSYYR+FDQ   
Sbjct  450  PHNFMRIEPDKSWCICLGIFMAVQALVLLLQHYLGSRWFIPRQILPEKYSYYRRFDQKGN  509

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
               DCVICMT IDL+QRSN+CMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA
Sbjct  510  HATDCVICMTAIDLTQRSNNCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  564



>ref|XP_006367477.1| PREDICTED: DSC E3 ubiquitin ligase complex subunit 1-like isoform 
X1 [Solanum tuberosum]
Length=565

 Score =   217 bits (553),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            PHNFMRIE DK WCICLGIFM +QA +  LQHY GSRWFIPRQILPEKYSYYR+FDQ   
Sbjct  451  PHNFMRIEPDKSWCICLGIFMAVQALVLLLQHYLGSRWFIPRQILPEKYSYYRRFDQKGN  510

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
               DCVICMT IDL+QRSN+CMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA
Sbjct  511  HATDCVICMTAIDLTQRSNNCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  565



>ref|XP_006367479.1| PREDICTED: DSC E3 ubiquitin ligase complex subunit 1-like isoform 
X3 [Solanum tuberosum]
Length=564

 Score =   217 bits (553),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            PHNFMRIE DK WCICLGIFM +QA +  LQHY GSRWFIPRQILPEKYSYYR+FDQ   
Sbjct  450  PHNFMRIEPDKSWCICLGIFMAVQALVLLLQHYLGSRWFIPRQILPEKYSYYRRFDQKGN  509

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
               DCVICMT IDL+QRSN+CMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA
Sbjct  510  HATDCVICMTAIDLTQRSNNCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  564



>ref|XP_008229068.1| PREDICTED: uncharacterized protein LOC103328453 [Prunus mume]
Length=576

 Score =   217 bits (553),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 95/115 (83%), Positives = 104/115 (90%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P+NFMRIE DK WCICLG+F+G+QASI  LQHY GSRWFIPRQILPEKYSY+R++DQD  
Sbjct  462  PNNFMRIEPDKSWCICLGVFIGLQASILLLQHYLGSRWFIPRQILPEKYSYFRRYDQDTH  521

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
               DCVICMT +DL+QRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA
Sbjct  522  HTTDCVICMTAVDLTQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  576



>ref|XP_002517888.1| protein binding protein, putative [Ricinus communis]
 gb|EEF44406.1| protein binding protein, putative [Ricinus communis]
Length=570

 Score =   216 bits (551),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P+NFMRIE DK WC+CL +FMG+QASI  LQHY GSRWFIPRQILPEKYSYYR+FDQD  
Sbjct  456  PNNFMRIEPDKSWCMCLSVFMGLQASILLLQHYLGSRWFIPRQILPEKYSYYRRFDQDTN  515

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
               DCVICMT IDL+QRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRR LPPA
Sbjct  516  HATDCVICMTAIDLTQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRSLPPA  570



>ref|XP_006447274.1| hypothetical protein CICLE_v10014745mg [Citrus clementina]
 ref|XP_006469890.1| PREDICTED: transmembrane E3 ubiquitin-protein ligase 1-like [Citrus 
sinensis]
 gb|ESR60514.1| hypothetical protein CICLE_v10014745mg [Citrus clementina]
 gb|KDO42770.1| hypothetical protein CISIN_1g008227mg [Citrus sinensis]
Length=573

 Score =   216 bits (550),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 97/115 (84%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            PHNFMRIE DK WCICL +F+G+QASI  LQHY GSRWFIPRQILPEKYSYYR+FDQ   
Sbjct  459  PHNFMRIEPDKNWCICLCVFIGLQASILLLQHYLGSRWFIPRQILPEKYSYYRRFDQGTY  518

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
               DCVICMT IDL QRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA
Sbjct  519  HTTDCVICMTAIDLMQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  573



>ref|XP_009781467.1| PREDICTED: transmembrane E3 ubiquitin-protein ligase 1-like [Nicotiana 
sylvestris]
Length=566

 Score =   216 bits (549),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 95/115 (83%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            PHNFMRIE DK WCICLG+FM +QA+I  LQHY GSRWFIPRQILPEKY+YYR+FDQ A 
Sbjct  452  PHNFMRIEPDKNWCICLGVFMALQAAILLLQHYLGSRWFIPRQILPEKYNYYRRFDQGAN  511

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
               DCVICM  IDL+QRSN CMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA
Sbjct  512  SAADCVICMAAIDLTQRSNTCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  566



>ref|XP_010313659.1| PREDICTED: transmembrane E3 ubiquitin-protein ligase 1-like isoform 
X2 [Solanum lycopersicum]
Length=527

 Score =   215 bits (547),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 95/115 (83%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            PHNFMRIE DK WCICLG+F+ +QASI  LQHY GSRWFIPRQILPEKY+YYR+FDQ A 
Sbjct  413  PHNFMRIEPDKNWCICLGVFIVLQASILLLQHYLGSRWFIPRQILPEKYNYYRRFDQGAN  472

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
               DCVICMT ID +QRSN+CMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA
Sbjct  473  HATDCVICMTAIDHTQRSNNCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  527



>ref|XP_004243364.1| PREDICTED: DSC E3 ubiquitin ligase complex subunit 1 isoform 
X1 [Solanum lycopersicum]
Length=564

 Score =   215 bits (547),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 95/115 (83%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            PHNFMRIE D+ WCICLGIFM +QA I  LQHY GSRWFIPRQILPEKYSYYR+FDQ+  
Sbjct  450  PHNFMRIEPDRSWCICLGIFMAVQALILLLQHYLGSRWFIPRQILPEKYSYYRRFDQNGD  509

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
               DCVICMT IDL+QRSN+CMVTPCDHFFHSGCLQRWMDIKMECPTCRR LPPA
Sbjct  510  HATDCVICMTAIDLTQRSNNCMVTPCDHFFHSGCLQRWMDIKMECPTCRRSLPPA  564



>ref|XP_010323745.1| PREDICTED: DSC E3 ubiquitin ligase complex subunit 1 isoform 
X2 [Solanum lycopersicum]
Length=563

 Score =   215 bits (547),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 95/115 (83%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            PHNFMRIE D+ WCICLGIFM +QA I  LQHY GSRWFIPRQILPEKYSYYR+FDQ+  
Sbjct  449  PHNFMRIEPDRSWCICLGIFMAVQALILLLQHYLGSRWFIPRQILPEKYSYYRRFDQNGD  508

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
               DCVICMT IDL+QRSN+CMVTPCDHFFHSGCLQRWMDIKMECPTCRR LPPA
Sbjct  509  HATDCVICMTAIDLTQRSNNCMVTPCDHFFHSGCLQRWMDIKMECPTCRRSLPPA  563



>ref|XP_011047660.1| PREDICTED: transmembrane E3 ubiquitin-protein ligase 1 isoform 
X2 [Populus euphratica]
Length=274

 Score =   207 bits (526),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 91/115 (79%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P+NFMR E DK WC+ LG+F+G+QASI  LQHY GSRWFIPRQILPEKY YYR+FDQ++ 
Sbjct  160  PNNFMRTEPDKTWCLYLGVFIGLQASILLLQHYLGSRWFIPRQILPEKYFYYRRFDQESN  219

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
               DCVICMT IDL++ SNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA
Sbjct  220  HATDCVICMTAIDLTRHSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  274



>ref|XP_006351940.1| PREDICTED: transmembrane E3 ubiquitin-protein ligase 1-like [Solanum 
tuberosum]
Length=569

 Score =   214 bits (546),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 95/115 (83%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            PHNFMRIE DK WCICLG+F+ +QASI  LQHY GSRWFIPRQILPEKY+YYR+FDQ A 
Sbjct  455  PHNFMRIEPDKNWCICLGVFIVLQASILLLQHYLGSRWFIPRQILPEKYNYYRRFDQGAN  514

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
               DCVICMT ID +QRSN+CMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA
Sbjct  515  HATDCVICMTAIDHTQRSNNCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  569



>ref|XP_009603544.1| PREDICTED: transmembrane E3 ubiquitin-protein ligase 1-like [Nicotiana 
tomentosiformis]
Length=566

 Score =   214 bits (546),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 95/115 (83%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            PHNFMRIE DK WCICLG+FM +QA+I  LQHY GSRWFIPRQILPEKY+Y R+FDQ A 
Sbjct  452  PHNFMRIEPDKNWCICLGVFMSLQAAILLLQHYLGSRWFIPRQILPEKYNYNRRFDQGAN  511

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
               DCVICM  IDLSQRSN+CMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA
Sbjct  512  SAADCVICMAAIDLSQRSNNCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  566



>ref|XP_009606918.1| PREDICTED: transmembrane E3 ubiquitin-protein ligase 1 isoform 
X1 [Nicotiana tomentosiformis]
Length=557

 Score =   214 bits (545),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 95/115 (83%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            PHNFMRIE D+ WCICLGIFM  QAS+  LQHY GSRWFIPRQILPEKYSYYR+F+QDA 
Sbjct  443  PHNFMRIEPDENWCICLGIFMAFQASVLLLQHYLGSRWFIPRQILPEKYSYYRRFNQDAA  502

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
            +  DCVICMT IDL+QR+N  MVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA
Sbjct  503  RVSDCVICMTAIDLTQRANHWMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  557



>ref|XP_004251496.1| PREDICTED: transmembrane E3 ubiquitin-protein ligase 1-like isoform 
X1 [Solanum lycopersicum]
 ref|XP_010313658.1| PREDICTED: transmembrane E3 ubiquitin-protein ligase 1-like isoform 
X1 [Solanum lycopersicum]
Length=569

 Score =   214 bits (546),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 95/115 (83%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            PHNFMRIE DK WCICLG+F+ +QASI  LQHY GSRWFIPRQILPEKY+YYR+FDQ A 
Sbjct  455  PHNFMRIEPDKNWCICLGVFIVLQASILLLQHYLGSRWFIPRQILPEKYNYYRRFDQGAN  514

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
               DCVICMT ID +QRSN+CMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA
Sbjct  515  HATDCVICMTAIDHTQRSNNCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  569



>ref|XP_007149831.1| hypothetical protein PHAVU_005G102100g [Phaseolus vulgaris]
 gb|ESW21825.1| hypothetical protein PHAVU_005G102100g [Phaseolus vulgaris]
Length=569

 Score =   214 bits (545),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 93/115 (81%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P+NFMRIE DK WC+CL +F+G+QA+I  LQHY GSRWFIPRQILPEKYSYYR+FDQ+  
Sbjct  455  PNNFMRIEPDKTWCVCLAVFIGLQAAILLLQHYLGSRWFIPRQILPEKYSYYRRFDQETR  514

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
               DCVICMT ID+SQRSNDCMVTPCDHFFH GCLQRWMDIKMECPTCRRPLPPA
Sbjct  515  HATDCVICMTAIDISQRSNDCMVTPCDHFFHFGCLQRWMDIKMECPTCRRPLPPA  569



>ref|XP_009606919.1| PREDICTED: transmembrane E3 ubiquitin-protein ligase 1 isoform 
X2 [Nicotiana tomentosiformis]
Length=556

 Score =   214 bits (545),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 95/115 (83%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            PHNFMRIE D+ WCICLGIFM  QAS+  LQHY GSRWFIPRQILPEKYSYYR+F+QDA 
Sbjct  442  PHNFMRIEPDENWCICLGIFMAFQASVLLLQHYLGSRWFIPRQILPEKYSYYRRFNQDAA  501

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
            +  DCVICMT IDL+QR+N  MVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA
Sbjct  502  RVSDCVICMTAIDLTQRANHWMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  556



>ref|XP_009606920.1| PREDICTED: transmembrane E3 ubiquitin-protein ligase 1 isoform 
X3 [Nicotiana tomentosiformis]
Length=556

 Score =   214 bits (544),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 95/115 (83%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            PHNFMRIE D+ WCICLGIFM  QAS+  LQHY GSRWFIPRQILPEKYSYYR+F+QDA 
Sbjct  442  PHNFMRIEPDENWCICLGIFMAFQASVLLLQHYLGSRWFIPRQILPEKYSYYRRFNQDAA  501

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
            +  DCVICMT IDL+QR+N  MVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA
Sbjct  502  RVSDCVICMTAIDLTQRANHWMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  556



>ref|XP_007149832.1| hypothetical protein PHAVU_005G102100g [Phaseolus vulgaris]
 gb|ESW21826.1| hypothetical protein PHAVU_005G102100g [Phaseolus vulgaris]
Length=570

 Score =   214 bits (545),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 93/115 (81%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P+NFMRIE DK WC+CL +F+G+QA+I  LQHY GSRWFIPRQILPEKYSYYR+FDQ+  
Sbjct  456  PNNFMRIEPDKTWCVCLAVFIGLQAAILLLQHYLGSRWFIPRQILPEKYSYYRRFDQETR  515

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
               DCVICMT ID+SQRSNDCMVTPCDHFFH GCLQRWMDIKMECPTCRRPLPPA
Sbjct  516  HATDCVICMTAIDISQRSNDCMVTPCDHFFHFGCLQRWMDIKMECPTCRRPLPPA  570



>ref|XP_011047659.1| PREDICTED: transmembrane E3 ubiquitin-protein ligase 1 isoform 
X1 [Populus euphratica]
Length=330

 Score =   207 bits (528),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 91/115 (79%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P+NFMR E DK WC+ LG+F+G+QASI  LQHY GSRWFIPRQILPEKY YYR+FDQ++ 
Sbjct  216  PNNFMRTEPDKTWCLYLGVFIGLQASILLLQHYLGSRWFIPRQILPEKYFYYRRFDQESN  275

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
               DCVICMT IDL++ SNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA
Sbjct  276  HATDCVICMTAIDLTRHSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  330



>ref|XP_010928986.1| PREDICTED: transmembrane E3 ubiquitin-protein ligase 1-like isoform 
X4 [Elaeis guineensis]
Length=533

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 92/115 (80%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P NFMRIE D  WCI LG+F+G+QASI  LQHYFGSRWFIPRQILPEKYSYYR+ + D  
Sbjct  419  PSNFMRIEVDTNWCISLGVFLGLQASILLLQHYFGSRWFIPRQILPEKYSYYRRLESDTT  478

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
            Q  DCVICMT +DL+QRSND MVTPCDHFFHSGCLQRWMDIKMECPTCRR LPPA
Sbjct  479  QTTDCVICMTAVDLTQRSNDYMVTPCDHFFHSGCLQRWMDIKMECPTCRRSLPPA  533



>ref|XP_010928979.1| PREDICTED: transmembrane E3 ubiquitin-protein ligase 1-like isoform 
X3 [Elaeis guineensis]
Length=559

 Score =   213 bits (542),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 92/115 (80%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P NFMRIE D  WCI LG+F+G+QASI  LQHYFGSRWFIPRQILPEKYSYYR+ + D  
Sbjct  445  PSNFMRIEVDTNWCISLGVFLGLQASILLLQHYFGSRWFIPRQILPEKYSYYRRLESDTT  504

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
            Q  DCVICMT +DL+QRSND MVTPCDHFFHSGCLQRWMDIKMECPTCRR LPPA
Sbjct  505  QTTDCVICMTAVDLTQRSNDYMVTPCDHFFHSGCLQRWMDIKMECPTCRRSLPPA  559



>ref|XP_010928965.1| PREDICTED: transmembrane E3 ubiquitin-protein ligase 1-like isoform 
X1 [Elaeis guineensis]
Length=561

 Score =   213 bits (542),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 92/115 (80%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P NFMRIE D  WCI LG+F+G+QASI  LQHYFGSRWFIPRQILPEKYSYYR+ + D  
Sbjct  447  PSNFMRIEVDTNWCISLGVFLGLQASILLLQHYFGSRWFIPRQILPEKYSYYRRLESDTT  506

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
            Q  DCVICMT +DL+QRSND MVTPCDHFFHSGCLQRWMDIKMECPTCRR LPPA
Sbjct  507  QTTDCVICMTAVDLTQRSNDYMVTPCDHFFHSGCLQRWMDIKMECPTCRRSLPPA  561



>ref|XP_010928973.1| PREDICTED: transmembrane E3 ubiquitin-protein ligase 1-like isoform 
X2 [Elaeis guineensis]
Length=560

 Score =   213 bits (542),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 92/115 (80%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P NFMRIE D  WCI LG+F+G+QASI  LQHYFGSRWFIPRQILPEKYSYYR+ + D  
Sbjct  446  PSNFMRIEVDTNWCISLGVFLGLQASILLLQHYFGSRWFIPRQILPEKYSYYRRLESDTT  505

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
            Q  DCVICMT +DL+QRSND MVTPCDHFFHSGCLQRWMDIKMECPTCRR LPPA
Sbjct  506  QTTDCVICMTAVDLTQRSNDYMVTPCDHFFHSGCLQRWMDIKMECPTCRRSLPPA  560



>ref|XP_007043624.1| RING/U-box superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX99455.1| RING/U-box superfamily protein isoform 1 [Theobroma cacao]
Length=577

 Score =   213 bits (542),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 94/115 (82%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            PHNFMRIE DK WCICLG+F+G+QAS+  LQHY GSRWFIPRQILPEKYSYYR+FD D  
Sbjct  463  PHNFMRIEPDKSWCICLGVFIGLQASLLLLQHYLGSRWFIPRQILPEKYSYYRRFDPDTN  522

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
               DCVICMT IDL+Q S+DCMVTPCDHFFHSGCLQRWMDIKMECPTCRR LPPA
Sbjct  523  HATDCVICMTAIDLTQHSSDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRSLPPA  577



>gb|KJB31655.1| hypothetical protein B456_005G200400 [Gossypium raimondii]
Length=526

 Score =   212 bits (539),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 95/115 (83%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            PHNFMRIE DK WCICL +F+G+QASI  LQHY GSRWFIPRQILPEKYSYYR+FD +A 
Sbjct  412  PHNFMRIEPDKSWCICLVVFIGLQASILLLQHYLGSRWFIPRQILPEKYSYYRRFDPEAN  471

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
              IDCVICMT+IDL+QRS DCMVTPCDHFFHSGCLQRWMDIKMECPTCRR LP A
Sbjct  472  HAIDCVICMTSIDLTQRSRDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRSLPTA  526



>gb|KJB31656.1| hypothetical protein B456_005G200400 [Gossypium raimondii]
Length=570

 Score =   212 bits (539),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 95/115 (83%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            PHNFMRIE DK WCICL +F+G+QASI  LQHY GSRWFIPRQILPEKYSYYR+FD +A 
Sbjct  456  PHNFMRIEPDKSWCICLVVFIGLQASILLLQHYLGSRWFIPRQILPEKYSYYRRFDPEAN  515

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
              IDCVICMT+IDL+QRS DCMVTPCDHFFHSGCLQRWMDIKMECPTCRR LP A
Sbjct  516  HAIDCVICMTSIDLTQRSRDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRSLPTA  570



>gb|KJB31652.1| hypothetical protein B456_005G200400 [Gossypium raimondii]
Length=577

 Score =   212 bits (539),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 95/115 (83%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            PHNFMRIE DK WCICL +F+G+QASI  LQHY GSRWFIPRQILPEKYSYYR+FD +A 
Sbjct  463  PHNFMRIEPDKSWCICLVVFIGLQASILLLQHYLGSRWFIPRQILPEKYSYYRRFDPEAN  522

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
              IDCVICMT+IDL+QRS DCMVTPCDHFFHSGCLQRWMDIKMECPTCRR LP A
Sbjct  523  HAIDCVICMTSIDLTQRSRDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRSLPTA  577



>ref|XP_011100360.1| PREDICTED: transmembrane E3 ubiquitin-protein ligase 1 [Sesamum 
indicum]
Length=563

 Score =   212 bits (539),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 93/115 (81%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            PHNFMRIE D+ WCICL +F G+QA I  LQHYFG+RWFIPRQILPEKYSYYR+F Q + 
Sbjct  449  PHNFMRIEPDRGWCICLALFTGLQACILLLQHYFGARWFIPRQILPEKYSYYRRFHQGSN  508

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
              IDCVICMT I+L QRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPP+
Sbjct  509  HAIDCVICMTTIELGQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPS  563



>ref|XP_010260250.1| PREDICTED: DSC E3 ubiquitin ligase complex subunit 1 [Nelumbo 
nucifera]
Length=569

 Score =   211 bits (538),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P+NFMRIE DK WCI L +FMG+QASI  LQHY GSR  IPRQILPEKYSYYR+FDQD  
Sbjct  455  PNNFMRIEQDKNWCIFLVVFMGLQASILLLQHYLGSRCLIPRQILPEKYSYYRRFDQDTS  514

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
            Q  DCVICMT IDL+QRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA
Sbjct  515  QATDCVICMTAIDLTQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  569



>ref|XP_003540369.1| PREDICTED: transmembrane E3 ubiquitin-protein ligase 1-like [Glycine 
max]
 gb|KHN27899.1| Transmembrane E3 ubiquitin-protein ligase 1 [Glycine soja]
Length=570

 Score =   211 bits (536),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 92/115 (80%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P+NFMRI+ DK WC+CL +F+G+QA+I  LQHY GSRWFIPR+ILPEKYSYYR+ DQD  
Sbjct  456  PNNFMRIKPDKSWCVCLAVFIGLQAAILLLQHYLGSRWFIPREILPEKYSYYRRVDQDTR  515

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
               DCVICMT IDLS RSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA
Sbjct  516  HATDCVICMTAIDLSPRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  570



>ref|XP_011029040.1| PREDICTED: uncharacterized protein LOC105128890 [Populus euphratica]
Length=573

 Score =   209 bits (533),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 95/115 (83%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P+NFMRIE DK WCICL IF+G+QASI  LQHY GSR FIPRQILPEKY YYR+FD+DA 
Sbjct  459  PYNFMRIEPDKTWCICLSIFIGLQASILLLQHYLGSRCFIPRQILPEKYCYYRRFDKDAN  518

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
               DCVICMT+IDL+ RSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA
Sbjct  519  HATDCVICMTSIDLTHRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  573



>ref|XP_006372722.1| hypothetical protein POPTR_0017s04430g [Populus trichocarpa]
 gb|ERP50519.1| hypothetical protein POPTR_0017s04430g [Populus trichocarpa]
Length=573

 Score =   209 bits (533),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 95/115 (83%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P+NFMRIE DK WCICL IF+G+QASI  LQHY GSR FIPRQILPEKY YYR+FD+DA 
Sbjct  459  PYNFMRIEPDKTWCICLSIFIGLQASILLLQHYLGSRCFIPRQILPEKYCYYRRFDKDAN  518

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
               DCVICMT+IDL+ RSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA
Sbjct  519  HATDCVICMTSIDLTHRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  573



>ref|XP_004303099.1| PREDICTED: transmembrane E3 ubiquitin-protein ligase 1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011466917.1| PREDICTED: transmembrane E3 ubiquitin-protein ligase 1 [Fragaria 
vesca subsp. vesca]
Length=562

 Score =   209 bits (531),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 93/115 (81%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P+NFMRIE DK WCICL +F+G+QASI  LQHY GSRWFIPRQILPEKYSY+R+ DQD  
Sbjct  448  PNNFMRIEPDKSWCICLSLFLGLQASILLLQHYLGSRWFIPRQILPEKYSYHRRPDQDTN  507

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
               DCVICMT IDL+ RS+DCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA
Sbjct  508  HATDCVICMTGIDLTLRSDDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  562



>ref|XP_010238000.1| PREDICTED: uncharacterized protein LOC100834287 isoform X1 [Brachypodium 
distachyon]
Length=574

 Score =   208 bits (530),  Expect = 2e-60, Method: Composition-based stats.
 Identities = 86/115 (75%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P+NFMRIE DKKWCI + +FMGIQA++  LQHY GSR FIPRQILPEKY Y+RK + +  
Sbjct  460  PNNFMRIEPDKKWCIAVTVFMGIQAAVLLLQHYLGSRCFIPRQILPEKYCYHRKVEDNTN  519

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
            QPIDCVICMT IDL+QR+++ MV PC+H FHSGCLQRWMDIKMECPTCRRPLPPA
Sbjct  520  QPIDCVICMTTIDLTQRTSEYMVAPCEHIFHSGCLQRWMDIKMECPTCRRPLPPA  574



>ref|XP_008381598.1| PREDICTED: uncharacterized protein LOC103444446 [Malus domestica]
Length=573

 Score =   208 bits (530),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 92/115 (80%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P+NFMRIE DK WCICLG+F+G+QASI  LQHY GSRWFIPRQILPEKYSYYR+FDQ+  
Sbjct  459  PNNFMRIEPDKSWCICLGVFIGLQASILLLQHYLGSRWFIPRQILPEKYSYYRRFDQNTN  518

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
               DCVICMT +DL+QRS DCMVTPC+H FHSGCLQRWMDIKMECPTCRR LPPA
Sbjct  519  HTTDCVICMTAVDLTQRSTDCMVTPCEHCFHSGCLQRWMDIKMECPTCRRSLPPA  573



>ref|XP_006853553.1| hypothetical protein AMTR_s00032p00236910, partial [Amborella 
trichopoda]
 gb|ERN15020.1| hypothetical protein AMTR_s00032p00236910, partial [Amborella 
trichopoda]
Length=515

 Score =   207 bits (526),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 90/115 (78%), Positives = 101/115 (88%), Gaps = 1/115 (1%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P NFMRIE DK WC+CLG+FMG QA +  LQHY GSRWFIPRQILPEKYSYYR+F+ + +
Sbjct  402  PSNFMRIEVDKNWCMCLGLFMGFQALVLLLQHYLGSRWFIPRQILPEKYSYYRRFENN-I  460

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
              +DCVICMT+ID+ QRSN+CMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPP 
Sbjct  461  NAVDCVICMTSIDVVQRSNECMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPV  515



>ref|XP_002309743.2| hypothetical protein POPTR_0007s00990g [Populus trichocarpa]
 gb|EEE90193.2| hypothetical protein POPTR_0007s00990g [Populus trichocarpa]
Length=572

 Score =   207 bits (528),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 91/115 (79%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P+NFMR E DK WC+ LG+F+G+QASI  LQHY GSRWFIPRQILPEKY YYR+FDQ++ 
Sbjct  458  PNNFMRTEPDKTWCLYLGVFVGLQASILLLQHYLGSRWFIPRQILPEKYFYYRRFDQESN  517

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
               DCVICMT IDL++ SNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA
Sbjct  518  HTTDCVICMTAIDLTRHSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  572



>ref|XP_010656989.1| PREDICTED: DSC E3 ubiquitin ligase complex subunit 1 [Vitis vinifera]
 ref|XP_010656990.1| PREDICTED: DSC E3 ubiquitin ligase complex subunit 1 [Vitis vinifera]
 emb|CBI21873.3| unnamed protein product [Vitis vinifera]
Length=570

 Score =   207 bits (526),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 93/115 (81%), Positives = 100/115 (87%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P+NFMRIE  K WCICLGIFMG+QASI  LQHY GSR FIPRQILPEKYSYYR+ +QD  
Sbjct  456  PNNFMRIEPSKSWCICLGIFMGLQASILLLQHYLGSRCFIPRQILPEKYSYYRRSNQDTN  515

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
               DCVICMT ID++ RSN+CMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA
Sbjct  516  HVTDCVICMTTIDITHRSNECMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  570



>ref|XP_004171171.1| PREDICTED: transmembrane E3 ubiquitin-protein ligase 1-like [Cucumis 
sativus]
Length=276

 Score =   199 bits (506),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 98/115 (85%), Gaps = 1/115 (1%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            PHNFMRI+ DK WCICLG+F  +Q +I  LQHYFGSRWFIPRQ+LPEKYSYYR+ DQ+  
Sbjct  163  PHNFMRIQPDKTWCICLGVFTFLQVAILLLQHYFGSRWFIPRQVLPEKYSYYRRIDQNGN  222

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
               DCVICMT ID+S R NDCM+TPCDHFFHSGCLQRWMDIKMECPTCRR LPPA
Sbjct  223  HATDCVICMTTIDIS-RPNDCMITPCDHFFHSGCLQRWMDIKMECPTCRRLLPPA  276



>ref|XP_006285362.1| hypothetical protein CARUB_v10006753mg [Capsella rubella]
 gb|EOA18260.1| hypothetical protein CARUB_v10006753mg [Capsella rubella]
Length=564

 Score =   206 bits (525),  Expect = 7e-60, Method: Composition-based stats.
 Identities = 84/115 (73%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            PHNFMR+E +K WC+CL  FMG+QA+I  LQHYFGSR F+PRQ+LPEKY+Y+R+F++D  
Sbjct  450  PHNFMRVEPNKFWCVCLCTFMGLQAAILLLQHYFGSRCFVPRQMLPEKYNYHRRFNRDVN  509

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
               DCVICMT IDL Q ++DCMVTPC+HFFHSGCLQRWMDIKMECPTCRR LPPA
Sbjct  510  HNTDCVICMTAIDLRQHTSDCMVTPCEHFFHSGCLQRWMDIKMECPTCRRSLPPA  564



>ref|XP_009336232.1| PREDICTED: uncharacterized protein LOC103928854 isoform X2 [Pyrus 
x bretschneideri]
Length=573

 Score =   204 bits (520),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 92/115 (80%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P+NFMRIE DK WCICLG+F+G+QASI  LQHY GSRWFIPRQILPEKYSY R+ DQ+  
Sbjct  459  PNNFMRIEPDKSWCICLGVFIGLQASILLLQHYLGSRWFIPRQILPEKYSYCRRLDQNTN  518

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
            +  DCVICMT +DL+QRSND MVTPCDH FHSGCLQRWMDIKMECPTCRRPLPPA
Sbjct  519  RTTDCVICMTAVDLTQRSNDRMVTPCDHCFHSGCLQRWMDIKMECPTCRRPLPPA  573



>ref|XP_009336231.1| PREDICTED: uncharacterized protein LOC103928854 isoform X1 [Pyrus 
x bretschneideri]
Length=587

 Score =   205 bits (521),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 92/115 (80%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P+NFMRIE DK WCICLG+F+G+QASI  LQHY GSRWFIPRQILPEKYSY R+ DQ+  
Sbjct  473  PNNFMRIEPDKSWCICLGVFIGLQASILLLQHYLGSRWFIPRQILPEKYSYCRRLDQNTN  532

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
            +  DCVICMT +DL+QRSND MVTPCDH FHSGCLQRWMDIKMECPTCRRPLPPA
Sbjct  533  RTTDCVICMTAVDLTQRSNDRMVTPCDHCFHSGCLQRWMDIKMECPTCRRPLPPA  587



>ref|XP_008368649.1| PREDICTED: DSC E3 ubiquitin ligase complex subunit 1-like [Malus 
domestica]
Length=573

 Score =   204 bits (519),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 91/115 (79%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P+NFMRIE DK WCICLG+F+G+QASI  LQHY GSRWFIPRQILPEKYSY R+ DQ+  
Sbjct  459  PNNFMRIEPDKSWCICLGVFIGLQASILLLQHYLGSRWFIPRQILPEKYSYCRRLDQNTN  518

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
            +  DCVICMT +DL+QRSND MVTPCDH FHSGCLQRWMD+KMECPTCRRPLPPA
Sbjct  519  RTTDCVICMTAVDLTQRSNDRMVTPCDHCFHSGCLQRWMDVKMECPTCRRPLPPA  573



>ref|XP_003527424.1| PREDICTED: transmembrane E3 ubiquitin-protein ligase 1-like [Glycine 
max]
Length=575

 Score =   204 bits (518),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 90/115 (78%), Positives = 98/115 (85%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P NF+RIE D+ WC+CL IF+G+QA+I  LQHYFGS WFIPRQ LPEKY YYR+F QD  
Sbjct  461  PDNFLRIEPDQSWCVCLAIFVGLQAAILLLQHYFGSLWFIPRQFLPEKYCYYRRFAQDTN  520

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
               DCVICMT ID+S RSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA
Sbjct  521  HATDCVICMTAIDISPRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  575



>ref|XP_004957788.1| PREDICTED: DSC E3 ubiquitin ligase complex subunit 1-like isoform 
X4 [Setaria italica]
Length=572

 Score =   203 bits (517),  Expect = 1e-58, Method: Composition-based stats.
 Identities = 85/115 (74%), Positives = 96/115 (83%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P NFMRIE DKKWCI + +FMGIQA++  LQHY GSR FIPRQILPEKY Y+RK +    
Sbjct  458  PSNFMRIEPDKKWCIVVTVFMGIQAAVLLLQHYLGSRCFIPRQILPEKYCYHRKVEDSTN  517

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
            QPIDCVICMT IDL+QR+++ MV PC+H FHSGCLQRWMDIKMECPTCRR LPPA
Sbjct  518  QPIDCVICMTTIDLTQRTSEYMVAPCEHIFHSGCLQRWMDIKMECPTCRRSLPPA  572



>ref|XP_004957785.1| PREDICTED: DSC E3 ubiquitin ligase complex subunit 1-like isoform 
X1 [Setaria italica]
 ref|XP_004957786.1| PREDICTED: DSC E3 ubiquitin ligase complex subunit 1-like isoform 
X2 [Setaria italica]
 ref|XP_004957787.1| PREDICTED: DSC E3 ubiquitin ligase complex subunit 1-like isoform 
X3 [Setaria italica]
Length=607

 Score =   203 bits (517),  Expect = 2e-58, Method: Composition-based stats.
 Identities = 85/115 (74%), Positives = 96/115 (83%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P NFMRIE DKKWCI + +FMGIQA++  LQHY GSR FIPRQILPEKY Y+RK +    
Sbjct  493  PSNFMRIEPDKKWCIVVTVFMGIQAAVLLLQHYLGSRCFIPRQILPEKYCYHRKVEDSTN  552

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
            QPIDCVICMT IDL+QR+++ MV PC+H FHSGCLQRWMDIKMECPTCRR LPPA
Sbjct  553  QPIDCVICMTTIDLTQRTSEYMVAPCEHIFHSGCLQRWMDIKMECPTCRRSLPPA  607



>ref|XP_004149272.1| PREDICTED: DSC E3 ubiquitin ligase complex subunit 1-like [Cucumis 
sativus]
 gb|KGN46976.1| hypothetical protein Csa_6G155550 [Cucumis sativus]
Length=570

 Score =   201 bits (511),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 98/115 (85%), Gaps = 1/115 (1%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            PHNFMRI+ DK WCICLG+F  +Q +I  LQHYFGSRWFIPRQ+LPEKYSYYR+ DQ+  
Sbjct  457  PHNFMRIQPDKTWCICLGVFTFLQVAILLLQHYFGSRWFIPRQVLPEKYSYYRRIDQNGN  516

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
               DCVICMT ID+S R NDCM+TPCDHFFHSGCLQRWMDIKMECPTCRR LPPA
Sbjct  517  HATDCVICMTTIDIS-RPNDCMITPCDHFFHSGCLQRWMDIKMECPTCRRLLPPA  570



>ref|XP_008448263.1| PREDICTED: transmembrane E3 ubiquitin-protein ligase 1-like isoform 
X2 [Cucumis melo]
Length=570

 Score =   201 bits (510),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 98/115 (85%), Gaps = 1/115 (1%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            PHNFMRI+ DK WCICLG+F  +Q +I  LQHYFGSRWFIPRQ+LPEKYSYYR+ DQ+  
Sbjct  457  PHNFMRIQPDKTWCICLGVFTFLQVAILLLQHYFGSRWFIPRQVLPEKYSYYRRIDQNGN  516

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
               DCVICMT ID+S R NDCM+TPCDHFFHSGCLQRWMDIKMECPTCRR LPPA
Sbjct  517  HATDCVICMTTIDVS-RPNDCMITPCDHFFHSGCLQRWMDIKMECPTCRRLLPPA  570



>dbj|BAF01437.1| hypothetical protein [Arabidopsis thaliana]
Length=194

 Score =   191 bits (484),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            PHNFMR+E +K WCICL  FMG+QA I  LQHYFGSR F+PRQ+LPEKY+Y+R+F++D  
Sbjct  80   PHNFMRVEPNKVWCICLCTFMGLQAVILLLQHYFGSRCFVPRQMLPEKYNYHRRFNRDVS  139

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
            +  DCVICMT IDL Q ++DCMVTPC+HFFHSGCLQRWMDIKMECPTCRR LPPA
Sbjct  140  RTTDCVICMTAIDLRQHTSDCMVTPCEHFFHSGCLQRWMDIKMECPTCRRSLPPA  194



>ref|XP_003539936.1| PREDICTED: transmembrane E3 ubiquitin-protein ligase 1-like [Glycine 
max]
Length=575

 Score =   201 bits (510),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 97/115 (84%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P+NF+ IE D+ WC+CL IF+G+QA+I  LQHYFGS WFIPRQ LPEKY YYR+F QD  
Sbjct  461  PNNFLHIEPDQSWCVCLAIFVGLQAAILLLQHYFGSLWFIPRQFLPEKYCYYRRFAQDTN  520

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
               DCVICMT IDLS RSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCR PLPPA
Sbjct  521  HATDCVICMTAIDLSPRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRGPLPPA  575



>ref|XP_008448262.1| PREDICTED: transmembrane E3 ubiquitin-protein ligase 1-like isoform 
X1 [Cucumis melo]
Length=579

 Score =   201 bits (510),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 98/115 (85%), Gaps = 1/115 (1%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            PHNFMRI+ DK WCICLG+F  +Q +I  LQHYFGSRWFIPRQ+LPEKYSYYR+ DQ+  
Sbjct  466  PHNFMRIQPDKTWCICLGVFTFLQVAILLLQHYFGSRWFIPRQVLPEKYSYYRRIDQNGN  525

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
               DCVICMT ID+S R NDCM+TPCDHFFHSGCLQRWMDIKMECPTCRR LPPA
Sbjct  526  HATDCVICMTTIDVS-RPNDCMITPCDHFFHSGCLQRWMDIKMECPTCRRLLPPA  579



>gb|KEH30698.1| RING/U-box protein [Medicago truncatula]
Length=578

 Score =   200 bits (509),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 97/115 (84%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P+NF+RIE D+ WC+CL +F G QA++  LQHY GSRWFIP QILPEKYSYYR+  QD  
Sbjct  464  PNNFLRIEPDQSWCVCLVLFTGFQATVLLLQHYLGSRWFIPHQILPEKYSYYRRSSQDTN  523

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
               DCVICMT IDL+ RSNDCMVTPCDHFFH+GCLQRWMDIKMECPTCRRPLPPA
Sbjct  524  HATDCVICMTAIDLTPRSNDCMVTPCDHFFHTGCLQRWMDIKMECPTCRRPLPPA  578



>ref|XP_008775556.1| PREDICTED: transmembrane E3 ubiquitin-protein ligase 1-like [Phoenix 
dactylifera]
Length=564

 Score =   200 bits (508),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 96/115 (83%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P NFMRIE D  WCI LG+F+G+QASI  LQHY GSRWFIP QILPEKYSYYR+ + D  
Sbjct  450  PSNFMRIEVDTNWCISLGVFLGLQASILLLQHYLGSRWFIPHQILPEKYSYYRRLESDVT  509

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
            +  DCVICMT IDL+QRS+D MVTPCDH FHSGCLQRWMDIKMECPTCRR LPPA
Sbjct  510  RNTDCVICMTAIDLTQRSDDHMVTPCDHCFHSGCLQRWMDIKMECPTCRRSLPPA  564



>ref|XP_010689035.1| PREDICTED: transmembrane E3 ubiquitin-protein ligase 1 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010689036.1| PREDICTED: transmembrane E3 ubiquitin-protein ligase 1 [Beta 
vulgaris subsp. vulgaris]
Length=581

 Score =   200 bits (509),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 90/115 (78%), Positives = 100/115 (87%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P+NFMRI  DK WCICL  FMG+Q+ +  LQHY GSR FIPRQILPEKYSYYR+F+QD  
Sbjct  467  PNNFMRIGPDKIWCICLSSFMGLQSLVLLLQHYLGSRCFIPRQILPEKYSYYRRFNQDGN  526

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
            +  DCVICMT+IDLS+RS+DCMVTPCDHFFHSGCLQRWMDIKMECPTCRR LPPA
Sbjct  527  RTTDCVICMTSIDLSERSSDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRSLPPA  581



>gb|EYU28208.1| hypothetical protein MIMGU_mgv1a003930mg [Erythranthe guttata]
Length=554

 Score =   199 bits (507),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 90/115 (78%), Positives = 98/115 (85%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            PHNFMRIE D+ WCICL IFMG+QA I  LQHYFGSR FIPRQ+LP+KYSYYR+F Q + 
Sbjct  440  PHNFMRIEADRNWCICLAIFMGLQALILILQHYFGSRCFIPRQVLPDKYSYYRRFHQGSN  499

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
              IDCVICMT IDL  RSNDCMVTPC+HFFH+ CLQRWMDIKMECPTCRR LPPA
Sbjct  500  NGIDCVICMTPIDLGPRSNDCMVTPCEHFFHNSCLQRWMDIKMECPTCRRALPPA  554



>ref|XP_002869508.1| zinc ion binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45767.1| zinc ion binding protein [Arabidopsis lyrata subsp. lyrata]
Length=561

 Score =   199 bits (505),  Expect = 7e-57, Method: Composition-based stats.
 Identities = 82/115 (71%), Positives = 97/115 (84%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            PHNFMR+E +K WCICL   MG+QA I  LQHYFGSR F+PRQ+LPEKY+Y+R+F++D  
Sbjct  447  PHNFMRVEPNKVWCICLCTSMGLQAVILLLQHYFGSRCFVPRQMLPEKYNYHRRFNRDVS  506

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
            +  DCVICMT IDL Q ++D M+TPC+HFFHSGCLQRWMDIKMECPTCRR LPPA
Sbjct  507  RNTDCVICMTAIDLRQHTSDFMITPCEHFFHSGCLQRWMDIKMECPTCRRSLPPA  561



>ref|XP_004505562.1| PREDICTED: transmembrane E3 ubiquitin-protein ligase 1-like isoform 
X1 [Cicer arietinum]
Length=578

 Score =   198 bits (504),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 97/115 (84%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P+NF+RIE D+ WC+CL +F+G QA I  LQHY GSRWFIP QILPEKYSYYR+  QD  
Sbjct  464  PNNFLRIEPDQSWCVCLVLFIGFQAVILLLQHYLGSRWFIPHQILPEKYSYYRRSSQDIN  523

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
               DCVICMT ID++ RSNDCMVTPCDHFFH+GCLQRWMDIKMECPTCRRPLPPA
Sbjct  524  HATDCVICMTAIDITPRSNDCMVTPCDHFFHTGCLQRWMDIKMECPTCRRPLPPA  578



>ref|XP_006412963.1| hypothetical protein EUTSA_v10024798mg [Eutrema salsugineum]
 ref|XP_006412964.1| hypothetical protein EUTSA_v10024798mg [Eutrema salsugineum]
 gb|ESQ54416.1| hypothetical protein EUTSA_v10024798mg [Eutrema salsugineum]
 gb|ESQ54417.1| hypothetical protein EUTSA_v10024798mg [Eutrema salsugineum]
Length=564

 Score =   197 bits (500),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            PHNFMR+E  K WCICL  F+G+QA I  LQHYFGSR F+PRQ+LPEKY+Y+R+F+QD  
Sbjct  450  PHNFMRVEPSKVWCICLCTFLGLQAVILLLQHYFGSRCFVPRQMLPEKYNYHRRFNQDVS  509

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
            +  DCVICMT IDL QR++DCMVTPC+HFFHSGCLQRWMDIKMECPTCRR LPPA
Sbjct  510  RTTDCVICMTAIDLRQRTSDCMVTPCEHFFHSGCLQRWMDIKMECPTCRRSLPPA  564



>ref|XP_010238002.1| PREDICTED: transmembrane E3 ubiquitin-protein ligase 1-like isoform 
X2 [Brachypodium distachyon]
Length=568

 Score =   196 bits (499),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P+NFMRIE DKKWCI + +FMGIQA++  LQHY GSR FIPRQILPEKY Y+RK + +  
Sbjct  454  PNNFMRIEPDKKWCIAVTVFMGIQAAVLLLQHYLGSRCFIPRQILPEKYCYHRKVEDNTN  513

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
            QPIDCVICMT IDL+QR+++ MV PC+H FHSGCLQRWMDIKMECPTCRRPLPPA
Sbjct  514  QPIDCVICMTTIDLTQRTSEYMVAPCEHIFHSGCLQRWMDIKMECPTCRRPLPPA  568



>ref|XP_010438470.1| PREDICTED: transmembrane E3 ubiquitin-protein ligase 1-like isoform 
X1 [Camelina sativa]
Length=563

 Score =   195 bits (496),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 100/115 (87%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            PHNFMR++ +K WC+CL IFMG+QA +  LQHYFGSR F+PRQ+LPEKY+Y+R+F++D  
Sbjct  449  PHNFMRVDPNKFWCVCLCIFMGLQAVVLLLQHYFGSRCFVPRQMLPEKYNYHRRFNRDVS  508

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
            +  DCVICMT IDL Q +NDCMVTPC+HFFHSGCLQRWMDIKMECPTCRR LPPA
Sbjct  509  RNTDCVICMTAIDLRQHTNDCMVTPCEHFFHSGCLQRWMDIKMECPTCRRSLPPA  563



>ref|NP_001059722.1| Os07g0501900 [Oryza sativa Japonica Group]
 dbj|BAF21636.1| Os07g0501900 [Oryza sativa Japonica Group]
Length=278

 Score =   188 bits (478),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 96/115 (83%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P NFMRIE DK WCI + IFMGIQA++  LQHYFGSR FIP QILPEKY Y+RK + +  
Sbjct  164  PSNFMRIEPDKTWCIAVTIFMGIQAAVLLLQHYFGSRCFIPHQILPEKYCYHRKVEDNTN  223

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
            QPIDCVICMT IDL+QR+++ MV PC+H FHSGCLQRWMDIKMECPTCRR LPPA
Sbjct  224  QPIDCVICMTTIDLTQRTSEYMVAPCEHIFHSGCLQRWMDIKMECPTCRRSLPPA  278



>ref|XP_010438471.1| PREDICTED: transmembrane E3 ubiquitin-protein ligase 1-like isoform 
X2 [Camelina sativa]
Length=563

 Score =   195 bits (496),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 100/115 (87%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            PHNFMR++ +K WC+CL IFMG+QA +  LQHYFGSR F+PRQ+LPEKY+Y+R+F++D  
Sbjct  449  PHNFMRVDPNKFWCVCLCIFMGLQAVVLLLQHYFGSRCFVPRQMLPEKYNYHRRFNRDVS  508

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
            +  DCVICMT IDL Q +NDCMVTPC+HFFHSGCLQRWMDIKMECPTCRR LPPA
Sbjct  509  RNTDCVICMTAIDLRQHTNDCMVTPCEHFFHSGCLQRWMDIKMECPTCRRSLPPA  563



>ref|XP_008664387.1| PREDICTED: transmembrane E3 ubiquitin-protein ligase 1-like, 
partial [Zea mays]
Length=188

 Score =   185 bits (469),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 95/115 (83%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P NFMRIE DKKW I + +FMGIQA++  LQHY GSR FIPRQILPEKY Y+RK +    
Sbjct  74   PSNFMRIEPDKKWSIAVTVFMGIQAAVLLLQHYLGSRCFIPRQILPEKYCYHRKVEDSTN  133

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
            QPIDCVICMT IDL+QR+++ MV PC+H FHSGCLQRWMDIKMECPTCRR LPPA
Sbjct  134  QPIDCVICMTTIDLTQRTSEYMVAPCEHIFHSGCLQRWMDIKMECPTCRRSLPPA  188



>ref|NP_194566.3| E3 ubiquitin ligase FLY1 [Arabidopsis thaliana]
 gb|AAV84495.1| At4g28370 [Arabidopsis thaliana]
 gb|AEE85475.1| RING/U-box domain-containing protein [Arabidopsis thaliana]
Length=562

 Score =   194 bits (493),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            PHNFMR+E +K WCICL  FMG+QA I  LQHYFGSR F+PRQ+LPEKY+Y+R+F++D  
Sbjct  448  PHNFMRVEPNKVWCICLCTFMGLQAVILLLQHYFGSRCFVPRQMLPEKYNYHRRFNRDVS  507

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
            +  DCVICMT IDL Q ++DCMVTPC+HFFHSGCLQRWMDIKMECPTCRR LPPA
Sbjct  508  RTTDCVICMTAIDLRQHTSDCMVTPCEHFFHSGCLQRWMDIKMECPTCRRSLPPA  562



>ref|XP_006658589.1| PREDICTED: transmembrane E3 ubiquitin-protein ligase 1-like [Oryza 
brachyantha]
Length=537

 Score =   193 bits (491),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P+NFMRIE DKKWCI + IFMGIQA++  LQHYFGSR FIP QILPEKY Y+RK + ++ 
Sbjct  423  PNNFMRIEPDKKWCIAVTIFMGIQAAVLLLQHYFGSRCFIPHQILPEKYCYHRKVEDNSN  482

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
            QP+DCVICMT IDL+QR+++ MV PC+H FHSGCLQRWMDIKMECPTCRR LPPA
Sbjct  483  QPVDCVICMTTIDLTQRTSEYMVAPCEHIFHSGCLQRWMDIKMECPTCRRSLPPA  537



>ref|XP_009408647.1| PREDICTED: transmembrane E3 ubiquitin-protein ligase 1-like [Musa 
acuminata subsp. malaccensis]
Length=569

 Score =   193 bits (490),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 96/117 (82%), Gaps = 2/117 (2%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P NF+RI+ D+ WCI LG+FMG+QA I  LQ++ GSRWFIPRQILPEKY YYRK + D  
Sbjct  453  PSNFLRIQVDRSWCIFLGLFMGLQALILLLQYFLGSRWFIPRQILPEKYCYYRKLENDTN  512

Query  366  QPIDCVICMTNIDL--SQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
            Q  DCVICMT IDL   QRSND MVTPCDHFFH+GCLQRWMDIKMECPTCRR LPPA
Sbjct  513  QIADCVICMTGIDLLTQQRSNDYMVTPCDHFFHTGCLQRWMDIKMECPTCRRSLPPA  569



>gb|EMT26573.1| Transmembrane E3 ubiquitin-protein ligase 1 [Aegilops tauschii]
Length=415

 Score =   189 bits (481),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 95/115 (83%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P NFMRIE DKKWCI +  FMGIQA++  LQHY GSR FIPRQILPEKY Y+RK +    
Sbjct  301  PSNFMRIEPDKKWCIAVTAFMGIQAAVLLLQHYLGSRCFIPRQILPEKYCYHRKVEDSTN  360

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
            QPIDCVICMT IDLSQR+++ MV PC+H FHSGCLQRWMDIKMECPTCRR LPPA
Sbjct  361  QPIDCVICMTTIDLSQRTSEYMVAPCEHIFHSGCLQRWMDIKMECPTCRRSLPPA  415



>gb|EEC82105.1| hypothetical protein OsI_26121 [Oryza sativa Indica Group]
Length=549

 Score =   191 bits (485),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 96/115 (83%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P NFMRIE DK WCI + IFMGIQA++  LQHYFGSR FIP QILPEKY Y+RK + +  
Sbjct  435  PSNFMRIEPDKTWCIAVTIFMGIQAAVLLLQHYFGSRCFIPHQILPEKYCYHRKVEDNTN  494

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
            QPIDCVICMT IDL+QR+++ MV PC+H FHSGCLQRWMDIKMECPTCRR LPPA
Sbjct  495  QPIDCVICMTTIDLTQRTSEYMVAPCEHIFHSGCLQRWMDIKMECPTCRRSLPPA  549



>gb|EEE67227.1| hypothetical protein OsJ_24360 [Oryza sativa Japonica Group]
Length=560

 Score =   191 bits (485),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 96/115 (83%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P NFMRIE DK WCI + IFMGIQA++  LQHYFGSR FIP QILPEKY Y+RK + +  
Sbjct  446  PSNFMRIEPDKTWCIAVTIFMGIQAAVLLLQHYFGSRCFIPHQILPEKYCYHRKVEDNTN  505

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
            QPIDCVICMT IDL+QR+++ MV PC+H FHSGCLQRWMDIKMECPTCRR LPPA
Sbjct  506  QPIDCVICMTTIDLTQRTSEYMVAPCEHIFHSGCLQRWMDIKMECPTCRRSLPPA  560



>dbj|BAK00633.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=565

 Score =   190 bits (483),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 95/115 (83%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P NFMRIE DKKWCI +  FMGIQA++  LQHY GSR FIP QILPEKY Y+RK + +  
Sbjct  451  PSNFMRIEPDKKWCIAVTTFMGIQAAVLLLQHYLGSRCFIPHQILPEKYCYHRKVEDNTN  510

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
            QPIDCVICMT IDLSQR+++ MV PC+H FHSGCLQRWMDIKMECPTCRR LPPA
Sbjct  511  QPIDCVICMTTIDLSQRASEYMVAPCEHIFHSGCLQRWMDIKMECPTCRRSLPPA  565



>ref|XP_010451148.1| PREDICTED: uncharacterized protein LOC104733253 [Camelina sativa]
Length=704

 Score =   192 bits (487),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            PHNFMR+E +K WC+CL IFMG+QA +  LQHYFGSR F+PRQ+LPEKY+Y+R+ ++D  
Sbjct  590  PHNFMRVEPNKFWCVCLCIFMGLQAVVLLLQHYFGSRCFVPRQMLPEKYNYHRRINRDVS  649

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
            +  DCVICMT IDL Q ++DCMVTPC+HFFHSGCLQRWMDIKMECPTCRR LPPA
Sbjct  650  RNTDCVICMTAIDLRQHTSDCMVTPCEHFFHSGCLQRWMDIKMECPTCRRSLPPA  704



>ref|XP_006297349.1| hypothetical protein CARUB_v10013368mg [Capsella rubella]
 gb|EOA30247.1| hypothetical protein CARUB_v10013368mg [Capsella rubella]
Length=560

 Score =   190 bits (482),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 94/115 (82%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P NFMR+E  K WCI L  F+G QA++  LQHYFGSR F+PR++LPEKYSYYR+FD D  
Sbjct  446  PKNFMRVEPSKAWCIGLCAFVGFQAAVLLLQHYFGSRCFVPRKMLPEKYSYYRRFDHDVN  505

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
            +  DCVICMT IDL  R NDCMVTPC+H FHSGCLQRWMDIKMECPTCRRPLPPA
Sbjct  506  RSRDCVICMTTIDLRHRVNDCMVTPCEHMFHSGCLQRWMDIKMECPTCRRPLPPA  560



>ref|XP_010526511.1| PREDICTED: transmembrane E3 ubiquitin-protein ligase 1 [Tarenaya 
hassleriana]
Length=571

 Score =   189 bits (481),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 97/115 (84%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P NFMR+E    WC+CL +FM  QAS+  LQHYFGSR F+PRQ+LPEKYSYYR+ D+D  
Sbjct  457  PKNFMRVEPSNFWCVCLCLFMWFQASVLLLQHYFGSRCFVPRQMLPEKYSYYRRLDKDVN  516

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
            +  DCVICMT I+L+ RS+DCMVTPC+HFFH+GCLQRWMDIKMECPTCRRPLPPA
Sbjct  517  RTSDCVICMTAIELTHRSSDCMVTPCEHFFHTGCLQRWMDIKMECPTCRRPLPPA  571



>emb|CDX97438.1| BnaC08g13030D [Brassica napus]
Length=565

 Score =   189 bits (480),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 97/115 (84%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            PHNFMR+   K WC+CL  FMG+QA I  LQHYFGSR F+PRQ+LPEKY+Y+R+F+QD  
Sbjct  451  PHNFMRVVPSKAWCVCLCTFMGLQAVILLLQHYFGSRCFVPRQMLPEKYNYHRRFNQDVS  510

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
            +  DCVICMT I+L QR++D MVTPC+HFFH+GCLQRWMDIKMECPTCRR LPPA
Sbjct  511  RNTDCVICMTAINLRQRTSDFMVTPCEHFFHTGCLQRWMDIKMECPTCRRSLPPA  565



>ref|XP_009392841.1| PREDICTED: transmembrane E3 ubiquitin-protein ligase 1-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009392846.1| PREDICTED: transmembrane E3 ubiquitin-protein ligase 1-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009392855.1| PREDICTED: transmembrane E3 ubiquitin-protein ligase 1-like [Musa 
acuminata subsp. malaccensis]
Length=561

 Score =   189 bits (479),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 95/115 (83%), Gaps = 1/115 (1%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P NF+RIE D+ WCI LG+FMG+QAS+  LQHY GSR FIPRQILPEKY YYRKF ++A 
Sbjct  448  PSNFLRIEVDEYWCIYLGVFMGLQASVLLLQHYLGSRCFIPRQILPEKYCYYRKF-ENAS  506

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
            Q  DCVICMT ID +Q SN  MVTPCDH FHSGCLQRWMDIKMECPTCRR LPPA
Sbjct  507  QETDCVICMTAIDFTQHSNGYMVTPCDHCFHSGCLQRWMDIKMECPTCRRSLPPA  561



>gb|EMS65730.1| Transmembrane E3 ubiquitin-protein ligase 1 [Triticum urartu]
Length=540

 Score =   188 bits (477),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 94/115 (82%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P NFMRIE DKKWCI +  FM IQA++  LQHY GSR FIPRQILPEKY Y+RK +    
Sbjct  426  PSNFMRIEPDKKWCIAVTTFMSIQAAVLLLQHYLGSRCFIPRQILPEKYCYHRKVEDSTN  485

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
            QPIDCVICMT IDLSQR+++ MV PC+H FHSGCLQRWMDIKMECPTCRR LPPA
Sbjct  486  QPIDCVICMTTIDLSQRTSEYMVAPCEHIFHSGCLQRWMDIKMECPTCRRSLPPA  540


 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQ  418
            P NFMRIE DKKWCI +  FM IQA++  LQHY GSR FIPRQ
Sbjct  357  PSNFMRIEPDKKWCIAVTTFMSIQAAVLLLQHYLGSRCFIPRQ  399



>gb|AAM15208.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAD21704.2| hypothetical protein [Arabidopsis thaliana]
Length=515

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 92/115 (80%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P NFMR+E  K WC+ L  FMG QA +  LQHYFGSR F+PR++LPEKYSYYR+ D +  
Sbjct  401  PKNFMRVEPSKAWCVSLCAFMGFQAGVLLLQHYFGSRCFVPRKLLPEKYSYYRRLDHNVN  460

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
            +  DCVICMT IDL  R NDCMVTPC+H FHSGCLQRWMDIKMECPTCRRPLPPA
Sbjct  461  RSRDCVICMTTIDLRHRINDCMVTPCEHIFHSGCLQRWMDIKMECPTCRRPLPPA  515



>emb|CDY14243.1| BnaA08g13740D [Brassica napus]
Length=565

 Score =   187 bits (476),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 96/115 (83%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            PHNFMRI   K WC+CL  FMG+QA I  LQHYFGSR F+PRQ+LPEKY+Y+R+F+QD  
Sbjct  451  PHNFMRIVPSKAWCVCLCTFMGLQAVILLLQHYFGSRCFVPRQMLPEKYNYHRRFNQDVS  510

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
            +  DCVICMT I+L QR++D MVTPC+H FH+GCLQRWMDIKMECPTCRR LPPA
Sbjct  511  RNTDCVICMTAINLRQRTSDFMVTPCEHLFHTGCLQRWMDIKMECPTCRRSLPPA  565



>ref|NP_179657.2| putative RING E3 ubiquitin ligase [Arabidopsis thaliana]
 ref|NP_973491.1| putative RING E3 ubiquitin ligase [Arabidopsis thaliana]
 gb|AAY34176.1| At2g20650 [Arabidopsis thaliana]
 gb|AEC07052.1| putative RING E3 ubiquitin ligase [Arabidopsis thaliana]
 gb|AEC07053.1| putative RING E3 ubiquitin ligase [Arabidopsis thaliana]
Length=559

 Score =   187 bits (475),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 92/115 (80%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P NFMR+E  K WC+ L  FMG QA +  LQHYFGSR F+PR++LPEKYSYYR+ D +  
Sbjct  445  PKNFMRVEPSKAWCVSLCAFMGFQAGVLLLQHYFGSRCFVPRKLLPEKYSYYRRLDHNVN  504

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
            +  DCVICMT IDL  R NDCMVTPC+H FHSGCLQRWMDIKMECPTCRRPLPPA
Sbjct  505  RSRDCVICMTTIDLRHRINDCMVTPCEHIFHSGCLQRWMDIKMECPTCRRPLPPA  559



>ref|XP_002886295.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62554.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=559

 Score =   187 bits (475),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 93/115 (81%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P NFMR+E  K WC+ L  FMG QA++  LQHYFGSR F+PR++LPEKYSYYR+ D +  
Sbjct  445  PKNFMRVEPSKAWCVSLCAFMGFQAAVLLLQHYFGSRCFVPRKMLPEKYSYYRRLDHNVN  504

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
            +  DCVICMT IDL  R NDCMVTPC+H FHSGCLQRWMDIKMECPTCRRPLPPA
Sbjct  505  RSRDCVICMTTIDLRHRINDCMVTPCEHIFHSGCLQRWMDIKMECPTCRRPLPPA  559



>ref|XP_006408999.1| hypothetical protein EUTSA_v10002192mg, partial [Eutrema salsugineum]
 gb|ESQ50452.1| hypothetical protein EUTSA_v10002192mg, partial [Eutrema salsugineum]
Length=552

 Score =   187 bits (474),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 93/115 (81%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P NFMR+E  K WCI L  F+G QA++  LQHYFGSR F+PR++LPEKYSYYR+FD D  
Sbjct  438  PKNFMRVEPSKAWCIGLCTFIGFQAAVLLLQHYFGSRCFVPRKMLPEKYSYYRRFDHDVN  497

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
            +  DCVICMT IDL  R+NDCM TPC+H FHSGCLQRWMDIKMECPTCRR LPPA
Sbjct  498  RSRDCVICMTTIDLRHRNNDCMATPCEHLFHSGCLQRWMDIKMECPTCRRTLPPA  552



>ref|XP_009109096.1| PREDICTED: transmembrane E3 ubiquitin-protein ligase 1 [Brassica 
rapa]
Length=565

 Score =   186 bits (472),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 96/115 (83%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            PHNFMRI   K WC+ L  FMG+QA I  LQHYFGSR F+PRQ+LPEKY+Y+R+F+QD  
Sbjct  451  PHNFMRIVPSKAWCVFLCTFMGLQAVILLLQHYFGSRCFVPRQMLPEKYNYHRRFNQDVS  510

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
            +  DCVICMT I+L QR++D MVTPC+HFFH+GCLQRWMDIKMECPTCRR LPPA
Sbjct  511  RNTDCVICMTAINLRQRTSDFMVTPCEHFFHTGCLQRWMDIKMECPTCRRSLPPA  565



>ref|XP_010467785.1| PREDICTED: transmembrane E3 ubiquitin-protein ligase 1 [Camelina 
sativa]
Length=558

 Score =   185 bits (470),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 93/115 (81%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P NFMR+   K WC+ L  F+G QA++  LQHYFGSR F+PR++LPEKYSYYR+FD D  
Sbjct  444  PKNFMRVGPSKAWCVGLCAFVGSQAALLLLQHYFGSRCFVPRKMLPEKYSYYRRFDHDVN  503

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
            +  DCVICM  IDL QR NDCMVTPC+H FHSGCLQRWMDIKMECPTCRRPLPPA
Sbjct  504  RSRDCVICMATIDLRQRINDCMVTPCEHIFHSGCLQRWMDIKMECPTCRRPLPPA  558



>emb|CDY61644.1| BnaAnng17640D [Brassica napus]
Length=556

 Score =   185 bits (470),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 93/115 (81%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P NFMR+E  K WCI L  F+G QA++  LQHYFGSR F+PR++LPEKY+YYR+ D D  
Sbjct  442  PKNFMRVEASKAWCIGLCAFIGFQAAVLLLQHYFGSRCFVPRKMLPEKYNYYRRLDHDVN  501

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
            +  DCVICM  IDL +R+NDCMVTPC+H FHSGCLQRWMDIKMECPTCRR LPPA
Sbjct  502  RSRDCVICMATIDLRRRTNDCMVTPCEHLFHSGCLQRWMDIKMECPTCRRTLPPA  556



>ref|XP_004487270.1| PREDICTED: transmembrane E3 ubiquitin-protein ligase 1-like isoform 
X2 [Cicer arietinum]
Length=569

 Score =   185 bits (469),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 97/115 (84%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P+NFMRIE DK WC+CL +F+ +QA +  LQHY GSRWFIPRQILPEKYSY R FD D  
Sbjct  455  PNNFMRIEPDKSWCVCLSVFVVLQAVVVLLQHYLGSRWFIPRQILPEKYSYCRMFDHDTR  514

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
               DCVICMT IDLS+R+NDCMVTPCDHFFHSGCLQRWMDIKMECPTCRR LPPA
Sbjct  515  HATDCVICMTAIDLSRRTNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRTLPPA  569



>ref|XP_004487269.1| PREDICTED: transmembrane E3 ubiquitin-protein ligase 1-like isoform 
X1 [Cicer arietinum]
Length=598

 Score =   185 bits (469),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 97/115 (84%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P+NFMRIE DK WC+CL +F+ +QA +  LQHY GSRWFIPRQILPEKYSY R FD D  
Sbjct  484  PNNFMRIEPDKSWCVCLSVFVVLQAVVVLLQHYLGSRWFIPRQILPEKYSYCRMFDHDTR  543

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
               DCVICMT IDLS+R+NDCMVTPCDHFFHSGCLQRWMDIKMECPTCRR LPPA
Sbjct  544  HATDCVICMTAIDLSRRTNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRTLPPA  598



>ref|XP_001755692.1| predicted protein [Physcomitrella patens]
 gb|EDQ79365.1| predicted protein [Physcomitrella patens]
Length=526

 Score =   182 bits (463),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 97/121 (80%), Gaps = 7/121 (6%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P+NF+RIE + +WC+ L  F+G QA+I  LQHY G+R FIPRQ+LPEKYSY+R+ D+   
Sbjct  405  PNNFIRIEANVRWCVGLTTFLGAQAAILLLQHYCGARCFIPRQLLPEKYSYFRRVDRVNE  464

Query  366  Q-------PIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLP  208
            Q       PIDCVICM  +D+SQR NDCMVTPCDHFFH+GCLQRWMDIKMECPTCRRPLP
Sbjct  465  QLGGEENAPIDCVICMAAVDVSQRCNDCMVTPCDHFFHTGCLQRWMDIKMECPTCRRPLP  524

Query  207  P  205
            P
Sbjct  525  P  525



>ref|XP_010555112.1| PREDICTED: transmembrane E3 ubiquitin-protein ligase 1-like isoform 
X2 [Tarenaya hassleriana]
Length=643

 Score =   182 bits (461),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 93/115 (81%), Gaps = 1/115 (1%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRK-FDQDA  370
            P NFMR+E  K WC+CL +F+G QAS+  LQHYFGSR FIP Q+LPEKY YYR+ FD D 
Sbjct  528  PSNFMRVEPSKVWCVCLCVFIGFQASLLLLQHYFGSRCFIPHQMLPEKYIYYRRLFDHDV  587

Query  369  VQPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPP  205
             +  DCVICMT IDL Q S DCMVTPC+HFFHSGCLQRWMDIKM+CPTCRR LPP
Sbjct  588  NRTTDCVICMTAIDLMQHSGDCMVTPCEHFFHSGCLQRWMDIKMDCPTCRRQLPP  642



>ref|XP_009102002.1| PREDICTED: transmembrane E3 ubiquitin-protein ligase 1 [Brassica 
rapa]
Length=556

 Score =   179 bits (455),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 91/115 (79%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P NFMR+E    WC+ L  F G QA++  LQHYFGSR F+PR++LP+KY+YYR+ D D  
Sbjct  442  PKNFMRVEPSNAWCVGLCAFTGFQAAVLLLQHYFGSRCFVPRKMLPDKYNYYRRLDHDVN  501

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
            +  DCVICM  IDL +R+NDCMVTPC+H FHSGCLQRWMDIKMECPTCRR LPPA
Sbjct  502  RSRDCVICMATIDLRRRTNDCMVTPCEHLFHSGCLQRWMDIKMECPTCRRTLPPA  556



>emb|CDY31948.1| BnaA07g00470D [Brassica napus]
Length=556

 Score =   179 bits (455),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 91/115 (79%), Gaps = 0/115 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P NFMR+E    WC+ L  F G QA++  LQHYFGSR F+PR++LP+KY+YYR+ D D  
Sbjct  442  PKNFMRVEPSNAWCVGLCAFTGFQAAVLLLQHYFGSRCFVPRKMLPDKYNYYRRLDHDVN  501

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
            +  DCVICM  IDL +R+NDCMVTPC+H FHSGCLQRWMDIKMECPTCRR LPPA
Sbjct  502  RSRDCVICMATIDLRRRTNDCMVTPCEHLFHSGCLQRWMDIKMECPTCRRTLPPA  556



>gb|EPS63571.1| hypothetical protein M569_11212, partial [Genlisea aurea]
Length=269

 Score =   172 bits (435),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 90/115 (78%), Gaps = 1/115 (1%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P NFMRI  D+ W I L  FMG QA +  LQHYFGSR F+P+QILPEKYSYYR+ +++  
Sbjct  156  PRNFMRIAADRNWSIALVAFMGSQAGLLLLQHYFGSRCFVPQQILPEKYSYYRRLNEEN-  214

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
               DCVICMT ID+   S++CMVTPCDHFFH GCLQRWMDIKMECPTCRR LPPA
Sbjct  215  HVDDCVICMTPIDVRSSSSECMVTPCDHFFHGGCLQRWMDIKMECPTCRRTLPPA  269



>ref|XP_001783682.1| predicted protein [Physcomitrella patens]
 gb|EDQ51512.1| predicted protein, partial [Physcomitrella patens]
Length=523

 Score =   176 bits (445),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 95/122 (78%), Gaps = 8/122 (7%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQ---  376
            P+NFMRIE +  WC+ L  F+G QA+I  LQH+ G+R FIPRQ+LPEKYSY+R+  +   
Sbjct  401  PNNFMRIEPNLGWCLGLTTFLGAQAAILLLQHFCGARCFIPRQLLPEKYSYFRRVIRANE  460

Query  375  -----DAVQPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPL  211
                 +   PIDCVICM  +D+SQR NDCMVTPCDHFFH+GCLQRWMDIKMECPTCRRPL
Sbjct  461  HIERGEECTPIDCVICMAAVDVSQRCNDCMVTPCDHFFHTGCLQRWMDIKMECPTCRRPL  520

Query  210  PP  205
            PP
Sbjct  521  PP  522



>ref|XP_010555111.1| PREDICTED: transmembrane E3 ubiquitin-protein ligase 1-like isoform 
X1 [Tarenaya hassleriana]
Length=645

 Score =   177 bits (448),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 93/117 (79%), Gaps = 3/117 (3%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRK-FDQDA  370
            P NFMR+E  K WC+CL +F+G QAS+  LQHYFGSR FIP Q+LPEKY YYR+ FD D 
Sbjct  528  PSNFMRVEPSKVWCVCLCVFIGFQASLLLLQHYFGSRCFIPHQMLPEKYIYYRRLFDHDV  587

Query  369  VQPIDCVICMTNIDLSQRSNDC--MVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPP  205
             +  DCVICMT IDL Q S DC  MVTPC+HFFHSGCLQRWMDIKM+CPTCRR LPP
Sbjct  588  NRTTDCVICMTAIDLMQHSGDCMVMVTPCEHFFHSGCLQRWMDIKMDCPTCRRQLPP  644



>gb|KJB31654.1| hypothetical protein B456_005G200400 [Gossypium raimondii]
Length=537

 Score =   172 bits (435),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 78/93 (84%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = -3

Query  480  IQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAVQPIDCVICMTNIDLSQRSNDCM  301
            I ASI  LQHY GSRWFIPRQILPEKYSYYR+FD +A   IDCVICMT+IDL+QRS DCM
Sbjct  445  ILASILLLQHYLGSRWFIPRQILPEKYSYYRRFDPEANHAIDCVICMTSIDLTQRSRDCM  504

Query  300  VTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
            VTPCDHFFHSGCLQRWMDIKMECPTCRR LP A
Sbjct  505  VTPCDHFFHSGCLQRWMDIKMECPTCRRSLPTA  537



>gb|KJB31653.1| hypothetical protein B456_005G200400 [Gossypium raimondii]
Length=486

 Score =   170 bits (430),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = -3

Query  474  ASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAVQPIDCVICMTNIDLSQRSNDCMVT  295
            +SI  LQHY GSRWFIPRQILPEKYSYYR+FD +A   IDCVICMT+IDL+QRS DCMVT
Sbjct  396  SSILLLQHYLGSRWFIPRQILPEKYSYYRRFDPEANHAIDCVICMTSIDLTQRSRDCMVT  455

Query  294  PCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
            PCDHFFHSGCLQRWMDIKMECPTCRR LP A
Sbjct  456  PCDHFFHSGCLQRWMDIKMECPTCRRSLPTA  486



>ref|XP_002971623.1| hypothetical protein SELMODRAFT_147759 [Selaginella moellendorffii]
 gb|EFJ27372.1| hypothetical protein SELMODRAFT_147759 [Selaginella moellendorffii]
Length=524

 Score =   166 bits (420),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 92/122 (75%), Gaps = 8/122 (7%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P NFMRIE D  WCI +  F+ +QA    LQHY GSRWFIPR+ LPEKYSY+R+ D+ A+
Sbjct  402  PRNFMRIEVDVGWCIGISSFLLLQAFFLLLQHYLGSRWFIPRKFLPEKYSYFRRIDRTAL  461

Query  366  Q--------PIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPL  211
            Q         +DCVICM  +D+ QRS+DCMVTPCDH FHSGCLQRWMDIKMECPTCRR L
Sbjct  462  QIGLNGDNMVVDCVICMAAVDIGQRSSDCMVTPCDHVFHSGCLQRWMDIKMECPTCRRSL  521

Query  210  PP  205
            PP
Sbjct  522  PP  523



>ref|XP_002965708.1| hypothetical protein SELMODRAFT_143664 [Selaginella moellendorffii]
 gb|EFJ33128.1| hypothetical protein SELMODRAFT_143664 [Selaginella moellendorffii]
Length=583

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 92/122 (75%), Gaps = 8/122 (7%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P NFMRIE D  WCI +  F+ +QA    LQHY GSRWFIPR+ LPEKYSY+R+ D+ A+
Sbjct  461  PRNFMRIEVDVGWCIGISSFLLLQAFFLLLQHYLGSRWFIPRKFLPEKYSYFRRIDRTAL  520

Query  366  Q--------PIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPL  211
            Q         +DCVICM  +D+ QRS+DCMVTPCDH FHSGCLQRWMDIKMECPTCRR L
Sbjct  521  QIGLNGDNMVVDCVICMAAVDIGQRSSDCMVTPCDHVFHSGCLQRWMDIKMECPTCRRSL  580

Query  210  PP  205
            PP
Sbjct  581  PP  582



>ref|XP_010433231.1| PREDICTED: transmembrane E3 ubiquitin-protein ligase 1-like [Camelina 
sativa]
Length=561

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 84/96 (88%), Gaps = 0/96 (0%)
 Frame = -3

Query  489  FMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAVQPIDCVICMTNIDLSQRSN  310
            FMG+QA I  LQHYFGSR F+PRQ+LPEKY+Y+R+F++D  +  DCVICMT IDL Q ++
Sbjct  466  FMGLQAIILLLQHYFGSRCFVPRQMLPEKYNYHRRFNRDVSRNTDCVICMTAIDLRQHTS  525

Query  309  DCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
            DCMVTPC+HFFHSGCLQRWMDIKMECPTCRR LPPA
Sbjct  526  DCMVTPCEHFFHSGCLQRWMDIKMECPTCRRSLPPA  561



>ref|XP_007043625.1| RING/U-box superfamily protein isoform 2 [Theobroma cacao]
 gb|EOX99456.1| RING/U-box superfamily protein isoform 2 [Theobroma cacao]
Length=599

 Score =   144 bits (362),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            PHNFMRIE DK WCICLG+F+G+QAS+  LQHY GSRWFIPRQILPEKYSYYR+FD D  
Sbjct  463  PHNFMRIEPDKSWCICLGVFIGLQASLLLLQHYLGSRWFIPRQILPEKYSYYRRFDPDTN  522

Query  366  QPIDCVICMTNIDLSQRSNDCMV  298
               DCVICMT IDL+Q S+DCMV
Sbjct  523  HATDCVICMTAIDLTQHSSDCMV  545



>ref|XP_006372721.1| hypothetical protein POPTR_0017s04430g [Populus trichocarpa]
 gb|ERP50518.1| hypothetical protein POPTR_0017s04430g [Populus trichocarpa]
Length=601

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P+NFMRIE DK WCICL IF+G+QASI  LQHY GSR FIPRQILPEKY YYR+FD+DA 
Sbjct  459  PYNFMRIEPDKTWCICLSIFIGLQASILLLQHYLGSRCFIPRQILPEKYCYYRRFDKDAN  518

Query  366  QPIDCVICMTNIDLSQRSNDCMV  298
               DCVICMT+IDL+ RSNDCMV
Sbjct  519  HATDCVICMTSIDLTHRSNDCMV  541



>ref|XP_010928991.1| PREDICTED: DSC E3 ubiquitin ligase complex subunit 1-like isoform 
X5 [Elaeis guineensis]
Length=522

 Score =   135 bits (340),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 68/115 (59%), Gaps = 39/115 (34%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P NFMRIE D  WCI LG+F+G+QASI  LQHYFGSRWFIPRQ                 
Sbjct  447  PSNFMRIEVDTNWCISLGVFLGLQASILLLQHYFGSRWFIPRQ-----------------  489

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
                                  VTPCDHFFHSGCLQRWMDIKMECPTCRR LPPA
Sbjct  490  ----------------------VTPCDHFFHSGCLQRWMDIKMECPTCRRSLPPA  522



>gb|KHN01116.1| Transmembrane E3 ubiquitin-protein ligase 1 [Glycine soja]
Length=489

 Score =   132 bits (332),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 58/87 (67%), Positives = 67/87 (77%), Gaps = 0/87 (0%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P NF+RIE D+ WC+CL IF+G+QA+I  LQHYFGS WFIPRQ LPEKY YYR+F QD  
Sbjct  393  PDNFLRIEPDQSWCVCLAIFVGLQAAILLLQHYFGSLWFIPRQFLPEKYCYYRRFAQDTN  452

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCD  286
               DCVICMT ID+S RSNDCM   C+
Sbjct  453  HATDCVICMTAIDISPRSNDCMACECN  479



>gb|KHN28115.1| Transmembrane E3 ubiquitin-protein ligase 1 [Glycine soja]
Length=543

 Score =   129 bits (325),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P+NF+ IE D+ WC+CL IF+G+QA+I  LQHYFGS WFIPRQ LPEKY YYR+F QD  
Sbjct  457  PNNFLHIEPDQSWCVCLAIFVGLQAAILLLQHYFGSLWFIPRQFLPEKYCYYRRFAQDTN  516

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCD  286
               DCVICMT IDLS RSNDCM   CD
Sbjct  517  HATDCVICMTAIDLSPRSNDCMA--CD  541



>ref|XP_009533229.1| hypothetical protein PHYSODRAFT_519898 [Phytophthora sojae]
 gb|EGZ10484.1| hypothetical protein PHYSODRAFT_519898 [Phytophthora sojae]
Length=712

 Score =   120 bits (302),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 55/126 (44%), Positives = 73/126 (58%), Gaps = 15/126 (12%)
 Frame = -3

Query  546  PHNFMRI------ETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRK  385
            P NF+        + D  +C  L ++MG+Q  I  LQ  +G R+F+P + LP KY+Y R+
Sbjct  587  PDNFLTAFPMYESKIDPHFCYVLAVWMGLQVGILALQQRYGPRFFVPARFLPVKYNYERR  646

Query  384  FD-------QDAVQPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPT  226
             +       +D    IDCVICM  +D+  R  D M+ PCDH FH  CLQ WM +KMECPT
Sbjct  647  INLQQLALLKDGDNSIDCVICMVELDIEAR--DYMIAPCDHIFHRECLQGWMQVKMECPT  704

Query  225  CRRPLP  208
            CR  LP
Sbjct  705  CRHVLP  710



>emb|CCI43701.1| unnamed protein product [Albugo candida]
Length=745

 Score =   119 bits (299),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 59/132 (45%), Positives = 75/132 (57%), Gaps = 21/132 (16%)
 Frame = -3

Query  546  PHNFMR----IET--DKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRK  385
            P NF+     +ET  +  +C+ L ++M +Q  I  LQH  G ++FIP + LP KY+Y R+
Sbjct  614  PANFLTEFPMLETRWNPSYCVGLSLWMALQVGILTLQHRLGPQFFIPARFLPVKYNYERR  673

Query  384  FD-------------QDAVQPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDI  244
            FD                V  IDCVICM  +DL  R  D M+ PCDH FH  CLQ WM +
Sbjct  674  FDIQQVSLVLSNDTGNGEVNTIDCVICMVELDLEAR--DYMLAPCDHVFHRECLQNWMQV  731

Query  243  KMECPTCRRPLP  208
            KMECPTCR  LP
Sbjct  732  KMECPTCRCALP  743



>gb|ETL29064.1| hypothetical protein L916_17707 [Phytophthora parasitica]
Length=719

 Score =   119 bits (298),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 55/126 (44%), Positives = 74/126 (59%), Gaps = 15/126 (12%)
 Frame = -3

Query  546  PHNFMRI------ETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRK  385
            P NF+        + +  +C  L  +MG+Q SI  LQ  +G R+F+P + LP KY+Y R+
Sbjct  594  PDNFLTAFPMYESKINPHFCYVLAGWMGLQVSILALQQRYGPRFFVPARFLPVKYNYERR  653

Query  384  FD-------QDAVQPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPT  226
             +       +D    IDCVICM  +D+  R  D M+ PCDH FH  CLQ WM++KMECPT
Sbjct  654  INLQQLALLKDGDNSIDCVICMVELDIEAR--DYMIAPCDHIFHRECLQGWMEVKMECPT  711

Query  225  CRRPLP  208
            CR  LP
Sbjct  712  CRHVLP  717



>ref|XP_009827875.1| hypothetical protein H257_04916 [Aphanomyces astaci]
 gb|ETV82206.1| hypothetical protein H257_04916 [Aphanomyces astaci]
Length=668

 Score =   118 bits (296),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 56/127 (44%), Positives = 72/127 (57%), Gaps = 16/127 (13%)
 Frame = -3

Query  546  PHNFMR------IETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRK  385
            P NF+       ++     CI L ++MG Q  +  LQ Y+G R+F+P   LP KY+Y R+
Sbjct  542  PKNFLSAMPIFPLQYHPNVCIALVLWMGAQVGVLLLQRYWGPRFFVPAMFLPVKYNYERR  601

Query  384  FDQDAVQ--------PIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECP  229
             D D +          +DCVICM  +DL  R  D M+ PCDH FH  CLQ WM +KMECP
Sbjct  602  MDADQLSLLRLNQGDELDCVICMVELDLEAR--DYMIAPCDHVFHRPCLQEWMQVKMECP  659

Query  228  TCRRPLP  208
            TCR  LP
Sbjct  660  TCRSVLP  666



>ref|XP_009827876.1| hypothetical protein, variant 1 [Aphanomyces astaci]
 gb|ETV82207.1| hypothetical protein, variant 1 [Aphanomyces astaci]
Length=664

 Score =   118 bits (295),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 53/108 (49%), Positives = 66/108 (61%), Gaps = 10/108 (9%)
 Frame = -3

Query  507  CICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAVQ--------PIDC  352
            CI L ++MG Q  +  LQ Y+G R+F+P   LP KY+Y R+ D D +          +DC
Sbjct  557  CIALVLWMGAQVGVLLLQRYWGPRFFVPAMFLPVKYNYERRMDADQLSLLRLNQGDELDC  616

Query  351  VICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLP  208
            VICM  +DL  R  D M+ PCDH FH  CLQ WM +KMECPTCR  LP
Sbjct  617  VICMVELDLEAR--DYMIAPCDHVFHRPCLQEWMQVKMECPTCRSVLP  662



>gb|ETP33356.1| hypothetical protein F442_18122 [Phytophthora parasitica P10297]
Length=719

 Score =   117 bits (293),  Expect = 6e-27, Method: Composition-based stats.
 Identities = 54/126 (43%), Positives = 73/126 (58%), Gaps = 15/126 (12%)
 Frame = -3

Query  546  PHNFMRI------ETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRK  385
            P NF+        + +  +C  L  +MG+Q  I  LQ  +G R+F+P + LP KY+Y R+
Sbjct  594  PDNFLTAFPMYESKINPHFCYVLAGWMGLQVGILALQQRYGPRFFVPARFLPVKYNYERR  653

Query  384  FD-------QDAVQPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPT  226
             +       +D    IDCVICM  +D+  R  D M+ PCDH FH  CLQ WM++KMECPT
Sbjct  654  INLQQLALLKDGDNSIDCVICMVELDIEAR--DYMIAPCDHIFHRECLQGWMEVKMECPT  711

Query  225  CRRPLP  208
            CR  LP
Sbjct  712  CRHVLP  717



>ref|XP_008912930.1| hypothetical protein PPTG_16931 [Phytophthora parasitica INRA-310]
 gb|ETI35379.1| hypothetical protein F443_18280 [Phytophthora parasitica P1569]
 gb|ETK75633.1| hypothetical protein L915_17808 [Phytophthora parasitica]
 gb|ETL82299.1| hypothetical protein L917_17537 [Phytophthora parasitica]
 gb|ETM35509.1| hypothetical protein L914_17617 [Phytophthora parasitica]
 gb|ETN01851.1| hypothetical protein PPTG_16931 [Phytophthora parasitica INRA-310]
 gb|ETO64124.1| hypothetical protein F444_18303 [Phytophthora parasitica P1976]
 gb|ETP05222.1| hypothetical protein F441_18151 [Phytophthora parasitica CJ01A1]
Length=719

 Score =   117 bits (293),  Expect = 6e-27, Method: Composition-based stats.
 Identities = 54/126 (43%), Positives = 73/126 (58%), Gaps = 15/126 (12%)
 Frame = -3

Query  546  PHNFMRI------ETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRK  385
            P NF+        + +  +C  L  +MG+Q  I  LQ  +G R+F+P + LP KY+Y R+
Sbjct  594  PDNFLTAFPMYESKINPHFCYVLAGWMGLQVGILALQQRYGPRFFVPARFLPVKYNYERR  653

Query  384  FD-------QDAVQPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPT  226
             +       +D    IDCVICM  +D+  R  D M+ PCDH FH  CLQ WM++KMECPT
Sbjct  654  INLQQLALLKDGDNSIDCVICMVELDIEAR--DYMIAPCDHIFHRECLQGWMEVKMECPT  711

Query  225  CRRPLP  208
            CR  LP
Sbjct  712  CRHVLP  717



>ref|XP_005839252.1| hypothetical protein GUITHDRAFT_65446 [Guillardia theta CCMP2712]
 gb|EKX52272.1| hypothetical protein GUITHDRAFT_65446 [Guillardia theta CCMP2712]
Length=390

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 73/114 (64%), Gaps = 1/114 (1%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDA-  370
            P+NF+  E +      L  ++G Q ++  +QHY G R+FIPR   PEKY YYR+   ++ 
Sbjct  272  PYNFLHSEPNYSLAFALVAWVGFQVAVLVVQHYKGPRFFIPRIFRPEKYDYYRRIPMESP  331

Query  369  VQPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLP  208
             +  DC ICM ++  S  ++  +VTPCDH FH  CL+RWM+IK+ECP CRR +P
Sbjct  332  SESQDCAICMMSVGGSHDTSPRVVTPCDHVFHQDCLKRWMEIKLECPVCRRTVP  385



>ref|XP_008867063.1| hypothetical protein, variant 1 [Aphanomyces invadans]
 gb|ETW04107.1| hypothetical protein, variant 1 [Aphanomyces invadans]
Length=675

 Score =   115 bits (289),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 53/127 (42%), Positives = 73/127 (57%), Gaps = 16/127 (13%)
 Frame = -3

Query  546  PHNFMR------IETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRK  385
            P+NF+       ++     C+ L ++M  Q ++  LQ Y+G R+F+P   LP KY+Y R+
Sbjct  549  PNNFLTAMPIFPLQYHPHLCVGLVVWMTAQVAVLFLQRYWGPRFFVPAMFLPVKYNYERR  608

Query  384  FDQDAVQ--------PIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECP  229
             D D +          +DCVICM  +D+  R  D M+ PCDH FH  CLQ WM +KMECP
Sbjct  609  MDPDQLSLLRVNQGDELDCVICMVELDMEAR--DYMIAPCDHVFHRPCLQEWMQVKMECP  666

Query  228  TCRRPLP  208
            TCR  LP
Sbjct  667  TCRSVLP  673



>ref|XP_005539543.1| hypothetical protein, conserved [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM83507.1| hypothetical protein, conserved [Cyanidioschyzon merolae strain 
10D]
Length=785

 Score =   115 bits (287),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 54/114 (47%), Positives = 72/114 (63%), Gaps = 5/114 (4%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P NF+ +    + CI L  +  +Q      Q  +G RWFIPR++ P+KY Y R F   AV
Sbjct  674  PSNFLHLRPRPRLCIGLVCWSLLQIVWMESQARWGGRWFIPRRLRPQKYEYSRPF---AV  730

Query  366  QPI-DCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLP  208
                DCVICM +++  + ++  MVTPCDH FHS CL +WM+IK+ECPTCRR LP
Sbjct  731  HSQGDCVICMQSLE-DEETSAVMVTPCDHAFHSECLLKWMEIKLECPTCRRALP  783



>ref|XP_004332975.1| zinc finger family protein [Acanthamoeba castellanii str. Neff]
 gb|ELR10962.1| zinc finger family protein [Acanthamoeba castellanii str. Neff]
Length=457

 Score =   112 bits (280),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 73/115 (63%), Gaps = 4/115 (3%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P+NF+ ++ +      L  ++ +Q  +   Q   G RWF+PR+ LP+KY Y R    DA 
Sbjct  343  PYNFLHVQPNYNLLSWLAAYLLLQVFVLFTQDLLGPRWFLPRRFLPDKYDYQRPVHVDAE  402

Query  366  Q--PIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLP  208
            Q    +CVICM+ +  +QR  D MVTPC+H FH  CL++WM+ KMECPTCRRPLP
Sbjct  403  QGESKECVICMSVVLPNQR--DYMVTPCNHLFHQNCLEQWMEFKMECPTCRRPLP  455



>emb|CCA18796.1| conserved hypothetical protein [Albugo laibachii Nc14]
Length=749

 Score =   113 bits (282),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 59/132 (45%), Positives = 74/132 (56%), Gaps = 21/132 (16%)
 Frame = -3

Query  546  PHNFMR----IET--DKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRK  385
            P NF+     +ET  +  +C+ L ++M  Q  I  LQH  G ++FIP + LP KY+Y R+
Sbjct  618  PDNFLTEFPMLETKWNPSYCLGLTLWMAFQVGILTLQHRLGPQFFIPARFLPVKYNYERR  677

Query  384  FD---------QDA----VQPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDI  244
             D          DA    V  IDCVICM  +D   R  D M+ PCDH FH  CLQ WM +
Sbjct  678  LDIQQVSLVVSNDAGNGEVNTIDCVICMVELDSEAR--DYMLAPCDHVFHRECLQNWMQV  735

Query  243  KMECPTCRRPLP  208
            KMECPTCR  LP
Sbjct  736  KMECPTCRCALP  747



>ref|XP_002900523.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gb|EEY59838.1| conserved hypothetical protein [Phytophthora infestans T30-4]
Length=701

 Score =   112 bits (281),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 52/126 (41%), Positives = 71/126 (56%), Gaps = 15/126 (12%)
 Frame = -3

Query  546  PHNFMRI------ETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRK  385
            P NF+        + +  +C  L  ++G+Q     LQ  +G R+F+P + LP KY+Y R+
Sbjct  576  PDNFLTAFPMYESKINPHFCYVLAAWVGLQVGFLALQQRYGPRFFVPARFLPVKYNYERR  635

Query  384  FD-------QDAVQPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPT  226
             +       +D    IDCVICM  +++  R  D MV PCDH FH  CLQ WM +KMECPT
Sbjct  636  INLQQLALLKDGDNSIDCVICMVELEIEAR--DYMVAPCDHIFHRECLQGWMQVKMECPT  693

Query  225  CRRPLP  208
            CR  LP
Sbjct  694  CRHVLP  699



>ref|XP_003685010.1| hypothetical protein TPHA_0C04260 [Tetrapisispora phaffii CBS 
4417]
 emb|CCE62576.1| hypothetical protein TPHA_0C04260 [Tetrapisispora phaffii CBS 
4417]
Length=757

 Score =   112 bits (281),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 49/131 (37%), Positives = 74/131 (56%), Gaps = 17/131 (13%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRK-FDQDA  370
            P N +R  TD K+   L +++ IQ  +   Q YFGSRWF+P+  +P+ YSY++    Q+ 
Sbjct  626  PSNILRHHTDLKFVTILTLWLSIQILLLYSQDYFGSRWFLPKHAIPDGYSYHKPVLSQEL  685

Query  369  VQ-------PIDCVICMTNIDLSQR---------SNDCMVTPCDHFFHSGCLQRWMDIKM  238
            ++        +DC ICM+ + +  +             MVTPC+H FH+ CL+ WM  K+
Sbjct  686  LEHGASENHTVDCAICMSEVPVYVKDIPETHAVDQQSYMVTPCNHIFHTACLENWMGYKL  745

Query  237  ECPTCRRPLPP  205
            +CP CR PLPP
Sbjct  746  QCPVCRAPLPP  756



>pir||T04607 hypothetical protein F20O9.50 - Arabidopsis thaliana
Length=481

 Score =   110 bits (276),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 68/113 (60%), Gaps = 30/113 (27%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPR------------------  421
            PHNFMR+E +K WCICL  FMG+QA I  LQHYFGSR F+PR                  
Sbjct  281  PHNFMRVEPNKVWCICLCTFMGLQAVILLLQHYFGSRCFVPRQFGLNISSLVPIAKLFLT  340

Query  420  ------------QILPEKYSYYRKFDQDAVQPIDCVICMTNIDLSQRSNDCMV  298
                        Q+LPEKY+Y+R+F++D  +  DCVICMT IDL Q ++DCMV
Sbjct  341  TTNLFLHRFAYTQMLPEKYNYHRRFNRDVSRTTDCVICMTAIDLRQHTSDCMV  393



>emb|CEF97619.1| Zinc finger, RING/FYVE/PHD-type [Ostreococcus tauri]
Length=614

 Score =   111 bits (278),  Expect = 5e-25, Method: Composition-based stats.
 Identities = 52/139 (37%), Positives = 74/139 (53%), Gaps = 26/139 (19%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKF-----  382
            P NF+R+  +  +C  + ++   Q  +   Q+Y   R+  P  + PE Y Y+R       
Sbjct  476  PSNFLRVRPNYFYCALIIVWTTAQCGVLLAQYYVSPRYGFPDGLFPEVYDYHRALTAEVL  535

Query  381  ------DQDAVQP--------------IDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCL  262
                  ++ AV P              +DCVICM ++ +   +N+ MVTPC+HFFH+ CL
Sbjct  536  EQCGIVEEAAVPPGGEPDIEMGDVSSGVDCVICMNSVQIYH-TNERMVTPCNHFFHTKCL  594

Query  261  QRWMDIKMECPTCRRPLPP  205
             RWMDIK ECPTCRR LPP
Sbjct  595  TRWMDIKQECPTCRRHLPP  613



>ref|XP_005648496.1| hypothetical protein COCSUDRAFT_36201 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE23952.1| hypothetical protein COCSUDRAFT_36201 [Coccomyxa subellipsoidea 
C-169]
Length=290

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 77/130 (59%), Gaps = 17/130 (13%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            PHN +  +     C+ L I M +Q ++  +Q  +G R FIP++ LP KY Y+R+     +
Sbjct  161  PHNLLGWQPRPGVCLALCICMAVQVAVLMVQTRWGPRCFIPKRFLPAKYDYHRRAPARPL  220

Query  366  QP----------------IDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKME  235
            +                 ++CVICM  +D+ +R++  MVTPC+HFFH  CL RWMD+KME
Sbjct  221  EAPDQARGPRDIETGDAGVECVICMNPLDV-ERTSARMVTPCNHFFHPDCLNRWMDVKME  279

Query  234  CPTCRRPLPP  205
            CPTCR+ LPP
Sbjct  280  CPTCRQLLPP  289



>ref|XP_008867064.1| hypothetical protein, variant 2 [Aphanomyces invadans]
 gb|ETW04108.1| hypothetical protein, variant 2 [Aphanomyces invadans]
Length=556

 Score =   108 bits (271),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 52/140 (37%), Positives = 73/140 (52%), Gaps = 27/140 (19%)
 Frame = -3

Query  546  PHNFMR------IETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRK  385
            P+NF+       ++     C+ L ++M  Q ++  LQ Y+G R+F+P   LP KY+Y R+
Sbjct  415  PNNFLTAMPIFPLQYHPHLCVGLVVWMTAQVAVLFLQRYWGPRFFVPAMFLPVKYNYERR  474

Query  384  FDQDAVQ--------PIDCVICMT-------------NIDLSQRSNDCMVTPCDHFFHSG  268
             D D +          +DCVICM               ++L   + D M+ PCDH FH  
Sbjct  475  MDPDQLSLLRVNQGDELDCVICMVRAARVEDHGLTHAQVELDMEARDYMIAPCDHVFHRP  534

Query  267  CLQRWMDIKMECPTCRRPLP  208
            CLQ WM +KMECPTCR  LP
Sbjct  535  CLQEWMQVKMECPTCRSVLP  554



>ref|XP_008867062.1| hypothetical protein H310_04469 [Aphanomyces invadans]
 gb|ETW04106.1| hypothetical protein H310_04469 [Aphanomyces invadans]
Length=690

 Score =   109 bits (272),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 52/140 (37%), Positives = 73/140 (52%), Gaps = 27/140 (19%)
 Frame = -3

Query  546  PHNFMR------IETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRK  385
            P+NF+       ++     C+ L ++M  Q ++  LQ Y+G R+F+P   LP KY+Y R+
Sbjct  549  PNNFLTAMPIFPLQYHPHLCVGLVVWMTAQVAVLFLQRYWGPRFFVPAMFLPVKYNYERR  608

Query  384  FDQDAVQ--------PIDCVICMT-------------NIDLSQRSNDCMVTPCDHFFHSG  268
             D D +          +DCVICM               ++L   + D M+ PCDH FH  
Sbjct  609  MDPDQLSLLRVNQGDELDCVICMVRAARVEDHGLTHAQVELDMEARDYMIAPCDHVFHRP  668

Query  267  CLQRWMDIKMECPTCRRPLP  208
            CLQ WM +KMECPTCR  LP
Sbjct  669  CLQEWMQVKMECPTCRSVLP  688



>ref|XP_008867065.1| hypothetical protein, variant 3 [Aphanomyces invadans]
 gb|ETW04109.1| hypothetical protein, variant 3 [Aphanomyces invadans]
Length=541

 Score =   108 bits (269),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 53/127 (42%), Positives = 73/127 (57%), Gaps = 16/127 (13%)
 Frame = -3

Query  546  PHNFMR------IETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRK  385
            P+NF+       ++     C+ L ++M  Q ++  LQ Y+G R+F+P   LP KY+Y R+
Sbjct  415  PNNFLTAMPIFPLQYHPHLCVGLVVWMTAQVAVLFLQRYWGPRFFVPAMFLPVKYNYERR  474

Query  384  FDQDAVQ--------PIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECP  229
             D D +          +DCVICM  +D+  R  D M+ PCDH FH  CLQ WM +KMECP
Sbjct  475  MDPDQLSLLRVNQGDELDCVICMVELDMEAR--DYMIAPCDHVFHRPCLQEWMQVKMECP  532

Query  228  TCRRPLP  208
            TCR  LP
Sbjct  533  TCRSVLP  539



>ref|WP_028830698.1| hypothetical protein [Proteobacteria bacterium JGI 0000113-E04]
Length=663

 Score =   108 bits (270),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 50/119 (42%), Positives = 68/119 (57%), Gaps = 11/119 (9%)
 Frame = -3

Query  537  FMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKF--------  382
            F R         CL +++ +QA++   Q  FG R F+P++ LPEKY Y RK         
Sbjct  545  FFRTSARPILGTCLVLWVLLQAALLRAQERFGPRCFVPKRFLPEKYDYRRKVVCKQSLAD  604

Query  381  -DQDAVQPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLP  208
             +    + I+C IC+  ++    SN+ MVTPCDHFFH  CL+RWMD+K ECP CR  LP
Sbjct  605  AENGESEEINCSICLNPVEAG--SNEYMVTPCDHFFHDSCLERWMDVKQECPVCRTVLP  661



>ref|XP_003060740.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH55509.1| predicted protein [Micromonas pusilla CCMP1545]
Length=329

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 67/116 (58%), Gaps = 2/116 (2%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDA-  370
            P NF+RIE     C+ L  ++G Q      QH  G R   P    P  Y Y+R   +D  
Sbjct  213  PTNFIRIEPQYWVCLVLVSWVGAQVFALYAQHVRGPRCVFPESWFPPVYDYHRDVSEDGD  272

Query  369  VQPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
               +DCVICM  ++ + R N  +VTPC+HFFH  CL RWM++KMECPTCR  LPPA
Sbjct  273  AGGVDCVICMATVECADR-NQRVVTPCNHFFHEPCLTRWMEVKMECPTCRGALPPA  327



>ref|XP_008616765.1| hypothetical protein SDRG_12472 [Saprolegnia diclina VS20]
 gb|EQC29926.1| hypothetical protein SDRG_12472 [Saprolegnia diclina VS20]
Length=689

 Score =   107 bits (267),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 51/127 (40%), Positives = 71/127 (56%), Gaps = 16/127 (13%)
 Frame = -3

Query  546  PHNFM------RIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRK  385
            P NF+      +++     C  L  ++ +Q ++  LQ   G R+F+P + LP KY+Y R+
Sbjct  563  PSNFLSALPVYQMQVQPGMCYLLVGWVALQIAVLLLQQRCGPRFFVPARFLPVKYNYERR  622

Query  384  FDQDAVQ--------PIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECP  229
             + D +          IDCVICM  +D+  R  D M+ PCDH FH  CLQ WM +KMECP
Sbjct  623  INADQMSLLRANHGDEIDCVICMVELDMDAR--DYMIAPCDHIFHRPCLQEWMHVKMECP  680

Query  228  TCRRPLP  208
            TCR  LP
Sbjct  681  TCRCALP  687



>ref|XP_005712057.1| unnamed protein product [Chondrus crispus]
 emb|CDF32392.1| unnamed protein product [Chondrus crispus]
Length=574

 Score =   103 bits (257),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 51/146 (35%), Positives = 75/146 (51%), Gaps = 34/146 (23%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFD----  379
            P NF+ I+      + L  ++ IQ  I   Q+ FG RWFIP+  LPEKY YYR       
Sbjct  430  PQNFLHIQPQPSSVMALVAWLAIQVIILLSQYKFGPRWFIPKAFLPEKYDYYRPLPMGDE  489

Query  378  --QDAVQ----------------PI----------DCVICMTNIDLSQRSNDCMVTPCDH  283
              +D ++                P+          +C ICM ++ +  R  D MVTPC+H
Sbjct  490  GLEDDIEAQEGTREEDEEGSDKRPLVGGMSNEPKRECCICMESVGVHAR--DRMVTPCNH  547

Query  282  FFHSGCLQRWMDIKMECPTCRRPLPP  205
            FFH+ CL+RW+++++EC  CR  +PP
Sbjct  548  FFHAICLERWLEVRLECALCRTAVPP  573



>ref|XP_003955580.1| hypothetical protein KAFR_0B01460 [Kazachstania africana CBS 
2517]
 emb|CCF56445.1| hypothetical protein KAFR_0B01460 [Kazachstania africana CBS 
2517]
Length=761

 Score =   103 bits (258),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 46/130 (35%), Positives = 67/130 (52%), Gaps = 18/130 (14%)
 Frame = -3

Query  540  NFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQ-----  376
            N  R   D ++ + L +++  Q ++   Q   GSRWF+PR  +PE YSY++         
Sbjct  631  NVFRHHKDVRFAVLLSLWLLFQITMLYTQDILGSRWFLPRHAIPEGYSYFKAISSQHLME  690

Query  375  ----DAVQPIDCVICMTNIDLSQR---------SNDCMVTPCDHFFHSGCLQRWMDIKME  235
                  V  +DC ICM+ I +             +  MVTPC+H FH+ CL+ WM  K++
Sbjct  691  HGQTSEVNTVDCSICMSEIPVYVEELPETHKVDQHSYMVTPCNHIFHTSCLENWMSYKLQ  750

Query  234  CPTCRRPLPP  205
            CP CR PLPP
Sbjct  751  CPVCRAPLPP  760



>ref|XP_001417276.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO95569.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=270

 Score = 99.4 bits (246),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 67/120 (56%), Gaps = 7/120 (6%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQ---  376
            P NF++I  +   C  +  +   Q ++   Q+Y   R+  P  I PE Y Y+RK  +   
Sbjct  151  PSNFLKIRPNYFHCAVMVAWTTAQTAMLLAQYYINPRYGFPIGIFPEVYDYHRKARERDV  210

Query  375  ---DAVQPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPP  205
               D     DCVICM  +   +  +D MVTPC+HFFH+ CL RWMDIK ECPTCR  LPP
Sbjct  211  EMGDVAAGPDCVICMNPVKF-RAVHDRMVTPCNHFFHTKCLMRWMDIKQECPTCRGALPP  269



>ref|XP_008883860.1| zinc finger, C3HC4 type (RING finger) domain-containing protein 
[Hammondia hammondi]
 gb|KEP65649.1| zinc finger, C3HC4 type (RING finger) domain-containing protein 
[Hammondia hammondi]
Length=794

 Score =   102 bits (255),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 46/105 (44%), Positives = 65/105 (62%), Gaps = 7/105 (7%)
 Frame = -3

Query  504  ICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYR----KFDQDAVQPI-DCVICM  340
            +C+ + M +Q  +   Q  FGSR+F+P   LP  Y+Y+R     F  DA + + +C ICM
Sbjct  690  VCIVVIMTLQVLLMLAQRRFGSRFFVPLDHLPHVYNYHRPLPASFLNDAEEGLPECAICM  749

Query  339  TNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPP  205
              I  +++S    +TPCDH FH  CLQ+WM++KMECP CR  LPP
Sbjct  750  NPI--ARKSRHRSITPCDHLFHDKCLQQWMEVKMECPNCRGALPP  792



>dbj|GAM19291.1| hypothetical protein SAMD00019534_024660 [Acytostelium subglobosum 
LB1]
Length=593

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 71/117 (61%), Gaps = 5/117 (4%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFD---Q  376
            P+NF  I+ +  +C  + I+  IQ     LQ  +G ++F+P++ LP KY Y R      +
Sbjct  478  PNNFFSIKPNFAYCAIMVIWTCIQVLTLWLQDKYGPQFFVPKRFLPPKYQYTRPISNSIR  537

Query  375  DAVQPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPP  205
            +  +   CVIC+   D+ +  ++ M+TPCDH FH  CL RWMD KMECPTCRRP+P 
Sbjct  538  NREEGQGCVICIN--DIEENDSEYMITPCDHLFHERCLLRWMDFKMECPTCRRPIPA  592



>ref|XP_001647220.1| hypothetical protein Kpol_1002p7 [Vanderwaltozyma polyspora DSM 
70294]
 gb|EDO19362.1| hypothetical protein Kpol_1002p7 [Vanderwaltozyma polyspora DSM 
70294]
Length=754

 Score =   102 bits (254),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 45/131 (34%), Positives = 68/131 (52%), Gaps = 17/131 (13%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFD----  379
            P N  R   D  + + L  ++G Q  +   Q  FGSRWF+P+ ++PE YSY++       
Sbjct  623  PSNIFRHHKDTFFAVLLCCWLGFQLLVLYSQEIFGSRWFLPKLVIPEGYSYHKAMSLQNL  682

Query  378  ----QDAVQPIDCVICMTNIDLSQRS---------NDCMVTPCDHFFHSGCLQRWMDIKM  238
                  +   +DC ICM+ + +             +  M+TPC+H FH+ CL+ WM  K+
Sbjct  683  LEHGASSDHTVDCAICMSEVPVYVDDVPTTHKVDLDSFMITPCNHVFHTQCLENWMGYKL  742

Query  237  ECPTCRRPLPP  205
            +CP CR PLPP
Sbjct  743  QCPVCRAPLPP  753



>ref|XP_004343779.2| hypothetical protein CAOG_07055 [Capsaspora owczarzaki ATCC 30864]
 gb|KJE96786.1| hypothetical protein, variant [Capsaspora owczarzaki ATCC 30864]
Length=804

 Score =   102 bits (254),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 44/89 (49%), Positives = 58/89 (65%), Gaps = 11/89 (12%)
 Frame = -3

Query  447  FGSRWFIPRQILPEKYSYYRK--------FDQDAVQPIDCVICMTNIDLSQRSNDCMVTP  292
             GSR+FIP   LP++Y YYRK        +D +  +  DCV+CM  I  ++R    M+TP
Sbjct  709  LGSRFFIPALFLPKEYDYYRKVVFTSLTGYDPETAR-TDCVVCMNEIPYTRRGY--MITP  765

Query  291  CDHFFHSGCLQRWMDIKMECPTCRRPLPP  205
            C H FH+ CLQRWMD+KM+CPTCR+ L P
Sbjct  766  CSHIFHTDCLQRWMDVKMQCPTCRQHLVP  794



>emb|CCK68363.1| hypothetical protein KNAG_0A07090 [Kazachstania naganishii CBS 
8797]
Length=762

 Score =   102 bits (253),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 48/134 (36%), Positives = 70/134 (52%), Gaps = 20/134 (15%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKF-----  382
            P N  +   + K+ + L +++  Q SI   Q   G+RWF+P+  +PE YSY++       
Sbjct  628  PSNIFKHHKNVKFVVLLSLWLLFQVSILYSQDILGARWFLPQHTIPEGYSYFKSVTSQYL  687

Query  381  ----DQDAVQ--PIDCVICMTNIDLSQRSN---------DCMVTPCDHFFHSGCLQRWMD  247
                D+  V+   +DC ICM+ I L                MVTPC+H FH+ CL+ WM 
Sbjct  688  AEHGDESLVETNSVDCSICMSGIPLYVDDKPETHKVDQYSYMVTPCNHIFHTECLENWMS  747

Query  246  IKMECPTCRRPLPP  205
             K++CP CR PLPP
Sbjct  748  YKLQCPVCRTPLPP  761



>gb|EPT25011.1| zinc finger, C3HC4 type (RING finger) domain-containing protein 
[Toxoplasma gondii ME49]
 gb|ESS34282.1| zinc finger, C3HC4 type (RING finger) domain-containing protein 
[Toxoplasma gondii VEG]
Length=794

 Score =   101 bits (252),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 45/105 (43%), Positives = 64/105 (61%), Gaps = 7/105 (7%)
 Frame = -3

Query  504  ICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYR----KFDQDAVQPI-DCVICM  340
            +C+ + M +Q  +   Q  FGSR+F+P   LP  Y+Y+R        DA + + +C ICM
Sbjct  690  VCIIVIMTLQVLLMLAQRRFGSRFFVPLDHLPHVYNYHRPLPASLSNDAEEGLPECAICM  749

Query  339  TNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPP  205
              I  +++S    +TPCDH FH  CLQ+WM++KMECP CR  LPP
Sbjct  750  NPI--ARKSRHRSITPCDHLFHDKCLQQWMEVKMECPNCRGALPP  792



>gb|EPR63522.1| zinc finger, C3HC4 type (RING finger) domain-containing protein 
[Toxoplasma gondii GT1]
 gb|KFG46572.1| zinc finger, C3HC4 type (RING finger) domain-containing protein 
[Toxoplasma gondii GAB2-2007-GAL-DOM2]
 gb|KFG48360.1| zinc finger, C3HC4 type (RING finger) domain-containing protein 
[Toxoplasma gondii p89]
 gb|KFG64410.1| zinc finger, C3HC4 type (RING finger) domain-containing protein 
[Toxoplasma gondii RUB]
 gb|KFH12208.1| zinc finger, C3HC4 type (RING finger) domain-containing protein 
[Toxoplasma gondii VAND]
 gb|KFH16019.1| zinc finger, C3HC4 type (RING finger) domain-containing protein 
[Toxoplasma gondii MAS]
Length=794

 Score =   101 bits (251),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 45/105 (43%), Positives = 64/105 (61%), Gaps = 7/105 (7%)
 Frame = -3

Query  504  ICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYR----KFDQDAVQPI-DCVICM  340
            +C+ + M +Q  +   Q  FGSR+F+P   LP  Y+Y+R        DA + + +C ICM
Sbjct  690  VCIIVIMTLQVLLMLAQRRFGSRFFVPLDHLPHVYNYHRPLPASLSNDAEEGLPECAICM  749

Query  339  TNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPP  205
              I  +++S    +TPCDH FH  CLQ+WM++KMECP CR  LPP
Sbjct  750  NPI--ARKSRHRSITPCDHLFHDKCLQQWMEVKMECPNCRGALPP  792



>gb|KFG54083.1| zinc finger, C3HC4 type (RING finger) domain-containing protein 
[Toxoplasma gondii FOU]
Length=794

 Score =   101 bits (251),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 45/105 (43%), Positives = 64/105 (61%), Gaps = 7/105 (7%)
 Frame = -3

Query  504  ICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYR----KFDQDAVQPI-DCVICM  340
            +C+ + M +Q  +   Q  FGSR+F+P   LP  Y+Y+R        DA + + +C ICM
Sbjct  690  VCIIVIMTLQVLLMLAQRRFGSRFFVPLDHLPHVYNYHRPLPASLSNDAEEGLPECAICM  749

Query  339  TNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPP  205
              I  +++S    +TPCDH FH  CLQ+WM++KMECP CR  LPP
Sbjct  750  NPI--ARKSRHRSITPCDHLFHDKCLQQWMEVKMECPNCRGALPP  792



>gb|EFA85537.1| hypothetical protein PPL_01495 [Polysphondylium pallidum PN500]
Length=537

 Score = 99.8 bits (247),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 70/118 (59%), Gaps = 5/118 (4%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFD---Q  376
            P NF+ +E +  +   L ++M  Q     LQ  +G  +FIP++ LP KY Y R      +
Sbjct  422  PINFILLEPNYFFSCALFLWMCTQIFALYLQDRYGPTFFIPKRFLPPKYQYTRPISMSIR  481

Query  375  DAVQPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA  202
            +  +   CVICM   D+    +D M+TPC+H FHS CL RWMD KMECPTCRR +PPA
Sbjct  482  NREEGQGCVICMN--DVEANDSDYMITPCEHLFHSRCLLRWMDYKMECPTCRRTIPPA  537



>gb|KDO17998.1| hypothetical protein SPRG_16480 [Saprolegnia parasitica CBS 223.65]
Length=511

 Score = 99.4 bits (246),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 71/127 (56%), Gaps = 16/127 (13%)
 Frame = -3

Query  546  PHNFM------RIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRK  385
            P NF+      +++     C  L  ++ +Q ++  LQ   G R+F+P + LP KY+Y R+
Sbjct  385  PSNFLSALPVYQMQAQPGMCYLLVGWVALQIAVLQLQQRCGPRFFVPARFLPVKYNYERR  444

Query  384  FDQDAVQ--------PIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECP  229
             + D +          IDCVICM  +D+  R  D M+ PCDH FH  CLQ WM +KMECP
Sbjct  445  INADQMSLLRANHGDEIDCVICMVELDMDAR--DYMIAPCDHIFHRPCLQEWMQVKMECP  502

Query  228  TCRRPLP  208
            TCR  LP
Sbjct  503  TCRCALP  509



>ref|XP_002504862.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO66120.1| predicted protein [Micromonas sp. RCC299]
Length=227

 Score = 96.3 bits (238),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 53/127 (42%), Positives = 75/127 (59%), Gaps = 14/127 (11%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P NF+R++     C  L +++  Q +    QH FG R FIP + LPE Y Y+R+ + + +
Sbjct  101  PENFVRVKPQFWVCWLLVVWVAAQVAALAAQHVFGPRCFIPDKYLPEVYDYHRRVEPEVL  160

Query  366  QP-------------IDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPT  226
                           +DCVICM  +D ++   + MVTPC+HFFH  CL+RWM++KMECPT
Sbjct  161  ASAGAGDEECGEAGGVDCVICMNAVD-AKTPRERMVTPCNHFFHQECLERWMEVKMECPT  219

Query  225  CRRPLPP  205
            CR  LPP
Sbjct  220  CRGALPP  226



>ref|XP_002546298.1| predicted protein [Candida tropicalis MYA-3404]
 gb|EER30377.1| predicted protein [Candida tropicalis MYA-3404]
Length=690

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 44/96 (46%), Positives = 60/96 (63%), Gaps = 5/96 (5%)
 Frame = -3

Query  492  IFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAVQPIDCVICMTNIDLSQRS  313
            +++ IQ  +  +Q Y   R +I  + LPE Y+Y+R F+   V    C IC+T+ID   R 
Sbjct  599  VWLMIQLGVLAVQSY-NPRLWISTRFLPESYNYFRAFE---VPETTCSICLTDIDGKNR-  653

Query  312  NDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPP  205
             D MVTPCDH FH+ CL+ WM  K++CPTCR  LPP
Sbjct  654  KDYMVTPCDHVFHTSCLESWMQFKLQCPTCRSSLPP  689



>gb|KDO22722.1| hypothetical protein SPRG_22291 [Saprolegnia parasitica CBS 223.65]
Length=541

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 71/127 (56%), Gaps = 16/127 (13%)
 Frame = -3

Query  546  PHNFM------RIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRK  385
            P NF+      +++     C  L  ++ +Q ++  LQ   G R+F+P + LP KY+Y R+
Sbjct  415  PSNFLSALPVYQMQVQPGMCYLLVGWVALQIAVLLLQQRCGPRFFVPARFLPVKYNYERR  474

Query  384  FDQDAVQ--------PIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECP  229
             + D +          IDCVICM  +D+  R  D M+ PCDH FH  CLQ WM +KMECP
Sbjct  475  INADQMSLLRANHGDEIDCVICMVELDMDAR--DYMIAPCDHIFHRPCLQEWMHVKMECP  532

Query  228  TCRRPLP  208
            TCR  LP
Sbjct  533  TCRCALP  539



>ref|XP_005847033.1| hypothetical protein CHLNCDRAFT_23912 [Chlorella variabilis]
 gb|EFN54931.1| hypothetical protein CHLNCDRAFT_23912 [Chlorella variabilis]
Length=215

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 66/117 (56%), Gaps = 4/117 (3%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQD--  373
            P N +R++ +   C  L  ++G+Q  +   QH++G R FIP+Q     Y        D  
Sbjct  99   PSNLLRVQPNLTLCAGLVAYVGLQCGLLLAQHWWGPRCFIPKQARNTPYGGSIAAANDIE  158

Query  372  -AVQPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPP  205
             +    +CVICM  +D+S +S D  VTPC H FH  CL+RW+  K +CPTCRR LPP
Sbjct  159  TSEGSRECVICMAQVDVSDKS-DRAVTPCTHVFHRSCLERWLSYKHDCPTCRRALPP  214



>ref|XP_002772757.1| zinc finger protein, putative [Perkinsus marinus ATCC 50983]
 gb|EER04573.1| zinc finger protein, putative [Perkinsus marinus ATCC 50983]
Length=313

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 69/113 (61%), Gaps = 11/113 (10%)
 Frame = -3

Query  525  ETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKF----DQDAVQPI  358
             T+    +CL +    Q +I   Q  FG R F+P   LP  Y+YYR      D++   P 
Sbjct  202  STEATLIVCLQV---AQIAIMWAQARFGPRSFVPWICLPHVYNYYRAVPSVQDEELGAP-  257

Query  357  DCVICMTNIDLSQR---SNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLP  208
            +CVICM +IDLS+     +  ++TPCDH FH+GCL++WMD+KMECPTCR  LP
Sbjct  258  ECVICMNDIDLSEVHDPESRPVITPCDHIFHAGCLEQWMDVKMECPTCRGELP  310



>emb|CEG66833.1| hypothetical protein RMATCC62417_03346 [Rhizopus microsporus]
Length=690

 Score = 98.2 bits (243),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 49/131 (37%), Positives = 68/131 (52%), Gaps = 19/131 (15%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYY--------  391
            P N +  ET   W   +  ++G+Q  I  LQ  FG R  +P + LP+ Y Y+        
Sbjct  559  PTNLIGHET-SSWIWVIVAYVGLQVVILLLQDAFGPRLVVPSRYLPDTYDYHPILTTNID  617

Query  390  -RKFDQDAVQPIDCVICMTNIDLSQRSN---------DCMVTPCDHFFHSGCLQRWMDIK  241
                 Q+  QP DC ICM  +D++  S+         + M+TPC H FH+ CL+RWM IK
Sbjct  618  EETVQQEISQPKDCAICMLPVDIANHSHSGLNVLTRANYMMTPCHHLFHTECLERWMRIK  677

Query  240  MECPTCRRPLP  208
            +ECP CR  LP
Sbjct  678  LECPVCRAYLP  688



>gb|EJY78944.1| RING-finger-containing ubiquitin ligase [Oxytricha trifallax]
Length=496

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 53/138 (38%), Positives = 73/138 (53%), Gaps = 24/138 (17%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKF-DQDA  370
            P+N ++I+    +C    +F+ +Q  I  +Q Y G R+ IPR   P  Y Y RKF D D 
Sbjct  355  PNNLLKIKPQPGFCFLYALFISLQFIILFVQKYKGPRFMIPRSFRPNTYDYVRKFRDVDD  414

Query  369  VQPI-----------DCVICMTN-----------IDLSQ-RSNDCMVTPCDHFFHSGCLQ  259
            ++             +CV+CM N           +D SQ R+   M TPC+H FH+ CLQ
Sbjct  415  LESASQSEEQSYLNDECVVCMHNLRFEVDESMQLVDGSQVRAKSFMQTPCNHKFHAKCLQ  474

Query  258  RWMDIKMECPTCRRPLPP  205
             WM +KMECP CR+ LPP
Sbjct  475  SWMKVKMECPVCRKILPP  492



>emb|CEG66834.1| hypothetical protein RMATCC62417_03346 [Rhizopus microsporus]
Length=565

 Score = 97.4 bits (241),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 49/131 (37%), Positives = 68/131 (52%), Gaps = 19/131 (15%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYY--------  391
            P N +  ET   W   +  ++G+Q  I  LQ  FG R  +P + LP+ Y Y+        
Sbjct  434  PTNLIGHET-SSWIWVIVAYVGLQVVILLLQDAFGPRLVVPSRYLPDTYDYHPILTTNID  492

Query  390  -RKFDQDAVQPIDCVICMTNIDLSQRSN---------DCMVTPCDHFFHSGCLQRWMDIK  241
                 Q+  QP DC ICM  +D++  S+         + M+TPC H FH+ CL+RWM IK
Sbjct  493  EETVQQEISQPKDCAICMLPVDIANHSHSGLNVLTRANYMMTPCHHLFHTECLERWMRIK  552

Query  240  MECPTCRRPLP  208
            +ECP CR  LP
Sbjct  553  LECPVCRAYLP  563



>emb|CEI87116.1| hypothetical protein RMCBS344292_01536 [Rhizopus microsporus]
Length=567

 Score = 97.4 bits (241),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 49/131 (37%), Positives = 68/131 (52%), Gaps = 19/131 (15%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYY--------  391
            P N +  ET   W   +  ++G+Q  I  LQ  FG R  +P + LP+ Y Y+        
Sbjct  436  PTNLIGHET-SSWIWVIVAYVGLQVVILLLQDAFGPRLVVPSRYLPDTYDYHPILTTNID  494

Query  390  -RKFDQDAVQPIDCVICMTNIDLSQRSN---------DCMVTPCDHFFHSGCLQRWMDIK  241
                 Q+  QP DC ICM  +D++  S+         + M+TPC H FH+ CL+RWM IK
Sbjct  495  EETVQQEISQPKDCAICMLPVDIANHSHSGLNVLTRANYMMTPCHHLFHTECLERWMRIK  554

Query  240  MECPTCRRPLP  208
            +ECP CR  LP
Sbjct  555  LECPVCRAYLP  565



>emb|CDO62547.1| E3 ubiquitin-protein ligase, putative [Plasmodium reichenowi]
Length=880

 Score = 97.8 bits (242),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 50/122 (41%), Positives = 70/122 (57%), Gaps = 11/122 (9%)
 Frame = -3

Query  546  PHNFMRIET--------DKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYY  391
            PHN  +++T        +  + I +   + IQ     LQ  +G R+F+   +LP  ++YY
Sbjct  758  PHNIFQLDTFSQLIDTSNTMFSILVIFIVFIQCIYMFLQRIYGPRYFVNIDLLPHVHNYY  817

Query  390  RKFDQDAVQPI-DCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRP  214
            +  D +    I +CVICM +I L  + N   VTPC H FH  CLQ+WMDIK+ECPTCR P
Sbjct  818  KTIDVNFEAGIPECVICMYDIVL--KPNKYCVTPCYHIFHEKCLQQWMDIKLECPTCRGP  875

Query  213  LP  208
            LP
Sbjct  876  LP  877



>ref|XP_002769008.1| zinc finger protein, putative [Perkinsus marinus ATCC 50983]
 gb|EER01726.1| zinc finger protein, putative [Perkinsus marinus ATCC 50983]
Length=472

 Score = 96.3 bits (238),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 68/112 (61%), Gaps = 11/112 (10%)
 Frame = -3

Query  522  TDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKF----DQDAVQPID  355
             +    +CL +    Q +I   Q  FG R F+P   LP  Y+YYR      D++   P +
Sbjct  362  AEATLIVCLQV---AQVAILWAQARFGPRSFVPWICLPHVYNYYRAVPPVQDEELGAP-E  417

Query  354  CVICMTNIDLSQRSNDCM---VTPCDHFFHSGCLQRWMDIKMECPTCRRPLP  208
            CVICM +IDLS+  +  +   +TPCDH FH+GCL++WMD+KMECPTCR  LP
Sbjct  418  CVICMNDIDLSETHDPELRPVITPCDHIFHAGCLEQWMDVKMECPTCRGELP  469



>emb|CEG84530.1| hypothetical protein RMATCC62417_18319 [Rhizopus microsporus]
Length=210

 Score = 93.2 bits (230),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 50/131 (38%), Positives = 70/131 (53%), Gaps = 19/131 (15%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYY----RKFD  379
            P N +  ET   W   +  ++G+Q  I  LQ  FG R F+P + LP+ Y Y+       D
Sbjct  79   PTNLIGHETSS-WIWAIVAYVGLQVVILLLQDAFGPRLFVPSRYLPDTYDYHPILTTNID  137

Query  378  QDAVQ-----PIDCVICMTNIDLSQRSN---------DCMVTPCDHFFHSGCLQRWMDIK  241
            ++ VQ     P DC ICM  +D++   +         + M+TPC H FH+ CL+RWM IK
Sbjct  138  EETVQQEIGQPKDCAICMLPVDVANHGHSGLNVLTRANYMMTPCHHLFHTECLERWMRIK  197

Query  240  MECPTCRRPLP  208
            +ECP CR  LP
Sbjct  198  LECPVCRAYLP  208



>ref|XP_011104303.1| tul1p [Saccharomyces arboricola H-6]
 gb|EJS42893.1| tul1p [Saccharomyces arboricola H-6]
Length=758

 Score = 97.1 bits (240),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 72/130 (55%), Gaps = 18/130 (14%)
 Frame = -3

Query  540  NFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV--  367
            N  R   D  + + L +++  Q SI   Q   GSRWF+P+  +P+ YSY++   ++ +  
Sbjct  628  NVFRHHKDVHFVVFLSLWLLFQISILYSQDILGSRWFLPKHTIPDGYSYFKPLSKEYISE  687

Query  366  -------QPIDCVICMTNI-----DLSQR----SNDCMVTPCDHFFHSGCLQRWMDIKME  235
                     +DC ICM+++     ++S+      +  MVTPC+H FH+ CL+ WM  K++
Sbjct  688  HGSGTVENTVDCAICMSDVPIYIEEISETHKVDQHSYMVTPCNHVFHTSCLESWMSYKLQ  747

Query  234  CPTCRRPLPP  205
            CP CR PLPP
Sbjct  748  CPVCRSPLPP  757



>gb|AJS48749.1| Tul1p [Saccharomyces cerevisiae YJM1388]
 gb|AJS49045.1| Tul1p [Saccharomyces cerevisiae YJM1389]
 gb|AJS53767.1| Tul1p [Saccharomyces cerevisiae YJM1460]
 gb|AJS55826.1| Tul1p [Saccharomyces cerevisiae YJM1549]
Length=758

 Score = 97.1 bits (240),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 69/130 (53%), Gaps = 18/130 (14%)
 Frame = -3

Query  540  NFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQD----  373
            N  R   D  + + L +++  Q SI   Q   GSRWF+P+  +P+ YSY++    +    
Sbjct  628  NVFRHHKDVHFVVFLSLWLLFQISILYSQDVLGSRWFLPKHTIPDGYSYFKPLSNEYISE  687

Query  372  -----AVQPIDCVICMTNIDLSQRS---------NDCMVTPCDHFFHSGCLQRWMDIKME  235
                 A   +DC ICM+++ +             +  MVTPC+H FH+ CL+ WM+ K++
Sbjct  688  HGGGTAEHTVDCAICMSDVPIYIEEIPETHKVDQHSYMVTPCNHVFHTSCLENWMNYKLQ  747

Query  234  CPTCRRPLPP  205
            CP CR PLPP
Sbjct  748  CPVCRSPLPP  757



>ref|NP_012890.1| ubiquitin-protein ligase TUL1 [Saccharomyces cerevisiae S288c]
 sp|P36096.1|TUL1_YEAST RecName: Full=Transmembrane E3 ubiquitin-protein ligase 1; Flags: 
Precursor [Saccharomyces cerevisiae S288c]
 emb|CAA81869.1| unnamed protein product [Saccharomyces cerevisiae]
 tpg|DAA09121.1| TPA: ubiquitin-protein ligase TUL1 [Saccharomyces cerevisiae 
S288c]
 gb|EIW09201.1| Tul1p [Saccharomyces cerevisiae CEN.PK113-7D]
Length=758

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 69/130 (53%), Gaps = 18/130 (14%)
 Frame = -3

Query  540  NFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQD----  373
            N  R   D  + + L +++  Q SI   Q   GSRWF+P+  +P+ YSY++    +    
Sbjct  628  NVFRHHKDVHFVVFLSLWLLFQISILYSQDVLGSRWFLPKHTIPDGYSYFKPLSNEYISE  687

Query  372  -----AVQPIDCVICMTNIDLSQRS---------NDCMVTPCDHFFHSGCLQRWMDIKME  235
                 A   +DC ICM+++ +             +  MVTPC+H FH+ CL+ WM+ K++
Sbjct  688  HGGGTAEHTVDCAICMSDVPIYIEEIPETHKVDQHSYMVTPCNHVFHTSCLENWMNYKLQ  747

Query  234  CPTCRRPLPP  205
            CP CR PLPP
Sbjct  748  CPVCRSPLPP  757



>gb|AJS36445.1| Tul1p [Saccharomyces cerevisiae YJM683]
 gb|AJS36740.1| Tul1p [Saccharomyces cerevisiae YJM689]
 gb|AJS41852.1| Tul1p [Saccharomyces cerevisiae YJM1208]
 gb|AJS57026.1| Tul1p [Saccharomyces cerevisiae YJM1615]
Length=758

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 69/130 (53%), Gaps = 18/130 (14%)
 Frame = -3

Query  540  NFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQD----  373
            N  R   D  + + L +++  Q SI   Q   GSRWF+P+  +P+ YSY++    +    
Sbjct  628  NVFRHHKDVHFVVFLSLWLLFQISILYSQDVLGSRWFLPKHTIPDGYSYFKPLSNEYISE  687

Query  372  -----AVQPIDCVICMTNIDLSQRS---------NDCMVTPCDHFFHSGCLQRWMDIKME  235
                 A   +DC ICM+++ +             +  MVTPC+H FH+ CL+ WM+ K++
Sbjct  688  HGGGTAEHTVDCAICMSDVPIYIEEIPETHKVDQHSYMVTPCNHVFHTSCLENWMNYKLQ  747

Query  234  CPTCRRPLPP  205
            CP CR PLPP
Sbjct  748  CPVCRSPLPP  757



>gb|AJS34343.1| Tul1p [Saccharomyces cerevisiae YJM470]
Length=758

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 69/130 (53%), Gaps = 18/130 (14%)
 Frame = -3

Query  540  NFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQD----  373
            N  R   D  + + L +++  Q SI   Q   GSRWF+P+  +P+ YSY++    +    
Sbjct  628  NVFRHHKDVHFVVFLSLWLLFQISILYSQDVLGSRWFLPKHTIPDGYSYFKPLSNEYISE  687

Query  372  -----AVQPIDCVICMTNIDLSQRS---------NDCMVTPCDHFFHSGCLQRWMDIKME  235
                 A   +DC ICM+++ +             +  MVTPC+H FH+ CL+ WM+ K++
Sbjct  688  HGGGTAEHTVDCTICMSDVPIYIEEIPETHKVDQHSYMVTPCNHVFHTSCLENWMNYKLQ  747

Query  234  CPTCRRPLPP  205
            CP CR PLPP
Sbjct  748  CPVCRSPLPP  757



>emb|CEG84529.1| hypothetical protein RMATCC62417_18319 [Rhizopus microsporus]
Length=277

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/131 (38%), Positives = 70/131 (53%), Gaps = 19/131 (15%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYY----RKFD  379
            P N +  ET   W   +  ++G+Q  I  LQ  FG R F+P + LP+ Y Y+       D
Sbjct  146  PTNLIGHETSS-WIWAIVAYVGLQVVILLLQDAFGPRLFVPSRYLPDTYDYHPILTTNID  204

Query  378  QDAVQ-----PIDCVICMTNIDLSQRSN---------DCMVTPCDHFFHSGCLQRWMDIK  241
            ++ VQ     P DC ICM  +D++   +         + M+TPC H FH+ CL+RWM IK
Sbjct  205  EETVQQEIGQPKDCAICMLPVDVANHGHSGLNVLTRANYMMTPCHHLFHTECLERWMRIK  264

Query  240  MECPTCRRPLP  208
            +ECP CR  LP
Sbjct  265  LECPVCRAYLP  275



>gb|AJS32896.1| Tul1p [Saccharomyces cerevisiae YJM428]
 gb|AJS43930.1| Tul1p [Saccharomyces cerevisiae YJM1304]
 gb|AJS52583.1| Tul1p [Saccharomyces cerevisiae YJM1443]
Length=758

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 68/130 (52%), Gaps = 18/130 (14%)
 Frame = -3

Query  540  NFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQD----  373
            N  R   D  + + L +++  Q SI   Q   GSRWF+P+  +P+ YSY++    +    
Sbjct  628  NLFRHHKDVHFVVFLSLWLLFQISILYSQDVLGSRWFLPKHTIPDGYSYFKPLSNEYISE  687

Query  372  -----AVQPIDCVICMTNIDLSQRS---------NDCMVTPCDHFFHSGCLQRWMDIKME  235
                 A   +DC ICM+++ +             +  MVTPC+H FH+ CL+ WM  K++
Sbjct  688  HGGGTAEHTVDCAICMSDVPIYIEEIPETHKVDQHSYMVTPCNHVFHTSCLENWMSYKLQ  747

Query  234  CPTCRRPLPP  205
            CP CR PLPP
Sbjct  748  CPVCRSPLPP  757



>ref|NP_985822.1| AFR275Wp [Ashbya gossypii ATCC 10895]
 gb|AAS53646.1| AFR275Wp [Ashbya gossypii ATCC 10895]
 gb|AEY97959.1| FAFR275Wp [Ashbya gossypii FDAG1]
Length=753

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/131 (37%), Positives = 74/131 (56%), Gaps = 17/131 (13%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P N  R   D ++ + L +++ +Q  I  LQ  FG+RWF+P+  +PE YSY++  +   +
Sbjct  622  PSNIFRHHRDIRYAVGLSVWLLLQMLILFLQDTFGARWFLPKSAIPEGYSYHKPLNSTCL  681

Query  366  QP--------IDCVICMTNIDL-------SQRSN--DCMVTPCDHFFHSGCLQRWMDIKM  238
                      + C ICM+ + +       + ++N  D MVTPC H FH+GCL+ WM  K+
Sbjct  682  LEHGANDNYCVSCAICMSELAIHVEDIPETHKANIHDYMVTPCSHLFHTGCLENWMSYKL  741

Query  237  ECPTCRRPLPP  205
            +CP CR PLPP
Sbjct  742  QCPVCRAPLPP  752



>gb|AJS30501.1| Tul1p [Saccharomyces cerevisiae YJM193]
 gb|AJS31996.1| Tul1p [Saccharomyces cerevisiae YJM271]
 gb|AJS40945.1| Tul1p [Saccharomyces cerevisiae YJM1190]
Length=758

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 68/130 (52%), Gaps = 18/130 (14%)
 Frame = -3

Query  540  NFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQD----  373
            N  R   D  + I L +++  Q SI   Q   GSRWF+P+  +P+ YSY++    +    
Sbjct  628  NVFRHHKDVHFVIFLSLWLLFQISILYSQDVLGSRWFLPKHTIPDGYSYFKPLSNEYISE  687

Query  372  -----AVQPIDCVICMTNIDLSQRS---------NDCMVTPCDHFFHSGCLQRWMDIKME  235
                 A   +DC ICM+++ +             +  MVTPC+H FH+ CL+ WM  K++
Sbjct  688  HGGGTAEHTVDCAICMSDVPIYIEEIPETHKVDQHSYMVTPCNHVFHTSCLENWMSYKLQ  747

Query  234  CPTCRRPLPP  205
            CP CR PLPP
Sbjct  748  CPVCRSPLPP  757



>gb|EHN01496.1| Tul1p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii 
VIN7]
Length=758

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 68/130 (52%), Gaps = 18/130 (14%)
 Frame = -3

Query  540  NFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQD----  373
            N  R   D  + + L +++  Q SI   Q   GSRWF+P+  +P+ Y+Y++    +    
Sbjct  628  NVFRHHKDVHFVVFLSLWLLFQISILYSQDILGSRWFLPKHTIPDGYTYFKPLSNEYISE  687

Query  372  -----AVQPIDCVICMTNIDLSQRS---------NDCMVTPCDHFFHSGCLQRWMDIKME  235
                 A   +DC ICM+++ +             +  MVTPCDH FH+ CL+ WM  K++
Sbjct  688  HGSGAAENTVDCTICMSDVPIYIEEIPETHKVDQHSYMVTPCDHVFHTSCLENWMSYKLQ  747

Query  234  CPTCRRPLPP  205
            CP CR PLPP
Sbjct  748  CPVCRSPLPP  757



>gb|EHN06148.1| Tul1p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii 
VIN7]
Length=758

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 68/130 (52%), Gaps = 18/130 (14%)
 Frame = -3

Query  540  NFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQD----  373
            N  R   D  + + L +++  Q SI   Q   GSRWF+P+  +P+ YSY++    +    
Sbjct  628  NVFRHHKDVHFVVFLSLWLLFQISILYSQDVLGSRWFLPKHTIPDGYSYFKPLSNEYISE  687

Query  372  -----AVQPIDCVICMTNIDLSQRS---------NDCMVTPCDHFFHSGCLQRWMDIKME  235
                 A   +DC ICM+++ +             +  MVTPC+H FH+ CL+ WM  K++
Sbjct  688  HGGGTAEHTVDCAICMSDVPIYIZEIPETHKVDQHSYMVTPCNHVFHTSCLENWMSYKLQ  747

Query  234  CPTCRRPLPP  205
            CP CR PLPP
Sbjct  748  CPVCRSPLPP  757



>gb|ETW30641.1| hypothetical protein PFFCH_01943 [Plasmodium falciparum FCH/4]
Length=835

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 49/122 (40%), Positives = 70/122 (57%), Gaps = 11/122 (9%)
 Frame = -3

Query  546  PHNFMRIE--------TDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYY  391
            PHN  +++        ++  + I +   + IQ     LQ  +G R+F+   +LP  ++YY
Sbjct  713  PHNIFQLDNFSQLIDTSNTMFSILIIFIVFIQCIYMLLQRIYGPRYFVNIDLLPHVHNYY  772

Query  390  RKFDQDAVQPI-DCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRP  214
            +  D +    I +CVICM +I L  + N   VTPC H FH  CLQ+WMDIK+ECPTCR P
Sbjct  773  KTIDVNFEAGIPECVICMYDIIL--KPNKYCVTPCYHIFHEKCLQQWMDIKLECPTCRGP  830

Query  213  LP  208
            LP
Sbjct  831  LP  832



>gb|ETW52205.1| hypothetical protein PFUGPA_05820 [Plasmodium falciparum Palo 
Alto/Uganda]
 gb|ETW63606.1| hypothetical protein PFMC_00494 [Plasmodium falciparum CAMP/Malaysia]
Length=837

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 49/122 (40%), Positives = 70/122 (57%), Gaps = 11/122 (9%)
 Frame = -3

Query  546  PHNFMRIE--------TDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYY  391
            PHN  +++        ++  + I +   + IQ     LQ  +G R+F+   +LP  ++YY
Sbjct  715  PHNIFQLDNFSQLIDTSNTMFSILIIFIVFIQCIYMLLQRIYGPRYFVNIDLLPHVHNYY  774

Query  390  RKFDQDAVQPI-DCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRP  214
            +  D +    I +CVICM +I L  + N   VTPC H FH  CLQ+WMDIK+ECPTCR P
Sbjct  775  KTIDVNFEAGIPECVICMYDIVL--KPNKYCVTPCYHIFHEKCLQQWMDIKLECPTCRGP  832

Query  213  LP  208
            LP
Sbjct  833  LP  834



>gb|EWC78793.1| hypothetical protein C923_00560 [Plasmodium falciparum UGT5.1]
Length=835

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 49/122 (40%), Positives = 70/122 (57%), Gaps = 11/122 (9%)
 Frame = -3

Query  546  PHNFMRIE--------TDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYY  391
            PHN  +++        ++  + I +   + IQ     LQ  +G R+F+   +LP  ++YY
Sbjct  713  PHNIFQLDNFSQLIDTSNTMFSILIIFIVFIQCIYMLLQRIYGPRYFVNIDLLPHVHNYY  772

Query  390  RKFDQDAVQPI-DCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRP  214
            +  D +    I +CVICM +I L  + N   VTPC H FH  CLQ+WMDIK+ECPTCR P
Sbjct  773  KTIDVNFEAGIPECVICMYDIVL--KPNKYCVTPCYHIFHEKCLQQWMDIKLECPTCRGP  830

Query  213  LP  208
            LP
Sbjct  831  LP  832



>gb|AJS50171.1| Tul1p [Saccharomyces cerevisiae YJM1402]
 gb|AJS56128.1| Tul1p [Saccharomyces cerevisiae YJM1573]
Length=758

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 68/130 (52%), Gaps = 18/130 (14%)
 Frame = -3

Query  540  NFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQD----  373
            N  R   D  + + L +++  Q SI   Q   GSRWF+P+  +P+ YSY++    +    
Sbjct  628  NVFRHHKDVHFVVFLSLWLLFQISILYSQDVLGSRWFLPKHTIPDGYSYFKPLSNEYISE  687

Query  372  -----AVQPIDCVICMTNIDLSQRS---------NDCMVTPCDHFFHSGCLQRWMDIKME  235
                 A   +DC ICM+++ +             +  MVTPC+H FH+ CL+ WM  K++
Sbjct  688  HGGGTAEHTVDCAICMSDVPIYIEEIPETHKVDQHSYMVTPCNHVFHTSCLENWMSYKLQ  747

Query  234  CPTCRRPLPP  205
            CP CR PLPP
Sbjct  748  CPVCRSPLPP  757



>gb|AJS46337.1| Tul1p [Saccharomyces cerevisiae YJM1342]
Length=758

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 68/130 (52%), Gaps = 18/130 (14%)
 Frame = -3

Query  540  NFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQD----  373
            N  R   D  + + L +++  Q SI   Q   GSRWF+P+  +P+ YSY++    +    
Sbjct  628  NVFRHHKDVHFVVFLSLWLLFQISILYSQDVLGSRWFLPKHTIPDGYSYFKPLSNEYISE  687

Query  372  -----AVQPIDCVICMTNIDLSQRS---------NDCMVTPCDHFFHSGCLQRWMDIKME  235
                 A   +DC ICM+++ +             +  MVTPC+H FH+ CL+ WM  K++
Sbjct  688  HGGGTAEHTVDCAICMSDVPIYIEEIPETHKVDQHSYMVTPCNHVFHTSCLENWMSYKLQ  747

Query  234  CPTCRRPLPP  205
            CP CR PLPP
Sbjct  748  CPVCRSPLPP  757



>gb|AJS54066.1| Tul1p [Saccharomyces cerevisiae YJM1463]
Length=758

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 68/130 (52%), Gaps = 18/130 (14%)
 Frame = -3

Query  540  NFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQD----  373
            N  R   D  + + L +++  Q SI   Q   GSRWF+P+  +P+ YSY++    +    
Sbjct  628  NVFRHHKDVHFVVFLSLWLLFQISILYSQDVLGSRWFLPKHTIPDGYSYFKPLSNEYISE  687

Query  372  -----AVQPIDCVICMTNIDLSQRS---------NDCMVTPCDHFFHSGCLQRWMDIKME  235
                 A   +DC ICM+++ +             +  MVTPC+H FH+ CL+ WM  K++
Sbjct  688  HGGGTAEHTVDCAICMSDVPIYIEEIPETHKVDQHSYMVTPCNHVFHTSCLENWMSYKLQ  747

Query  234  CPTCRRPLPP  205
            CP CR PLPP
Sbjct  748  CPVCRSPLPP  757



>gb|AJS40645.1| Tul1p [Saccharomyces cerevisiae YJM1133]
 gb|AJS44829.1| Tul1p [Saccharomyces cerevisiae YJM1326]
Length=758

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 68/130 (52%), Gaps = 18/130 (14%)
 Frame = -3

Query  540  NFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQD----  373
            N  R   D  + + L +++  Q SI   Q   GSRWF+P+  +P+ YSY++    +    
Sbjct  628  NVFRHHKDVHFVVFLSLWLLFQISILYSQDVLGSRWFLPKHTIPDGYSYFKPLSNEYISE  687

Query  372  -----AVQPIDCVICMTNIDLSQRS---------NDCMVTPCDHFFHSGCLQRWMDIKME  235
                 A   +DC ICM+++ +             +  MVTPC+H FH+ CL+ WM  K++
Sbjct  688  HGGGTAEHTVDCAICMSDVPIYIEEIPETHKVDQHSYMVTPCNHVFHTSCLENWMSYKLQ  747

Query  234  CPTCRRPLPP  205
            CP CR PLPP
Sbjct  748  CPVCRSPLPP  757



>gb|AJS37040.1| Tul1p [Saccharomyces cerevisiae YJM693]
Length=758

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 68/130 (52%), Gaps = 18/130 (14%)
 Frame = -3

Query  540  NFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQD----  373
            N  R   D  + + L +++  Q SI   Q   GSRWF+P+  +P+ YSY++    +    
Sbjct  628  NVFRHHKDVHFVVFLSLWLLFQISILYSQDVLGSRWFLPKHTIPDGYSYFKPLSNEYISE  687

Query  372  -----AVQPIDCVICMTNIDLSQRS---------NDCMVTPCDHFFHSGCLQRWMDIKME  235
                 A   +DC ICM+++ +             +  MVTPC+H FH+ CL+ WM  K++
Sbjct  688  HGGGTAEHTVDCAICMSDVPIYIEEIPETHKVDQHSYMVTPCNHVFHTSCLENWMSYKLQ  747

Query  234  CPTCRRPLPP  205
            CP CR PLPP
Sbjct  748  CPVCRSPLPP  757



>gb|AJS32294.1| Tul1p [Saccharomyces cerevisiae YJM320]
 gb|AJS34645.1| Tul1p [Saccharomyces cerevisiae YJM541]
 gb|AJS35245.1| Tul1p [Saccharomyces cerevisiae YJM555]
 gb|AJS54664.1| Tul1p [Saccharomyces cerevisiae YJM1478]
Length=758

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 68/130 (52%), Gaps = 18/130 (14%)
 Frame = -3

Query  540  NFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQD----  373
            N  R   D  + + L +++  Q SI   Q   GSRWF+P+  +P+ YSY++    +    
Sbjct  628  NVFRHHKDVHFVVFLSLWLLFQISILYSQDVLGSRWFLPKHTIPDGYSYFKPLSNEYISE  687

Query  372  -----AVQPIDCVICMTNIDLSQRS---------NDCMVTPCDHFFHSGCLQRWMDIKME  235
                 A   +DC ICM+++ +             +  MVTPC+H FH+ CL+ WM  K++
Sbjct  688  HGGGTAEHTVDCAICMSDVPIYIEEIPETHKVDQHSYMVTPCNHVFHTSCLENWMSYKLQ  747

Query  234  CPTCRRPLPP  205
            CP CR PLPP
Sbjct  748  CPVCRSPLPP  757



>gb|EGA82064.1| Tul1p [Saccharomyces cerevisiae Lalvin QA23]
Length=758

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 68/130 (52%), Gaps = 18/130 (14%)
 Frame = -3

Query  540  NFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQD----  373
            N  R   D  + + L +++  Q SI   Q   GSRWF+P+  +P+ YSY++    +    
Sbjct  628  NVFRHHKDVHFVVFLSLWLLFQISILYSQDVLGSRWFLPKHTIPDGYSYFKPLSNEYISE  687

Query  372  -----AVQPIDCVICMTNIDLSQRS---------NDCMVTPCDHFFHSGCLQRWMDIKME  235
                 A   +DC ICM+++ +             +  MVTPC+H FH+ CL+ WM  K++
Sbjct  688  HGGGTAEHTVDCAICMSDVPIYIEEIPETHKVDQHSYMVTPCNHVFHTSCLENWMSYKLQ  747

Query  234  CPTCRRPLPP  205
            CP CR PLPP
Sbjct  748  CPVCRSPLPP  757



>gb|EGA57882.1| Tul1p [Saccharomyces cerevisiae FostersB]
Length=758

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 68/130 (52%), Gaps = 18/130 (14%)
 Frame = -3

Query  540  NFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQD----  373
            N  R   D  + + L +++  Q SI   Q   GSRWF+P+  +P+ YSY++    +    
Sbjct  628  NVFRHHKDVHFVVFLSLWLLFQISILYSQDVLGSRWFLPKHTIPDGYSYFKPLSNEXISE  687

Query  372  -----AVQPIDCVICMTNIDLSQRS---------NDCMVTPCDHFFHSGCLQRWMDIKME  235
                 A   +DC ICM+++ +             +  MVTPC+H FH+ CL+ WM  K++
Sbjct  688  HGGGTAEHTVDCAICMSDVPIYIEEIPETHKVDQHSYMVTPCNHVFHTSCLENWMSYKLQ  747

Query  234  CPTCRRPLPP  205
            CP CR PLPP
Sbjct  748  CPVCRSPLPP  757



>gb|EEU07447.1| Tul1p [Saccharomyces cerevisiae JAY291]
 gb|AJS33196.1| Tul1p [Saccharomyces cerevisiae YJM450]
 gb|AJS34042.1| Tul1p [Saccharomyces cerevisiae YJM456]
 gb|AJS35544.1| Tul1p [Saccharomyces cerevisiae YJM627]
 gb|AJS42755.1| Tul1p [Saccharomyces cerevisiae YJM1248]
 gb|AJS43027.1| Tul1p [Saccharomyces cerevisiae YJM1250]
 gb|AJS43626.1| Tul1p [Saccharomyces cerevisiae YJM1273]
 gb|AJS51075.1| Tul1p [Saccharomyces cerevisiae YJM1418]
 gb|AJS51379.1| Tul1p [Saccharomyces cerevisiae YJM1419]
 gb|AJS51984.1| Tul1p [Saccharomyces cerevisiae YJM1434]
 gb|AJS52285.1| Tul1p [Saccharomyces cerevisiae YJM1439]
 gb|AJS53176.1| Tul1p [Saccharomyces cerevisiae YJM1447]
 gb|AJS56427.1| Tul1p [Saccharomyces cerevisiae YJM1574]
Length=758

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 68/130 (52%), Gaps = 18/130 (14%)
 Frame = -3

Query  540  NFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQD----  373
            N  R   D  + + L +++  Q SI   Q   GSRWF+P+  +P+ YSY++    +    
Sbjct  628  NVFRHHKDVHFVVFLSLWLLFQISILYSQDVLGSRWFLPKHTIPDGYSYFKPLSNEYISE  687

Query  372  -----AVQPIDCVICMTNIDLSQRS---------NDCMVTPCDHFFHSGCLQRWMDIKME  235
                 A   +DC ICM+++ +             +  MVTPC+H FH+ CL+ WM  K++
Sbjct  688  HGGGTAEHTVDCAICMSDVPIYIEEIPETHKVDQHSYMVTPCNHVFHTSCLENWMSYKLQ  747

Query  234  CPTCRRPLPP  205
            CP CR PLPP
Sbjct  748  CPVCRSPLPP  757



>gb|EDN59873.1| RING-domain E3 ubiquitin ligase [Saccharomyces cerevisiae YJM789]
 gb|AJS44531.1| Tul1p [Saccharomyces cerevisiae YJM1311]
 gb|AJS47845.1| Tul1p [Saccharomyces cerevisiae YJM1385]
 gb|AJS49573.1| Tul1p [Saccharomyces cerevisiae YJM1400]
 gb|AJS54959.1| Tul1p [Saccharomyces cerevisiae YJM1479]
Length=758

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 68/130 (52%), Gaps = 18/130 (14%)
 Frame = -3

Query  540  NFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQD----  373
            N  R   D  + + L +++  Q SI   Q   GSRWF+P+  +P+ YSY++    +    
Sbjct  628  NVFRHHKDVHFVVFLSLWLLFQISILYSQDVLGSRWFLPKHTIPDGYSYFKPLSNEYISE  687

Query  372  -----AVQPIDCVICMTNIDLSQRS---------NDCMVTPCDHFFHSGCLQRWMDIKME  235
                 A   +DC ICM+++ +             +  MVTPC+H FH+ CL+ WM  K++
Sbjct  688  HGGGTAEHTVDCAICMSDVPIYIEEIPETHKVDQHSYMVTPCNHVFHTSCLENWMSYKLQ  747

Query  234  CPTCRRPLPP  205
            CP CR PLPP
Sbjct  748  CPVCRSPLPP  757



>gb|AJS37340.1| Tul1p [Saccharomyces cerevisiae YJM969]
 gb|AJS37625.1| Tul1p [Saccharomyces cerevisiae YJM972]
 gb|AJS37928.1| Tul1p [Saccharomyces cerevisiae YJM975]
 gb|AJS38531.1| Tul1p [Saccharomyces cerevisiae YJM981]
 gb|AJS39435.1| Tul1p [Saccharomyces cerevisiae YJM990]
 gb|AJS39737.1| Tul1p [Saccharomyces cerevisiae YJM996]
Length=758

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 71/130 (55%), Gaps = 18/130 (14%)
 Frame = -3

Query  540  NFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQD----  373
            N  R   D  + + L +++  Q SI   Q   GSRWF+P+  +P+ YSY++    +    
Sbjct  628  NVFRHHKDVHFVVFLSLWLLFQISILYSQDVLGSRWFLPKHTIPDGYSYFKPLSNEYISE  687

Query  372  -----AVQPIDCVICMTNI-----DLSQR----SNDCMVTPCDHFFHSGCLQRWMDIKME  235
                 A   +DC ICM+++     ++++      +  MVTPC+H FH+ CL+ WM  K++
Sbjct  688  HGGGTAEHTVDCAICMSDVPIYIEEITETHKVDQHSYMVTPCNHVFHTSCLENWMSYKLQ  747

Query  234  CPTCRRPLPP  205
            CP CR PLPP
Sbjct  748  CPVCRSPLPP  757



>gb|AJS33436.1| Tul1p [Saccharomyces cerevisiae YJM451]
 gb|AJS49875.1| Tul1p [Saccharomyces cerevisiae YJM1401]
Length=758

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 68/130 (52%), Gaps = 18/130 (14%)
 Frame = -3

Query  540  NFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQD----  373
            N  R   D  + + L +++  Q SI   Q   GSRWF+P+  +P+ YSY++    +    
Sbjct  628  NVFRHHKDVHFVVFLSLWLLFQISILYSQDVLGSRWFLPKHTIPDGYSYFKPLSNEYISE  687

Query  372  -----AVQPIDCVICMTNIDLSQRS---------NDCMVTPCDHFFHSGCLQRWMDIKME  235
                 A   +DC ICM+++ +             +  MVTPC+H FH+ CL+ WM  K++
Sbjct  688  HGGGTAEHTVDCAICMSDVPIYIEEIPETHKVDQHSYMVTPCNHVFHTSCLENWMSYKLQ  747

Query  234  CPTCRRPLPP  205
            CP CR PLPP
Sbjct  748  CPVCRSPLPP  757



>gb|AJS32594.1| Tul1p [Saccharomyces cerevisiae YJM326]
 gb|AJS34945.1| Tul1p [Saccharomyces cerevisiae YJM554]
 gb|AJS35843.1| Tul1p [Saccharomyces cerevisiae YJM681]
 gb|AJS36144.1| Tul1p [Saccharomyces cerevisiae YJM682]
Length=758

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 68/130 (52%), Gaps = 18/130 (14%)
 Frame = -3

Query  540  NFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQD----  373
            N  R   D  + + L +++  Q SI   Q   GSRWF+P+  +P+ YSY++    +    
Sbjct  628  NVFRHHKDVHFVVFLSLWLLFQISILYSQDVLGSRWFLPKHTIPDGYSYFKPLSNEYISE  687

Query  372  -----AVQPIDCVICMTNIDLSQRS---------NDCMVTPCDHFFHSGCLQRWMDIKME  235
                 A   +DC ICM+++ +             +  MVTPC+H FH+ CL+ WM  K++
Sbjct  688  HGGGTAEHTVDCAICMSDVPIYIEEIPETHKVDQHSYMVTPCNHVFHTSCLENWMSYKLQ  747

Query  234  CPTCRRPLPP  205
            CP CR PLPP
Sbjct  748  CPVCRSPLPP  757



>emb|CEP60852.1| LALA0S02e01112g1_1 [Lachancea lanzarotensis]
Length=751

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 43/131 (33%), Positives = 66/131 (50%), Gaps = 17/131 (13%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P N      D+++   +  ++ IQ ++   Q  FG RWF+P   +P+ Y Y++      +
Sbjct  620  PPNIFYHHQDRRFVAVVAAWLFIQIALLYSQDVFGGRWFLPNYTIPDGYKYHKAISSGEL  679

Query  366  --------QPIDCVICMTNI-----DLSQR----SNDCMVTPCDHFFHSGCLQRWMDIKM  238
                      IDC ICM ++     D+++         MVTPC H FH+ CL+ WM  K+
Sbjct  680  LEHGSSENHTIDCAICMNDVAVYVEDIAETHKVDQQSYMVTPCGHIFHTNCLENWMSYKL  739

Query  237  ECPTCRRPLPP  205
            +CP CR PLPP
Sbjct  740  QCPVCRAPLPP  750



>emb|CAY81051.1| Tul1p [Saccharomyces cerevisiae EC1118]
 gb|AJS31697.1| Tul1p [Saccharomyces cerevisiae YJM270]
Length=758

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 68/130 (52%), Gaps = 18/130 (14%)
 Frame = -3

Query  540  NFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQD----  373
            N  R   D  + + L +++  Q SI   Q   GSRWF+P+  +P+ YSY++    +    
Sbjct  628  NVFRHHKDVHFVVFLSLWLLFQISILYSQDVLGSRWFLPKHTIPDGYSYFKPLSNEYISE  687

Query  372  -----AVQPIDCVICMTNIDLSQRS---------NDCMVTPCDHFFHSGCLQRWMDIKME  235
                 A   +DC ICM+++ +             +  MVTPC+H FH+ CL+ WM  K++
Sbjct  688  HGGGTAEHTVDCAICMSDVPIYIEEIPETHKVDQHSYMVTPCNHVFHTSCLENWMSYKLQ  747

Query  234  CPTCRRPLPP  205
            CP CR PLPP
Sbjct  748  CPVCRSPLPP  757



>gb|AJS48447.1| Tul1p [Saccharomyces cerevisiae YJM1387]
 gb|AJS53469.1| Tul1p [Saccharomyces cerevisiae YJM1450]
Length=758

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 68/130 (52%), Gaps = 18/130 (14%)
 Frame = -3

Query  540  NFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQD----  373
            N  R   D  + + L +++  Q SI   Q   GSRWF+P+  +P+ YSY++    +    
Sbjct  628  NVFRHHKDVHFVVFLSLWLLFQISILYSQDVLGSRWFLPKHTIPDGYSYFKPLSNEYISE  687

Query  372  -----AVQPIDCVICMTNIDLSQRS---------NDCMVTPCDHFFHSGCLQRWMDIKME  235
                 A   +DC ICM+++ +             +  MVTPC+H FH+ CL+ WM  K++
Sbjct  688  HGGGTAEHTVDCAICMSDVPIYIEEIPETHKVDQHSYMVTPCNHVFHTSCLENWMSYKLQ  747

Query  234  CPTCRRPLPP  205
            CP CR PLPP
Sbjct  748  CPVCRSPLPP  757



>gb|AJS40038.1| Tul1p [Saccharomyces cerevisiae YJM1083]
 gb|AJS44232.1| Tul1p [Saccharomyces cerevisiae YJM1307]
Length=758

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 68/130 (52%), Gaps = 18/130 (14%)
 Frame = -3

Query  540  NFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQD----  373
            N  R   D  + + L +++  Q SI   Q   GSRWF+P+  +P+ YSY++    +    
Sbjct  628  NVFRHHKDVHFVVFLSLWLLFQISILYSQDVLGSRWFLPKHTIPDGYSYFKPLSNEYISE  687

Query  372  -----AVQPIDCVICMTNIDLSQRS---------NDCMVTPCDHFFHSGCLQRWMDIKME  235
                 A   +DC ICM+++ +             +  MVTPC+H FH+ CL+ WM  K++
Sbjct  688  HGGGTAEHTVDCAICMSDVPIYIEEIPETHKVDQHSYMVTPCNHVFHTSCLENWMSYKLQ  747

Query  234  CPTCRRPLPP  205
            CP CR PLPP
Sbjct  748  CPVCRSPLPP  757



>gb|EDV13055.1| transmembrane ubiquitin ligase 1 [Saccharomyces cerevisiae RM11-1a]
 gb|EGA85952.1| Tul1p [Saccharomyces cerevisiae VL3]
 gb|EWG84812.1| Tul1p [Saccharomyces cerevisiae R008]
 gb|EWG90112.1| Tul1p [Saccharomyces cerevisiae P301]
 gb|EWG94959.1| Tul1p [Saccharomyces cerevisiae R103]
 gb|EWH17340.1| Tul1p [Saccharomyces cerevisiae P283]
 gb|AHY76208.1| Tul1p [Saccharomyces cerevisiae YJM993]
 gb|AJP40002.1| Tul1p [Saccharomyces cerevisiae YJM1078]
 gb|AJS31395.1| Tul1p [Saccharomyces cerevisiae YJM248]
 gb|AJS38229.1| Tul1p [Saccharomyces cerevisiae YJM978]
 gb|AJS38832.1| Tul1p [Saccharomyces cerevisiae YJM984]
 gb|AJS39133.1| Tul1p [Saccharomyces cerevisiae YJM987]
 gb|AJS40343.1| Tul1p [Saccharomyces cerevisiae YJM1129]
 gb|AJS41249.1| Tul1p [Saccharomyces cerevisiae YJM1199]
 gb|AJS41550.1| Tul1p [Saccharomyces cerevisiae YJM1202]
 gb|AJS42155.1| Tul1p [Saccharomyces cerevisiae YJM1242]
 gb|AJS42455.1| Tul1p [Saccharomyces cerevisiae YJM1244]
 gb|AJS43326.1| Tul1p [Saccharomyces cerevisiae YJM1252]
 gb|AJS45130.1| Tul1p [Saccharomyces cerevisiae YJM1332]
 gb|AJS46037.1| Tul1p [Saccharomyces cerevisiae YJM1341]
 gb|AJS46640.1| Tul1p [Saccharomyces cerevisiae YJM1355]
 gb|AJS46942.1| Tul1p [Saccharomyces cerevisiae YJM1356]
 gb|AJS47544.1| Tul1p [Saccharomyces cerevisiae YJM1383]
 gb|AJS48145.1| Tul1p [Saccharomyces cerevisiae YJM1386]
 gb|AJS50473.1| Tul1p [Saccharomyces cerevisiae YJM1415]
 gb|AJS50774.1| Tul1p [Saccharomyces cerevisiae YJM1417]
 gb|AJS51682.1| Tul1p [Saccharomyces cerevisiae YJM1433]
 gb|AJS52881.1| Tul1p [Saccharomyces cerevisiae YJM1444]
 gb|AJS54366.1| Tul1p [Saccharomyces cerevisiae YJM1477]
 gb|AJS55563.1| Tul1p [Saccharomyces cerevisiae YJM1527]
Length=758

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 68/130 (52%), Gaps = 18/130 (14%)
 Frame = -3

Query  540  NFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQD----  373
            N  R   D  + + L +++  Q SI   Q   GSRWF+P+  +P+ YSY++    +    
Sbjct  628  NVFRHHKDVHFVVFLSLWLLFQISILYSQDVLGSRWFLPKHTIPDGYSYFKPLSNEYISE  687

Query  372  -----AVQPIDCVICMTNIDLSQRS---------NDCMVTPCDHFFHSGCLQRWMDIKME  235
                 A   +DC ICM+++ +             +  MVTPC+H FH+ CL+ WM  K++
Sbjct  688  HGGGTAEHTVDCAICMSDVPIYIEEIPETHKVDQHSYMVTPCNHVFHTSCLENWMSYKLQ  747

Query  234  CPTCRRPLPP  205
            CP CR PLPP
Sbjct  748  CPVCRSPLPP  757



>gb|EDZ70925.1| YKL034Wp-like protein [Saccharomyces cerevisiae AWRI1631]
 gb|AJS30200.1| Tul1p [Saccharomyces cerevisiae YJM189]
 gb|AJS31100.1| Tul1p [Saccharomyces cerevisiae YJM244]
 gb|AJS33741.1| Tul1p [Saccharomyces cerevisiae YJM453]
 gb|AJS45433.1| Tul1p [Saccharomyces cerevisiae YJM1336]
 gb|AJS45735.1| Tul1p [Saccharomyces cerevisiae YJM1338]
 gb|AJS55262.1| Tul1p [Saccharomyces cerevisiae YJM1526]
Length=758

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 68/130 (52%), Gaps = 18/130 (14%)
 Frame = -3

Query  540  NFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQD----  373
            N  R   D  + + L +++  Q SI   Q   GSRWF+P+  +P+ YSY++    +    
Sbjct  628  NVFRHHKDVHFVVFLSLWLLFQISILYSQDVLGSRWFLPKHTIPDGYSYFKPLSNEYISE  687

Query  372  -----AVQPIDCVICMTNIDLSQRS---------NDCMVTPCDHFFHSGCLQRWMDIKME  235
                 A   +DC ICM+++ +             +  MVTPC+H FH+ CL+ WM  K++
Sbjct  688  HGGGTAEHTVDCAICMSDVPIYIEEIPETHKVDQHSYMVTPCNHVFHTSCLENWMSYKLQ  747

Query  234  CPTCRRPLPP  205
            CP CR PLPP
Sbjct  748  CPVCRSPLPP  757



>gb|ETW45203.1| hypothetical protein PFNF135_00529 [Plasmodium falciparum NF135/5.C10]
 gb|EUT92296.1| hypothetical protein PFAG_00433 [Plasmodium falciparum Santa 
Lucia]
Length=828

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 49/122 (40%), Positives = 70/122 (57%), Gaps = 11/122 (9%)
 Frame = -3

Query  546  PHNFMRIE--------TDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYY  391
            PHN  +++        ++  + I +   + IQ     LQ  +G R+F+   +LP  ++YY
Sbjct  706  PHNIFQLDNFSQLIDTSNTMFSILIIFIVFIQCIYMLLQRIYGPRYFVNIDLLPHVHNYY  765

Query  390  RKFDQDAVQPI-DCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRP  214
            +  D +    I +CVICM +I L  + N   VTPC H FH  CLQ+WMDIK+ECPTCR P
Sbjct  766  KTIDVNFEAGIPECVICMYDIVL--KPNKYCVTPCYHIFHEKCLQQWMDIKLECPTCRGP  823

Query  213  LP  208
            LP
Sbjct  824  LP  825



>gb|EUR80363.1| hypothetical protein PFBG_00369 [Plasmodium falciparum 7G8]
Length=829

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 49/122 (40%), Positives = 70/122 (57%), Gaps = 11/122 (9%)
 Frame = -3

Query  546  PHNFMRIE--------TDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYY  391
            PHN  +++        ++  + I +   + IQ     LQ  +G R+F+   +LP  ++YY
Sbjct  707  PHNIFQLDNFSQLIDTSNTMFSILIIFIVFIQCIYMLLQRIYGPRYFVNIDLLPHVHNYY  766

Query  390  RKFDQDAVQPI-DCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRP  214
            +  D +    I +CVICM +I L  + N   VTPC H FH  CLQ+WMDIK+ECPTCR P
Sbjct  767  KTIDVNFEAGIPECVICMYDIVL--KPNKYCVTPCYHIFHEKCLQQWMDIKLECPTCRGP  824

Query  213  LP  208
            LP
Sbjct  825  LP  826



>gb|ETW38724.1| hypothetical protein PFTANZ_00561 [Plasmodium falciparum Tanzania 
(2000708)]
Length=830

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 49/122 (40%), Positives = 70/122 (57%), Gaps = 11/122 (9%)
 Frame = -3

Query  546  PHNFMRIE--------TDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYY  391
            PHN  +++        ++  + I +   + IQ     LQ  +G R+F+   +LP  ++YY
Sbjct  708  PHNIFQLDNFSQLIDTSNTMFSILIIFIVFIQCIYMLLQRIYGPRYFVNIDLLPHVHNYY  767

Query  390  RKFDQDAVQPI-DCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRP  214
            +  D +    I +CVICM +I L  + N   VTPC H FH  CLQ+WMDIK+ECPTCR P
Sbjct  768  KTIDVNFEAGIPECVICMYDIVL--KPNKYCVTPCYHIFHEKCLQQWMDIKLECPTCRGP  825

Query  213  LP  208
            LP
Sbjct  826  LP  827



>gb|ETW20583.1| hypothetical protein PFFVO_00494 [Plasmodium falciparum Vietnam 
Oak-Knoll (FVO)]
Length=835

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 49/122 (40%), Positives = 70/122 (57%), Gaps = 11/122 (9%)
 Frame = -3

Query  546  PHNFMRIE--------TDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYY  391
            PHN  +++        ++  + I +   + IQ     LQ  +G R+F+   +LP  ++YY
Sbjct  713  PHNIFQLDNFSQLIDTSNTMFSILIIFIVFIQCIYMLLQRIYGPRYFVNIDLLPHVHNYY  772

Query  390  RKFDQDAVQPI-DCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRP  214
            +  D +    I +CVICM +I L  + N   VTPC H FH  CLQ+WMDIK+ECPTCR P
Sbjct  773  KTIDVNFEAGIPECVICMYDIVL--KPNKYCVTPCYHIFHEKCLQQWMDIKLECPTCRGP  830

Query  213  LP  208
            LP
Sbjct  831  LP  832



>ref|XP_002367192.1| zinc finger (C3HC4 RING finger) protein, putative [Toxoplasma 
gondii ME49]
Length=806

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 42/100 (42%), Positives = 61/100 (61%), Gaps = 7/100 (7%)
 Frame = -3

Query  504  ICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYR----KFDQDAVQPI-DCVICM  340
            +C+ + M +Q  +   Q  FGSR+F+P   LP  Y+Y+R        DA + + +C ICM
Sbjct  690  VCIIVIMTLQVLLMLAQRRFGSRFFVPLDHLPHVYNYHRPLPASLSNDAEEGLPECAICM  749

Query  339  TNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCR  220
              I  +++S    +TPCDH FH  CLQ+WM++KMECP CR
Sbjct  750  NPI--ARKSRHRSITPCDHLFHDKCLQQWMEVKMECPNCR  787



>ref|XP_001351194.1| RING zinc finger protein, putative [Plasmodium falciparum 3D7]
 emb|CAA15602.1| RING zinc finger protein, putative [Plasmodium falciparum 3D7]
 gb|EWC90822.1| hypothetical protein PFNF54_00467 [Plasmodium falciparum NF54]
Length=836

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 49/122 (40%), Positives = 70/122 (57%), Gaps = 11/122 (9%)
 Frame = -3

Query  546  PHNFMRIE--------TDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYY  391
            PHN  +++        ++  + I +   + IQ     LQ  +G R+F+   +LP  ++YY
Sbjct  714  PHNIFQLDNFSQLIDTSNTMFSILIIFIVFIQCIYMLLQRIYGPRYFVNIDLLPHVHNYY  773

Query  390  RKFDQDAVQPI-DCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRP  214
            +  D +    I +CVICM +I L  + N   VTPC H FH  CLQ+WMDIK+ECPTCR P
Sbjct  774  KTIDVNFEAGIPECVICMYDIVL--KPNKYCVTPCYHIFHEKCLQQWMDIKLECPTCRGP  831

Query  213  LP  208
            LP
Sbjct  832  LP  833



>gb|ETW45712.1| hypothetical protein PFMALIP_06251 [Plasmodium falciparum MaliPS096_E11]
Length=837

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 49/122 (40%), Positives = 70/122 (57%), Gaps = 11/122 (9%)
 Frame = -3

Query  546  PHNFMRIE--------TDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYY  391
            PHN  +++        ++  + I +   + IQ     LQ  +G R+F+   +LP  ++YY
Sbjct  715  PHNIFQLDNFSQLIDTSNTMFSILIIFIVFIQCIYMLLQRIYGPRYFVNIDLLPHVHNYY  774

Query  390  RKFDQDAVQPI-DCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRP  214
            +  D +    I +CVICM +I L  + N   VTPC H FH  CLQ+WMDIK+ECPTCR P
Sbjct  775  KTIDVNFEAGIPECVICMYDIVL--KPNKYCVTPCYHIFHEKCLQQWMDIKLECPTCRGP  832

Query  213  LP  208
            LP
Sbjct  833  LP  834



>emb|CEJ00621.1| hypothetical protein RMCBS344292_14673 [Rhizopus microsporus]
Length=565

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 49/131 (37%), Positives = 69/131 (53%), Gaps = 19/131 (15%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYY----RKFD  379
            P N +  ET   W   +  ++G+Q  I  LQ  FG R  +P + LP+ Y Y+       D
Sbjct  434  PTNLIGHET-SSWIWVIVAYVGLQVVILFLQDAFGPRLVVPSRYLPDTYDYHPILTTNID  492

Query  378  QDAVQ-----PIDCVICMTNIDLSQRSN---------DCMVTPCDHFFHSGCLQRWMDIK  241
            ++ VQ     P DC ICM  +D++   +         + M+TPC H FH+ CL+RWM IK
Sbjct  493  EETVQQEIGQPKDCAICMLPVDIANHGHSGLNVLARANYMMTPCHHLFHTECLERWMRIK  552

Query  240  MECPTCRRPLP  208
            +ECP CR  LP
Sbjct  553  LECPVCRAYLP  563



>gb|AJS47240.1| Tul1p [Saccharomyces cerevisiae YJM1381]
Length=758

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 68/130 (52%), Gaps = 18/130 (14%)
 Frame = -3

Query  540  NFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQD----  373
            N  R   D  + + L +++  Q SI   Q   GSRWF+P+  +P+ YSY++    +    
Sbjct  628  NVFRHHKDVHFVVFLSLWLLFQISILYSQDVLGSRWFLPKHAIPDGYSYFKPLSNEYISE  687

Query  372  -----AVQPIDCVICMTNIDLSQRS---------NDCMVTPCDHFFHSGCLQRWMDIKME  235
                 A   +DC ICM+++ +             +  MVTPC+H FH+ CL+ WM  K++
Sbjct  688  HGGGTAGHTVDCAICMSDVPIYIEEIPETHKVDQHSYMVTPCNHVFHTSCLENWMSYKLQ  747

Query  234  CPTCRRPLPP  205
            CP CR PLPP
Sbjct  748  CPVCRSPLPP  757



>gb|AJS30800.1| Tul1p [Saccharomyces cerevisiae YJM195]
Length=758

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 68/130 (52%), Gaps = 18/130 (14%)
 Frame = -3

Query  540  NFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQD----  373
            N  R   D  + + L +++  Q SI   Q   GSRWF+P+  +P+ YSY++    +    
Sbjct  628  NVFRHHKDVHFIVFLSLWLLFQISILYSQDVLGSRWFLPKHTIPDGYSYFKPLSNEYISE  687

Query  372  -----AVQPIDCVICMTNIDLSQRS---------NDCMVTPCDHFFHSGCLQRWMDIKME  235
                 A   +DC ICM+++ +             +  MVTPC+H FH+ CL+ WM  K++
Sbjct  688  HGGGTAEHTVDCAICMSDVPIYIEEIPETHKVDQHSYMVTPCNHVFHTSCLENWMSYKLQ  747

Query  234  CPTCRRPLPP  205
            CP CR PLPP
Sbjct  748  CPVCRSPLPP  757



>gb|AJS56725.1| Tul1p [Saccharomyces cerevisiae YJM1592]
Length=758

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 68/130 (52%), Gaps = 18/130 (14%)
 Frame = -3

Query  540  NFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQD----  373
            N  R   D  + + L +++  Q SI   Q   GSRWF+P+  +P+ YSY++    +    
Sbjct  628  NVFRHHKDVHFVVFLSLWLLFQISILYSQDVLGSRWFLPKHTIPDGYSYFKPLSNEYISE  687

Query  372  -----AVQPIDCVICMTNIDLSQRS---------NDCMVTPCDHFFHSGCLQRWMDIKME  235
                 A    DC ICM+++ +             +  MVTPC+H FH+ CL+ WM+ K++
Sbjct  688  HGGGTAEHTFDCAICMSDVPIYIEEIPETHKVDQHSYMVTPCNHVFHTSCLENWMNYKLQ  747

Query  234  CPTCRRPLPP  205
            CP CR PLPP
Sbjct  748  CPVCRSPLPP  757



>ref|XP_003647903.1| hypothetical protein Ecym_7241 [Eremothecium cymbalariae DBVPG#7215]
 gb|AET41086.1| hypothetical protein Ecym_7241 [Eremothecium cymbalariae DBVPG#7215]
Length=758

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/131 (36%), Positives = 68/131 (52%), Gaps = 17/131 (13%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRK-FDQDA  370
            P N  R   D ++   L  ++ +Q  +   Q   G+RWF+PR  +PE YSY++     D 
Sbjct  627  PSNMFRHHRDIRFAAILSFWLLLQILVLYSQDILGARWFLPRHTIPEGYSYHKAMLSSDL  686

Query  369  VQP-------IDCVICMTNIDL---------SQRSNDCMVTPCDHFFHSGCLQRWMDIKM  238
            ++        IDC ICM+ + +             N+ MVTPC H FH+ CL+ WM  K+
Sbjct  687  LEHGATGNYCIDCAICMSEVAIYVEDIPETHKTNPNEYMVTPCAHVFHTECLENWMSYKL  746

Query  237  ECPTCRRPLPP  205
            +CP CR PLPP
Sbjct  747  QCPVCRAPLPP  757



>gb|AJS49273.1| Tul1p [Saccharomyces cerevisiae YJM1399]
Length=758

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 68/130 (52%), Gaps = 18/130 (14%)
 Frame = -3

Query  540  NFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQD----  373
            N  R   D  + + L +++  Q SI   Q   GSRWF+P+  +P+ YSY++    +    
Sbjct  628  NVFRHHKDFHFVVFLSLWLLFQISILYSQDVLGSRWFLPKHTIPDGYSYFKPLSNEYISE  687

Query  372  -----AVQPIDCVICMTNIDLSQRS---------NDCMVTPCDHFFHSGCLQRWMDIKME  235
                 A   +DC ICM+++ +             +  MVTPC+H FH+ CL+ WM  K++
Sbjct  688  HGGGTAEHTVDCAICMSDVPIYIEEIPETHKVDQHSYMVTPCNHVFHTSCLENWMSYKLQ  747

Query  234  CPTCRRPLPP  205
            CP CR PLPP
Sbjct  748  CPVCRSPLPP  757



>dbj|GAA24689.1| K7_Tul1p [Saccharomyces cerevisiae Kyokai no. 7]
Length=758

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 68/130 (52%), Gaps = 18/130 (14%)
 Frame = -3

Query  540  NFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQD----  373
            N  R   D  + + L +++  Q SI   Q   GSRWF+P+  +P+ YSY++    +    
Sbjct  628  NVFRHHKDVHFVVFLSLWLLFQISILYSQDVLGSRWFLPKHTIPDGYSYFKPLSNEYISE  687

Query  372  -----AVQPIDCVICMTNIDLSQRS---------NDCMVTPCDHFFHSGCLQRWMDIKME  235
                 A    DC ICM+++ +             +  MVTPC+H FH+ CL+ WM+ K++
Sbjct  688  HGGGTAEHTFDCAICMSDVPIYIEEIPETHKVDQHSYMVTPCNHVFHTSCLENWMNYKLQ  747

Query  234  CPTCRRPLPP  205
            CP CR PLPP
Sbjct  748  CPVCRSPLPP  757



>gb|KFH64130.1| hypothetical protein MVEG_09955 [Mortierella verticillata NRRL 
6337]
Length=769

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 52/139 (37%), Positives = 71/139 (51%), Gaps = 27/139 (19%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKF---DQ  376
            P N M  E   KW   L +++ +Q ++  LQ + G R+FIP++ LP  Y Y+      D+
Sbjct  630  PENLMGHEP-TKWIWGLVLWVALQVAVLLLQDWLGPRFFIPKKYLPPIYDYHPIIPAGDE  688

Query  375  DAVQPI---------DCVICMTNIDLSQRSN--------------DCMVTPCDHFFHSGC  265
            ++ Q I         DC ICM  ID +  S               + M+TPC H FHS C
Sbjct  689  ESGQSITGHTHGHQQDCAICMLPIDTASTSGHARLSSVVGSLGRLNYMLTPCGHLFHSDC  748

Query  264  LQRWMDIKMECPTCRRPLP  208
            L+RWM IK+ECP CR  LP
Sbjct  749  LERWMRIKLECPNCRAFLP  767



>gb|EUD70830.1| hypothetical protein YYG_03952 [Plasmodium vinckei petteri]
Length=673

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 45/95 (47%), Positives = 60/95 (63%), Gaps = 3/95 (3%)
 Frame = -3

Query  489  FMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAVQPI-DCVICMTNIDLSQRS  313
            F+ +Q     +Q  +G R+F    +LP  ++YY+  D +    I +CVICM NI L+  +
Sbjct  578  FISLQLLFMYIQRIYGPRYFFNTSLLPHVHNYYQNLDPNFEAGIPECVICMYNIILNN-T  636

Query  312  NDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLP  208
              C VTPC H FH  CLQ+WM+IKMECPTCR PLP
Sbjct  637  KYC-VTPCYHIFHEKCLQQWMNIKMECPTCRGPLP  670



>ref|XP_002289009.1| hypothetical protein THAPSDRAFT_261916 [Thalassiosira pseudonana 
CCMP1335]
 gb|EED94445.1| hypothetical protein THAPSDRAFT_261916, partial [Thalassiosira 
pseudonana CCMP1335]
Length=251

 Score = 92.0 bits (227),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 70/112 (63%), Gaps = 3/112 (3%)
 Frame = -3

Query  540  NFMR-IETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAVQ  364
            NF++ +  D   C  L +++ IQ ++   Q  FG+R+ IP++ LP K+ Y +    DA  
Sbjct  142  NFLKEVNPDPNMCKMLFVWVIIQTAVLIGQGKFGTRFMIPQRFLPPKFDYSQVVVPDA-P  200

Query  363  PIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLP  208
             +DCVIC   ID++ R+   M+ PCDH FH  CL++WM++KMECP CR  LP
Sbjct  201  TLDCVICYNEIDVNDRAGY-MLAPCDHIFHRQCLEQWMEVKMECPICRCNLP  251



>ref|XP_001613139.1| hypothetical protein [Plasmodium vivax Sal-1]
 gb|EDL43412.1| hypothetical protein, conserved [Plasmodium vivax]
Length=733

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 44/106 (42%), Positives = 64/106 (60%), Gaps = 3/106 (3%)
 Frame = -3

Query  522  TDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAVQPI-DCVI  346
            ++  + I L + + +Q  +  LQ  +G R  I  ++LP  ++YYR  D +    + +CVI
Sbjct  627  SNSTFSILLIVILAVQLLLMSLQRLYGPRHLIDLELLPHVHNYYRTVDPNFETGLPECVI  686

Query  345  CMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLP  208
            CM +I L  R+    VTPC H FH  CLQ+WMD+K+ECPTCR  LP
Sbjct  687  CMYDIVLKNRTY--CVTPCLHIFHEKCLQQWMDVKLECPTCRGALP  730



>ref|XP_002785476.1| zinc finger protein, putative [Perkinsus marinus ATCC 50983]
 gb|EER17272.1| zinc finger protein, putative [Perkinsus marinus ATCC 50983]
Length=511

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 68/113 (60%), Gaps = 11/113 (10%)
 Frame = -3

Query  525  ETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKF----DQDAVQPI  358
             T+    +CL +    Q +I   Q  FG R F+P   LP  Y+YYR      D++   P 
Sbjct  400  STEATLIVCLQV---AQIAIMWAQARFGPRSFVPWICLPHVYNYYRAVPSVQDEELGAP-  455

Query  357  DCVICMTNIDLSQR---SNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLP  208
            +CVICM +IDLS+     +  ++TPCDH FH+ CL++WMD+KMECPTCR  LP
Sbjct  456  ECVICMNDIDLSEVHDPESRPVITPCDHIFHAACLEQWMDVKMECPTCRGELP  508



>ref|XP_009692712.1| uncharacterized protein TOT_040000778 [Theileria orientalis strain 
Shintoku]
 dbj|BAM42411.1| uncharacterized protein TOT_040000778 [Theileria orientalis strain 
Shintoku]
Length=1194

 Score = 95.9 bits (237),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 46/108 (43%), Positives = 62/108 (57%), Gaps = 7/108 (6%)
 Frame = -3

Query  519   DKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYR---KFDQDAVQPIDCV  349
             ++K    +     +Q  +  +Q   G R F+   ILP+ YSY R   K  QD  Q  +CV
Sbjct  1065  NRKLVYIITFIASVQLILIAVQRLKGPRSFVSWSILPKIYSYVRPWSKIMQDDDQ--ECV  1122

Query  348   ICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPP  205
             ICM   D+ Q + D  +TPCDH FH+ CL+ W  IK+ECP CRRP+PP
Sbjct  1123  ICM--YDIVQSNRDWCLTPCDHLFHTKCLKDWTSIKLECPNCRRPIPP  1168



>ref|XP_004182327.1| hypothetical protein TBLA_0I01490 [Tetrapisispora blattae CBS 
6284]
 emb|CCH62808.1| hypothetical protein TBLA_0I01490 [Tetrapisispora blattae CBS 
6284]
Length=750

 Score = 95.1 bits (235),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 68/122 (56%), Gaps = 17/122 (14%)
 Frame = -3

Query  519  DKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV--------Q  364
            D K+ I + I++ +Q  +   Q  FGSRWF+P  ++P+ Y Y++    + +         
Sbjct  628  DIKFAIFISIWLLLQILVLYSQELFGSRWFLPIHVIPDGYQYHKSVSNELLLEHGTNKNH  687

Query  363  PIDCVICMTNI-----DLSQRSN----DCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPL  211
             +DC ICM+ +     D+ +  N      M+TPC+H FH+ CL+ WM  K++CP CR PL
Sbjct  688  TVDCTICMSEVPVYIQDIEETHNIDKDTYMITPCNHIFHTTCLENWMSYKLQCPVCRAPL  747

Query  210  PP  205
            PP
Sbjct  748  PP  749



>ref|XP_007510435.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18780.1| predicted protein [Bathycoccus prasinos]
Length=616

 Score = 94.7 bits (234),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 49/120 (41%), Positives = 69/120 (58%), Gaps = 10/120 (8%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSR--WFIPRQILPEKYSYYRKFDQD  373
            P NF R E +   C  + +++ +QA I   QHYF  R   F   + LPE ++Y++ +   
Sbjct  500  PKNFARNEPNYVLCASVSLYVFVQAFILFAQHYFHPRIVTFKLTKWLPEVHNYHKSY---  556

Query  372  AVQPIDCVICMTNIDLSQRS---NDC-MVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPP  205
             V+  DC IC++N+     S   N+  M  PC H FH+ CL RWMD+K+ECPTCR  LPP
Sbjct  557  -VKFGDCSICLSNLKSESESMSPNEMQMHAPCGHVFHAHCLSRWMDVKLECPTCRAKLPP  615



>emb|CEP15925.1| hypothetical protein [Parasitella parasitica]
Length=709

 Score = 94.7 bits (234),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 45/121 (37%), Positives = 62/121 (51%), Gaps = 20/121 (17%)
 Frame = -3

Query  510  WCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQD-----------AVQ  364
            W   L  +M +Q  +  LQ  FG R+F+P + LP+ Y+Y+     D             Q
Sbjct  587  WVYALVAYMALQVIVLFLQDAFGPRFFVPSRYLPQTYNYHPILALDDEETTENPASKTQQ  646

Query  363  PIDCVICMTNIDLSQRSN---------DCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPL  211
            P DC ICM  ID +   +         + M+TPC H FH+ CL++WM IK+ECP CR  L
Sbjct  647  PKDCAICMLPIDANSHGHSSLNVLSRTNYMMTPCHHMFHTDCLEKWMRIKLECPVCRAYL  706

Query  210  P  208
            P
Sbjct  707  P  707



>emb|CDR11290.1| E3 ubiquitin-protein ligase, putative [Plasmodium chabaudi chabaudi]
Length=698

 Score = 94.4 bits (233),  Expect = 8e-19, Method: Composition-based stats.
 Identities = 45/95 (47%), Positives = 59/95 (62%), Gaps = 3/95 (3%)
 Frame = -3

Query  489  FMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAVQPI-DCVICMTNIDLSQRS  313
            F+ +Q      Q  +G R+F    +LP  ++YY+  D +    I +CVICM NI L+  +
Sbjct  603  FISLQLLFMYAQRIYGPRYFFNTSLLPHVHNYYQNLDPNFEAGIPECVICMYNIILNN-T  661

Query  312  NDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLP  208
              C VTPC H FH  CLQ+WM+IKMECPTCR PLP
Sbjct  662  KYC-VTPCYHIFHEKCLQQWMNIKMECPTCRGPLP  695



>ref|XP_003673421.1| hypothetical protein NCAS_0A04760 [Naumovozyma castellii CBS 
4309]
 emb|CCC67034.1| hypothetical protein NCAS_0A04760 [Naumovozyma castellii CBS 
4309]
Length=761

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 71/129 (55%), Gaps = 17/129 (13%)
 Frame = -3

Query  540  NFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYR--------K  385
            N  R   D ++ + L +++  Q SI   Q   G+RWF+P+  +PE Y Y++        K
Sbjct  632  NIFRHHRDPRFVVFLSLWLLFQLSIMYSQDILGARWFLPQHSIPEGYIYFKPVSLAHLAK  691

Query  384  FDQDAVQPIDCVICMTN----IDLSQRSNDC-----MVTPCDHFFHSGCLQRWMDIKMEC  232
             +  +    DC ICM+     I+ ++ +++      MVTPCDH FH+ CL+ WM  K++C
Sbjct  692  HEGASKHTADCAICMSEVPVYIEEAEETHNIDQHSYMVTPCDHIFHTDCLENWMGYKLQC  751

Query  231  PTCRRPLPP  205
            P CR PLPP
Sbjct  752  PVCRTPLPP  760



>ref|XP_008625954.1| hypothetical protein YYE_04091 [Plasmodium vinckei vinckei]
 gb|KEG01056.1| hypothetical protein YYE_04091 [Plasmodium vinckei vinckei]
Length=664

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 45/95 (47%), Positives = 59/95 (62%), Gaps = 3/95 (3%)
 Frame = -3

Query  489  FMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAVQPI-DCVICMTNIDLSQRS  313
            F+ +Q     +Q  +G R+F    +LP  ++YY+  D +    I +CVICM NI L   +
Sbjct  569  FISLQLLFMYVQRIYGPRYFFNTSLLPHVHNYYQNLDPNFEAGIPECVICMYNIIL-HNT  627

Query  312  NDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLP  208
              C VTPC H FH  CLQ+WM+IKMECPTCR PLP
Sbjct  628  KYC-VTPCYHIFHEKCLQQWMNIKMECPTCRGPLP  661



>ref|XP_003283597.1| hypothetical protein DICPUDRAFT_74595 [Dictyostelium purpureum]
 gb|EGC39846.1| hypothetical protein DICPUDRAFT_74595 [Dictyostelium purpureum]
Length=586

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 42/108 (39%), Positives = 67/108 (62%), Gaps = 8/108 (7%)
 Frame = -3

Query  498  LGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFD---QDAVQPIDCVICMTNID  328
            L ++  +Q SI   Q+ FG ++FIP + LP++Y+YYR  +   +   +   CVICM++++
Sbjct  483  LVLWTALQVSILYAQYKFGPQFFIPARFLPQRYNYYRPINNTIRSREEGQGCVICMSDVE  542

Query  327  LSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPPA*VDCII  184
              Q+    M+T C+H FH  CL  WM+ K++CPTCR  L P  +D +I
Sbjct  543  EGQKY---MLTQCNHLFHEKCLVSWMEYKLQCPTCRCALEP--IDIVI  585



>ref|XP_004222160.1| zinc finger protein, partial [Plasmodium cynomolgi strain B]
 dbj|GAB66213.1| zinc finger protein, partial [Plasmodium cynomolgi strain B]
Length=692

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 44/106 (42%), Positives = 63/106 (59%), Gaps = 3/106 (3%)
 Frame = -3

Query  522  TDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAVQPI-DCVI  346
            ++  + I L + + +Q     LQ  +G R  I   +LP  ++YY+  D +    I +CVI
Sbjct  586  SNSTFSILLILILAVQLLFMSLQRLYGPRHLIDIDLLPHVHNYYKSIDPNFEMGIPECVI  645

Query  345  CMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLP  208
            CM +I L++R     VTPC H FH  CLQ+WMD+K+ECPTCR  LP
Sbjct  646  CMYDIVLNERKY--CVTPCVHIFHEKCLQQWMDVKLECPTCRGALP  689



>ref|XP_003886041.1| hypothetical protein NCLIV_064410 [Neospora caninum Liverpool]
 emb|CBZ56015.1| hypothetical protein NCLIV_064410 [Neospora caninum Liverpool]
Length=794

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 42/89 (47%), Positives = 56/89 (63%), Gaps = 7/89 (8%)
 Frame = -3

Query  456  QHYFGSRWFIPRQILPEKYSYYR----KFDQDAVQPI-DCVICMTNIDLSQRSNDCMVTP  292
            Q  FGSR+F+P   LP  Y+Y+R        DA + + +C ICM  I  +++S    +TP
Sbjct  706  QRRFGSRFFVPLDHLPHVYNYHRPLPASLANDAEEGLPECAICMNPI--ARKSRHRSITP  763

Query  291  CDHFFHSGCLQRWMDIKMECPTCRRPLPP  205
            CDH FH  CLQ+WM++KMECP CR  LPP
Sbjct  764  CDHLFHDKCLQQWMEVKMECPNCRGALPP  792



>ref|XP_448854.1| hypothetical protein [Candida glabrata CBS 138]
 emb|CAG61824.1| unnamed protein product [Candida glabrata]
Length=757

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/131 (38%), Positives = 67/131 (51%), Gaps = 17/131 (13%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYR-------  388
            P N  R   D K  I L +++  Q S+   Q   GSRWF+P+  +PE+YSY+R       
Sbjct  626  PSNVFRHHKDSKVVILLILWLLFQISVLYSQDILGSRWFLPKHSIPEEYSYHRVVSLQHL  685

Query  387  -KFDQDAVQPIDCVICMTNI--------DLSQRSNDC-MVTPCDHFFHSGCLQRWMDIKM  238
             +        +DC ICM           +  Q   D  M+TPCDH FH+ CL+ WM  K+
Sbjct  686  MEHGGSENHTVDCAICMAEFPVYVEELPETHQVDKDSYMITPCDHMFHTSCLESWMSYKL  745

Query  237  ECPTCRRPLPP  205
            +CP CR PLPP
Sbjct  746  QCPVCRSPLPP  756



>gb|EPB85544.1| hypothetical protein HMPREF1544_07633 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=382

 Score = 90.1 bits (222),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 66/133 (50%), Gaps = 21/133 (16%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQD--  373
            P+N +       W   L  ++ IQ  +  LQ  FG R+F+P + LP+ Y+Y+     D  
Sbjct  249  PNNLIG-HQSTPWVYALVAYVAIQVVVLFLQDAFGPRFFVPSRYLPQTYNYHPILSVDDE  307

Query  372  ---------AVQPIDCVICMTNIDLSQRSNDC---------MVTPCDHFFHSGCLQRWMD  247
                     + QP DC ICM  ID +   +           M+TPC H FH+ CL++WM 
Sbjct  308  ETSEDPTGKSQQPKDCAICMLPIDTNHHGHSSLNVLSRTNYMITPCHHMFHTECLEKWMR  367

Query  246  IKMECPTCRRPLP  208
            IK+ECP CR  LP
Sbjct  368  IKLECPVCRAYLP  380



>ref|XP_733999.1| hypothetical protein [Plasmodium chabaudi chabaudi]
 emb|CAH83386.1| hypothetical protein PC300476.00.0 [Plasmodium chabaudi chabaudi]
Length=210

 Score = 88.2 bits (217),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 63/106 (59%), Gaps = 3/106 (3%)
 Frame = -3

Query  522  TDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAVQPI-DCVI  346
            ++  +   +  F+ +Q      Q  +G R+F    +LP  ++YY+  D +    I +CVI
Sbjct  105  SNSTFSFLIIFFISLQLLFMYAQRIYGPRYFFNTSLLPHVHNYYQNLDPNFEAGIPECVI  164

Query  345  CMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLP  208
            CM NI L+  +  C VTPC H FH  CLQ+WM+IKMECPTCR PLP
Sbjct  165  CMYNIILN-NTKYC-VTPCYHIFHEKCLQQWMNIKMECPTCRGPLP  208



>ref|XP_745772.1| zinc finger protein [Plasmodium chabaudi chabaudi]
 emb|CAH78794.1| zinc finger protein, putative [Plasmodium chabaudi chabaudi]
Length=338

 Score = 89.0 bits (219),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 63/106 (59%), Gaps = 3/106 (3%)
 Frame = -3

Query  522  TDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAVQPI-DCVI  346
            ++  +   +  F+ +Q      Q  +G R+F    +LP  ++YY+  D +    I +CVI
Sbjct  232  SNSTFSFLIIFFISLQLLFMYAQRIYGPRYFFNTSLLPHVHNYYQNLDPNFEAGIPECVI  291

Query  345  CMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLP  208
            CM NI L+  +  C VTPC H FH  CLQ+WM+IKMECPTCR PLP
Sbjct  292  CMYNIILNN-TKYC-VTPCYHIFHEKCLQQWMNIKMECPTCRGPLP  335



>ref|XP_456223.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 emb|CAG98931.1| KLLA0F25674p [Kluyveromyces lactis]
Length=757

 Score = 91.3 bits (225),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 44/130 (34%), Positives = 66/130 (51%), Gaps = 16/130 (12%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P N  R + D ++ + L ++M  Q  I   Q   GSRWF+P+ ++P+ Y Y+R   Q  +
Sbjct  627  PSNVFRHDIDVRFAVLLSLWMLFQLLILYSQDLLGSRWFLPQHVIPDGYHYHRPVPQSIL  686

Query  366  QPID-------CVICMTNIDLSQRSND---------CMVTPCDHFFHSGCLQRWMDIKME  235
                       C ICM ++ +     +          M+TPC H FH+ CL+ WM  K++
Sbjct  687  MEYGSQNNCFVCPICMVDVPVYVEETEETHKIDAQSYMITPCSHIFHTECLENWMSYKLQ  746

Query  234  CPTCRRPLPP  205
            CP CR PLPP
Sbjct  747  CPVCRAPLPP  756



>dbj|BAO41609.1| transmembrane E3 ubiquitin-protein ligase 1 [Kluyveromyces marxianus 
DMKU3-1042]
 dbj|BAP73050.1| transmembrane E3 ubiquitin-protein ligase 1 [Kluyveromyces marxianus]
Length=757

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 42/130 (32%), Positives = 64/130 (49%), Gaps = 16/130 (12%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P N  R + D ++ + L ++M  Q  I   Q   GSRWF+P+ ++P+ Y Y++      +
Sbjct  627  PSNVFRHDKDVRFAVLLSLWMLFQILILYSQDLLGSRWFLPKHVMPDGYHYHKGVPVSIL  686

Query  366  -------QPIDCVICMTNIDLSQRSND---------CMVTPCDHFFHSGCLQRWMDIKME  235
                       C ICM ++ +     +          MVTPC H FH+ CL+ WM  K++
Sbjct  687  MEYGSEDNTFACPICMVDVPVYVEEKEETHKVDIQSYMVTPCSHVFHTECLENWMSYKLQ  746

Query  234  CPTCRRPLPP  205
            CP CR  LPP
Sbjct  747  CPVCRAALPP  756



>emb|CDS07323.1| hypothetical protein LRAMOSA01272 [Absidia idahoensis var. thermophila]
Length=690

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 48/138 (35%), Positives = 67/138 (49%), Gaps = 25/138 (18%)
 Frame = -3

Query  546  PHNFMRIETDK-KWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKF----  382
            PHN +  ET    W   L +++G+QA I  LQ   G R+F+  + LP+ Y+Y+       
Sbjct  555  PHNLIAHETSPLVWF--LALYVGLQAFILYLQDVLGPRFFVSERFLPQTYNYHPIIPPSD  612

Query  381  ---------DQDAVQPIDCVICMTNIDLSQRS---------NDCMVTPCDHFFHSGCLQR  256
                     +     P DC ICM  +D S               M+TPC H FH+ CL++
Sbjct  613  EENASGVAAENGGALPRDCAICMLPVDTSGTGPPGLHVLGRAQYMLTPCQHLFHTECLEK  672

Query  255  WMDIKMECPTCRRPLPPA  202
            WM IK+ECP CR  LP +
Sbjct  673  WMRIKLECPVCRSYLPAS  690



>gb|AGO13409.1| AaceriAFR275Wp [Saccharomycetaceae sp. 'Ashbya aceri']
Length=754

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/131 (37%), Positives = 73/131 (56%), Gaps = 17/131 (13%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P N  R   D ++ + L I++ +Q  I  LQ  FG+RWF+P+  +PE YSY++     ++
Sbjct  623  PSNIFRHHRDVRYAVGLSIWLLLQILILFLQDTFGARWFLPKSAIPEGYSYHKPLHSTSL  682

Query  366  QP--------IDCVICMTNIDL-------SQRSN--DCMVTPCDHFFHSGCLQRWMDIKM  238
                      + C ICM+ + +       + ++N  D MVTPC H FH+ CL+ WM  K+
Sbjct  683  LEHGANDNYCVSCAICMSELSIHVEDIPETHKANIHDYMVTPCSHLFHTSCLENWMSYKL  742

Query  237  ECPTCRRPLPP  205
            +CP CR PLPP
Sbjct  743  QCPVCRAPLPP  753



>ref|XP_008817707.1| hypothetical protein C922_03898 [Plasmodium inui San Antonio 
1]
 gb|EUD65650.1| hypothetical protein C922_03898 [Plasmodium inui San Antonio 
1]
Length=695

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 44/102 (43%), Positives = 59/102 (58%), Gaps = 3/102 (3%)
 Frame = -3

Query  510  WCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAVQPI-DCVICMTN  334
            + I L + + +Q     LQ  +G R  I   +LP  ++YY+  D +    I +CVICM +
Sbjct  593  FSILLIVILAVQLFFMSLQRLYGPRHLIDIDLLPHVHNYYKTIDPNFETGIPECVICMYD  652

Query  333  IDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLP  208
            I L  R     VTPC H FH  CLQ+WMD+K+ECPTCR  LP
Sbjct  653  IVLKDRKY--CVTPCFHIFHEKCLQQWMDVKLECPTCRGALP  692



>emb|CAA16876.2| hypothetical protein [Arabidopsis thaliana]
 emb|CAB79639.1| hypothetical protein [Arabidopsis thaliana]
Length=479

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 54/83 (65%), Gaps = 20/83 (24%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            PHNFMR+E +K                    HYFGSR F+PRQ+LPEKY+Y+R+F++D  
Sbjct  352  PHNFMRVEPNK--------------------HYFGSRCFVPRQMLPEKYNYHRRFNRDVS  391

Query  366  QPIDCVICMTNIDLSQRSNDCMV  298
            +  DCVICMT IDL Q ++DCMV
Sbjct  392  RTTDCVICMTAIDLRQHTSDCMV  414



>gb|ACU45293.1| zinc finger [Karlodinium veneficum]
Length=273

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 60/106 (57%), Gaps = 4/106 (4%)
 Frame = -3

Query  519  DKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAVQP-IDCVIC  343
            + + C  + +  G Q  +   Q   G RWFIP   LP  Y+Y R+  +  V P  +CVIC
Sbjct  169  NPRLCAAVVLLQGAQVGLMASQKVLGPRWFIPWICLPNVYNYSRRTVE--VPPDAECVIC  226

Query  342  MTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPP  205
            M  +  ++ S     TPC H FH  CL++WMDIKMECPTCR  LPP
Sbjct  227  MAELA-AEESQLRAFTPCGHCFHRRCLEQWMDIKMECPTCRTALPP  271



>gb|EAS01841.3| zinc finger, C3HC4 type (RING finger) protein [Tetrahymena thermophila 
SB210]
Length=612

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/140 (36%), Positives = 71/140 (51%), Gaps = 28/140 (20%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXL--QHYFGSRWFIPRQILPEKYSYYRKFDQD  373
            P N  ++    ++  C+GI + I A +  L  Q YFG R+FIP++   + Y YY K    
Sbjct  473  PENIAKLSP--QYSTCIGIVVIIIAQVLFLYAQEYFGPRFFIPKRFQTDCYDYYYKLPHS  530

Query  372  AV------QPIDCVICMTNIDL------------------SQRSNDCMVTPCDHFFHSGC  265
             V      Q  +C IC+T + +                   Q+ N  M TPCDH +H  C
Sbjct  531  QVDLESQGQADECTICITELSMQPVLQSNSSYFKDLIIKAKQKQNYIMKTPCDHKYHIPC  590

Query  264  LQRWMDIKMECPTCRRPLPP  205
            L +WM++KMECPTCR PLPP
Sbjct  591  LLKWMEVKMECPTCRAPLPP  610



>emb|CDK24298.1| unnamed protein product [Kuraishia capsulata CBS 1993]
Length=809

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 43/126 (34%), Positives = 66/126 (52%), Gaps = 30/126 (24%)
 Frame = -3

Query  492  IFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYR-------------KFDQDAVQ----  364
            I++GIQ  +  LQ  FG+R+F+P ++LP+ Y Y+              + D + V     
Sbjct  683  IWLGIQIFVLVLQELFGARFFLPDRLLPKSYDYHPVLTAGDLEHGFGVEHDDEGVHHEDG  742

Query  363  --PIDCVICMTNIDLS-QRSND----------CMVTPCDHFFHSGCLQRWMDIKMECPTC  223
               +DC ICM  +++   +S++           MVTPC H FH+ CL+ WM  K++CP C
Sbjct  743  KCKVDCAICMNEVEIPIAKSSEHLTNIMNRRGYMVTPCRHIFHTNCLESWMKYKLQCPVC  802

Query  222  RRPLPP  205
            R  LPP
Sbjct  803  RNSLPP  808



>ref|XP_001022086.2| zinc finger protein [Tetrahymena thermophila]
Length=689

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 51/140 (36%), Positives = 71/140 (51%), Gaps = 28/140 (20%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXL--QHYFGSRWFIPRQILPEKYSYYRKFDQD  373
            P N  ++    ++  C+GI + I A +  L  Q YFG R+FIP++   + Y YY K    
Sbjct  550  PENIAKLSP--QYSTCIGIVVIIIAQVLFLYAQEYFGPRFFIPKRFQTDCYDYYYKLPHS  607

Query  372  AV------QPIDCVICMTNIDL------------------SQRSNDCMVTPCDHFFHSGC  265
             V      Q  +C IC+T + +                   Q+ N  M TPCDH +H  C
Sbjct  608  QVDLESQGQADECTICITELSMQPVLQSNSSYFKDLIIKAKQKQNYIMKTPCDHKYHIPC  667

Query  264  LQRWMDIKMECPTCRRPLPP  205
            L +WM++KMECPTCR PLPP
Sbjct  668  LLKWMEVKMECPTCRAPLPP  687



>ref|XP_001694228.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP02661.1| predicted protein, partial [Chlamydomonas reinhardtii]
Length=264

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 67/117 (57%), Gaps = 4/117 (3%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P N +RI T    C+ L +++  QA++   Q  +G R F+P+  LP++Y Y+R   +  +
Sbjct  148  PANLLRITTRPGLCLALCVWLAAQAALVAAQIKWGPRVFVPKAFLPQRYDYHRAATRREM  207

Query  366  ---QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLPP  205
                  +CVICM  + L       MVTPC HFFH  CL RW+ +   CPTCRRPLPP
Sbjct  208  GLDDGTECVICMNPVALLPPRCR-MVTPCGHFFHEPCLSRWIAVNSTCPTCRRPLPP  263



>ref|XP_003679974.1| hypothetical protein TDEL_0B06340 [Torulaspora delbrueckii]
 emb|CCE90763.1| hypothetical protein TDEL_0B06340 [Torulaspora delbrueckii]
Length=762

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 64/129 (50%), Gaps = 17/129 (13%)
 Frame = -3

Query  540  NFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV--  367
            N  R   D ++ + L +++  Q ++   Q   GSRWF+P+  +PE YSY++      +  
Sbjct  633  NVFRHHKDVRFVVVLCLYLLFQIAVLYSQDILGSRWFLPKLAIPEGYSYHKPMSAQELME  692

Query  366  ------QPIDCVICMTNIDLSQRS---------NDCMVTPCDHFFHSGCLQRWMDIKMEC  232
                    +DC ICM+ + +                M TPC H FH+ CL+ WM  K++C
Sbjct  693  HGSSVDHTVDCAICMSEVPVYVEDVPETHKVDLQTYMTTPCGHVFHTQCLENWMSYKLQC  752

Query  231  PTCRRPLPP  205
            P CR PLPP
Sbjct  753  PVCRSPLPP  761



>ref|XP_002499175.1| ZYRO0E05632p [Zygosaccharomyces rouxii]
 emb|CAR30920.1| ZYRO0E05632p [Zygosaccharomyces rouxii]
Length=765

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 45/129 (35%), Positives = 68/129 (53%), Gaps = 17/129 (13%)
 Frame = -3

Query  540  NFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKF-DQDAVQ  364
            N  R   + ++ + L +++  Q ++   Q   GSRWF+P+  +PE YSY++    QD ++
Sbjct  636  NVFRHHRNVRFVVVLCLWLLFQIAVLYSQDILGSRWFLPKLSIPEGYSYHKAMPAQDLLE  695

Query  363  -------PIDCVICMTNIDLSQRS---------NDCMVTPCDHFFHSGCLQRWMDIKMEC  232
                    IDC ICM+ + +                MVTPC H FH+ CL+ WM  K++C
Sbjct  696  HGSTAGYTIDCAICMSEVPIRVEEVPETHKVDEQTYMVTPCAHIFHTQCLENWMSYKLQC  755

Query  231  PTCRRPLPP  205
            P CR PLPP
Sbjct  756  PVCRSPLPP  764



>gb|EWM27231.1| Zinc finger, RING-type [Nannochloropsis gaditana]
Length=737

 Score = 89.0 bits (219),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 49/168 (29%), Positives = 70/168 (42%), Gaps = 56/168 (33%)
 Frame = -3

Query  546  PHNFMRI-----ETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKF  382
            P NF+ +       D + C  L +++G Q ++   Q Y G ++ IP + LP KY+YYR  
Sbjct  569  PENFIHLIFSGYRPDYRLCFALVVWVGAQVAVLLSQDYLGPQYMIPARFLPPKYNYYRPV  628

Query  381  DQ------DAVQP--------------------------------------------IDC  352
             Q         QP                                            ++C
Sbjct  629  PQGRGGRAQGPQPTVRAGGLVHTQSSGSSGGCEEIELMDLEEGPGHGGEADGEEGGALEC  688

Query  351  VICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLP  208
             IC  ++D++ R    MV PC+H F   CL+RWMDIK+ECP CR  LP
Sbjct  689  AICFNDVDVT-RLGSYMVAPCNHVFDRECLERWMDIKLECPVCRCSLP  735



>ref|XP_005855273.1| hypothetical protein NGA_0075710 [Nannochloropsis gaditana CCMP526]
 gb|EKU21098.1| hypothetical protein NGA_0075710 [Nannochloropsis gaditana CCMP526]
Length=817

 Score = 89.0 bits (219),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 49/168 (29%), Positives = 70/168 (42%), Gaps = 56/168 (33%)
 Frame = -3

Query  546  PHNFMRI-----ETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKF  382
            P NF+ +       D + C  L +++G Q ++   Q Y G ++ IP + LP KY+YYR  
Sbjct  649  PENFIHLIFSGYRPDYRLCFALVVWVGAQVAVLLSQDYLGPQYMIPARFLPPKYNYYRPV  708

Query  381  DQ------DAVQP--------------------------------------------IDC  352
             Q         QP                                            ++C
Sbjct  709  PQGRGGRAQGPQPTVRAGGLVHTQSSGSSGGCEEIELMDLEEGPGHGGEADGEEGGALEC  768

Query  351  VICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECPTCRRPLP  208
             IC  ++D++ R    MV PC+H F   CL+RWMDIK+ECP CR  LP
Sbjct  769  AICFNDVDVT-RLGSYMVAPCNHVFDRECLERWMDIKLECPVCRCSLP  815



>emb|CDW89330.1| ring-finger-containing ubiquitin ligase [Stylonychia lemnae]
Length=453

 Score = 87.8 bits (216),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 71/137 (52%), Gaps = 23/137 (17%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKF-DQDA  370
            P N ++I+ +  + I     + IQ  +  LQ   G+R+ IPR+  P  Y Y ++F D D 
Sbjct  313  PSNLLKIKPNYGFVIMYITLIAIQLVVLVLQRSRGARFMIPRKYRPNTYDYIKRFRDVDD  372

Query  369  VQPI----------DCVICMTNIDL------------SQRSNDCMVTPCDHFFHSGCLQR  256
            ++            +CV+CM N+              S R++  M TPC+H FH+ CLQ 
Sbjct  373  LESASLSESSYLNDECVVCMHNLRFEVDESMQLIDGQSVRASTYMQTPCNHKFHAKCLQS  432

Query  255  WMDIKMECPTCRRPLPP  205
            WM IK+ECP CR+ LPP
Sbjct  433  WMKIKLECPVCRKVLPP  449



>ref|XP_002553035.1| KLTH0D07216p [Lachancea thermotolerans]
 emb|CAR22597.1| KLTH0D07216p [Lachancea thermotolerans CBS 6340]
Length=747

 Score = 88.6 bits (218),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 68/131 (52%), Gaps = 17/131 (13%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQ-DA  370
            P N      D ++ + + +++  Q  I   Q   G+RWF+P+  +PE YSY++     D 
Sbjct  616  PSNIFYHHRDIRYVVIVALWILFQIVILYSQDIMGARWFLPKYTIPEGYSYHKGISSADL  675

Query  369  VQ-------PIDCVICMTNI-----DLSQR----SNDCMVTPCDHFFHSGCLQRWMDIKM  238
            ++        IDC ICM ++     D+ +         M+TPC H FH+ CL+ WM  K+
Sbjct  676  LEHGSSPNYSIDCAICMNDVPVYVDDIPKTHKVDKESYMITPCSHIFHTQCLESWMSYKL  735

Query  237  ECPTCRRPLPP  205
            +CP CR PLPP
Sbjct  736  QCPVCRAPLPP  746



>ref|XP_004361781.1| hypothetical protein DFA_06068 [Dictyostelium fasciculatum]
 gb|EGG23930.1| hypothetical protein DFA_06068 [Dictyostelium fasciculatum]
Length=726

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 62/106 (58%), Gaps = 2/106 (2%)
 Frame = -3

Query  546  PHNFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFDQDAV  367
            P+NF+ +E D  + + L  +M +Q  +  LQ  +G ++FIP++ LP KY Y R+      
Sbjct  475  PYNFIPVEPDYTFSLMLFNWMCLQIFVLYLQEKWGPQFFIPKRFLPPKYQYARQIAPTIR  534

Query  366  QPIDCVICMTNIDLSQRSNDCMVTPCDHFFHSGCLQRWMDIKMECP  229
                CVICM   D+    ND M+TPCDH FHS CL  W++ KM CP
Sbjct  535  DGQQCVICMC--DVEADDNDYMITPCDHLFHSRCLLEWIEYKMSCP  578



>ref|XP_003672615.1| hypothetical protein NDAI_0K01810 [Naumovozyma dairenensis CBS 
421]
 emb|CCD27372.1| hypothetical protein NDAI_0K01810 [Naumovozyma dairenensis CBS 
421]
Length=762

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/132 (33%), Positives = 66/132 (50%), Gaps = 20/132 (15%)
 Frame = -3

Query  540  NFMRIETDKKWCICLGIFMGIQASIXXLQHYFGSRWFIPRQILPEKYSYYRKFD------  379
            N  R   D  + + L +++  Q +I   Q   GSRWF+P+  +PE Y+Y++         
Sbjct  630  NIFRHHRDVTFVVVLSLWLIFQIAILYSQDILGSRWFLPQHSIPEGYTYFKPISLQHSIE  689

Query  378  -----QDAVQPIDCVICMTNIDLSQRS---------NDCMVTPCDHFFHSGCLQRWMDIK  241
                 +D    +DC ICM+ + +             +  MVTPC+H FH+ CL+ WM  K
Sbjct  690  HGGGSKDEPYTVDCAICMSPVPVYIEEVEGTHKVDIHSYMVTPCNHIFHTECLENWMGYK  749

Query  240  MECPTCRRPLPP  205
            ++CP CR  LPP
Sbjct  750  LQCPVCRSSLPP  761



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 592801777335