BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF008N11

Length=763
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009612279.1|  PREDICTED: oxygen-evolving enhancer protein ...    175   8e-75   Nicotiana tomentosiformis
gb|AFH57997.1|  chloroplast PsbO1 precursor                             175   9e-75   Nicotiana benthamiana
gb|AAX53163.1|  chloroplast photosynthetic oxygen-evolving protei...    175   2e-74   Nicotiana benthamiana
gb|AFH57998.1|  chloroplast PsbO2 precursor                             175   2e-74   Nicotiana benthamiana
ref|XP_009768511.1|  PREDICTED: oxygen-evolving enhancer protein ...    175   3e-74   Nicotiana sylvestris
ref|XP_006344816.1|  PREDICTED: oxygen-evolving enhancer protein ...    173   1e-73   Solanum tuberosum [potatoes]
ref|XP_004233415.1|  PREDICTED: oxygen-evolving enhancer protein ...    172   1e-73   
ref|XP_009604683.1|  PREDICTED: oxygen-evolving enhancer protein ...    171   2e-73   Nicotiana tomentosiformis
gb|AFH58000.1|  chloroplast PsbO4 precursor                             171   3e-73   Nicotiana benthamiana
ref|XP_010103689.1|  Oxygen-evolving enhancer protein 1                 172   3e-73   Morus notabilis
ref|XP_002522386.1|  Oxygen-evolving enhancer protein 1, chloropl...    172   3e-73   Ricinus communis
ref|XP_009759927.1|  PREDICTED: oxygen-evolving enhancer protein ...    171   3e-73   Nicotiana sylvestris
gb|EPS61846.1|  oxygen-evolving enhancer protein 1, chloroplastic       167   4e-73   Genlisea aurea
ref|XP_009758248.1|  PREDICTED: oxygen-evolving enhancer protein ...    172   4e-73   Nicotiana sylvestris
ref|XP_011004600.1|  PREDICTED: oxygen-evolving enhancer protein ...    171   5e-73   Populus euphratica
gb|ADZ75466.1|  oxygen evolving enhancer protein 1                      171   5e-73   Litchi chinensis [litchi]
ref|XP_002310188.1|  O2 evolving complex 33kD family protein            171   6e-73   Populus trichocarpa [western balsam poplar]
ref|XP_002307234.1|  O2 evolving complex 33kD family protein            171   6e-73   Populus trichocarpa [western balsam poplar]
gb|KDP31833.1|  hypothetical protein JCGZ_12294                         170   6e-73   Jatropha curcas
ref|XP_011025676.1|  PREDICTED: oxygen-evolving enhancer protein ...    171   7e-73   Populus euphratica
ref|XP_006338257.1|  PREDICTED: chloroplast manganese stabilizing...    171   8e-73   Solanum tuberosum [potatoes]
gb|ABK96748.1|  unknown                                                 169   1e-72   Populus trichocarpa x Populus deltoides
ref|XP_004232077.1|  PREDICTED: oxygen-evolving enhancer protein ...    171   1e-72   
sp|P12359.1|PSBO_SPIOL  RecName: Full=Oxygen-evolving enhancer pr...    174   1e-72   Spinacia oleracea
ref|XP_010673597.1|  PREDICTED: oxygen-evolving enhancer protein ...    173   1e-72   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004141946.1|  PREDICTED: oxygen-evolving enhancer protein ...    170   1e-72   Cucumis sativus [cucumbers]
emb|CAA29062.1|  unnamed protein product                                173   1e-72   Spinacia oleracea
ref|XP_010028333.1|  PREDICTED: oxygen-evolving enhancer protein ...    172   1e-72   Eucalyptus grandis [rose gum]
gb|ADR71223.1|  chloroplast manganese stabilizing protein               172   2e-72   Solanum tuberosum [potatoes]
gb|AEN02470.1|  oxygen-evolving enhancer protein                        168   3e-72   Camellia sinensis [black tea]
emb|CDP02430.1|  unnamed protein product                                167   4e-72   Coffea canephora [robusta coffee]
gb|AFH57999.1|  chloroplast PsbO3 precursor                             168   6e-72   Nicotiana benthamiana
ref|XP_009616099.1|  PREDICTED: oxygen-evolving enhancer protein ...    170   7e-72   
sp|P26320.1|PSBO_SOLTU  RecName: Full=Oxygen-evolving enhancer pr...    168   8e-72   Solanum tuberosum [potatoes]
gb|AFH40666.1|  chloroplast oxygen-evolving enhancer protein 1          166   9e-72   Saccharum hybrid cultivar [sugarcane]
ref|XP_008647514.1|  PREDICTED: hypothetical protein isoform X1         166   1e-71   
emb|CAA35601.1|  33kDa precursor protein of oxygen-evolving complex     167   1e-71   Solanum tuberosum [potatoes]
sp|O49079.1|PSBO_FRIAG  RecName: Full=Oxygen-evolving enhancer pr...    167   1e-71   Fritillaria agrestis
gb|ABK95838.1|  unknown                                                 169   1e-71   Populus trichocarpa [western balsam poplar]
ref|XP_006644206.1|  PREDICTED: oxygen-evolving enhancer protein ...    170   1e-71   Oryza brachyantha
gb|AFW69213.1|  oxygen-evolving enhancer protein 1                      166   1e-71   
dbj|BAA96365.3|  oxygen evolving enhancer protein 1 precursor           169   1e-71   Bruguiera gymnorhiza [Burma mangrove]
ref|NP_001240871.1|  uncharacterized protein LOC100811386               171   1e-71   Glycine max [soybeans]
ref|XP_008440181.1|  PREDICTED: oxygen-evolving enhancer protein ...    168   1e-71   Cucumis melo [Oriental melon]
ref|XP_003636084.1|  Oxygen-evolving enhancer protein                   172   2e-71   
ref|XP_006856169.1|  hypothetical protein AMTR_s00059p00176390          166   3e-71   Amborella trichopoda
ref|NP_001130585.1|  uncharacterized protein LOC100191684               166   3e-71   Zea mays [maize]
prf||1204192A  photosystem II protein 33kD                              171   3e-71
ref|XP_002274796.1|  PREDICTED: oxygen-evolving enhancer protein ...    169   3e-71   Vitis vinifera
ref|XP_003548008.1|  PREDICTED: oxygen-evolving enhancer protein ...    172   3e-71   Glycine max [soybeans]
sp|P14226.1|PSBO_PEA  RecName: Full=Oxygen-evolving enhancer prot...    172   3e-71   Pisum sativum [garden pea]
ref|XP_003557544.1|  PREDICTED: oxygen-evolving enhancer protein ...    168   3e-71   Brachypodium distachyon [annual false brome]
gb|EMS63035.1|  Oxygen-evolving enhancer protein 1, chloroplastic       166   4e-71   Triticum urartu
dbj|BAJ89638.1|  predicted protein                                      166   4e-71   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001241522.1|  uncharacterized protein LOC100820458               172   4e-71   Glycine max [soybeans]
ref|XP_004968772.1|  PREDICTED: oxygen-evolving enhancer protein ...    166   5e-71   Setaria italica
emb|CAN61828.1|  hypothetical protein VITISV_027630                     168   5e-71   Vitis vinifera
ref|XP_010924166.1|  PREDICTED: oxygen-evolving enhancer protein ...    167   5e-71   Elaeis guineensis
ref|XP_004509219.1|  PREDICTED: oxygen-evolving enhancer protein ...    171   5e-71   
gb|KDO79409.1|  hypothetical protein CISIN_1g019870mg                   165   6e-71   Citrus sinensis [apfelsine]
ref|XP_006425778.1|  hypothetical protein CICLE_v10026034mg             165   7e-71   Citrus clementina [clementine]
ref|NP_001043134.1|  Os01g0501800                                       167   7e-71   
gb|EEC70714.1|  hypothetical protein OsI_02088                          167   7e-71   Oryza sativa Indica Group [Indian rice]
ref|WP_039310940.1|  Photosystem II manganese-stabilizing polypep...    165   7e-71   
ref|XP_008787656.1|  PREDICTED: oxygen-evolving enhancer protein ...    167   7e-71   Phoenix dactylifera
gb|AEO21912.1|  chloroplast oxygen-evolving enhancer protein 1          169   9e-71   Dimocarpus longan [longan]
sp|P85194.1|PSBO_HELAN  RecName: Full=Oxygen-evolving enhancer pr...    167   9e-71   Helianthus annuus
ref|XP_003611860.1|  Oxygen evolving enhancer protein                   169   9e-71   Medicago truncatula
ref|XP_009376463.1|  PREDICTED: oxygen-evolving enhancer protein ...    169   1e-70   Pyrus x bretschneideri [bai li]
ref|NP_001140815.1|  hypothetical protein                               164   1e-70   
ref|XP_009379152.1|  PREDICTED: oxygen-evolving enhancer protein ...    169   2e-70   Pyrus x bretschneideri [bai li]
ref|XP_007155994.1|  hypothetical protein PHAVU_003G249800g             168   2e-70   Phaseolus vulgaris [French bean]
gb|ABQ52657.1|  chloroplast oxygen-evolving enhancer protein 1          166   2e-70   Leymus chinensis
ref|XP_009341905.1|  PREDICTED: oxygen-evolving enhancer protein ...    168   2e-70   Pyrus x bretschneideri [bai li]
dbj|BAG70021.1|  33 kDa precursor protein of the oxygen-evolving ...    172   2e-70   Salicornia europaea [chicken-claws]
gb|AFK43771.1|  unknown                                                 169   2e-70   Lotus japonicus
ref|XP_007156865.1|  hypothetical protein PHAVU_002G024000g             170   3e-70   Phaseolus vulgaris [French bean]
ref|NP_001239736.1|  uncharacterized protein LOC100798485               171   3e-70   Glycine max [soybeans]
ref|XP_008241598.1|  PREDICTED: oxygen-evolving enhancer protein ...    167   3e-70   Prunus mume [ume]
ref|XP_004300575.1|  PREDICTED: oxygen-evolving enhancer protein ...    169   3e-70   Fragaria vesca subsp. vesca
ref|XP_007202212.1|  hypothetical protein PRUPE_ppa008420mg             167   4e-70   Prunus persica
ref|XP_008338186.1|  PREDICTED: oxygen-evolving enhancer protein ...    168   4e-70   Malus domestica [apple tree]
gb|KDO79410.1|  hypothetical protein CISIN_1g019870mg                   163   5e-70   Citrus sinensis [apfelsine]
prf||2002393A  oxygen-evolving complex protein 1                        165   8e-70
gb|ABR26062.1|  oxygen-evolving enhancer protein 1                      165   8e-70   Oryza sativa Indica Group [Indian rice]
ref|XP_007047093.1|  Photosystem II subunit O-2                         170   9e-70   
gb|ACU19823.1|  unknown                                                 169   9e-70   Glycine max [soybeans]
gb|KJB43585.1|  hypothetical protein B456_007G208000                    169   1e-69   Gossypium raimondii
gb|KJB43586.1|  hypothetical protein B456_007G208000                    169   1e-69   Gossypium raimondii
ref|XP_002283699.1|  PREDICTED: oxygen-evolving enhancer protein ...    165   1e-69   Vitis vinifera
gb|ABR26133.1|  oxygen-evolving enhancer protein 1                      165   1e-69   Oryza sativa Indica Group [Indian rice]
gb|KHG13438.1|  Oxygen-evolving enhancer 1, chloroplastic               168   1e-69   Gossypium arboreum [tree cotton]
ref|XP_007155995.1|  hypothetical protein PHAVU_003G249800g             166   1e-69   Phaseolus vulgaris [French bean]
ref|XP_008800919.1|  PREDICTED: oxygen-evolving enhancer protein ...    162   1e-69   Phoenix dactylifera
ref|XP_010255017.1|  PREDICTED: oxygen-evolving enhancer protein ...    169   2e-69   Nelumbo nucifera [Indian lotus]
ref|XP_010550399.1|  PREDICTED: oxygen-evolving enhancer protein ...    164   2e-69   Tarenaya hassleriana [spider flower]
emb|CAN79166.1|  hypothetical protein VITISV_019248                     165   2e-69   Vitis vinifera
gb|AJG36442.1|  oxygen-evolving enhancer protein 1                      166   2e-69   Pinus sylvestris [Scotch pine]
gb|ACJ84218.1|  unknown                                                 166   2e-69   Medicago truncatula
ref|XP_009412420.1|  PREDICTED: LOW QUALITY PROTEIN: oxygen-evolv...    170   4e-69   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010263833.1|  PREDICTED: oxygen-evolving enhancer protein ...    167   4e-69   Nelumbo nucifera [Indian lotus]
ref|XP_010557854.1|  PREDICTED: oxygen-evolving enhancer protein ...    163   7e-69   Tarenaya hassleriana [spider flower]
ref|XP_006291313.1|  hypothetical protein CARUB_v10017447mg             165   7e-69   
ref|XP_009149414.1|  PREDICTED: oxygen-evolving enhancer protein ...    164   1e-68   Brassica rapa
gb|KFK28330.1|  hypothetical protein AALP_AA8G502100                    164   1e-68   Arabis alpina [alpine rockcress]
ref|NP_190651.1|  oxygen-evolving enhancer protein 1-2                  164   2e-68   Arabidopsis thaliana [mouse-ear cress]
gb|AFK46831.1|  unknown                                                 165   2e-68   Lotus japonicus
emb|CDX81388.1|  BnaC09g07990D                                          162   2e-68   
ref|XP_002877774.1|  photosystem II subunit O-2                         163   2e-68   Arabidopsis lyrata subsp. lyrata
gb|ABK23365.1|  unknown                                                 161   2e-68   Picea sitchensis
ref|XP_006403995.1|  hypothetical protein EUTSA_v10010535mg             162   2e-68   Eutrema salsugineum [saltwater cress]
gb|ABQ85434.1|  33 kDa OEC protein                                      167   2e-68   Salicornia veneta
gb|ACN40581.1|  unknown                                                 161   2e-68   Picea sitchensis
ref|XP_009112310.1|  PREDICTED: oxygen-evolving enhancer protein ...    162   2e-68   Brassica rapa
gb|ABK24541.1|  unknown                                                 161   3e-68   Picea sitchensis
ref|XP_010531775.1|  PREDICTED: oxygen-evolving enhancer protein ...    162   3e-68   Tarenaya hassleriana [spider flower]
ref|XP_009130561.1|  PREDICTED: oxygen-evolving enhancer protein ...    162   3e-68   Brassica rapa
ref|XP_010503753.1|  PREDICTED: oxygen-evolving enhancer protein ...    163   4e-68   Camelina sativa [gold-of-pleasure]
gb|AGV54778.1|  oxygen-evolving enhancer protein 1                      169   4e-68   Phaseolus vulgaris [French bean]
emb|CDY30764.1|  BnaC07g16640D                                          161   5e-68   Brassica napus [oilseed rape]
ref|XP_009103510.1|  PREDICTED: oxygen-evolving enhancer protein ...    161   6e-68   Brassica rapa
emb|CDY50981.1|  BnaC02g48890D                                          160   7e-68   Brassica napus [oilseed rape]
ref|XP_006280785.1|  hypothetical protein CARUB_v10026754mg             161   8e-68   Capsella rubella
emb|CAA36675.1|  33 kDa oxygen-evolving protein                         161   9e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006393852.1|  hypothetical protein EUTSA_v10004563mg             161   9e-68   Eutrema salsugineum [saltwater cress]
gb|AAM96957.1|  33 kDa polypeptide of oxygen-evolving complex (OE...    161   9e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002866754.1|  oxygen-evolving enhancer 33                        161   9e-68   Arabidopsis lyrata subsp. lyrata
gb|AAL08257.1|  AT5g66570/K1F13_25                                      161   9e-68   Arabidopsis thaliana [mouse-ear cress]
gb|AAM65169.1|  33 kDa polypeptide of oxygen-evolving complex (OE...    161   9e-68   Arabidopsis thaliana [mouse-ear cress]
ref|NP_201458.1|  PS II oxygen-evolving complex 1                       161   1e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010515458.1|  PREDICTED: oxygen-evolving enhancer protein ...    163   1e-67   Camelina sativa [gold-of-pleasure]
gb|AAK49614.1|AF372898_1  AT5g66570/K1F13_25                            161   2e-67   Arabidopsis thaliana [mouse-ear cress]
gb|KFK34331.1|  hypothetical protein AALP_AA5G131000                    161   2e-67   Arabis alpina [alpine rockcress]
ref|XP_010465252.1|  PREDICTED: oxygen-evolving enhancer protein ...    160   2e-67   Camelina sativa [gold-of-pleasure]
ref|XP_010484624.1|  PREDICTED: oxygen-evolving enhancer protein ...    160   2e-67   Camelina sativa [gold-of-pleasure]
ref|XP_010444775.1|  PREDICTED: oxygen-evolving enhancer protein ...    160   2e-67   Camelina sativa [gold-of-pleasure]
ref|XP_006411950.1|  hypothetical protein EUTSA_v10025711mg             166   3e-67   Eutrema salsugineum [saltwater cress]
ref|XP_010424899.1|  PREDICTED: oxygen-evolving enhancer protein ...    160   3e-67   Camelina sativa [gold-of-pleasure]
gb|AAT65501.1|  photosystem II protein                                  159   5e-67   Brassica oleracea
emb|CDX72613.1|  BnaC07g46350D                                          164   5e-67   
gb|AAK96774.1|  33 kDa polypeptide of oxygen-evolving complex           158   5e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002866983.1|  hypothetical protein ARALYDRAFT_328078             166   2e-66   Arabidopsis lyrata subsp. lyrata
ref|XP_010446730.1|  PREDICTED: oxygen-evolving enhancer protein ...    165   4e-66   Camelina sativa [gold-of-pleasure]
gb|EYU44326.1|  hypothetical protein MIMGU_mgv1a009768mg                172   5e-66   Erythranthe guttata [common monkey flower]
emb|CDY42709.1|  BnaA03g53620D                                          164   9e-66   Brassica napus [oilseed rape]
ref|XP_010432119.1|  PREDICTED: oxygen-evolving enhancer protein ...    166   9e-66   Camelina sativa [gold-of-pleasure]
emb|CDY26519.1|  BnaC01g23800D                                          164   1e-65   Brassica napus [oilseed rape]
ref|XP_011099252.1|  PREDICTED: oxygen-evolving enhancer protein ...    168   1e-65   Sesamum indicum [beniseed]
ref|XP_011085527.1|  PREDICTED: oxygen-evolving enhancer protein ...    167   2e-65   Sesamum indicum [beniseed]
emb|CDY33308.1|  BnaA01g19750D                                          164   2e-65   Brassica napus [oilseed rape]
ref|XP_009138459.1|  PREDICTED: oxygen-evolving enhancer protein ...    162   2e-64   
ref|XP_010924332.1|  PREDICTED: LOW QUALITY PROTEIN: oxygen-evolv...    148   7e-64   Elaeis guineensis
sp|P27665.1|PSBO_WHEAT  RecName: Full=Oxygen-evolving enhancer pr...    145   7e-62   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010446731.1|  PREDICTED: oxygen-evolving enhancer protein ...    165   1e-61   
ref|XP_010432121.1|  PREDICTED: oxygen-evolving enhancer protein ...    166   3e-61   
dbj|BAF94218.1|  33kDa oxygen evolving protein of photosystem II        164   5e-61   Chara braunii
ref|XP_001784751.1|  predicted protein                                  154   1e-59   
ref|XP_001763258.1|  predicted protein                                  151   5e-59   
ref|XP_001781590.1|  predicted protein                                  150   5e-59   
gb|KCW55052.1|  hypothetical protein EUGRSUZ_I01025                     127   1e-58   Eucalyptus grandis [rose gum]
ref|XP_002991827.1|  hypothetical protein SELMODRAFT_272235             145   6e-58   
ref|XP_002992987.1|  hypothetical protein SELMODRAFT_187141             145   6e-58   Selaginella moellendorffii
ref|XP_001756893.1|  predicted protein                                  148   6e-58   
gb|ACS34663.1|  chloroplast manganese stabilizing protein-II            170   1e-56   Solanum tuberosum [potatoes]
ref|XP_002994513.1|  hypothetical protein SELMODRAFT_138743             143   5e-56   
gb|AAR85969.1|  ERT12                                                   129   2e-55   Nicotiana tabacum [American tobacco]
gb|AGI15761.1|  collinsiaXIII-like protein                              167   1e-54   Collinsia linearis
gb|ABS29557.1|  chloroplast photosynthetic water oxidation comple...    172   1e-54   Morus nigra
gb|AGI15739.1|  collinsiaXIII-like protein                              167   4e-54   Collinsia rattanii
gb|AGI15756.1|  collinsiaXIII-like protein                              167   4e-54   Collinsia linearis
dbj|BAF94214.1|  33kDa oxygen evolving protein of photosystem II        139   7e-54   Oedogonium obesum
gb|AGI15762.1|  collinsiaXIII-like protein                              168   4e-53   Collinsia linearis
gb|AGI15742.1|  collinsiaXIII-like protein                              167   6e-53   Collinsia rattanii
dbj|BAF94220.1|  33kDa oxygen evolving protein of photosystem II        132   8e-52   Closterium peracerosum-strigosum-littorale complex
dbj|BAF94217.1|  33kDa oxygen evolving protein of photosystem II        137   2e-51   Nephroselmis olivacea
gb|AGI15740.1|  collinsiaXIII-like protein                              167   6e-51   Collinsia rattanii
ref|XP_003063851.1|  photosystem II manganese-stabilizing polypep...    131   5e-50   Micromonas pusilla CCMP1545
gb|ABR17376.1|  unknown                                                 162   5e-50   Picea sitchensis
ref|XP_001422458.1|  psbO, PSII-O, OEE1, photosystem II polypepti...    130   6e-50   Ostreococcus lucimarinus CCE9901
ref|XP_005644574.1|  33kDa oxygen evolving protein of photosystem II    133   7e-50   Coccomyxa subellipsoidea C-169
gb|ABA01139.1|  chloroplast oxygen-evolving enhancer protein 1          129   7e-50   Chlamydomonas incerta
dbj|BAF94213.1|  33kDa oxygen evolving protein of photosystem II        137   2e-49   Hafniomonas montana
ref|XP_005843863.1|  hypothetical protein CHLNCDRAFT_32868              130   3e-49   Chlorella variabilis
gb|AAR20846.1|  oxygen-evolving enhancer protein 1                      130   3e-49   Pseudochlorella pringsheimii
ref|XP_003637254.1|  Oxygen-evolving enhancer protein                   173   6e-49   
dbj|BAF94216.1|  33kDa oxygen evolving protein of photosystem II        131   6e-49   Tetraselmis cordiformis
gb|AEH95324.1|  33 kDa manganese stabilizing chloroplast protein        167   7e-49   Allium cepa
gb|ACF24544.1|  photosystem II oxygen evolving enhancer protein 1       124   7e-49   Gymnochlora stellata
ref|XP_002505809.1|  photosystem II manganese-stabilizing polypep...    132   1e-48   Micromonas commoda
emb|CEG01950.1|  Photosystem II PsbO, manganese-stabilising             130   3e-48   Ostreococcus tauri
ref|XP_007513615.1|  predicted protein                                  128   3e-48   Bathycoccus prasinos
ref|XP_011400268.1|  Oxygen-evolving enhancer protein 1, chloropl...    133   3e-48   Auxenochlorella protothecoides
ref|XP_001694699.1|  oxygen-evolving enhancer protein 1 of photos...    129   5e-48   Chlamydomonas reinhardtii
sp|P12853.1|PSBO_CHLRE  RecName: Full=Oxygen-evolving enhancer pr...    128   1e-47   Chlamydomonas reinhardtii
gb|KIY97139.1|  Oxygen-evolving enhancer protein 1                      121   1e-47   Monoraphidium neglectum
gb|ADB07372.1|  chloroplast managanese stabilizing protein              169   4e-47   Capsicum annuum
dbj|BAF94215.1|  33kDa oxygen evolving protein of photosystem II        121   1e-46   Pyramimonas parkeae
ref|XP_002954867.1|  subunit of oxygen evolving complex of photos...    127   2e-46   Volvox carteri f. nagariensis
gb|AAP79149.1|  photosystem II protein PsbO                             122   2e-46   Bigelowiella natans
sp|Q9SBN6.1|PSBO_VOLCA  RecName: Full=Oxygen-evolving enhancer pr...    126   2e-46   Volvox carteri
gb|KJB43587.1|  hypothetical protein B456_007G208000                    123   3e-46   Gossypium raimondii
gb|ACE98011.1|  putative protein                                        163   4e-46   Populus tremula [European aspen]
gb|ABV57472.1|  chloroplast PsbO                                        161   2e-45   Phyllostachys edulis [kikko-chiku]
dbj|BAF94212.1|  33kDa oxygen evolving protein of photosystem II        115   3e-45   Chlorarachnion reptans
dbj|BAF94219.1|  33kDa oxygen evolving protein of photosystem II        120   3e-45   Bryopsis plumosa
dbj|BAA03529.2|  oxygen-evolving enhancer protein 1 precursor           118   3e-45   Euglena gracilis
sp|P46483.2|PSBO_EUGGR  RecName: Full=Oxygen-evolving enhancer pr...    117   7e-45   Euglena gracilis
dbj|BAF94211.1|  33kDa oxygen evolving protein of photosystem II        115   3e-44   Eutreptiella gymnastica
emb|CCC15104.1|  33kDa oxygen evolving protein of photosystem II        129   2e-42   Lepidodinium chlorophorum
ref|WP_026721744.1|  Photosystem II manganese-stabilizing polypep...    119   2e-41   Hapalosiphonaceae
ref|WP_016865127.1|  Photosystem II manganese-stabilizing polypep...    116   2e-40   Fischerella muscicola
ref|WP_017720228.1|  Photosystem II manganese-stabilizing polypep...    122   2e-40   Oscillatoria sp. PCC 10802
ref|WP_026733494.1|  Photosystem II manganese-stabilizing polypep...    118   2e-40   Fischerella sp. PCC 9605
ref|WP_016860504.1|  Photosystem II manganese-stabilizing polypep...    118   3e-40   Fischerella muscicola
gb|AFW90569.1|  chloroplast manganese stabilizing protein-II            151   5e-40   Solanum tuberosum [potatoes]
ref|WP_017310215.1|  Photosystem II manganese-stabilizing polypep...    115   6e-40   Fischerella sp. PCC 9339
ref|WP_009456798.1|  MULTISPECIES: photosystem II manganese-stabi...    114   6e-40   Fischerella
ref|WP_012411115.1|  photosystem II manganese-stabilizing protein...    119   9e-40   Nostoc
ref|WP_015117115.1|  Manganese-stabilising protein / photosystem ...    120   2e-39   Rivularia sp. PCC 7116
ref|WP_009768009.1|  Manganese-stabilising protein / photosystem ...    121   3e-39   Oscillatoriales cyanobacterium JSC-12
ref|WP_015115272.1|  photosystem II manganese-stabilizing protein...    117   3e-39   Nostoc sp. PCC 7107
ref|WP_037222014.1|  Photosystem II manganese-stabilizing protein...    113   9e-39   
ref|XP_005652213.1|  33kDa oxygen evolving protein of photosystem II  95.5    1e-38   Coccomyxa subellipsoidea C-169
emb|CAA33560.1|  manganese-stabilzing protein (MSP) precursor           114   1e-38   Nostoc sp. PCC 7120
ref|WP_008233010.1|  Photosystem II manganese-stabilizing protein...    115   1e-38   Richelia intracellularis
ref|WP_044259457.1|  Photosystem II manganese-stabilizing protein...    115   1e-38   
gb|ACT83791.1|  putative photosystem II oxygen evolving system 33...    143   1e-38   Lemna minor
emb|CCH65457.1|  Photosystem II manganese-stabilizing protein (PsbO)    115   2e-38   Richelia intracellularis HM01
ref|WP_015209602.1|  Manganese-stabilising protein / photosystem ...    114   2e-38   Cylindrospermum stagnale
ref|WP_040939353.1|  Photosystem II manganese-stabilizing polypep...    116   3e-38   
ref|WP_010997995.1|  manganese-stabilzing protein                       113   3e-38   Nostocaceae
ref|WP_011318645.1|  photosystem II manganese-stabilizing protein...    113   3e-38   Trichormus variabilis
ref|WP_019494816.1|  Photosystem II manganese-stabilizing polypep...    111   3e-38   Calothrix sp. PCC 7103
ref|WP_015127963.1|  photosystem II manganese-stabilizing protein...    115   4e-38   Calothrix sp. PCC 7507
ref|WP_015139796.1|  Manganese-stabilising protein / photosystem ...    112   5e-38   Nostoc sp. PCC 7524
ref|WP_007354116.1|  MULTISPECIES: photosystem II manganese-stabi...    117   6e-38   Kamptonema
ref|WP_036480960.1|  Photosystem II manganese-stabilizing polypep...    108   6e-38   Myxosarcina sp. GI1
ref|WP_035156929.1|  Photosystem II manganese-stabilizing polypep...    111   6e-38   Calothrix sp. 336/3
ref|WP_015196540.1|  photosystem II manganese-stabilizing protein...    111   8e-38   Calothrix parietina
gb|ADC54897.1|  oxygen-evolving enhancer protein                        117   9e-38   Cladophora coelothrix
ref|WP_015204171.1|  photosystem II manganese-stabilizing protein...    109   9e-38   Crinalium epipsammum
ref|WP_028090302.1|  Photosystem II manganese-stabilizing polypep...    114   9e-38   Dolichospermum circinale
ref|WP_017286598.1|  hypothetical protein                               120   1e-37   Leptolyngbya boryana
ref|WP_016872421.1|  Photosystem II manganese-stabilizing polypep...    111   1e-37   Chlorogloeopsis fritschii
ref|WP_039748810.1|  Photosystem II manganese-stabilizing polypep...    117   1e-37   
ref|WP_035997199.1|  Photosystem II manganese-stabilizing polypep...    103   1e-37   [Leptolyngbya] sp. JSC-1
ref|WP_016949009.1|  Photosystem II manganese-stabilizing polypep...    113   1e-37   Anabaena sp. PCC 7108
ref|WP_017656098.1|  Photosystem II manganese-stabilizing polypep...    115   1e-37   Fortiea contorta
ref|WP_041036292.1|  Photosystem II manganese-stabilizing polypep...    109   2e-37   Tolypothrix campylonemoides
ref|WP_015125988.1|  Manganese-stabilising protein / photosystem ...    119   2e-37   Synechococcus sp. PCC 6312
emb|CBI19622.3|  unnamed protein product                              93.6    2e-37   Vitis vinifera
ref|WP_017322486.1|  Photosystem II manganese-stabilizing polypep...    108   2e-37   cyanobacterium PCC 7702
ref|WP_006197397.1|  Photosystem II manganese-stabilizing protein...    110   3e-37   Nodularia spumigena
ref|WP_040929652.1|  Photosystem II manganese-stabilizing polypep...    116   3e-37   
ref|WP_015187373.1|  photosystem II manganese-stabilizing protein...    118   3e-37   Gloeocapsa sp. PCC 7428
ref|WP_028082855.1|  Photosystem II manganese-stabilizing polypep...    112   3e-37   Dolichospermum circinale
gb|AIR09396.1|  psbO                                                    116   5e-37   Trachelomonas abrupta
gb|KIE10612.1|  Photosystem II manganese-stabilizing polypeptide        111   5e-37   Tolypothrix bouteillei VB521301
gb|AHJ27766.1|  Photosystem II manganese-stabilizing protein (PsbO)     110   5e-37   Nodularia spumigena CCY9414
ref|WP_029636438.1|  Photosystem II manganese-stabilizing polypep...    112   6e-37   [Scytonema hofmanni] UTEX B 1581
dbj|BAJ61705.1|  oxygen-evolving enhancer protein                       125   6e-37   Porphyridium purpureum
ref|WP_017745622.1|  Photosystem II manganese-stabilizing polypep...    111   7e-37   Scytonema hofmannii
ref|WP_009631953.1|  Manganese-stabilising protein / photosystem ...    116   8e-37   Synechocystis sp. PCC 7509
ref|WP_009342897.1|  Photosystem II manganese-stabilizing protein...    114   1e-36   Aphanizomenonaceae
ref|WP_012625990.1|  photosystem II manganese-stabilizing protein...    114   1e-36   Cyanothece sp. PCC 7425
ref|WP_024125094.1|  photosystem II manganese-stabilizing protein...    114   1e-36   Thermosynechococcus sp. NK55a
gb|ADC54902.1|  oxygen-evolving enhancer protein                        137   2e-36   Klebsormidium flaccidum
ref|WP_013191007.1|  photosystem II manganese-stabilizing protein...    111   2e-36   Trichormus azollae
ref|WP_017314485.1|  Photosystem II manganese-stabilizing polypep...    107   2e-36   Mastigocladopsis repens
ref|WP_036530244.1|  Photosystem II manganese-stabilizing polypep...    110   2e-36   Neosynechococcus sphagnicola
ref|WP_015151496.1|  Manganese-stabilising protein / photosystem ...    115   2e-36   Oscillatoria acuminata
ref|WP_015161225.1|  Manganese-stabilising protein / photosystem ...    109   2e-36   Chamaesiphon minutus
ref|WP_015180190.1|  Manganese-stabilising protein / photosystem ...    115   3e-36   Microcoleus sp. PCC 7113
ref|WP_039205072.1|  Photosystem II manganese-stabilizing polypep...    108   3e-36   Nostocales
dbj|BAJ61706.1|  oxygen-evolving enhancer protein                       113   4e-36   Dixoniella grisea
ref|WP_006278712.1|  Photosystem II manganese-stabilizing protein...    112   6e-36   Cylindrospermopsis raciborskii
ref|WP_027404713.1|  Photosystem II manganese-stabilizing polypep...    107   6e-36   Aphanizomenon flos-aquae
ref|WP_015219672.1|  photosystem II manganese-stabilizing protein...    106   8e-36   Cyanobacterium aponinum
ref|WP_018399127.1|  hypothetical protein                               106   8e-36   filamentous cyanobacterium ESFC-1
ref|WP_006529097.1|  Manganese-stabilising protein / photosystem ...    107   1e-35   
ref|WP_011056297.1|  photosystem II manganese-stabilizing polypep...    110   1e-35   
ref|WP_027841041.1|  Photosystem II manganese-stabilizing polypep...    105   1e-35   
pdb|1S5L|O  Chain O, Architecture Of The Photosynthetic Oxygen Ev...    110   1e-35   
ref|WP_006630984.1|  photosystem II manganese-stabilizing protein...    115   1e-35   
pdb|2AXT|O  Chain O, Crystal Structure Of Photosystem Ii From The...    110   1e-35   
ref|WP_015153476.1|  photosystem II manganese-stabilizing protein...    116   1e-35   
ref|WP_039715746.1|  Photosystem II manganese-stabilizing polypep...    116   1e-35   
sp|D0VWR2.2|PSBO_THEVL  RecName: Full=Photosystem II manganese-st...    110   1e-35   
pdb|4PBU|O  Chain O, Serial Time-resolved Crystallography Of Phot...    110   2e-35   
pdb|3A0B|O  Chain O, Crystal Structure Of Br-Substituted Photosys...    110   2e-35   
ref|WP_015192867.1|  photosystem II manganese-stabilizing protein...    112   2e-35   
ref|WP_044204234.1|  Photosystem II manganese-stabilizing polypep...    115   2e-35   
gb|EDX78335.1|  Manganese-stabilizing protein / photosystem II po...    115   2e-35   
gb|EKD06931.1|  photosystem II manganese-stabilizing protein PsbO       114   2e-35   
ref|WP_031292620.1|  Photosystem II manganese-stabilizing polypep...    107   3e-35   
ref|WP_006616815.1|  MULTISPECIES: photosystem II manganese-stabi...    114   3e-35   
ref|WP_039726071.1|  MULTISPECIES: Photosystem II manganese-stabi...    104   3e-35   
ref|WP_019506429.1|  hypothetical protein                               100   3e-35   
gb|EAZ89921.1|  photosystem II manganese-stabilizing polypeptide        107   3e-35   
ref|WP_035799930.1|  Photosystem II manganese-stabilizing polypep...    107   3e-35   
gb|ESA36696.1|  photosystem ii manganese-stabilizing protein            107   4e-35   
ref|WP_017662186.1|  hypothetical protein                               103   4e-35   
ref|WP_015175499.1|  photosystem II manganese-stabilizing protein...    115   4e-35   
gb|AFK26084.1|  chloroplast oxygen-evolving enhancer protein 1 pr...    116   4e-35   
ref|WP_015170887.1|  photosystem II manganese-stabilizing protein...    105   5e-35   
gb|AFK26083.1|  chloroplast oxygen-evolving enhancer protein 1 pr...    115   5e-35   
ref|WP_015212390.1|  photosystem II manganese-stabilizing protein...    108   5e-35   
gb|AFK26085.1|  chloroplast oxygen-evolving enhancer protein 1 pr...    115   8e-35   
ref|WP_015081475.1|  photosystem II manganese-stabilizing protein...    106   9e-35   
ref|WP_022609298.1|  manganese-stabilising protein / photosystem ...    102   9e-35   
gb|AFK26082.1|  chloroplast oxygen-evolving enhancer protein 1 pr...    114   1e-34   
emb|CCQ62588.1|  Photosystem II manganese-stabilizing protein (PsbO)    104   5e-34   
ref|WP_007304841.1|  Manganese-stabilizing protein/photosystem II...    104   5e-34   
gb|AFK26080.1|  chloroplast oxygen-evolving enhancer protein 1 pr...    110   6e-34   
ref|WP_017293645.1|  hypothetical protein                             96.3    7e-34   
ref|WP_015133089.1|  photosystem II manganese-stabilizing protein...    103   8e-34   
ref|WP_015956866.1|  photosystem II manganese-stabilizing protein...    106   8e-34   
ref|WP_015785306.1|  MULTISPECIES: photosystem II manganese-stabi...    100   8e-34   
ref|WP_030006064.1|  Photosystem II manganese-stabilizing polypep...    101   1e-33   
ref|WP_026072511.1|  Photosystem II manganese-stabilizing protein...    103   1e-33   
gb|KIJ84318.1|  Photosystem II manganese-stabilizing polypeptide        103   2e-33   
gb|EWM24379.1|  oxygen-evolving enhancer protein                        112   2e-33   
ref|WP_033373963.1|  Photosystem II manganese-stabilizing polypep...    103   2e-33   
ref|XP_005853586.1|  photosystem II oxygen-evolving enhancer prot...    112   3e-33   
ref|WP_035985606.1|  hypothetical protein                               102   3e-33   
ref|WP_016922728.1|  hypothetical protein                             96.7    4e-33   
ref|WP_006518063.1|  Manganese-stabilising protein / photosystem ...    104   4e-33   
ref|WP_012305903.1|  photosystem II manganese stabilizing protein...  99.8    4e-33   
ref|WP_006510630.1|  Manganese-stabilising protein / photosystem ...  95.5    4e-33   
ref|WP_015230300.1|  Manganese-stabilising protein / photosystem ...    100   5e-33   
ref|WP_015223075.1|  photosystem II manganese-stabilizing protein...    100   5e-33   
ref|WP_008313000.1|  Manganese-stabilising protein / photosystem ...    100   6e-33   
ref|WP_008186133.1|  manganese-stabilising protein/ photosystem I...    110   6e-33   
gb|AAF13997.1|  photosystem II manganese stabilizing protein            103   6e-33   
ref|WP_009544738.1|  MULTISPECIES: photosystem II manganese-stabi...    103   7e-33   
ref|XP_005713751.1|  Plastid oxygen-evolving enhancer 1                 114   1e-32   
ref|WP_002791059.1|  Photosystem II manganese-stabilizing polypep...  99.4    1e-32   
gb|AFK26079.1|  chloroplast oxygen-evolving enhancer protein 1 pr...    109   1e-32   
gb|ABF73017.1|  oxygen-enhancer 1 protein precursor                     108   2e-32   
ref|WP_002761031.1|  Photosystem II manganese-stabilizing polypep...  98.6    2e-32   
ref|WP_004160298.1|  Photosystem II manganese-stabilizing polypep...  98.6    2e-32   
ref|WP_015142403.1|  Manganese-stabilising protein / photosystem ...  92.0    2e-32   
emb|CAH04962.1|  oxygen-evolving enhancer protein 1                   99.8    2e-32   
ref|WP_023065168.1|  photosystem II manganese-stabilizing polypep...    101   3e-32   
ref|WP_024544659.1|  Photosystem II manganese-stabilizing polypep...    102   3e-32   
gb|AAM77464.1|  oxygen evolving enhancer 1 precursor                    107   3e-32   
ref|WP_013323533.1|  photosystem II manganese-stabilizing protein...    100   3e-32   
ref|WP_004162736.1|  Photosystem II manganese-stabilizing polypep...  97.4    4e-32   
ref|WP_002800587.1|  Photosystem II manganese-stabilizing polypep...  97.4    4e-32   
ref|WP_008199011.1|  Photosystem II manganese-stabilizing polypep...  97.4    4e-32   
ref|WP_002741980.1|  photosystem II manganese-stabilizing polypep...  97.4    4e-32   
ref|WP_002773425.1|  Photosystem II manganese-stabilizing polypep...  97.4    4e-32   
ref|WP_002738218.1|  photosystem II manganese-stabilizing polypep...  97.1    5e-32   
gb|KEI69285.1|  PsbO                                                    107   7e-32   
ref|WP_042156912.1|  Photosystem II manganese-stabilizing polypep...    107   8e-32   
ref|XP_005824851.1|  hypothetical protein GUITHDRAFT_97111              107   8e-32   
gb|ABD51936.1|  chloroplast photosystem II 33 kDa oxygen evolving...    107   1e-31   
ref|WP_009783095.1|  Photosystem II manganese-stabilizing protein...    100   1e-31   
emb|CAH25340.1|  oxygen-evolving enhancer                               107   1e-31   
dbj|BAJ61701.1|  oxygen-evolving enhancer protein                       106   2e-31   
ref|WP_026787255.1|  MULTISPECIES: Photosystem II manganese-stabi...    106   2e-31   
gb|AFK26081.1|  chloroplast oxygen-evolving enhancer protein 1 pr...    110   2e-31   
ref|WP_011243530.1|  MULTISPECIES: photosystem II PsbO protein        96.3    3e-31   
dbj|BAJ61707.1|  oxygen-evolving enhancer protein                       110   3e-31   
gb|ADC54900.1|  oxygen-evolving enhancer protein                        124   3e-31   
dbj|BAG85210.1|  extrinsic protein in photosystem II                    112   4e-31   
gb|ABF59672.1|  photosystem II extrinsic protein O                      103   4e-31   
dbj|BAJ61708.1|  oxygen-evolving enhancer protein                       124   5e-31   
dbj|BAF94210.1|  33kDa oxygen evolving protein of photosystem II      97.8    7e-31   
gb|AAM77466.1|  oxygen evolving enhancer 1 precursor                    103   7e-31   
dbj|BAJ61702.1|  oxygen-evolving enhancer protein                       105   7e-31   
ref|WP_011613279.1|  photosystem II manganese-stabilizing protein...  99.8    8e-31   
gb|AFZ44849.1|  photosystem II manganese-stabilizing protein PsbO     98.6    1e-30   
dbj|BAJ61711.1|  oxygen-evolving enhancer protein                       105   1e-30   
ref|WP_041596665.1|  Photosystem II manganese-stabilizing polypep...  98.6    2e-30   
dbj|BAJ61704.1|  oxygen-evolving enhancer protein                       108   2e-30   
ref|WP_028946996.1|  Photosystem II manganese-stabilizing polypep...    101   2e-30   
ref|XP_005536430.1|  manganese-stabilzing protein precursor             101   2e-30   
dbj|BAJ61710.1|  oxygen-evolving enhancer protein                       107   2e-30   
gb|AIE75688.1|  Photosystem II manganese-stabilizing protein (PsbO)     101   2e-30   
ref|WP_025782239.1|  Photosystem II manganese-stabilizing polypep...  97.4    2e-30   
ref|WP_012161181.1|  photosystem II manganese-stabilizing protein...    103   3e-30   
ref|WP_010873097.1|  photosystem II manganese-stabilizing polypep...    100   4e-30   
ref|WP_006456861.1|  Manganese-stabilizing protein / photosystem ...  97.4    5e-30   
ref|WP_010478151.1|  photosystem II manganese-stabilizing protein       102   6e-30   
gb|AAN11311.1|  oxygen-evolving enhancer 1                              102   1e-29   
ref|WP_035832498.1|  Photosystem II manganese-stabilizing polypep...  85.1    1e-29   
ref|XP_005706438.1|  photosystem II PsbO protein                      96.7    3e-29   
gb|ACF28703.1|  oxygen evolving complex protein variant               98.2    5e-29   
gb|AAW33887.1|  plastid oxygen-evolving enhancer 1-2 precursor        91.3    7e-29   
ref|XP_005761454.1|  oxygen-evolving enhancer protein 1 of photos...    100   7e-29   
dbj|BAJ61709.1|  oxygen-evolving enhancer protein                       100   7e-29   
ref|WP_036486652.1|  Photosystem II manganese-stabilizing polypep...  93.2    1e-28   
gb|AAM77465.1|  oxygen evolving enhancer 1 precursor                  90.5    1e-28   
gb|ADC54903.1|  oxygen-evolving enhancer protein                        117   1e-28   
gb|ADC54890.1|  oxygen-evolving enhancer protein                        115   4e-28   
dbj|BAJ61703.1|  oxygen-evolving enhancer protein                     90.5    1e-27   
gb|ADC54907.1|  oxygen-evolving enhancer protein                        113   2e-27   
gb|ADC54904.1|  oxygen-evolving enhancer protein                        113   2e-27   
ref|WP_015109468.1|  Manganese-stabilising protein / photosystem ...  88.6    2e-27   
ref|WP_006172331.1|  photosystem II manganese-stabilizing polypep...  81.6    4e-27   
ref|WP_038016162.1|  Photosystem II manganese-stabilizing polypep...  94.4    6e-27   
gb|EDX87597.1|  Manganese-stabilizing protein / photosystem II po...  94.4    6e-27   
gb|ADC54906.1|  oxygen-evolving enhancer protein                        111   1e-26   
ref|WP_043737375.1|  Photosystem II manganese-stabilizing polypep...  83.2    2e-26   
gb|AGL79736.1|  chloroplast oxygen-evolving enhancer                  91.3    2e-26   
emb|CAK29098.1|  Photosystem II manganese-stabilizing protein PsbO    82.8    2e-26   
gb|AGL79735.1|  chloroplast oxygen-evolving enhancer                  91.3    2e-26   
emb|CBN78902.1|  manganese stabilising protein                        88.2    3e-26   
ref|YP_002049183.1|  Photosystem II manganese-stabilizing polypep...  82.8    3e-26   
gb|ABH09263.1|  photosystem II manganese-stabilizing protein          82.4    3e-26   
ref|WP_007100705.1|  photosystem II manganese-stabilizing polypep...  74.3    4e-26   
ref|WP_011618325.1|  photosystem II manganese-stabilizing protein     73.9    4e-26   
gb|ADC54905.1|  oxygen-evolving enhancer protein                        110   5e-26   
gb|AIS72812.1|  oxygen evolving activity                                109   7e-26   
ref|WP_019500685.1|  hypothetical protein                             90.1    2e-25   
gb|ACF95815.1|  oxygen evolving enhancer protein 1                    94.0    3e-25   
ref|WP_010314562.1|  photosystem II manganese-stabilizing protein     77.4    3e-25   
ref|WP_007099801.1|  photosystem II manganese-stabilizing polypep...  73.9    3e-25   
ref|WP_010311944.1|  photosystem II manganese-stabilizing protein     77.0    4e-25   
gb|ADC54911.1|  oxygen-evolving enhancer protein                        107   5e-25   
ref|WP_038542990.1|  Photosystem II manganese-stabilizing polypep...  74.3    6e-25   
ref|WP_028953543.1|  Photosystem II manganese-stabilizing polypep...  74.7    6e-25   
ref|WP_006853634.1|  photosystem II manganese-stabilizing protein...  73.2    7e-25   
ref|WP_011127177.1|  photosystem II manganese-stabilizing polypep...  74.3    8e-25   
ref|WP_015165708.1|  photosystem II manganese-stabilizing protein...  87.4    8e-25   
ref|WP_015167227.1|  Manganese-stabilising protein / photosystem ...  91.3    9e-25   
gb|ADC54912.1|  oxygen-evolving enhancer protein                        106   1e-24   
gb|ADC54909.1|  oxygen-evolving enhancer protein                        105   1e-24   
gb|ADC54913.1|  oxygen-evolving enhancer protein                        106   1e-24   
gb|ADC54891.1|  oxygen-evolving enhancer protein                        105   2e-24   
gb|ADC54901.1|  oxygen-evolving enhancer protein                        105   2e-24   
gb|ADC54908.1|  oxygen-evolving enhancer protein                        105   3e-24   
ref|WP_006042289.1|  photosystem II manganese-stabilizing polypep...  73.2    3e-24   
ref|WP_043694690.1|  Photosystem II manganese-stabilizing polypep...  72.0    3e-24   
gb|AHF62713.1|  photosystem II manganese-stabilizing polypeptide      71.6    4e-24   
ref|WP_011363327.1|  photosystem II manganese-stabilizing polypep...  71.6    4e-24   
gb|ADC54896.1|  oxygen-evolving enhancer protein                        104   4e-24   
gb|ADC54894.1|  oxygen-evolving enhancer protein                        104   4e-24   
gb|AAO43192.1|  oxygen-evolving enhancer protein 1 precursor            108   4e-24   
ref|WP_011932278.1|  photosystem II manganese-stabilizing protein...  72.0    5e-24   
gb|ADD94884.1|  photosystem II manganese stabilizing polypeptide      71.2    5e-24   
ref|WP_006909436.1|  photosystem II manganese-stabilizing protein     85.1    6e-24   
ref|XP_002180309.1|  oxygen-evolving enhancer protein 1 precursor       107   7e-24   
ref|WP_009788842.1|  photosystem II manganese-stabilizing polypep...  73.2    7e-24   
gb|ADC54893.1|  oxygen-evolving enhancer protein                        104   8e-24   
gb|ADC54910.1|  oxygen-evolving enhancer protein                        103   9e-24   
ref|WP_038551339.1|  Photosystem II manganese-stabilizing polypep...  70.1    1e-23   
ref|WP_011360791.1|  photosystem II manganese-stabilizing polypep...  70.9    3e-23   
ref|WP_011433163.1|  photosystem II manganese-stabilizing protein     83.6    5e-23   
gb|EJK75097.1|  hypothetical protein THAOC_03193                        104   8e-23   
gb|ABR25929.1|  oxygen-evolving enhancer protein 1                    98.2    2e-22   
ref|XP_002291225.1|  oxygen-evolving enhancer protein 1 precursor       103   2e-22   
ref|WP_036906171.1|  Photosystem II manganese-stabilizing polypep...  67.8    4e-22   
ref|WP_011294230.1|  photosystem II manganese-stabilizing protein     67.8    4e-22   
ref|WP_038651072.1|  Photosystem II manganese-stabilizing polypep...  67.8    5e-22   
ref|WP_019474069.1|  MULTISPECIES: Photosystem II manganese-stabi...  68.9    6e-22   
gb|ABV49867.1|  Photosystem II manganese-stabilizing protein          69.3    6e-22   
ref|WP_011375796.1|  photosystem II manganese-stabilizing protein     69.3    7e-22   
ref|WP_002806175.1|  photosystem II manganese-stabilizing protein     69.3    8e-22   
ref|WP_009628648.1|  photosystem II manganese-stabilizing protein...  80.9    1e-21   
gb|AAW33888.1|  plastid oxygen-evolving enhancer 1 precursor            102   1e-21   
ref|WP_026032523.1|  Photosystem II manganese-stabilizing polypep...  69.3    1e-21   
ref|WP_025929711.1|  Photosystem II manganese-stabilizing polypep...  68.9    1e-21   
ref|WP_026032868.1|  Photosystem II manganese-stabilizing polypep...  69.3    1e-21   
ref|WP_036922154.1|  Photosystem II manganese-stabilizing polypep...  67.8    1e-21   
gb|ADC54898.1|  oxygen-evolving enhancer protein                      98.2    1e-21   
gb|KIY93348.1|  Oxygen-evolving enhancer protein 1                    96.7    1e-21   
ref|XP_005847917.1|  hypothetical protein CHLNCDRAFT_22722            64.7    4e-21   
ref|WP_025952314.1|  Photosystem II manganese-stabilizing polypep...  69.3    4e-21   
gb|ABM69537.1|  Photosystem II manganese-stabilizing protein          69.3    4e-21   
ref|WP_025955147.1|  MULTISPECIES: Photosystem II manganese-stabi...  69.3    4e-21   
ref|WP_025921390.1|  Photosystem II manganese-stabilizing polypep...  69.3    4e-21   
ref|WP_025945629.1|  MULTISPECIES: Photosystem II manganese-stabi...  69.3    4e-21   
gb|ABO16873.1|  Photosystem II manganese-stabilizing protein          69.3    5e-21   
ref|WP_025979193.1|  MULTISPECIES: Photosystem II manganese-stabi...  69.3    5e-21   
ref|WP_025890347.1|  MULTISPECIES: Photosystem II manganese-stabi...  69.3    5e-21   
ref|WP_025892535.1|  MULTISPECIES: Photosystem II manganese-stabi...  69.3    5e-21   
ref|WP_041484654.1|  Photosystem II manganese-stabilizing polypep...  69.3    5e-21   
ref|WP_025942737.1|  MULTISPECIES: Photosystem II manganese-stabi...  69.3    5e-21   
ref|WP_025937984.1|  Photosystem II manganese-stabilizing polypep...  68.9    5e-21   
ref|WP_032527523.1|  Photosystem II manganese-stabilizing polypep...  68.9    5e-21   
ref|WP_042849726.1|  Photosystem II manganese-stabilizing polypep...  68.9    5e-21   
ref|WP_025925905.1|  Photosystem II manganese-stabilizing polypep...  68.9    6e-21   
ref|WP_025956454.1|  Photosystem II manganese-stabilizing polypep...  68.9    6e-21   
gb|KGF94551.1|  Photosystem II manganese-stabilizing protein (PsbO)   68.9    8e-21   
ref|WP_029981289.1|  Photosystem II manganese-stabilizing polypep...  68.9    8e-21   
ref|WP_025946585.1|  Photosystem II manganese-stabilizing polypep...  68.9    8e-21   
ref|WP_025914084.1|  Photosystem II manganese-stabilizing polypep...  69.3    1e-20   
ref|XP_009033884.1|  hypothetical protein AURANDRAFT_69678            98.6    1e-20   
ref|WP_025941252.1|  Photosystem II manganese-stabilizing polypep...  69.3    1e-20   
ref|WP_025906083.1|  Photosystem II manganese-stabilizing polypep...  67.8    1e-20   
ref|WP_011430097.1|  photosystem II manganese-stabilizing protein     80.5    1e-20   
gb|ADC54899.1|  oxygen-evolving enhancer protein                      95.1    1e-20   
ref|WP_025965258.1|  Photosystem II manganese-stabilizing polypep...  67.0    2e-20   
gb|ADC54892.1|  oxygen-evolving enhancer protein                      95.1    2e-20   
ref|WP_019477231.1|  Photosystem II manganese-stabilizing polypep...  65.1    2e-20   
gb|ADC54895.1|  oxygen-evolving enhancer protein                      94.7    2e-20   
ref|WP_036913864.1|  MULTISPECIES: Photosystem II manganese-stabi...  67.4    6e-20   
ref|WP_032514588.1|  Photosystem II manganese-stabilizing polypep...  68.6    6e-20   



>ref|XP_009612279.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Nicotiana tomentosiformis]
 sp|Q40459.1|PSBO_TOBAC RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Nicotiana tabacum]
 emb|CAA45701.1| 33 kDa polypeptide of water-oxidizing complex of photosystem 
II [Nicotiana tabacum]
Length=332

 Score =   175 bits (443),  Expect(2) = 8e-75, Method: Compositional matrix adjust.
 Identities = 84/88 (95%), Positives = 86/88 (98%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVSSDG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESFSGEF
Sbjct  172  DEIEGPFEVSSDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFSGEF  231

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  232  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  259


 Score =   133 bits (335),  Expect(2) = 8e-75, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEELQKEN+KN +SSTGKIT SVT SKPETGEVIGVFES+QPSDTDLGAK PK+V
Sbjct  262  GGRGDEEELQKENVKNTSSSTGKITLSVTQSKPETGEVIGVFESIQPSDTDLGAKVPKDV  321

Query  312  KIQGIWYAQLE  280
            KIQGIWYAQLE
Sbjct  322  KIQGIWYAQLE  332



>gb|AFH57997.1| chloroplast PsbO1 precursor [Nicotiana benthamiana]
Length=332

 Score =   175 bits (444),  Expect(2) = 9e-75, Method: Compositional matrix adjust.
 Identities = 84/88 (95%), Positives = 86/88 (98%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVSSDG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESFSGEF
Sbjct  172  DEIEGPFEVSSDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFSGEF  231

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  232  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  259


 Score =   133 bits (334),  Expect(2) = 9e-75, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL+KEN+KN ASSTGKIT SVT SKPETGEVIGVFES+QPSDTDLGAK PK+V
Sbjct  262  GGRGDEEELEKENVKNTASSTGKITLSVTQSKPETGEVIGVFESIQPSDTDLGAKVPKDV  321

Query  312  KIQGIWYAQLE  280
            KIQGIWYAQLE
Sbjct  322  KIQGIWYAQLE  332



>gb|AAX53163.1| chloroplast photosynthetic oxygen-evolving protein 33 kDa subunit 
[Nicotiana benthamiana]
Length=332

 Score =   175 bits (444),  Expect(2) = 2e-74, Method: Compositional matrix adjust.
 Identities = 84/88 (95%), Positives = 86/88 (98%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVSSDG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESFSGEF
Sbjct  172  DEIEGPFEVSSDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFSGEF  231

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  232  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  259


 Score =   132 bits (331),  Expect(2) = 2e-74, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL+KEN+KN ASSTGKIT SVT SKP+TGEVIGVFES+QPSDTDLGAK PK+V
Sbjct  262  GGRGDEEELEKENVKNTASSTGKITLSVTQSKPQTGEVIGVFESIQPSDTDLGAKVPKDV  321

Query  312  KIQGIWYAQLE  280
            KIQGIWYAQLE
Sbjct  322  KIQGIWYAQLE  332



>gb|AFH57998.1| chloroplast PsbO2 precursor [Nicotiana benthamiana]
Length=332

 Score =   175 bits (444),  Expect(2) = 2e-74, Method: Compositional matrix adjust.
 Identities = 84/88 (95%), Positives = 86/88 (98%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVSSDG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESFSGEF
Sbjct  172  DEIEGPFEVSSDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFSGEF  231

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  232  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  259


 Score =   132 bits (331),  Expect(2) = 2e-74, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL+KEN+KN ASSTGKIT SVT SKP+TGEVIGVFES+QPSDTDLGAK PK+V
Sbjct  262  GGRGDEEELEKENVKNTASSTGKITLSVTQSKPQTGEVIGVFESIQPSDTDLGAKVPKDV  321

Query  312  KIQGIWYAQLE  280
            KIQGIWYAQLE
Sbjct  322  KIQGIWYAQLE  332



>ref|XP_009768511.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Nicotiana sylvestris]
 gb|AAP03871.1| oxygen evolving complex 33 kDa photosystem II protein [Nicotiana 
tabacum]
Length=332

 Score =   175 bits (444),  Expect(2) = 3e-74, Method: Compositional matrix adjust.
 Identities = 84/88 (95%), Positives = 86/88 (98%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVSSDG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESFSGEF
Sbjct  172  DEIEGPFEVSSDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFSGEF  231

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  232  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  259


 Score =   131 bits (330),  Expect(2) = 3e-74, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL+KEN+KN ASSTGKIT SVT  KPETGEVIGVFES+QPSDTDLGAK PK+V
Sbjct  262  GGRGDEEELEKENVKNTASSTGKITLSVTQCKPETGEVIGVFESIQPSDTDLGAKVPKDV  321

Query  312  KIQGIWYAQLE  280
            KIQGIWYAQLE
Sbjct  322  KIQGIWYAQLE  332



>ref|XP_006344816.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Solanum tuberosum]
Length=329

 Score =   173 bits (438),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 83/88 (94%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVS DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESFSGEF
Sbjct  169  DEIEGPFEVSPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFSGEF  228

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  229  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  256


 Score =   132 bits (331),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEELQKEN+KN AS TGKIT SVT SKPETGEVIGVFES+QPSDTDLGAK PK+V
Sbjct  259  GGRGDEEELQKENVKNTASLTGKITLSVTQSKPETGEVIGVFESIQPSDTDLGAKVPKDV  318

Query  312  KIQGIWYAQLE  280
            KIQGIWYAQLE
Sbjct  319  KIQGIWYAQLE  329



>ref|XP_004233415.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Solanum lycopersicum]
 sp|P23322.2|PSBO_SOLLC RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Solanum lycopersicum]
 emb|CAA78043.1| 33kDa precursor protein of oxygen-evolving complex [Solanum lycopersicum]
 prf||2001459A O2 evolving protein complex:SUBUNIT=33kD
Length=329

 Score =   172 bits (437),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 83/88 (94%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVS DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESFSGEF
Sbjct  169  DEIEGPFEVSPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFSGEF  228

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  229  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  256


 Score =   132 bits (331),  Expect(2) = 1e-73, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEELQKEN+KN AS TGKIT SVT SKPETGEVIGVFES+QPSDTDLGAK PK+V
Sbjct  259  GGRGDEEELQKENVKNTASLTGKITLSVTQSKPETGEVIGVFESIQPSDTDLGAKVPKDV  318

Query  312  KIQGIWYAQLE  280
            KIQGIWYAQLE
Sbjct  319  KIQGIWYAQLE  329



>ref|XP_009604683.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=332

 Score =   171 bits (434),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 82/88 (93%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVS DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKP+SFSGEF
Sbjct  172  DEIEGPFEVSPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPDSFSGEF  231

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  232  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  259


 Score =   132 bits (331),  Expect(2) = 2e-73, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEELQKEN+KN +SSTGKIT SVT SKPETGEVIGVFES+QPSDTDLGAK PK+V
Sbjct  262  GGRGDEEELQKENVKNTSSSTGKITLSVTQSKPETGEVIGVFESIQPSDTDLGAKVPKDV  321

Query  312  KIQGIWYAQLE  280
            KIQGIWYAQL+
Sbjct  322  KIQGIWYAQLD  332



>gb|AFH58000.1| chloroplast PsbO4 precursor [Nicotiana benthamiana]
Length=333

 Score =   171 bits (434),  Expect(2) = 3e-73, Method: Compositional matrix adjust.
 Identities = 82/88 (93%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVS DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKP+SFSGEF
Sbjct  172  DEIEGPFEVSPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPDSFSGEF  231

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  232  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  259


 Score =   132 bits (331),  Expect(2) = 3e-73, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL+KEN+KN ASSTGKIT SVT SKPETGEVIGVFES+QPSDTDLGAK PK+V
Sbjct  262  GGRGDEEELEKENVKNTASSTGKITLSVTQSKPETGEVIGVFESIQPSDTDLGAKVPKDV  321

Query  312  KIQGIWYAQLE  280
            KIQGIWYAQL+
Sbjct  322  KIQGIWYAQLD  332



>ref|XP_010103689.1| Oxygen-evolving enhancer protein 1 [Morus notabilis]
 gb|EXB96701.1| Oxygen-evolving enhancer protein 1 [Morus notabilis]
Length=333

 Score =   172 bits (436),  Expect(2) = 3e-73, Method: Compositional matrix adjust.
 Identities = 82/88 (93%), Positives = 86/88 (98%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEV++DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESFSGEF
Sbjct  172  DEIEGPFEVANDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFSGEF  231

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  232  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  259


 Score =   130 bits (328),  Expect(2) = 3e-73, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KENIKN ASSTGKIT SVT SKPETGEVIGVFES+QPSDTDLGAK PK+V
Sbjct  262  GGRGDEEELTKENIKNTASSTGKITLSVTKSKPETGEVIGVFESVQPSDTDLGAKTPKDV  321

Query  312  KIQGIWYAQLE  280
            KIQGIWYAQL+
Sbjct  322  KIQGIWYAQLD  332



>ref|XP_002522386.1| Oxygen-evolving enhancer protein 1, chloroplast precursor, putative 
[Ricinus communis]
 gb|EEF40070.1| Oxygen-evolving enhancer protein 1, chloroplast precursor, putative 
[Ricinus communis]
Length=334

 Score =   172 bits (436),  Expect(2) = 3e-73, Method: Compositional matrix adjust.
 Identities = 83/88 (94%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEV  DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF
Sbjct  173  DEIEGPFEVGPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  232

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  233  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  260


 Score =   130 bits (328),  Expect(2) = 3e-73, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KEN KN ASS GKIT SVTGSKPETGE+IGVFES+QPSDTDLGAK PK+V
Sbjct  263  GGRGDEEELAKENTKNAASSVGKITLSVTGSKPETGEIIGVFESVQPSDTDLGAKTPKDV  322

Query  312  KIQGIWYAQLE  280
            KIQGIWYAQLE
Sbjct  323  KIQGIWYAQLE  333



>ref|XP_009759927.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Nicotiana sylvestris]
Length=333

 Score =   171 bits (434),  Expect(2) = 3e-73, Method: Compositional matrix adjust.
 Identities = 82/88 (93%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVS DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKP+SFSGEF
Sbjct  172  DEIEGPFEVSPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPDSFSGEF  231

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  232  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  259


 Score =   131 bits (330),  Expect(2) = 3e-73, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL+KEN+KN ASSTGKIT SVT SKPETGEVIGVFES+QPSDTDLGAK PK+V
Sbjct  262  GGRGDEEELEKENVKNTASSTGKITLSVTRSKPETGEVIGVFESIQPSDTDLGAKVPKDV  321

Query  312  KIQGIWYAQLE  280
            KIQGIWYAQL+
Sbjct  322  KIQGIWYAQLD  332



>gb|EPS61846.1| oxygen-evolving enhancer protein 1, chloroplastic [Genlisea aurea]
Length=330

 Score =   167 bits (424),  Expect(2) = 4e-73, Method: Compositional matrix adjust.
 Identities = 81/88 (92%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVSSDGSVKF EKDGIDYAAVTVQLPGGERVPFLFTIKQL A+G P+SFSGEF
Sbjct  169  DEIEGPFEVSSDGSVKFVEKDGIDYAAVTVQLPGGERVPFLFTIKQLAASGTPDSFSGEF  228

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  229  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  256


 Score =   135 bits (339),  Expect(2) = 4e-73, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEELQKENIKN ASSTGKIT S+T +KPETGEVIGVFESLQPSDTDLG+KAPK+V
Sbjct  259  GGRGDEEELQKENIKNTASSTGKITLSITKTKPETGEVIGVFESLQPSDTDLGSKAPKDV  318

Query  312  KIQGIWYAQLE  280
            KIQGIWYAQLE
Sbjct  319  KIQGIWYAQLE  329



>ref|XP_009758248.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Nicotiana sylvestris]
Length=328

 Score =   172 bits (435),  Expect(2) = 4e-73, Method: Compositional matrix adjust.
 Identities = 83/88 (94%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVSSDG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQL A GKPESFSGEF
Sbjct  167  DEIEGPFEVSSDGNVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLAANGKPESFSGEF  226

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  227  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  254


 Score =   130 bits (328),  Expect(2) = 4e-73, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL+KEN+KN +SSTGKIT SVT SKPETGEVIGVFES+QPSDTDLGAK PK+V
Sbjct  257  GGRGDEEELEKENVKNTSSSTGKITLSVTNSKPETGEVIGVFESIQPSDTDLGAKVPKDV  316

Query  312  KIQGIWYAQLE  280
            KIQGIWYAQL+
Sbjct  317  KIQGIWYAQLD  327



>ref|XP_011004600.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Populus euphratica]
Length=331

 Score =   171 bits (432),  Expect(2) = 5e-73, Method: Compositional matrix adjust.
 Identities = 81/88 (92%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVS DG++KFEEKDGIDYAAVTVQLPGGERVPFLFTIKQL A+GKPESFSGEF
Sbjct  171  DEIEGPFEVSPDGTIKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLTASGKPESFSGEF  230

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  231  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  258


 Score =   131 bits (330),  Expect(2) = 5e-73, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KENIKN ASSTGKIT SVT SKPETGE+IGVFESLQPSDTDLGAK PK+V
Sbjct  261  GGRGDEEELLKENIKNTASSTGKITLSVTKSKPETGEIIGVFESLQPSDTDLGAKTPKDV  320

Query  312  KIQGIWYAQLE  280
            KIQGIWYAQL+
Sbjct  321  KIQGIWYAQLD  331



>gb|ADZ75466.1| oxygen evolving enhancer protein 1 [Litchi chinensis]
Length=333

 Score =   171 bits (432),  Expect(2) = 5e-73, Method: Compositional matrix adjust.
 Identities = 81/88 (92%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVSSDG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESF G+F
Sbjct  172  DEIEGPFEVSSDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFGGQF  231

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRG+SFLDPKGRGGSTGYDNAV  
Sbjct  232  LVPSYRGTSFLDPKGRGGSTGYDNAVAL  259


 Score =   131 bits (330),  Expect(2) = 5e-73, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KENIKN +SSTGKIT SVT +KPETGEVIGVFESLQPSDTDLGAK PK+V
Sbjct  262  GGRGDEEELAKENIKNASSSTGKITLSVTKTKPETGEVIGVFESLQPSDTDLGAKVPKDV  321

Query  312  KIQGIWYAQLE  280
            KIQGIWYAQLE
Sbjct  322  KIQGIWYAQLE  332



>ref|XP_002310188.1| O2 evolving complex 33kD family protein [Populus trichocarpa]
 gb|ABK95579.1| unknown [Populus trichocarpa]
 gb|ABK96112.1| unknown [Populus trichocarpa]
 gb|ABK96443.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE90638.1| O2 evolving complex 33kD family protein [Populus trichocarpa]
Length=332

 Score =   171 bits (434),  Expect(2) = 6e-73, Method: Compositional matrix adjust.
 Identities = 81/88 (92%), Positives = 86/88 (98%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVSSDG++KFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKP+SFSG+F
Sbjct  171  DEIEGPFEVSSDGNIKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPDSFSGDF  230

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  231  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  258


 Score =   131 bits (329),  Expect(2) = 6e-73, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KENIKN ASSTGKIT SVT SKPETGEVIGVFES+QPSDTDLGAK PK+V
Sbjct  261  GGRGDEEELTKENIKNTASSTGKITLSVTKSKPETGEVIGVFESVQPSDTDLGAKTPKDV  320

Query  312  KIQGIWYAQLE  280
            KIQGIWYAQL+
Sbjct  321  KIQGIWYAQLD  331



>ref|XP_002307234.1| O2 evolving complex 33kD family protein [Populus trichocarpa]
 gb|ABK95762.1| unknown [Populus trichocarpa]
 gb|ABK96188.1| unknown [Populus trichocarpa]
 gb|EEE94230.1| O2 evolving complex 33kD family protein [Populus trichocarpa]
Length=331

 Score =   171 bits (432),  Expect(2) = 6e-73, Method: Compositional matrix adjust.
 Identities = 81/88 (92%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVS DG++KFEEKDGIDYAAVTVQLPGGERVPFLFTIKQL A+GKPESFSGEF
Sbjct  171  DEIEGPFEVSPDGTIKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLAASGKPESFSGEF  230

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  231  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  258


 Score =   131 bits (330),  Expect(2) = 6e-73, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KENIKN ASSTGKIT SVT SKPETGE+IGVFESLQPSDTDLGAK PK+V
Sbjct  261  GGRGDEEELLKENIKNTASSTGKITLSVTKSKPETGEIIGVFESLQPSDTDLGAKTPKDV  320

Query  312  KIQGIWYAQLE  280
            KIQGIWYAQL+
Sbjct  321  KIQGIWYAQLD  331



>gb|KDP31833.1| hypothetical protein JCGZ_12294 [Jatropha curcas]
Length=332

 Score =   170 bits (431),  Expect(2) = 6e-73, Method: Compositional matrix adjust.
 Identities = 81/88 (92%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEV+ DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESFSG+F
Sbjct  171  DEIEGPFEVAPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFSGQF  230

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  231  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  258


 Score =   132 bits (331),  Expect(2) = 6e-73, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KEN KNV SSTGKIT SVTGSKPETGEVIGVFES+QPSDTDLGAK PK+V
Sbjct  261  GGRGDEEELAKENNKNVGSSTGKITLSVTGSKPETGEVIGVFESVQPSDTDLGAKTPKDV  320

Query  312  KIQGIWYAQLE  280
            KIQGIWYAQLE
Sbjct  321  KIQGIWYAQLE  331



>ref|XP_011025676.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Populus euphratica]
Length=332

 Score =   171 bits (432),  Expect(2) = 7e-73, Method: Compositional matrix adjust.
 Identities = 81/88 (92%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVSSDG++KFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKP+SF GEF
Sbjct  171  DEIEGPFEVSSDGTIKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPDSFGGEF  230

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  231  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  258


 Score =   131 bits (329),  Expect(2) = 7e-73, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KENIKN ASSTGKIT SVT SKPETGEVIGVFES+QPSDTDLGAK PK+V
Sbjct  261  GGRGDEEELTKENIKNTASSTGKITLSVTKSKPETGEVIGVFESVQPSDTDLGAKTPKDV  320

Query  312  KIQGIWYAQLE  280
            KIQGIWYAQL+
Sbjct  321  KIQGIWYAQLD  331



>ref|XP_006338257.1| PREDICTED: chloroplast manganese stabilizing protein-II [Solanum 
tuberosum]
Length=333

 Score =   171 bits (433),  Expect(2) = 8e-73, Method: Compositional matrix adjust.
 Identities = 82/88 (93%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVS DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESFSG+F
Sbjct  172  DEIEGPFEVSPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFSGDF  231

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  232  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  259


 Score =   130 bits (327),  Expect(2) = 8e-73, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEELQKEN+KN AS TGKITF+VT S P+TGEVIGVFES+QPSDTDLGAK PK+V
Sbjct  262  GGRGDEEELQKENVKNTASLTGKITFTVTKSNPQTGEVIGVFESIQPSDTDLGAKTPKDV  321

Query  312  KIQGIWYAQLE  280
            KIQGIWYAQLE
Sbjct  322  KIQGIWYAQLE  332



>gb|ABK96748.1| unknown [Populus trichocarpa x Populus deltoides]
Length=331

 Score =   169 bits (427),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 79/88 (90%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVS DG++KFEEKDGIDYAAVTVQLPGGERVPFLFTIKQL A+GKPE+FSGEF
Sbjct  171  DEIEGPFEVSPDGTIKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLAASGKPENFSGEF  230

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRG+SFLDPKGRGGSTGYDNAV  
Sbjct  231  LVPSYRGTSFLDPKGRGGSTGYDNAVAL  258


 Score =   133 bits (334),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KENIKN ASSTGKIT SVT SKPETGE+IGVFESLQPSDTDLGAK PK+V
Sbjct  261  GGRGDEEELLKENIKNTASSTGKITLSVTKSKPETGEIIGVFESLQPSDTDLGAKTPKDV  320

Query  312  KIQGIWYAQLE  280
            KIQGIWYAQLE
Sbjct  321  KIQGIWYAQLE  331



>ref|XP_004232077.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Solanum lycopersicum]
Length=333

 Score =   171 bits (433),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 82/88 (93%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVS DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESFSG+F
Sbjct  172  DEIEGPFEVSPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFSGDF  231

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  232  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  259


 Score =   130 bits (327),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEELQKEN+KN AS TGKITF+VT S P+TGEVIGVFES+QPSDTDLGAK PK+V
Sbjct  262  GGRGDEEELQKENVKNTASLTGKITFTVTKSNPQTGEVIGVFESIQPSDTDLGAKTPKDV  321

Query  312  KIQGIWYAQLE  280
            KIQGIWYAQLE
Sbjct  322  KIQGIWYAQLE  332



>sp|P12359.1|PSBO_SPIOL RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Spinacia oleracea]
Length=332

 Score =   174 bits (440),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 83/88 (94%), Positives = 86/88 (98%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVSSDG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESFSG+F
Sbjct  170  DEIEGPFEVSSDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFSGDF  229

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  230  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  257


 Score =   127 bits (320),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEELQKEN KNVASS G IT SVT SKPETGEVIGVF+SLQPSDTDLGAK PK+V
Sbjct  260  GGRGDEEELQKENNKNVASSKGTITLSVTSSKPETGEVIGVFQSLQPSDTDLGAKVPKDV  319

Query  312  KIQGIWYAQLE  280
            KI+G+WYAQLE
Sbjct  320  KIEGVWYAQLE  330



>ref|XP_010673597.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=330

 Score =   173 bits (438),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 82/88 (93%), Positives = 86/88 (98%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DE+EGPFEVSSDG+VKFEEKDGIDYAAVTVQLPGGERVPFLFT+KQLVA+GKPESFSGEF
Sbjct  169  DEMEGPFEVSSDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQLVASGKPESFSGEF  228

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  229  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  256


 Score =   128 bits (321),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEELQKEN+KN ASS G IT SVT SKPETGEVIGVF+SLQPSDTDLGAK PK+V
Sbjct  259  GGRGDEEELQKENVKNTASSKGTITLSVTQSKPETGEVIGVFQSLQPSDTDLGAKVPKDV  318

Query  312  KIQGIWYAQLE  280
            KI+GIWYAQLE
Sbjct  319  KIEGIWYAQLE  329



>ref|XP_004141946.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004160493.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Cucumis sativus]
 gb|KGN48464.1| Oxygen-evolving enhancer protein 1 [Cucumis sativus]
Length=332

 Score =   170 bits (430),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 81/88 (92%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEV +DGS+KFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESFSG+F
Sbjct  171  DEIEGPFEVGADGSIKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFSGDF  230

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  231  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  258


 Score =   131 bits (329),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KENIKN +SSTGKIT SVT SKPETGEVIGVFES+QPSDTDLGAKAPK+V
Sbjct  261  GGRGDEEELAKENIKNASSSTGKITLSVTKSKPETGEVIGVFESIQPSDTDLGAKAPKDV  320

Query  312  KIQGIWYAQLE  280
            KIQG+WYAQL+
Sbjct  321  KIQGVWYAQLD  331



>emb|CAA29062.1| unnamed protein product [Spinacia oleracea]
 prf||1404364A protein 33kD
Length=331

 Score =   173 bits (439),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 83/88 (94%), Positives = 86/88 (98%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVSSDG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESFSG+F
Sbjct  170  DEIEGPFEVSSDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFSGDF  229

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  230  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  257


 Score =   127 bits (320),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEELQKEN KNVASS G IT SVT SKPETGEVIGVF+SLQPSDTDLGAK PK+V
Sbjct  260  GGRGDEEELQKENNKNVASSKGTITLSVTSSKPETGEVIGVFQSLQPSDTDLGAKVPKDV  319

Query  312  KIQGIWYAQLE  280
            KI+G+WYAQLE
Sbjct  320  KIEGVWYAQLE  330



>ref|XP_010028333.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Eucalyptus grandis]
 gb|KCW55051.1| hypothetical protein EUGRSUZ_I01025 [Eucalyptus grandis]
Length=331

 Score =   172 bits (437),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 83/88 (94%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVS DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESFSGEF
Sbjct  170  DEIEGPFEVSPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFSGEF  229

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  230  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  257


 Score =   128 bits (321),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEE+L KENIKN +SSTGKIT SVT +KPETGEVIGVFES+QPSDTDLGAK PK+V
Sbjct  260  GGRGDEEDLTKENIKNASSSTGKITLSVTKTKPETGEVIGVFESVQPSDTDLGAKVPKDV  319

Query  312  KIQGIWYAQLE  280
            KIQG+WYAQLE
Sbjct  320  KIQGVWYAQLE  330



>gb|ADR71223.1| chloroplast manganese stabilizing protein [Solanum tuberosum]
Length=321

 Score =   172 bits (436),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 83/88 (94%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVS DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESFSGEF
Sbjct  163  DEIEGPFEVSPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFSGEF  222

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  223  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  250


 Score =   128 bits (321),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEELQKEN+KN AS TGKIT SVT SKPETGEVIGVFES+QPSDTDLGAK PK+V
Sbjct  253  GGRGDEEELQKENVKNTASLTGKITLSVTQSKPETGEVIGVFESIQPSDTDLGAKVPKDV  312

Query  312  KIQGIWYAQ  286
            KIQGIWYAQ
Sbjct  313  KIQGIWYAQ  321



>gb|AEN02470.1| oxygen-evolving enhancer protein [Camellia sinensis]
Length=333

 Score =   168 bits (425),  Expect(2) = 3e-72, Method: Compositional matrix adjust.
 Identities = 81/88 (92%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVS DGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESF G+F
Sbjct  173  DEIEGPFEVSPDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFGGQF  232

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYD+AV  
Sbjct  233  LVPSYRGSSFLDPKGRGGSTGYDSAVAL  260


 Score =   131 bits (330),  Expect(2) = 3e-72, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KENIKN ASSTGKIT  VT SKPETGEVIGVFES+QPSDTDLGAK PKEV
Sbjct  263  GGRGDEEELVKENIKNTASSTGKITLGVTNSKPETGEVIGVFESIQPSDTDLGAKVPKEV  322

Query  312  KIQGIWYAQLE  280
            KIQG+WYAQLE
Sbjct  323  KIQGVWYAQLE  333



>emb|CDP02430.1| unnamed protein product [Coffea canephora]
Length=331

 Score =   167 bits (422),  Expect(2) = 4e-72, Method: Compositional matrix adjust.
 Identities = 79/88 (90%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEV++DG++KF EKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESFSGEF
Sbjct  171  DEIEGPFEVNTDGTIKFVEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFSGEF  230

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYD+AV  
Sbjct  231  LVPSYRGSSFLDPKGRGGSTGYDSAVAL  258


 Score =   132 bits (333),  Expect(2) = 4e-72, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KENIKNV+SS+GKIT SVT SKPETGEVIGVFES+QPSDTDLG+KAPKEV
Sbjct  261  GGRGDEEELVKENIKNVSSSSGKITLSVTKSKPETGEVIGVFESVQPSDTDLGSKAPKEV  320

Query  312  KIQGIWYAQLE  280
            KIQGIWYAQLE
Sbjct  321  KIQGIWYAQLE  331



>gb|AFH57999.1| chloroplast PsbO3 precursor [Nicotiana benthamiana]
Length=333

 Score =   168 bits (425),  Expect(2) = 6e-72, Method: Compositional matrix adjust.
 Identities = 81/88 (92%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVS DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKP+SFSGEF
Sbjct  172  DEIEGPFEVSPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPDSFSGEF  231

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGST YDNAV  
Sbjct  232  LVPSYRGSSFLDPKGRGGSTVYDNAVAL  259


 Score =   130 bits (328),  Expect(2) = 6e-72, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL+KEN+KN AS+TGKIT SVT SKPETGEVIGVFES+QPSDTDLGAK PK+V
Sbjct  262  GGRGDEEELEKENVKNTASATGKITLSVTQSKPETGEVIGVFESIQPSDTDLGAKVPKDV  321

Query  312  KIQGIWYAQLE  280
            KIQGIWYAQL+
Sbjct  322  KIQGIWYAQLD  332



>ref|XP_009616099.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Nicotiana tomentosiformis]
Length=326

 Score =   170 bits (431),  Expect(2) = 7e-72, Method: Compositional matrix adjust.
 Identities = 82/88 (93%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGP EVSSDG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQL A+GKPESFSGEF
Sbjct  165  DEIEGPLEVSSDGNVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLAASGKPESFSGEF  224

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  225  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  252


 Score =   128 bits (322),  Expect(2) = 7e-72, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL+KEN+KN +SSTGKIT SVT SKP+TGE+IGVFES+QPSDTDLGAK PK+V
Sbjct  255  GGRGDEEELEKENVKNTSSSTGKITLSVTNSKPDTGELIGVFESIQPSDTDLGAKVPKDV  314

Query  312  KIQGIWYAQLE  280
            KIQGIWYAQL+
Sbjct  315  KIQGIWYAQLD  325



>sp|P26320.1|PSBO_SOLTU RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Solanum tuberosum]
Length=333

 Score =   168 bits (425),  Expect(2) = 8e-72, Method: Compositional matrix adjust.
 Identities = 81/88 (92%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVS DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESFS +F
Sbjct  172  DEIEGPFEVSPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFSVDF  231

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  232  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  259


 Score =   130 bits (327),  Expect(2) = 8e-72, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEELQKEN+KN AS TGKITF+VT S P+TGEVIGVFES+QPSDTDLGAK PK+V
Sbjct  262  GGRGDEEELQKENVKNTASLTGKITFTVTKSNPQTGEVIGVFESIQPSDTDLGAKTPKDV  321

Query  312  KIQGIWYAQLE  280
            KIQGIWYAQLE
Sbjct  322  KIQGIWYAQLE  332



>gb|AFH40666.1| chloroplast oxygen-evolving enhancer protein 1, partial [Saccharum 
hybrid cultivar]
Length=332

 Score =   166 bits (419),  Expect(2) = 9e-72, Method: Compositional matrix adjust.
 Identities = 79/88 (90%), Positives = 82/88 (93%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGP EV SDG++KFEEKDGIDYAAVTVQLPGGERVPFLFT+KQLVATGKPESF G F
Sbjct  172  DEIEGPLEVGSDGTLKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQLVATGKPESFGGPF  231

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  232  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  259


 Score =   132 bits (333),  Expect(2) = 9e-72, Method: Compositional matrix adjust.
 Identities = 64/71 (90%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEELQKENIKN ASSTG IT SVT S PETGEVIGVFES+QPSDTDLGAKAPK+V
Sbjct  262  GGRGDEEELQKENIKNAASSTGNITLSVTKSNPETGEVIGVFESVQPSDTDLGAKAPKDV  321

Query  312  KIQGIWYAQLE  280
            KIQGIWYAQLE
Sbjct  322  KIQGIWYAQLE  332



>ref|XP_008647514.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACG31595.1| oxygen-evolving enhancer protein 1 [Zea mays]
 gb|ACN32168.1| unknown [Zea mays]
 gb|AFW75930.1| oxygen-evolving enhancer protein 1 [Zea mays]
Length=329

 Score =   166 bits (420),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 79/88 (90%), Positives = 82/88 (93%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGP EV SDG++KFEEKDGIDYAAVTVQLPGGERVPFLFT+KQLVATGKPESF G F
Sbjct  169  DEIEGPLEVGSDGTLKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQLVATGKPESFGGPF  228

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  229  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  256


 Score =   132 bits (332),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEELQKENIKN ASSTG IT SVT S PETGEVIGVFES+QPSDTDLGAKAPK+V
Sbjct  259  GGRGDEEELQKENIKNAASSTGNITLSVTKSNPETGEVIGVFESVQPSDTDLGAKAPKDV  318

Query  312  KIQGIWYAQLE  280
            KIQG+WYAQLE
Sbjct  319  KIQGVWYAQLE  329



>emb|CAA35601.1| 33kDa precursor protein of oxygen-evolving complex [Solanum tuberosum]
Length=332

 Score =   167 bits (424),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 81/88 (92%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVS DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESFS +F
Sbjct  171  DEIEGPFEVSPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFSVDF  230

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  231  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  258


 Score =   130 bits (327),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEELQKEN+KN AS TGKITF+VT S P+TGEVIGVFES+QPSDTDLGAK PK+V
Sbjct  261  GGRGDEEELQKENVKNTASLTGKITFTVTKSNPQTGEVIGVFESIQPSDTDLGAKTPKDV  320

Query  312  KIQGIWYAQLE  280
            KIQGIWYAQLE
Sbjct  321  KIQGIWYAQLE  331



>sp|O49079.1|PSBO_FRIAG RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Fritillaria agrestis]
 gb|AAC04808.1| photosystem II oxygen evolving complex protein 1 precursor [Fritillaria 
agrestis]
Length=329

 Score =   167 bits (422),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 79/88 (90%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEV+ DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFT+KQLVATGKPESFSG +
Sbjct  169  DEIEGPFEVAPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQLVATGKPESFSGSY  228

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGS GYDNAV  
Sbjct  229  LVPSYRGSSFLDPKGRGGSAGYDNAVAL  256


 Score =   131 bits (329),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KENIK+V+SSTGKIT SVT SKPETGEVIGVFES+QPSDTDLG+KAPK+V
Sbjct  259  GGRGDEEELVKENIKDVSSSTGKITLSVTKSKPETGEVIGVFESIQPSDTDLGSKAPKDV  318

Query  312  KIQGIWYAQLE  280
            KIQGIWYAQLE
Sbjct  319  KIQGIWYAQLE  329



>gb|ABK95838.1| unknown [Populus trichocarpa]
Length=170

 Score =   169 bits (427),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 81/88 (92%), Positives = 86/88 (98%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVSSDG++KFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKP+SFSG+F
Sbjct  9    DEIEGPFEVSSDGNIKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPDSFSGDF  68

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  69   LVPSYRGSSFLDPKGRGGSTGYDNAVAL  96


 Score =   129 bits (325),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KENIKN ASSTGKIT SVT SKPETGEVIGVFES+QPSDTDLGAK PK+V
Sbjct  99   GGRGDEEELTKENIKNTASSTGKITLSVTKSKPETGEVIGVFESVQPSDTDLGAKTPKDV  158

Query  312  KIQGIWYAQLE  280
            KIQGIWYAQL+
Sbjct  159  KIQGIWYAQLD  169



>ref|XP_006644206.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Oryza brachyantha]
Length=334

 Score =   170 bits (430),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 81/88 (92%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGP EVS+DG++KFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSG F
Sbjct  172  DEIEGPLEVSADGNIKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGPF  231

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  232  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  259


 Score =   128 bits (321),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KEN+KN +SSTG IT SVT SKPETGEVIGVFES+QPSDTDLGAK PK+V
Sbjct  262  GGRGDEEELAKENVKNASSSTGNITLSVTKSKPETGEVIGVFESVQPSDTDLGAKVPKDV  321

Query  312  KIQGIWYAQLE  280
            KIQG+WYAQLE
Sbjct  322  KIQGVWYAQLE  332



>gb|AFW69213.1| oxygen-evolving enhancer protein 1 [Zea mays]
Length=373

 Score =   166 bits (420),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 78/88 (89%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGP EV+SDG++KFEEKDGIDYAAVTVQLPGGERVPFLFT+KQLVATGKP+SF G F
Sbjct  213  DEIEGPLEVASDGTLKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQLVATGKPDSFGGPF  272

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  273  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  300


 Score =   131 bits (330),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEELQKENIKN ASSTG IT SVT S P+TGEVIGVFES+QPSDTDLGAKAPK+V
Sbjct  303  GGRGDEEELQKENIKNAASSTGNITLSVTKSNPDTGEVIGVFESVQPSDTDLGAKAPKDV  362

Query  312  KIQGIWYAQLE  280
            KIQG+WYAQLE
Sbjct  363  KIQGVWYAQLE  373



>dbj|BAA96365.3| oxygen evolving enhancer protein 1 precursor [Bruguiera gymnorhiza]
Length=332

 Score =   169 bits (427),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 80/88 (91%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVS DG+VKF EKDGIDYAAVTVQLPGGERVPFLFT+KQLVATGKPESFSGE+
Sbjct  171  DEIEGPFEVSPDGTVKFVEKDGIDYAAVTVQLPGGERVPFLFTVKQLVATGKPESFSGEY  230

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGY+NAV  
Sbjct  231  LVPSYRGSSFLDPKGRGGSTGYBNAVAL  258


 Score =   129 bits (324),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KENIKN +SSTGKIT  VT SKPETGEVIGVFESLQPSDTDLGAK PK+V
Sbjct  261  GGRGDEEELTKENIKNTSSSTGKITLGVTKSKPETGEVIGVFESLQPSDTDLGAKVPKDV  320

Query  312  KIQGIWYAQLE  280
            KIQGIWYAQL+
Sbjct  321  KIQGIWYAQLD  331



>ref|NP_001240871.1| uncharacterized protein LOC100811386 [Glycine max]
 gb|ACU17834.1| unknown [Glycine max]
 gb|KHN00579.1| Oxygen-evolving enhancer protein 1, chloroplastic [Glycine soja]
Length=326

 Score =   171 bits (433),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 82/88 (93%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVSSDG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKP+SFSGEF
Sbjct  165  DEIEGPFEVSSDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPDSFSGEF  224

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRG STGYDNAV  
Sbjct  225  LVPSYRGSSFLDPKGRGASTGYDNAVAL  252


 Score =   126 bits (317),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KEN K+ +SS GKITFSVT +KPETGEVIGVF+SLQPSDTDLGAKAPK+V
Sbjct  255  GGRGDEEELAKENNKSASSSKGKITFSVTKTKPETGEVIGVFQSLQPSDTDLGAKAPKDV  314

Query  312  KIQGIWYAQLE  280
            KIQGIWYAQLE
Sbjct  315  KIQGIWYAQLE  325



>ref|XP_008440181.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Cucumis melo]
Length=332

 Score =   168 bits (426),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 80/88 (91%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEV +DGS+KFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESF G+F
Sbjct  171  DEIEGPFEVGADGSIKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFGGDF  230

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  231  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  258


 Score =   129 bits (324),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KEN KN +SSTGKIT SVT SKPETGEVIGVFES+QPSDTDLGAKAPK+V
Sbjct  261  GGRGDEEELAKENNKNASSSTGKITLSVTKSKPETGEVIGVFESIQPSDTDLGAKAPKDV  320

Query  312  KIQGIWYAQLE  280
            KIQG+WYAQLE
Sbjct  321  KIQGVWYAQLE  331



>ref|XP_003636084.1| Oxygen-evolving enhancer protein [Medicago truncatula]
 gb|KEH20462.1| photosystem II oxygen-evolving enhancer protein [Medicago truncatula]
Length=329

 Score =   172 bits (437),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 83/88 (94%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESFSGE+
Sbjct  168  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFSGEY  227

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRG STGYDNAV  
Sbjct  228  LVPSYRGSSFLDPKGRGASTGYDNAVAL  255


 Score =   124 bits (312),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KEN K+ ASS GKIT SVT +KPETGEVIGVFES+QPSDTDLGAKAPK+V
Sbjct  258  GGRGDEEELGKENNKSAASSKGKITLSVTQTKPETGEVIGVFESIQPSDTDLGAKAPKDV  317

Query  312  KIQGIWYAQLE  280
            KIQG+WYAQLE
Sbjct  318  KIQGVWYAQLE  328



>ref|XP_006856169.1| hypothetical protein AMTR_s00059p00176390 [Amborella trichopoda]
 gb|ERN17636.1| hypothetical protein AMTR_s00059p00176390 [Amborella trichopoda]
Length=331

 Score =   166 bits (421),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 79/88 (90%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVS DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPE F G+F
Sbjct  171  DEIEGPFEVSPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPERFGGQF  230

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNA+  
Sbjct  231  LVPSYRGSSFLDPKGRGGSTGYDNAIAL  258


 Score =   130 bits (326),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGD+EELQKENIKN ASSTG IT SVT SKPE+GEVIGVFES+QPSDTDLGAK PK+V
Sbjct  261  GGRGDDEELQKENIKNTASSTGNITLSVTKSKPESGEVIGVFESIQPSDTDLGAKTPKDV  320

Query  312  KIQGIWYAQLE  280
            KIQGIWYAQLE
Sbjct  321  KIQGIWYAQLE  331



>ref|NP_001130585.1| uncharacterized protein LOC100191684 [Zea mays]
 gb|ACF78862.1| unknown [Zea mays]
 gb|ACF88206.1| unknown [Zea mays]
 gb|ACG31799.1| oxygen-evolving enhancer protein 1 [Zea mays]
 gb|ACN29302.1| unknown [Zea mays]
 gb|ACN33484.1| unknown [Zea mays]
Length=335

 Score =   166 bits (419),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 78/88 (89%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGP EV+SDG++KFEEKDGIDYAAVTVQLPGGERVPFLFT+KQLVATGKP+SF G F
Sbjct  175  DEIEGPLEVASDGTLKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQLVATGKPDSFGGPF  234

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  235  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  262


 Score =   131 bits (329),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEELQKENIKN ASSTG IT SVT S P+TGEVIGVFES+QPSDTDLGAKAPK+V
Sbjct  265  GGRGDEEELQKENIKNAASSTGNITLSVTKSNPDTGEVIGVFESVQPSDTDLGAKAPKDV  324

Query  312  KIQGIWYAQLE  280
            KIQG+WYAQLE
Sbjct  325  KIQGVWYAQLE  335



>prf||1204192A photosystem II protein 33kD
Length=248

 Score =   171 bits (432),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 83/88 (94%), Positives = 86/88 (98%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVSSDG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESFSG+F
Sbjct  86   DEIEGPFEVSSDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFSGDF  145

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  146  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  173


 Score =   126 bits (316),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEELQKEN KNVASS G IT SVT SKPETGEVIGVF+SLQPSDTDLGAK PK+V
Sbjct  176  GGRGDEEELQKENNKNVASSKGTITLSVTSSKPETGEVIGVFQSLQPSDTDLGAKVPKDV  235

Query  312  KIQGIWYAQLE  280
            KI+G+WYAQLE
Sbjct  236  KIEGVWYAQLE  246



>ref|XP_002274796.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Vitis vinifera]
Length=332

 Score =   169 bits (427),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 81/88 (92%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVSSDG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKP+ F GEF
Sbjct  171  DEIEGPFEVSSDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPDKFGGEF  230

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  231  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  258


 Score =   127 bits (320),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL+KENIK+ +SSTGKIT SVT SKPETGEVIGVFES+QPSDTDLGAK PKEV
Sbjct  261  GGRGDEEELKKENIKDASSSTGKITLSVTKSKPETGEVIGVFESIQPSDTDLGAKTPKEV  320

Query  312  KIQGIWYAQLE  280
            KIQG WY QLE
Sbjct  321  KIQGFWYGQLE  331



>ref|XP_003548008.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Glycine max]
 gb|KHN13352.1| Oxygen-evolving enhancer protein 1, chloroplastic [Glycine soja]
Length=331

 Score =   172 bits (435),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 82/88 (93%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVSSDG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKP+SFSGEF
Sbjct  170  DEIEGPFEVSSDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPDSFSGEF  229

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRG STGYDNAV  
Sbjct  230  LVPSYRGSSFLDPKGRGASTGYDNAVAL  257


 Score =   124 bits (311),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KEN K+ +SS GKIT SVT +KPETGEVIGVFES+QPSDTDLGAKAPK+V
Sbjct  260  GGRGDEEELAKENNKSASSSKGKITLSVTKTKPETGEVIGVFESVQPSDTDLGAKAPKDV  319

Query  312  KIQGIWYAQLE  280
            KIQGIWYAQLE
Sbjct  320  KIQGIWYAQLE  330



>sp|P14226.1|PSBO_PEA RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Pisum sativum]
 emb|CAA33408.1| unnamed protein product [Pisum sativum]
 dbj|BAA02554.1| precursor for 33-kDa protein of photosystem II [Pisum sativum]
 prf||1611461A O2 evolving complex 33kD protein
Length=329

 Score =   172 bits (435),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 82/88 (93%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVS+DGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKP+SFSGEF
Sbjct  168  DEIEGPFEVSADGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPDSFSGEF  227

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRG STGYDNAV  
Sbjct  228  LVPSYRGSSFLDPKGRGASTGYDNAVAL  255


 Score =   124 bits (312),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KEN K+ ASS GKIT SVT +KPETGEVIGVFES+QPSDTDLGAKAPK+V
Sbjct  258  GGRGDEEELGKENNKSAASSKGKITLSVTQTKPETGEVIGVFESIQPSDTDLGAKAPKDV  317

Query  312  KIQGIWYAQLE  280
            KIQG+WYAQLE
Sbjct  318  KIQGVWYAQLE  328



>ref|XP_003557544.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Brachypodium distachyon]
Length=330

 Score =   168 bits (426),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 79/88 (90%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGP EV++DG++KFEEKDGIDYAAVTVQLPGGERVPFLFT+KQLVATGKPESFSG F
Sbjct  168  DEIEGPLEVAADGTLKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQLVATGKPESFSGPF  227

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  228  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  255


 Score =   127 bits (320),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KEN+KN +SS G IT SVT SKPETGEVIGVFES+QPSDTDLGAKAPK+V
Sbjct  258  GGRGDEEELAKENVKNASSSQGNITLSVTKSKPETGEVIGVFESVQPSDTDLGAKAPKDV  317

Query  312  KIQGIWYAQLE  280
            KIQG+WYAQLE
Sbjct  318  KIQGVWYAQLE  328



>gb|EMS63035.1| Oxygen-evolving enhancer protein 1, chloroplastic [Triticum urartu]
 gb|EMT33794.1| Oxygen-evolving enhancer protein 1, chloroplastic [Aegilops tauschii]
Length=328

 Score =   166 bits (420),  Expect(2) = 4e-71, Method: Compositional matrix adjust.
 Identities = 78/88 (89%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DE+EGP EV +DG++KFEEKDGIDYAAVTVQLPGGERVPFLFT+KQLVATGKPESFSG F
Sbjct  166  DEMEGPLEVGADGTLKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQLVATGKPESFSGPF  225

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  226  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  253


 Score =   130 bits (326),  Expect(2) = 4e-71, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KEN+KN +SSTG IT SVT SKPETGEVIGVFES+QPSDTDLGAKAPK+V
Sbjct  256  GGRGDEEELAKENVKNASSSTGNITLSVTKSKPETGEVIGVFESVQPSDTDLGAKAPKDV  315

Query  312  KIQGIWYAQLE  280
            KIQG+WYAQLE
Sbjct  316  KIQGVWYAQLE  326



>dbj|BAJ89638.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ85472.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=328

 Score =   166 bits (420),  Expect(2) = 4e-71, Method: Compositional matrix adjust.
 Identities = 78/88 (89%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DE+EGP EV +DG++KFEEKDGIDYAAVTVQLPGGERVPFLFT+KQLVATGKPESFSG F
Sbjct  166  DEMEGPLEVGADGTLKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQLVATGKPESFSGPF  225

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  226  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  253


 Score =   130 bits (326),  Expect(2) = 4e-71, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KEN+KN +SSTG IT SVT SKPETGEVIGVFES+QPSDTDLGAKAPK+V
Sbjct  256  GGRGDEEELAKENVKNASSSTGNITLSVTKSKPETGEVIGVFESVQPSDTDLGAKAPKDV  315

Query  312  KIQGIWYAQLE  280
            KIQG+WYAQLE
Sbjct  316  KIQGVWYAQLE  326



>ref|NP_001241522.1| uncharacterized protein LOC100820458 [Glycine max]
 gb|ACU23458.1| unknown [Glycine max]
 gb|KHN36175.1| Oxygen-evolving enhancer protein 1, chloroplastic [Glycine soja]
Length=329

 Score =   172 bits (435),  Expect(2) = 4e-71, Method: Compositional matrix adjust.
 Identities = 82/88 (93%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVSSDG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKP+SFSGEF
Sbjct  168  DEIEGPFEVSSDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPDSFSGEF  227

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRG STGYDNAV  
Sbjct  228  LVPSYRGSSFLDPKGRGASTGYDNAVAL  255


 Score =   124 bits (310),  Expect(2) = 4e-71, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KEN K+ +SS GKIT SVT SKPETGEVIGVFES+QPSDTDLGAKAPK+V
Sbjct  258  GGRGDEEELAKENNKSASSSKGKITLSVTKSKPETGEVIGVFESVQPSDTDLGAKAPKDV  317

Query  312  KIQGIWYAQLE  280
            KIQGIWYAQL+
Sbjct  318  KIQGIWYAQLD  328



>ref|XP_004968772.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Setaria italica]
Length=333

 Score =   166 bits (420),  Expect(2) = 5e-71, Method: Compositional matrix adjust.
 Identities = 79/88 (90%), Positives = 82/88 (93%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGP EV SDG++KFEEKDGIDYAAVTVQLPGGERVPFLFT+KQLVATGKPESF G F
Sbjct  171  DEIEGPLEVGSDGTLKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQLVATGKPESFGGPF  230

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  231  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  258


 Score =   130 bits (326),  Expect(2) = 5e-71, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KENIKN ASSTG IT SVT S PETGEVIGVFES+QPSDTDLGAKAPK+V
Sbjct  261  GGRGDEEELVKENIKNAASSTGNITLSVTKSNPETGEVIGVFESVQPSDTDLGAKAPKDV  320

Query  312  KIQGIWYAQLE  280
            KIQGIWYAQLE
Sbjct  321  KIQGIWYAQLE  331



>emb|CAN61828.1| hypothetical protein VITISV_027630 [Vitis vinifera]
Length=312

 Score =   168 bits (426),  Expect(2) = 5e-71, Method: Compositional matrix adjust.
 Identities = 81/88 (92%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVSSDG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKP+ F GEF
Sbjct  151  DEIEGPFEVSSDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPDKFGGEF  210

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  211  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  238


 Score =   127 bits (319),  Expect(2) = 5e-71, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL+KENIK+ +SSTGKIT SVT SKPETGEVIGVFES+QPSDTDLGAK PKEV
Sbjct  241  GGRGDEEELKKENIKDASSSTGKITLSVTKSKPETGEVIGVFESIQPSDTDLGAKTPKEV  300

Query  312  KIQGIWYAQLE  280
            KIQG WY QLE
Sbjct  301  KIQGFWYGQLE  311



>ref|XP_010924166.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Elaeis guineensis]
Length=334

 Score =   167 bits (422),  Expect(2) = 5e-71, Method: Compositional matrix adjust.
 Identities = 80/88 (91%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVS +GSV FEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESF G+F
Sbjct  173  DEIEGPFEVSPNGSVTFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFGGQF  232

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  233  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  260


 Score =   129 bits (323),  Expect(2) = 5e-71, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KENIKN +SSTG IT SVT SKPE+GEVIGVFES+QPSDTDLGAK PKEV
Sbjct  263  GGRGDEEELTKENIKNTSSSTGSITLSVTKSKPESGEVIGVFESVQPSDTDLGAKTPKEV  322

Query  312  KIQGIWYAQLE  280
            KIQGIWYAQLE
Sbjct  323  KIQGIWYAQLE  333



>ref|XP_004509219.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Cicer arietinum]
Length=329

 Score =   171 bits (432),  Expect(2) = 5e-71, Method: Compositional matrix adjust.
 Identities = 82/88 (93%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVS DGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKP+SFSGEF
Sbjct  168  DEIEGPFEVSPDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPDSFSGEF  227

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRG STGYDNAV  
Sbjct  228  LVPSYRGSSFLDPKGRGASTGYDNAVAL  255


 Score =   125 bits (313),  Expect(2) = 5e-71, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KEN K+ +SS GKIT SVT SKPETGEVIGVFES+QPSDTDLGAKAPK+V
Sbjct  258  GGRGDEEELAKENNKSASSSKGKITLSVTQSKPETGEVIGVFESIQPSDTDLGAKAPKDV  317

Query  312  KIQGIWYAQLE  280
            KIQG+WYAQLE
Sbjct  318  KIQGVWYAQLE  328



>gb|KDO79409.1| hypothetical protein CISIN_1g019870mg [Citrus sinensis]
Length=334

 Score =   165 bits (418),  Expect(2) = 6e-71, Method: Compositional matrix adjust.
 Identities = 78/88 (89%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVS DG++KF EKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPE+F GEF
Sbjct  173  DEIEGPFEVSPDGTIKFVEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPENFGGEF  232

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNA+  
Sbjct  233  LVPSYRGSSFLDPKGRGGSTGYDNAIAL  260


 Score =   130 bits (326),  Expect(2) = 6e-71, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEE+L KENIKN +SSTGKIT SVT SKPETGEVIGVFESLQPSDTD+GAK PK+V
Sbjct  263  GGRGDEEDLAKENIKNTSSSTGKITLSVTKSKPETGEVIGVFESLQPSDTDMGAKVPKDV  322

Query  312  KIQGIWYAQLE  280
            KIQGIWYAQLE
Sbjct  323  KIQGIWYAQLE  333



>ref|XP_006425778.1| hypothetical protein CICLE_v10026034mg [Citrus clementina]
 ref|XP_006466690.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Citrus sinensis]
 gb|ESR39018.1| hypothetical protein CICLE_v10026034mg [Citrus clementina]
Length=334

 Score =   165 bits (418),  Expect(2) = 7e-71, Method: Compositional matrix adjust.
 Identities = 78/88 (89%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVS DG++KF EKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPE+F GEF
Sbjct  173  DEIEGPFEVSPDGTIKFVEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPENFGGEF  232

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNA+  
Sbjct  233  LVPSYRGSSFLDPKGRGGSTGYDNAIAL  260


 Score =   130 bits (326),  Expect(2) = 7e-71, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEE+L KENIKN +SSTGKIT SVT SKPETGEVIGVFESLQPSDTD+GAK PK+V
Sbjct  263  GGRGDEEDLAKENIKNTSSSTGKITLSVTKSKPETGEVIGVFESLQPSDTDMGAKVPKDV  322

Query  312  KIQGIWYAQLE  280
            KIQGIWYAQLE
Sbjct  323  KIQGIWYAQLE  333



>ref|NP_001043134.1| Os01g0501800 [Oryza sativa Japonica Group]
 dbj|BAB64069.1| putative 33kDa oxygen evolving protein of photosystem II [Oryza 
sativa Japonica Group]
 dbj|BAF05048.1| Os01g0501800 [Oryza sativa Japonica Group]
 gb|EAZ12041.1| hypothetical protein OsJ_01921 [Oryza sativa Japonica Group]
 dbj|BAG96401.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96320.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96862.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96934.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99571.1| unnamed protein product [Oryza sativa Japonica Group]
Length=333

 Score =   167 bits (423),  Expect(2) = 7e-71, Method: Compositional matrix adjust.
 Identities = 80/88 (91%), Positives = 82/88 (93%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGP EVSSDG++KFEEKDGIDYAAVTVQLPGGERVPFLFTIK LVATGKPESF G F
Sbjct  173  DEIEGPLEVSSDGTIKFEEKDGIDYAAVTVQLPGGERVPFLFTIKNLVATGKPESFGGPF  232

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  233  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  260


 Score =   128 bits (321),  Expect(2) = 7e-71, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KEN+KN +SSTG IT SVT SKPETGEVIGVFES+QPSDTDLGAK PK+V
Sbjct  263  GGRGDEEELAKENVKNASSSTGNITLSVTKSKPETGEVIGVFESVQPSDTDLGAKVPKDV  322

Query  312  KIQGIWYAQLE  280
            KIQG+WYAQLE
Sbjct  323  KIQGVWYAQLE  333



>gb|EEC70714.1| hypothetical protein OsI_02088 [Oryza sativa Indica Group]
Length=333

 Score =   167 bits (423),  Expect(2) = 7e-71, Method: Compositional matrix adjust.
 Identities = 80/88 (91%), Positives = 82/88 (93%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGP EVSSDG++KFEEKDGIDYAAVTVQLPGGERVPFLFTIK LVATGKPESF G F
Sbjct  173  DEIEGPLEVSSDGTIKFEEKDGIDYAAVTVQLPGGERVPFLFTIKNLVATGKPESFGGPF  232

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  233  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  260


 Score =   128 bits (321),  Expect(2) = 7e-71, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KEN+KN +SSTG IT SVT SKPETGEVIGVFES+QPSDTDLGAK PK+V
Sbjct  263  GGRGDEEELAKENVKNASSSTGNITLSVTKSKPETGEVIGVFESVQPSDTDLGAKVPKDV  322

Query  312  KIQGIWYAQLE  280
            KIQG+WYAQLE
Sbjct  323  KIQGVWYAQLE  333



>ref|WP_039310940.1| Photosystem II manganese-stabilizing polypeptide, partial [Paenibacillus 
sp. IHB B 3415]
Length=232

 Score =   165 bits (418),  Expect(2) = 7e-71, Method: Compositional matrix adjust.
 Identities = 81/88 (92%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVS DGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESF G+F
Sbjct  72   DEIEGPFEVSPDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFGGQF  131

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYD+AV  
Sbjct  132  LVPSYRGSSFLDPKGRGGSTGYDSAVAL  159


 Score =   130 bits (326),  Expect(2) = 7e-71, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KENIKN ASSTGKIT  VT SKPETGEVIGVFES+QPSDTDLGAK PKEV
Sbjct  162  GGRGDEEELVKENIKNTASSTGKITLGVTNSKPETGEVIGVFESIQPSDTDLGAKVPKEV  221

Query  312  KIQGIWYAQLE  280
            KIQG+WYAQLE
Sbjct  222  KIQGVWYAQLE  232



>ref|XP_008787656.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Phoenix dactylifera]
Length=334

 Score =   167 bits (422),  Expect(2) = 7e-71, Method: Compositional matrix adjust.
 Identities = 79/88 (90%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVS DG+V+F+EKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESF G+F
Sbjct  173  DEIEGPFEVSPDGAVRFQEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFGGQF  232

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  233  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  260


 Score =   128 bits (321),  Expect(2) = 7e-71, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KENIKN +SSTG IT SVT SKPE+GEVIGVFESLQPSDTD+GAK PK+V
Sbjct  263  GGRGDEEELTKENIKNTSSSTGSITLSVTKSKPESGEVIGVFESLQPSDTDMGAKVPKDV  322

Query  312  KIQGIWYAQLE  280
            KIQGIWYAQLE
Sbjct  323  KIQGIWYAQLE  333



>gb|AEO21912.1| chloroplast oxygen-evolving enhancer protein 1 [Dimocarpus longan]
Length=333

 Score =   169 bits (428),  Expect(2) = 9e-71, Method: Compositional matrix adjust.
 Identities = 80/88 (91%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVSSDG+VKFEEKDGIDYAAVTVQLPGGERVPFLFT+KQLVA+GKPESF G+F
Sbjct  172  DEIEGPFEVSSDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQLVASGKPESFGGQF  231

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRG+SFLDPKGRGGSTGYDNAV  
Sbjct  232  LVPSYRGTSFLDPKGRGGSTGYDNAVAL  259


 Score =   125 bits (315),  Expect(2) = 9e-71, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KENIKN +SSTGKIT SVT SKPETGEVIGVFES QPSDTDLGAK  K+V
Sbjct  262  GGRGDEEELAKENIKNASSSTGKITLSVTKSKPETGEVIGVFESFQPSDTDLGAKVAKDV  321

Query  312  KIQGIWYAQLE  280
            KIQGIWYAQL+
Sbjct  322  KIQGIWYAQLD  332



>sp|P85194.1|PSBO_HELAN RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Helianthus annuus]
Length=324

 Score =   167 bits (424),  Expect(2) = 9e-71, Method: Compositional matrix adjust.
 Identities = 80/88 (91%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGP EVSSDG++KFEEKDGIDYAAVTVQLPGGERVPFLFTIK+LVATGKPESF G F
Sbjct  164  DEIEGPLEVSSDGTIKFEEKDGIDYAAVTVQLPGGERVPFLFTIKELVATGKPESFGGNF  223

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  224  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  251


 Score =   127 bits (318),  Expect(2) = 9e-71, Method: Compositional matrix adjust.
 Identities = 60/70 (86%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KENIKN A+  G+ITFSVT SKPETGEVIGVFES+QPSDTDLGAKAPK+V
Sbjct  254  GGRGDEEELLKENIKNTAAGKGEITFSVTSSKPETGEVIGVFESIQPSDTDLGAKAPKDV  313

Query  312  KIQGIWYAQL  283
            KIQG+WYAQL
Sbjct  314  KIQGVWYAQL  323



>ref|XP_003611860.1| Oxygen evolving enhancer protein [Medicago truncatula]
 gb|AES94818.1| photosystem II oxygen-evolving enhancer protein [Medicago truncatula]
Length=329

 Score =   169 bits (429),  Expect(2) = 9e-71, Method: Compositional matrix adjust.
 Identities = 81/88 (92%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVS DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKP+SFSGEF
Sbjct  168  DEIEGPFEVSPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPDSFSGEF  227

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRG STGYDNAV  
Sbjct  228  LVPSYRGSSFLDPKGRGASTGYDNAVAL  255


 Score =   125 bits (314),  Expect(2) = 9e-71, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KEN K+ ASS GKIT SVT SKPETGEVIGVFES+QPSDTDLGAKAPK+V
Sbjct  258  GGRGDEEELGKENNKSAASSKGKITLSVTQSKPETGEVIGVFESIQPSDTDLGAKAPKDV  317

Query  312  KIQGIWYAQLE  280
            KIQG+WYAQLE
Sbjct  318  KIQGVWYAQLE  328



>ref|XP_009376463.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Pyrus x bretschneideri]
Length=332

 Score =   169 bits (429),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 80/88 (91%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEV+ DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPE+F+GEF
Sbjct  172  DEIEGPFEVAPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPENFTGEF  231

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  232  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  259


 Score =   125 bits (313),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KEN KN A+S+GKIT SVT SKPETGE+IGVFES+QPSDTDLGAK PK+V
Sbjct  262  GGRGDEEELAKENTKNTAASSGKITLSVTKSKPETGELIGVFESIQPSDTDLGAKTPKDV  321

Query  312  KIQGIWYAQLE  280
            KIQG+WYAQL+
Sbjct  322  KIQGVWYAQLD  332



>ref|NP_001140815.1| hypothetical protein [Zea mays]
 gb|ACF84695.1| unknown [Zea mays]
 gb|AFW75931.1| hypothetical protein ZEAMMB73_003972 [Zea mays]
Length=230

 Score =   164 bits (415),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 79/88 (90%), Positives = 82/88 (93%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGP EV SDG++KFEEKDGIDYAAVTVQLPGGERVPFLFT+KQLVATGKPESF G F
Sbjct  70   DEIEGPLEVGSDGTLKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQLVATGKPESFGGPF  129

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  130  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  157


 Score =   130 bits (327),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 63/71 (89%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEELQKENIKN ASSTG IT SVT S PETGEVIGVFES+QPSDTDLGAKAPK+V
Sbjct  160  GGRGDEEELQKENIKNAASSTGNITLSVTKSNPETGEVIGVFESVQPSDTDLGAKAPKDV  219

Query  312  KIQGIWYAQLE  280
            KIQG+WYAQLE
Sbjct  220  KIQGVWYAQLE  230



>ref|XP_009379152.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Pyrus x bretschneideri]
Length=332

 Score =   169 bits (428),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 79/88 (90%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEV+ DG++KFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPE+F+GEF
Sbjct  172  DEIEGPFEVAPDGTIKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPENFTGEF  231

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  232  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  259


 Score =   124 bits (312),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KEN KN A+S GKIT SVT +KPETGE+IGVFESLQPSDTDLGAK PK+V
Sbjct  262  GGRGDEEELAKENTKNTAASKGKITLSVTKTKPETGELIGVFESLQPSDTDLGAKTPKDV  321

Query  312  KIQGIWYAQLE  280
            KIQGIWYAQL+
Sbjct  322  KIQGIWYAQLD  332



>ref|XP_007155994.1| hypothetical protein PHAVU_003G249800g [Phaseolus vulgaris]
 gb|ESW27988.1| hypothetical protein PHAVU_003G249800g [Phaseolus vulgaris]
Length=330

 Score =   168 bits (426),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 81/88 (92%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVSSDG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESF G F
Sbjct  169  DEIEGPFEVSSDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFGGPF  228

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRG STGYDNAV  
Sbjct  229  LVPSYRGSSFLDPKGRGASTGYDNAVAL  256


 Score =   125 bits (314),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KEN K+ +SSTGKIT SVT +KPETGEVIGVFES+QPSDTDLGAKAPK+V
Sbjct  259  GGRGDEEELAKENNKSASSSTGKITLSVTKTKPETGEVIGVFESVQPSDTDLGAKAPKDV  318

Query  312  KIQGIWYAQLE  280
            KIQG+WYAQLE
Sbjct  319  KIQGVWYAQLE  329



>gb|ABQ52657.1| chloroplast oxygen-evolving enhancer protein 1 [Leymus chinensis]
Length=328

 Score =   166 bits (420),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 78/88 (89%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DE+EGP EV +DG++KFEEKDGIDYAAVTVQLPGGERVPFLFT+KQLVATGKPESFSG F
Sbjct  166  DEMEGPLEVGADGTLKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQLVATGKPESFSGPF  225

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  226  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  253


 Score =   127 bits (320),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KEN+KN +SSTG IT SVT SKPETGEVIGVFE +QPSDTDLGAKAPK+V
Sbjct  256  GGRGDEEELAKENVKNASSSTGNITLSVTKSKPETGEVIGVFERVQPSDTDLGAKAPKDV  315

Query  312  KIQGIWYAQLE  280
            KIQG+WYAQLE
Sbjct  316  KIQGVWYAQLE  326



>ref|XP_009341905.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Pyrus x bretschneideri]
 ref|XP_009341920.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Pyrus x bretschneideri]
Length=332

 Score =   168 bits (426),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 79/88 (90%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            D+IEGPFEV+ DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPE+F+GEF
Sbjct  172  DQIEGPFEVAPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPENFTGEF  231

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  232  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  259


 Score =   125 bits (314),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KEN KN A+S+GKIT SVT SKPETGE+IGVFES+QPSDTDLGAK PK+V
Sbjct  262  GGRGDEEELAKENTKNTAASSGKITLSVTKSKPETGELIGVFESIQPSDTDLGAKTPKDV  321

Query  312  KIQGIWYAQLE  280
            KIQG+WYAQL+
Sbjct  322  KIQGVWYAQLD  332



>dbj|BAG70021.1| 33 kDa precursor protein of the oxygen-evolving complex [Salicornia 
europaea]
Length=330

 Score =   172 bits (436),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 82/88 (93%), Positives = 86/88 (98%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DE+EGPFEVSSDG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKP+SFSGEF
Sbjct  169  DEMEGPFEVSSDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPDSFSGEF  228

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  229  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  256


 Score =   121 bits (304),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KEN KN ASS G IT SV+ SKPETGEVIGVF+SLQPSDTDLGAK PK+V
Sbjct  259  GGRGDEEELLKENNKNTASSKGTITLSVSKSKPETGEVIGVFQSLQPSDTDLGAKTPKDV  318

Query  312  KIQGIWYAQLE  280
            KI+GIWYAQLE
Sbjct  319  KIEGIWYAQLE  329



>gb|AFK43771.1| unknown [Lotus japonicus]
Length=332

 Score =   169 bits (428),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 80/88 (91%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVS DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFT+KQLVA+GKPESFSG+F
Sbjct  171  DEIEGPFEVSPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQLVASGKPESFSGDF  230

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRG STGYDNAV  
Sbjct  231  LVPSYRGSSFLDPKGRGTSTGYDNAVAL  258


 Score =   124 bits (312),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KEN K+ +SS GKIT SVT SKPETGE+IGVFES+QPSDTDLGAKAPK+V
Sbjct  261  GGRGDEEELAKENNKSASSSKGKITLSVTQSKPETGEIIGVFESIQPSDTDLGAKAPKDV  320

Query  312  KIQGIWYAQLE  280
            KIQG+WYAQLE
Sbjct  321  KIQGVWYAQLE  331



>ref|XP_007156865.1| hypothetical protein PHAVU_002G024000g [Phaseolus vulgaris]
 gb|AGV54484.1| oxygen-evolving enhancer protein 1 [Phaseolus vulgaris]
 gb|ESW28859.1| hypothetical protein PHAVU_002G024000g [Phaseolus vulgaris]
Length=329

 Score =   170 bits (430),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 81/88 (92%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEV+ DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSG+F
Sbjct  168  DEIEGPFEVTPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGDF  227

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRG STGYDNAV  
Sbjct  228  LVPSYRGSSFLDPKGRGASTGYDNAVAL  255


 Score =   123 bits (309),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KEN K+ +SS GKIT SVT +KPETGEVIGVFES+QPSDTDLGAKAPK+V
Sbjct  258  GGRGDEEELAKENNKSASSSKGKITLSVTKTKPETGEVIGVFESVQPSDTDLGAKAPKDV  317

Query  312  KIQGIWYAQLE  280
            KIQG+WYAQLE
Sbjct  318  KIQGVWYAQLE  328



>ref|NP_001239736.1| uncharacterized protein LOC100798485 [Glycine max]
 gb|ACU19444.1| unknown [Glycine max]
 gb|KHN42036.1| Oxygen-evolving enhancer protein 1, chloroplastic [Glycine soja]
Length=329

 Score =   171 bits (432),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 81/88 (92%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEV+SDG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKP+SFSGEF
Sbjct  168  DEIEGPFEVTSDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPDSFSGEF  227

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRG STGYDNAV  
Sbjct  228  LVPSYRGSSFLDPKGRGASTGYDNAVAL  255


 Score =   122 bits (307),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KEN K+ +SS GKIT SVT +KPETGEVIGVFES+QPSDTDLGAKAPK+V
Sbjct  258  GGRGDEEELAKENNKSASSSKGKITLSVTKTKPETGEVIGVFESVQPSDTDLGAKAPKDV  317

Query  312  KIQGIWYAQLE  280
            KIQGIWYAQL+
Sbjct  318  KIQGIWYAQLD  328



>ref|XP_008241598.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Prunus mume]
Length=332

 Score =   167 bits (424),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 79/88 (90%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVS DG++KFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPE+F GEF
Sbjct  172  DEIEGPFEVSPDGTLKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPENFGGEF  231

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNA+  
Sbjct  232  LVPSYRGSSFLDPKGRGGSTGYDNAIAL  259


 Score =   125 bits (315),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KENIKN ASS GKIT SVT SKPE+GE+IGVFES+QPSDTDLGAK PK+V
Sbjct  262  GGRGDEEELAKENIKNTASSKGKITLSVTKSKPESGELIGVFESIQPSDTDLGAKTPKDV  321

Query  312  KIQGIWYAQLE  280
            KIQG+WYAQL+
Sbjct  322  KIQGVWYAQLD  332



>ref|XP_004300575.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=331

 Score =   169 bits (428),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 80/88 (91%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVS DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKP++F+GEF
Sbjct  171  DEIEGPFEVSPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPDNFTGEF  230

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  231  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  258


 Score =   124 bits (311),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KEN KN ASS GKIT SVT +KPETGE+IGVFES+QPSDTDLGAK PK+V
Sbjct  261  GGRGDEEELAKENTKNTASSKGKITLSVTKTKPETGELIGVFESIQPSDTDLGAKVPKDV  320

Query  312  KIQGIWYAQLE  280
            KIQG+WYAQL+
Sbjct  321  KIQGVWYAQLD  331



>ref|XP_007202212.1| hypothetical protein PRUPE_ppa008420mg [Prunus persica]
 gb|EMJ03411.1| hypothetical protein PRUPE_ppa008420mg [Prunus persica]
Length=332

 Score =   167 bits (423),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 79/88 (90%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVS DG++KFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPE+F GEF
Sbjct  172  DEIEGPFEVSPDGTLKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPENFGGEF  231

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNA+  
Sbjct  232  LVPSYRGSSFLDPKGRGGSTGYDNAIAL  259


 Score =   125 bits (315),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KENIKN ASS GKIT SVT SKPE+GE+IGVFES+QPSDTDLGAK PK+V
Sbjct  262  GGRGDEEELAKENIKNTASSKGKITLSVTKSKPESGELIGVFESIQPSDTDLGAKTPKDV  321

Query  312  KIQGIWYAQLE  280
            KIQG+WYAQL+
Sbjct  322  KIQGVWYAQLD  332



>ref|XP_008338186.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Malus domestica]
Length=332

 Score =   168 bits (425),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 79/88 (90%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEV+ DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKP++F+GEF
Sbjct  172  DEIEGPFEVAPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPDNFTGEF  231

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  232  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  259


 Score =   124 bits (312),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KEN KN A+STGKIT SVT SKPE GE+IGVFES+QPSDTDLGAK PK+V
Sbjct  262  GGRGDEEELAKENTKNTAASTGKITLSVTKSKPENGELIGVFESIQPSDTDLGAKTPKDV  321

Query  312  KIQGIWYAQLE  280
            KIQG+WYAQL+
Sbjct  322  KIQGVWYAQLD  332



>gb|KDO79410.1| hypothetical protein CISIN_1g019870mg [Citrus sinensis]
Length=271

 Score =   163 bits (413),  Expect(2) = 5e-70, Method: Compositional matrix adjust.
 Identities = 78/88 (89%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVS DG++KF EKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPE+F GEF
Sbjct  110  DEIEGPFEVSPDGTIKFVEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPENFGGEF  169

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNA+  
Sbjct  170  LVPSYRGSSFLDPKGRGGSTGYDNAIAL  197


 Score =   129 bits (324),  Expect(2) = 5e-70, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEE+L KENIKN +SSTGKIT SVT SKPETGEVIGVFESLQPSDTD+GAK PK+V
Sbjct  200  GGRGDEEDLAKENIKNTSSSTGKITLSVTKSKPETGEVIGVFESLQPSDTDMGAKVPKDV  259

Query  312  KIQGIWYAQLE  280
            KIQGIWYAQLE
Sbjct  260  KIQGIWYAQLE  270



>prf||2002393A oxygen-evolving complex protein 1
Length=247

 Score =   165 bits (418),  Expect(2) = 8e-70, Method: Compositional matrix adjust.
 Identities = 81/88 (92%), Positives = 82/88 (93%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGP EVSSDG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIK LVATGKPESF G F
Sbjct  87   DEIEGPLEVSSDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKNLVATGKPESFGGPF  146

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  147  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  174


 Score =   126 bits (317),  Expect(2) = 8e-70, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KEN+KN +SSTG IT SVT SKPETGEVIGVFES+QPSDTDLGAK PK+V
Sbjct  177  GGRGDEEELAKENVKNASSSTGNITLSVTKSKPETGEVIGVFESVQPSDTDLGAKVPKDV  236

Query  312  KIQGIWYAQLE  280
            KIQG+WYAQLE
Sbjct  237  KIQGVWYAQLE  247



>gb|ABR26062.1| oxygen-evolving enhancer protein 1 [Oryza sativa Indica Group]
Length=203

 Score =   165 bits (418),  Expect(2) = 8e-70, Method: Compositional matrix adjust.
 Identities = 80/88 (91%), Positives = 82/88 (93%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGP EVSSDG++KFEEKDGIDYAAVTVQLPGGERVPFLFTIK LVATGKPESF G F
Sbjct  43   DEIEGPLEVSSDGTIKFEEKDGIDYAAVTVQLPGGERVPFLFTIKNLVATGKPESFGGPF  102

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  103  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  130


 Score =   126 bits (317),  Expect(2) = 8e-70, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KEN+KN +SSTG IT SVT SKPETGEVIGVFES+QPSDTDLGAK PK+V
Sbjct  133  GGRGDEEELAKENVKNASSSTGNITLSVTKSKPETGEVIGVFESVQPSDTDLGAKVPKDV  192

Query  312  KIQGIWYAQLE  280
            KIQG+WYAQLE
Sbjct  193  KIQGVWYAQLE  203



>ref|XP_007047093.1| Photosystem II subunit O-2 [Theobroma cacao]
 gb|EOX91250.1| Photosystem II subunit O-2 [Theobroma cacao]
Length=332

 Score =   170 bits (430),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 81/88 (92%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVS+DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESF G+F
Sbjct  171  DEIEGPFEVSTDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFGGDF  230

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  231  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  258


 Score =   122 bits (305),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEE+L KEN K+VASS+GKIT SVT ++PETGEVIGVFESLQPSDTDLG+KAPK+V
Sbjct  261  GGRGDEEDLAKENNKSVASSSGKITLSVTKTRPETGEVIGVFESLQPSDTDLGSKAPKDV  320

Query  312  KIQGIWYAQLE  280
            KI GIWYAQL+
Sbjct  321  KITGIWYAQLD  331



>gb|ACU19823.1| unknown [Glycine max]
Length=170

 Score =   169 bits (428),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 82/88 (93%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVSSDG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKP+SFSGEF
Sbjct  9    DEIEGPFEVSSDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPDSFSGEF  68

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRG STGYDNAV  
Sbjct  69   LVPSYRGSSFLDPKGRGASTGYDNAVAL  96


 Score =   122 bits (307),  Expect(2) = 9e-70, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KEN K+ +SS GKIT SVT +KPETGEVIGVFES+QPSDTDLGAKAPK+V
Sbjct  99   GGRGDEEELAKENNKSASSSKGKITLSVTKTKPETGEVIGVFESVQPSDTDLGAKAPKDV  158

Query  312  KIQGIWYAQLE  280
            KIQGIWYAQLE
Sbjct  159  KIQGIWYAQLE  169



>gb|KJB43585.1| hypothetical protein B456_007G208000 [Gossypium raimondii]
Length=316

 Score =   169 bits (427),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 80/88 (91%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVS+DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKP+SF G+F
Sbjct  155  DEIEGPFEVSTDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPDSFGGDF  214

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  215  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  242


 Score =   122 bits (307),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KEN K+ ASS+GKIT SVT SKPETGEVIGVFESLQPSDTDLGAK PK+V
Sbjct  245  GGRGDEEELAKENNKSAASSSGKITLSVTKSKPETGEVIGVFESLQPSDTDLGAKTPKDV  304

Query  312  KIQGIWYAQLE  280
            KI G+WYAQL+
Sbjct  305  KITGVWYAQLD  315



>gb|KJB43586.1| hypothetical protein B456_007G208000 [Gossypium raimondii]
Length=332

 Score =   169 bits (427),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 80/88 (91%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVS+DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKP+SF G+F
Sbjct  171  DEIEGPFEVSTDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPDSFGGDF  230

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  231  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  258


 Score =   122 bits (306),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KEN K+ ASS+GKIT SVT SKPETGEVIGVFESLQPSDTDLGAK PK+V
Sbjct  261  GGRGDEEELAKENNKSAASSSGKITLSVTKSKPETGEVIGVFESLQPSDTDLGAKTPKDV  320

Query  312  KIQGIWYAQLE  280
            KI G+WYAQL+
Sbjct  321  KITGVWYAQLD  331



>ref|XP_002283699.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Vitis vinifera]
Length=331

 Score =   165 bits (417),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 80/88 (91%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVSSD +VKF EKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPE+F GEF
Sbjct  171  DEIEGPFEVSSDRTVKFIEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPENFGGEF  230

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  231  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  258


 Score =   126 bits (316),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL++ENIK+ +SSTGKIT S+T SKPE+GEVIGVFES+QPSDTDLGAK PK+V
Sbjct  261  GGRGDEEELKRENIKDASSSTGKITLSITKSKPESGEVIGVFESIQPSDTDLGAKVPKDV  320

Query  312  KIQGIWYAQLE  280
            KIQG+WYAQLE
Sbjct  321  KIQGVWYAQLE  331



>gb|ABR26133.1| oxygen-evolving enhancer protein 1 [Oryza sativa Indica Group]
Length=178

 Score =   165 bits (417),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 80/88 (91%), Positives = 82/88 (93%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGP EVSSDG++KFEEKDGIDYAAVTVQLPGGERVPFLFTIK LVATGKPESF G F
Sbjct  18   DEIEGPLEVSSDGTIKFEEKDGIDYAAVTVQLPGGERVPFLFTIKNLVATGKPESFGGPF  77

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  78   LVPSYRGSSFLDPKGRGGSTGYDNAVAL  105


 Score =   126 bits (316),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KEN+KN +SSTG IT SVT SKPETGEVIGVFES+QPSDTDLGAK PK+V
Sbjct  108  GGRGDEEELAKENVKNASSSTGNITLSVTKSKPETGEVIGVFESVQPSDTDLGAKVPKDV  167

Query  312  KIQGIWYAQLE  280
            KIQG+WYAQLE
Sbjct  168  KIQGVWYAQLE  178



>gb|KHG13438.1| Oxygen-evolving enhancer 1, chloroplastic [Gossypium arboreum]
Length=332

 Score =   168 bits (426),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 80/88 (91%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVS+DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKP+SF G+F
Sbjct  171  DEIEGPFEVSTDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPDSFGGDF  230

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  231  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  258


 Score =   122 bits (306),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KEN K+ ASS+GKIT SVT SKPETGEVIGVFESLQPSDTDLGAK PK+V
Sbjct  261  GGRGDEEELAKENNKSAASSSGKITLSVTKSKPETGEVIGVFESLQPSDTDLGAKTPKDV  320

Query  312  KIQGIWYAQLE  280
            KI G+WYAQL+
Sbjct  321  KITGVWYAQLD  331



>ref|XP_007155995.1| hypothetical protein PHAVU_003G249800g [Phaseolus vulgaris]
 gb|ESW27989.1| hypothetical protein PHAVU_003G249800g [Phaseolus vulgaris]
Length=264

 Score =   166 bits (421),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 81/88 (92%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVSSDG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESF G F
Sbjct  103  DEIEGPFEVSSDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFGGPF  162

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRG STGYDNAV  
Sbjct  163  LVPSYRGSSFLDPKGRGASTGYDNAVAL  190


 Score =   124 bits (312),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KEN K+ +SSTGKIT SVT +KPETGEVIGVFES+QPSDTDLGAKAPK+V
Sbjct  193  GGRGDEEELAKENNKSASSSTGKITLSVTKTKPETGEVIGVFESVQPSDTDLGAKAPKDV  252

Query  312  KIQGIWYAQLE  280
            KIQG+WYAQLE
Sbjct  253  KIQGVWYAQLE  263



>ref|XP_008800919.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Phoenix dactylifera]
Length=334

 Score =   162 bits (409),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 77/88 (88%), Positives = 81/88 (92%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVS  G+V F EKDGIDYAAVTVQLPGGERVPFLFT+KQLVA+GKPESF G+F
Sbjct  173  DEIEGPFEVSPSGTVNFVEKDGIDYAAVTVQLPGGERVPFLFTVKQLVASGKPESFGGQF  232

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  233  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  260


 Score =   129 bits (324),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KENIKN +SSTG IT SVT SKPE+GEVIGVFES+QPSDTDLGAK PKEV
Sbjct  263  GGRGDEEELTKENIKNTSSSTGTITLSVTKSKPESGEVIGVFESIQPSDTDLGAKVPKEV  322

Query  312  KIQGIWYAQLE  280
            KIQGIWYAQLE
Sbjct  323  KIQGIWYAQLE  333



>ref|XP_010255017.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Nelumbo nucifera]
Length=332

 Score =   169 bits (427),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 80/88 (91%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVS+DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPE+F G+F
Sbjct  171  DEIEGPFEVSTDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPENFGGQF  230

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  231  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  258


 Score =   121 bits (304),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KENIK+ +SSTG I+ SVT SKPE+GEVIGVFES+QPSDTDLGAK PK+V
Sbjct  261  GGRGDEEELTKENIKDPSSSTGTISLSVTKSKPESGEVIGVFESIQPSDTDLGAKTPKDV  320

Query  312  KIQGIWYAQLE  280
            KIQGIWYA+LE
Sbjct  321  KIQGIWYAKLE  331



>ref|XP_010550399.1| PREDICTED: oxygen-evolving enhancer protein 1-2, chloroplastic-like 
[Tarenaya hassleriana]
Length=331

 Score =   164 bits (416),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 79/88 (90%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVSSDG+VKFEEKDGIDYAAVTVQLPGGERVPFLFT+KQL A+GKP SF G+F
Sbjct  171  DEIEGPFEVSSDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQLDASGKPNSFGGKF  230

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  231  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  258


 Score =   126 bits (316),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KENIKN ASSTG+IT  VT SKPETGE+IGVFES+QPSDTDLGAK PK+V
Sbjct  261  GGRGDEEELTKENIKNAASSTGEITLKVTKSKPETGELIGVFESIQPSDTDLGAKVPKDV  320

Query  312  KIQGIWYAQLE  280
            KIQGIWY QLE
Sbjct  321  KIQGIWYGQLE  331



>emb|CAN79166.1| hypothetical protein VITISV_019248 [Vitis vinifera]
Length=331

 Score =   165 bits (417),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 80/88 (91%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVSSD +VKF EKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPE+F GEF
Sbjct  171  DEIEGPFEVSSDRTVKFIEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPENFGGEF  230

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  231  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  258


 Score =   125 bits (314),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL+ ENIK+ +SSTGKIT S+T SKPE+GEVIGVFES+QPSDTDLGAK PK+V
Sbjct  261  GGRGDEEELKXENIKDASSSTGKITLSITKSKPESGEVIGVFESIQPSDTDLGAKVPKDV  320

Query  312  KIQGIWYAQLE  280
            KIQG+WYAQLE
Sbjct  321  KIQGVWYAQLE  331



>gb|AJG36442.1| oxygen-evolving enhancer protein 1 [Pinus sylvestris]
Length=340

 Score =   166 bits (419),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 78/88 (89%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGP EVSSDG +KFEEKDGIDYAAVTVQLPGGERVPFLFT+KQLVA+G PESFSG+F
Sbjct  178  DEIEGPLEVSSDGKLKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQLVASGTPESFSGQF  237

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVP+YRGSSFLDPKGRGGSTGYDNAV  
Sbjct  238  LVPAYRGSSFLDPKGRGGSTGYDNAVAL  265


 Score =   124 bits (312),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KENIK+V++S G IT SV+ SKPETGEVIGVFESLQPSDTDLG+KAPK+V
Sbjct  268  GGRGDEEELAKENIKDVSASKGTITLSVSKSKPETGEVIGVFESLQPSDTDLGSKAPKDV  327

Query  312  KIQGIWYAQLE  280
            KIQGIWYAQ+E
Sbjct  328  KIQGIWYAQIE  338



>gb|ACJ84218.1| unknown [Medicago truncatula]
Length=170

 Score =   166 bits (421),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 81/88 (92%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVS DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKP+SFSGEF
Sbjct  9    DEIEGPFEVSPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPDSFSGEF  68

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRG STGYDNAV  
Sbjct  69   LVPSYRGSSFLDPKGRGASTGYDNAVAL  96


 Score =   124 bits (310),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KEN K+ ASS GKIT SVT SKPETGEVIGVFES+QPSDTDLGAKAPK+V
Sbjct  99   GGRGDEEELGKENNKSAASSKGKITLSVTQSKPETGEVIGVFESIQPSDTDLGAKAPKDV  158

Query  312  KIQGIWYAQLE  280
            KIQG+WYAQLE
Sbjct  159  KIQGVWYAQLE  169



>ref|XP_009412420.1| PREDICTED: LOW QUALITY PROTEIN: oxygen-evolving enhancer protein 
1, chloroplastic-like [Musa acuminata subsp. malaccensis]
Length=340

 Score =   170 bits (431),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 82/88 (93%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVS DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESFSG+F
Sbjct  173  DEIEGPFEVSPDGAVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFSGKF  232

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  233  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  260


 Score =   119 bits (298),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 62/77 (81%), Gaps = 6/77 (8%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASS------TGKITFSVTGSKPETGEVIGVFESLQPSDTDLGA  331
            GGRGDEEEL KENIKN          TG IT SVT SKPETGEVIGVFESLQPSDTDLGA
Sbjct  263  GGRGDEEELSKENIKNXXXXXXXSSSTGSITLSVTKSKPETGEVIGVFESLQPSDTDLGA  322

Query  330  KAPKEVKIQGIWYAQLE  280
            K PK+VKIQG+WYAQLE
Sbjct  323  KTPKDVKIQGVWYAQLE  339



>ref|XP_010263833.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Nelumbo nucifera]
Length=332

 Score =   167 bits (424),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 80/88 (91%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVS DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPE+F G+F
Sbjct  171  DEIEGPFEVSPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPENFGGQF  230

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  231  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  258


 Score =   122 bits (305),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KENIK+ +SSTG IT SVT SK E+GEVIGVFESLQPSDTDLGAK PK+V
Sbjct  261  GGRGDEEELTKENIKDPSSSTGTITLSVTKSKTESGEVIGVFESLQPSDTDLGAKTPKDV  320

Query  312  KIQGIWYAQLE  280
            KIQGIWYAQLE
Sbjct  321  KIQGIWYAQLE  331



>ref|XP_010557854.1| PREDICTED: oxygen-evolving enhancer protein 1-2, chloroplastic 
[Tarenaya hassleriana]
Length=317

 Score =   163 bits (412),  Expect(2) = 7e-69, Method: Compositional matrix adjust.
 Identities = 78/88 (89%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPF+VSSDG+VKF EKDGIDYAAVTVQLPGGERVPFLFT+KQL A+GKP+SFSG+F
Sbjct  157  DEIEGPFDVSSDGTVKFVEKDGIDYAAVTVQLPGGERVPFLFTVKQLEASGKPDSFSGKF  216

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  217  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  244


 Score =   125 bits (315),  Expect(2) = 7e-69, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KENIKN ASSTG+IT  VT SKPETGE+IGVFES+QPSDTDLGAK PK+V
Sbjct  247  GGRGDEEELTKENIKNAASSTGEITLKVTKSKPETGELIGVFESIQPSDTDLGAKVPKDV  306

Query  312  KIQGIWYAQLE  280
            KIQGIWY QLE
Sbjct  307  KIQGIWYGQLE  317



>ref|XP_006291313.1| hypothetical protein CARUB_v10017447mg, partial [Capsella rubella]
 gb|EOA24211.1| hypothetical protein CARUB_v10017447mg, partial [Capsella rubella]
Length=376

 Score =   165 bits (417),  Expect(2) = 7e-69, Method: Compositional matrix adjust.
 Identities = 79/88 (90%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEV SDGSVKF+E+DGIDYAAVTVQLPGGERVPFLFT+KQL A+GKPESFSG+F
Sbjct  216  DEIEGPFEVGSDGSVKFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLEASGKPESFSGKF  275

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  276  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  303


 Score =   124 bits (310),  Expect(2) = 7e-69, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KEN+KN A+S G IT  +T SKPETGEVIGVFESLQPSDTDLGAK PK+V
Sbjct  306  GGRGDEEELSKENVKNTAASVGDITLRITKSKPETGEVIGVFESLQPSDTDLGAKVPKDV  365

Query  312  KIQGIWYAQLE  280
            KIQG+WY QLE
Sbjct  366  KIQGVWYGQLE  376



>ref|XP_009149414.1| PREDICTED: oxygen-evolving enhancer protein 1-2, chloroplastic 
[Brassica rapa]
Length=333

 Score =   164 bits (414),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 78/88 (89%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVSSDGSVKF+E+DGIDYAAVTVQLPGGERVPFLFT+KQL A+GKP++FSG+F
Sbjct  173  DEIEGPFEVSSDGSVKFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLEASGKPDNFSGKF  232

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  233  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  260


 Score =   124 bits (310),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KEN+KN A+S G+IT  +T SKPETGEVIGVFESLQPSDTDLGAK PK+V
Sbjct  263  GGRGDEEELSKENVKNTAASVGEITLKITKSKPETGEVIGVFESLQPSDTDLGAKVPKDV  322

Query  312  KIQGIWYAQLE  280
            KIQG+WY QLE
Sbjct  323  KIQGVWYGQLE  333



>gb|KFK28330.1| hypothetical protein AALP_AA8G502100 [Arabis alpina]
Length=332

 Score =   164 bits (415),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 78/88 (89%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVS+DGSVKF+E+DGIDYAAVTVQLPGGERVPFLFT+KQL A+GKP+SFSG+F
Sbjct  172  DEIEGPFEVSADGSVKFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLDASGKPDSFSGKF  231

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  232  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  259


 Score =   123 bits (309),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KEN+KN A+S G+IT  VT SKPETGEVIGVFES+QPSDTDLGAK PK+V
Sbjct  262  GGRGDEEELSKENVKNTAASVGEITLKVTKSKPETGEVIGVFESIQPSDTDLGAKVPKDV  321

Query  312  KIQGIWYAQLE  280
            KIQG+WY QLE
Sbjct  322  KIQGVWYGQLE  332



>ref|NP_190651.1| oxygen-evolving enhancer protein 1-2 [Arabidopsis thaliana]
 sp|Q9S841.1|PSBO2_ARATH RecName: Full=Oxygen-evolving enhancer protein 1-2, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=Manganese-stabilizing protein 
2; Short=MSP-2; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAB42911.1| putative protein 1 photosystem II oxygen-evolving complex [Arabidopsis 
thaliana]
 emb|CAB53092.1| precursor of the 33 kDa subunit of the oxygen evolving complex 
[Arabidopsis thaliana]
 gb|AAK91379.1| AT3g50820/F18B3_100 [Arabidopsis thaliana]
 gb|AAM51568.1| AT3g50820/F18B3_100 [Arabidopsis thaliana]
 gb|AAM67110.1| putative protein 1 photosystem II oxygen-evolving complex [Arabidopsis 
thaliana]
 gb|AEE78714.1| oxygen-evolving enhancer protein 1-2 [Arabidopsis thaliana]
Length=331

 Score =   164 bits (416),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 79/88 (90%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEV SDGSVKF+E+DGIDYAAVTVQLPGGERVPFLFT+KQL A+GKPESFSG+F
Sbjct  171  DEIEGPFEVGSDGSVKFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLEASGKPESFSGKF  230

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  231  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  258


 Score =   123 bits (308),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KEN+KN A+S G+IT  +T SKPETGEVIGVFESLQPSDTDLGAK PK+V
Sbjct  261  GGRGDEEELSKENVKNTAASVGEITLKITKSKPETGEVIGVFESLQPSDTDLGAKVPKDV  320

Query  312  KIQGIWYAQLE  280
            KIQG+WY Q+E
Sbjct  321  KIQGVWYGQIE  331



>gb|AFK46831.1| unknown [Lotus japonicus]
Length=170

 Score =   165 bits (417),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 80/88 (91%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVSSDG+VKFEEKDGIDYAAVT QLPGGERVP LFTIKQLVA+GKP+SFSGEF
Sbjct  9    DEIEGPFEVSSDGTVKFEEKDGIDYAAVTAQLPGGERVPSLFTIKQLVASGKPDSFSGEF  68

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRG STGYDNAV  
Sbjct  69   LVPSYRGSSFLDPKGRGASTGYDNAVAL  96


 Score =   122 bits (307),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KEN K+ +SS GKIT SVT SKP+TGEVIGVFES+QPSDTDLGAKAPK+V
Sbjct  99   GGRGDEEELAKENNKSASSSKGKITLSVTQSKPDTGEVIGVFESIQPSDTDLGAKAPKDV  158

Query  312  KIQGIWYAQLE  280
            KIQG+WYAQLE
Sbjct  159  KIQGVWYAQLE  169



>emb|CDX81388.1| BnaC09g07990D [Brassica napus]
Length=332

 Score =   162 bits (411),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 77/88 (88%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVSSDGSVKF+E+DGIDYAAVTVQLPGGERVPFLFT+KQL A+GKP++F+G+F
Sbjct  172  DEIEGPFEVSSDGSVKFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLDASGKPDNFTGKF  231

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  232  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  259


 Score =   124 bits (312),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KEN+KN A+S G+IT  VT SKPETGEVIGVFESLQPSDTDLGAK PK+V
Sbjct  262  GGRGDEEELSKENVKNTAASVGEITLKVTKSKPETGEVIGVFESLQPSDTDLGAKVPKDV  321

Query  312  KIQGIWYAQLE  280
            KIQG+WY QLE
Sbjct  322  KIQGVWYGQLE  332



>ref|XP_002877774.1| photosystem II subunit O-2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54033.1| photosystem II subunit O-2 [Arabidopsis lyrata subsp. lyrata]
Length=331

 Score =   163 bits (413),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 78/88 (89%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEV SDGSVKF+E+DGIDYAAVTVQLPGGERVPFLFT+KQL A+GKPE+FSG+F
Sbjct  171  DEIEGPFEVGSDGSVKFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLEASGKPENFSGKF  230

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  231  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  258


 Score =   124 bits (310),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KEN+KN A+S G+IT  +T SKPETGEVIGVFESLQPSDTDLGAK PK+V
Sbjct  261  GGRGDEEELSKENVKNTAASVGEITLKITKSKPETGEVIGVFESLQPSDTDLGAKVPKDV  320

Query  312  KIQGIWYAQLE  280
            KIQG+WY QLE
Sbjct  321  KIQGVWYGQLE  331



>gb|ABK23365.1| unknown [Picea sitchensis]
 gb|ABK26094.1| unknown [Picea sitchensis]
 gb|ABR16830.1| unknown [Picea sitchensis]
 gb|ACN39793.1| unknown [Picea sitchensis]
Length=341

 Score =   161 bits (408),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 76/88 (86%), Positives = 82/88 (93%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGP EVS DG +KFEEKDGIDYAAVTVQLPGGERVPFLFT+KQLVA+G P+SFSG+F
Sbjct  179  DEIEGPLEVSQDGKLKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQLVASGTPDSFSGQF  238

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVP+YRGSSFLDPKGRGGSTGYDNAV  
Sbjct  239  LVPAYRGSSFLDPKGRGGSTGYDNAVAL  266


 Score =   125 bits (314),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KENIK+V++S G+ITFSV+ SKP+TGEVIGVFESLQPSDTDLG+KAPK+V
Sbjct  269  GGRGDEEELVKENIKDVSASKGEITFSVSKSKPDTGEVIGVFESLQPSDTDLGSKAPKDV  328

Query  312  KIQGIWYAQLE  280
            KIQGIWYAQ+E
Sbjct  329  KIQGIWYAQIE  339



>ref|XP_006403995.1| hypothetical protein EUTSA_v10010535mg [Eutrema salsugineum]
 dbj|BAJ34028.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ45448.1| hypothetical protein EUTSA_v10010535mg [Eutrema salsugineum]
Length=331

 Score =   162 bits (411),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 78/88 (89%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEV SDGSVKF+E+DGIDYAAVTVQLPGGERVPFLFT+KQL A+GKP+SFSG+F
Sbjct  171  DEIEGPFEVGSDGSVKFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLEASGKPDSFSGKF  230

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  231  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  258


 Score =   124 bits (311),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KEN+KN A+S G+IT  +T SKPETGEVIGVFESLQPSDTDLGAK PK+V
Sbjct  261  GGRGDEEELSKENVKNTAASVGEITLKITKSKPETGEVIGVFESLQPSDTDLGAKVPKDV  320

Query  312  KIQGIWYAQLE  280
            KIQG+WY QLE
Sbjct  321  KIQGVWYGQLE  331



>gb|ABQ85434.1| 33 kDa OEC protein, partial [Salicornia veneta]
Length=170

 Score =   167 bits (422),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 81/88 (92%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DE+EGPFEVSSD +VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKP+SFSGEF
Sbjct  9    DEMEGPFEVSSDETVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPDSFSGEF  68

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  69   LVPSYRGSSFLDPKGRGGSTGYDNAVAL  96


 Score =   120 bits (300),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KEN KN ASS G IT SV+ SKPETGEVIGVF+SLQPSDTDLGAK PK+V
Sbjct  99   GGRGDEEELLKENNKNAASSKGTITLSVSKSKPETGEVIGVFQSLQPSDTDLGAKTPKDV  158

Query  312  KIQGIWYAQLE  280
            KI+GIWYAQLE
Sbjct  159  KIEGIWYAQLE  169



>gb|ACN40581.1| unknown [Picea sitchensis]
Length=341

 Score =   161 bits (408),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 76/88 (86%), Positives = 82/88 (93%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGP EVS DG +KFEEKDGIDYAAVTVQLPGGERVPFLFT+KQLVA+G P+SFSG+F
Sbjct  179  DEIEGPLEVSHDGKLKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQLVASGTPDSFSGQF  238

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVP+YRGSSFLDPKGRGGSTGYDNAV  
Sbjct  239  LVPAYRGSSFLDPKGRGGSTGYDNAVAL  266


 Score =   125 bits (314),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KENIK+V++S G+ITFSV+ SKP+TGEVIGVFESLQPSDTDLG+KAPK+V
Sbjct  269  GGRGDEEELVKENIKDVSASKGEITFSVSKSKPDTGEVIGVFESLQPSDTDLGSKAPKDV  328

Query  312  KIQGIWYAQLE  280
            KIQGIWYAQ+E
Sbjct  329  KIQGIWYAQIE  339



>ref|XP_009112310.1| PREDICTED: oxygen-evolving enhancer protein 1-1, chloroplastic 
[Brassica rapa]
 emb|CDY18611.1| BnaA09g07840D [Brassica napus]
Length=332

 Score =   162 bits (410),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 77/88 (88%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVSSDGSV F+E+DGIDYAAVTVQLPGGERVPFLFT+KQL A+GKP+SF+G+F
Sbjct  172  DEIEGPFEVSSDGSVNFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLDASGKPDSFTGKF  231

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  232  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  259


 Score =   124 bits (312),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KEN+KN A+S G+IT  VT SKPETGEVIGVFESLQPSDTDLGAK PK+V
Sbjct  262  GGRGDEEELSKENVKNTAASVGEITLKVTKSKPETGEVIGVFESLQPSDTDLGAKVPKDV  321

Query  312  KIQGIWYAQLE  280
            KIQG+WY QLE
Sbjct  322  KIQGVWYGQLE  332



>gb|ABK24541.1| unknown [Picea sitchensis]
 gb|ABK26154.1| unknown [Picea sitchensis]
 gb|ACN39762.1| unknown [Picea sitchensis]
 gb|ACN40363.1| unknown [Picea sitchensis]
 gb|ACN40484.1| unknown [Picea sitchensis]
Length=341

 Score =   161 bits (407),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 76/88 (86%), Positives = 82/88 (93%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGP EVS DG +KFEEKDGIDYAAVTVQLPGGERVPFLFT+KQLVA+G P+SFSG+F
Sbjct  179  DEIEGPLEVSHDGKLKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQLVASGTPDSFSGQF  238

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVP+YRGSSFLDPKGRGGSTGYDNAV  
Sbjct  239  LVPAYRGSSFLDPKGRGGSTGYDNAVAL  266


 Score =   125 bits (314),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KENIK+V++S G+ITFSV+ SKP+TGEVIGVFESLQPSDTDLG+KAPK+V
Sbjct  269  GGRGDEEELVKENIKDVSASKGEITFSVSKSKPDTGEVIGVFESLQPSDTDLGSKAPKDV  328

Query  312  KIQGIWYAQLE  280
            KIQGIWYAQ+E
Sbjct  329  KIQGIWYAQIE  339



>ref|XP_010531775.1| PREDICTED: oxygen-evolving enhancer protein 1-1, chloroplastic 
[Tarenaya hassleriana]
Length=230

 Score =   162 bits (410),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 79/88 (90%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVSSDG+VKFEEKDGIDYAAVTVQLPGGERVPFLFT+KQL A+GKP SF G+F
Sbjct  70   DEIEGPFEVSSDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQLDASGKPNSFGGKF  129

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  130  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  157


 Score =   124 bits (311),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KENIKN ASSTG+IT  VT SKPETGE+IGVFES+QPSDTDLGAK PK+V
Sbjct  160  GGRGDEEELTKENIKNAASSTGEITLKVTKSKPETGELIGVFESIQPSDTDLGAKVPKDV  219

Query  312  KIQGIWYAQLE  280
            KIQGIWY QLE
Sbjct  220  KIQGIWYGQLE  230



>ref|XP_009130561.1| PREDICTED: oxygen-evolving enhancer protein 1-1, chloroplastic-like 
[Brassica rapa]
 emb|CDY55088.1| BnaA02g34760D [Brassica napus]
Length=332

 Score =   162 bits (409),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 77/88 (88%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVSSDGSV F+E+DGIDYAAVTVQLPGGERVPFLFT+KQL A+GKP++FSG+F
Sbjct  172  DEIEGPFEVSSDGSVNFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLDASGKPDNFSGKF  231

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  232  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  259


 Score =   124 bits (312),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KEN+KN A+S G+IT  VT SKPETGEVIGVFESLQPSDTDLGAK PK+V
Sbjct  262  GGRGDEEELSKENVKNTAASVGEITLKVTKSKPETGEVIGVFESLQPSDTDLGAKVPKDV  321

Query  312  KIQGIWYAQLE  280
            KIQG+WY QLE
Sbjct  322  KIQGVWYGQLE  332



>ref|XP_010503753.1| PREDICTED: oxygen-evolving enhancer protein 1-2, chloroplastic-like 
[Camelina sativa]
Length=336

 Score =   163 bits (413),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 78/88 (89%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEV SDGSVKF+E DGIDYAAVTVQLPGGERVPFLFT+KQL A+GKPE+FSG+F
Sbjct  176  DEIEGPFEVGSDGSVKFKEADGIDYAAVTVQLPGGERVPFLFTVKQLEASGKPENFSGKF  235

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  236  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  263


 Score =   122 bits (307),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KEN+KN A+S G IT  +T SKPETGEVIGVFESLQPSDTDLGAK PK+V
Sbjct  266  GGRGDEEELSKENVKNTAASVGDITLKITKSKPETGEVIGVFESLQPSDTDLGAKVPKDV  325

Query  312  KIQGIWYAQLE  280
            KIQG+WY Q+E
Sbjct  326  KIQGVWYGQIE  336



>gb|AGV54778.1| oxygen-evolving enhancer protein 1 [Phaseolus vulgaris]
Length=329

 Score =   169 bits (429),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 81/88 (92%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEV+ DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSG+F
Sbjct  168  DEIEGPFEVTPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGDF  227

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRG STGYDNAV  
Sbjct  228  LVPSYRGSSFLDPKGRGASTGYDNAVAL  255


 Score =   116 bits (291),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KEN K+ + S GKI  SVT +KPETGEVIGVFES+QP DTDLGAKAPK+V
Sbjct  258  GGRGDEEELAKENNKSASFSKGKIPLSVTKTKPETGEVIGVFESVQPFDTDLGAKAPKDV  317

Query  312  KIQGIWYAQLE  280
            KIQG+WYAQLE
Sbjct  318  KIQGVWYAQLE  328



>emb|CDY30764.1| BnaC07g16640D [Brassica napus]
Length=332

 Score =   161 bits (407),  Expect(2) = 5e-68, Method: Compositional matrix adjust.
 Identities = 76/88 (86%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVSSDGSV F+E+DGIDYAAVTVQLPGGERVPFLFT+KQL A+GKP++F+G+F
Sbjct  172  DEIEGPFEVSSDGSVNFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLDASGKPDNFTGKF  231

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  232  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  259


 Score =   124 bits (312),  Expect(2) = 5e-68, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KEN+KN A+S G+IT  VT SKPETGEVIGVFESLQPSDTDLGAK PK+V
Sbjct  262  GGRGDEEELSKENVKNTAASVGEITLKVTKSKPETGEVIGVFESLQPSDTDLGAKVPKDV  321

Query  312  KIQGIWYAQLE  280
            KIQG+WY QLE
Sbjct  322  KIQGVWYGQLE  332



>ref|XP_009103510.1| PREDICTED: oxygen-evolving enhancer protein 1-1, chloroplastic 
[Brassica rapa]
 emb|CDY45242.1| BnaA07g12480D [Brassica napus]
Length=332

 Score =   161 bits (407),  Expect(2) = 6e-68, Method: Compositional matrix adjust.
 Identities = 76/88 (86%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVSSDGSV F+E+DGIDYAAVTVQLPGGERVPFLFT+KQL A+GKP++F+G+F
Sbjct  172  DEIEGPFEVSSDGSVNFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLDASGKPDNFTGKF  231

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  232  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  259


 Score =   124 bits (312),  Expect(2) = 6e-68, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KEN+KN A+S G+IT  VT SKPETGEVIGVFESLQPSDTDLGAK PK+V
Sbjct  262  GGRGDEEELSKENVKNTAASVGEITLKVTKSKPETGEVIGVFESLQPSDTDLGAKVPKDV  321

Query  312  KIQGIWYAQLE  280
            KIQG+WY QLE
Sbjct  322  KIQGVWYGQLE  332



>emb|CDY50981.1| BnaC02g48890D [Brassica napus]
Length=332

 Score =   160 bits (406),  Expect(2) = 7e-68, Method: Compositional matrix adjust.
 Identities = 76/88 (86%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVSSDGSV F+E+DGIDYAAVTVQLPGGERVPFLFT+KQL A+GKP++F+G+F
Sbjct  172  DEIEGPFEVSSDGSVNFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLDASGKPDNFTGKF  231

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  232  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  259


 Score =   124 bits (312),  Expect(2) = 7e-68, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KEN+KN A+S G+IT  VT SKPETGEVIGVFESLQPSDTDLGAK PK+V
Sbjct  262  GGRGDEEELSKENVKNTAASVGEITLKVTKSKPETGEVIGVFESLQPSDTDLGAKVPKDV  321

Query  312  KIQGIWYAQLE  280
            KIQG+WY QLE
Sbjct  322  KIQGVWYGQLE  332



>ref|XP_006280785.1| hypothetical protein CARUB_v10026754mg [Capsella rubella]
 gb|EOA13683.1| hypothetical protein CARUB_v10026754mg [Capsella rubella]
Length=332

 Score =   161 bits (407),  Expect(2) = 8e-68, Method: Compositional matrix adjust.
 Identities = 76/88 (86%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEV+SDGSV F+E+DGIDYAAVTVQLPGGERVPFLFT+KQL A+GKP+SF+G+F
Sbjct  172  DEIEGPFEVASDGSVNFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLDASGKPDSFTGKF  231

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  232  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  259


 Score =   124 bits (310),  Expect(2) = 8e-68, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KEN+KN A+S G+IT  VT SKPETGEVIGVFESLQPSDTDLGAK PK+V
Sbjct  262  GGRGDEEELVKENVKNTAASVGEITLKVTKSKPETGEVIGVFESLQPSDTDLGAKVPKDV  321

Query  312  KIQGIWYAQLE  280
            KIQG+WY QLE
Sbjct  322  KIQGVWYGQLE  332



>emb|CAA36675.1| 33 kDa oxygen-evolving protein [Arabidopsis thaliana]
Length=332

 Score =   161 bits (407),  Expect(2) = 9e-68, Method: Compositional matrix adjust.
 Identities = 76/88 (86%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEV+SDGSV F+E+DGIDYAAVTVQLPGGERVPFLFT+KQL A+GKP+SF+G+F
Sbjct  172  DEIEGPFEVASDGSVNFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLDASGKPDSFTGKF  231

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  232  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  259


 Score =   124 bits (310),  Expect(2) = 9e-68, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KEN+KN A+S G+IT  VT SKPETGEVIGVFESLQPSDTDLGAK PK+V
Sbjct  262  GGRGDEEELVKENVKNTAASVGEITLKVTKSKPETGEVIGVFESLQPSDTDLGAKVPKDV  321

Query  312  KIQGIWYAQLE  280
            KIQG+WY QLE
Sbjct  322  KIQGVWYGQLE  332



>ref|XP_006393852.1| hypothetical protein EUTSA_v10004563mg [Eutrema salsugineum]
 gb|ESQ31138.1| hypothetical protein EUTSA_v10004563mg [Eutrema salsugineum]
Length=332

 Score =   161 bits (407),  Expect(2) = 9e-68, Method: Compositional matrix adjust.
 Identities = 76/88 (86%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVSSDGSV+F+E+DGIDYAAVTVQLPGGERVPFLFT+KQL A+GKP++F+G+F
Sbjct  172  DEIEGPFEVSSDGSVQFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLDASGKPDNFTGKF  231

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  232  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  259


 Score =   124 bits (310),  Expect(2) = 9e-68, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KEN+KN A+S G+IT  VT SKPETGEVIGVFESLQPSDTDLGAK PK+V
Sbjct  262  GGRGDEEELVKENVKNTAASVGEITLKVTKSKPETGEVIGVFESLQPSDTDLGAKVPKDV  321

Query  312  KIQGIWYAQLE  280
            KIQG+WY QLE
Sbjct  322  KIQGVWYGQLE  332



>gb|AAM96957.1| 33 kDa polypeptide of oxygen-evolving complex (OEC) in photosystem 
II [Arabidopsis thaliana]
 gb|AAN15726.1| 33 kDa polypeptide of oxygen-evolving complex (OEC) in photosystem 
II [Arabidopsis thaliana]
Length=332

 Score =   161 bits (407),  Expect(2) = 9e-68, Method: Compositional matrix adjust.
 Identities = 76/88 (86%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEV+SDGSV F+E+DGIDYAAVTVQLPGGERVPFLFT+KQL A+GKP+SF+G+F
Sbjct  172  DEIEGPFEVASDGSVNFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLDASGKPDSFTGKF  231

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  232  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  259


 Score =   124 bits (310),  Expect(2) = 9e-68, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KEN+KN A+S G+IT  VT SKPETGEVIGVFESLQPSDTDLGAK PK+V
Sbjct  262  GGRGDEEELVKENVKNTAASVGEITLKVTKSKPETGEVIGVFESLQPSDTDLGAKVPKDV  321

Query  312  KIQGIWYAQLE  280
            KIQG+WY QLE
Sbjct  322  KIQGVWYGQLE  332



>ref|XP_002866754.1| oxygen-evolving enhancer 33 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43013.1| oxygen-evolving enhancer 33 [Arabidopsis lyrata subsp. lyrata]
Length=332

 Score =   161 bits (407),  Expect(2) = 9e-68, Method: Compositional matrix adjust.
 Identities = 76/88 (86%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEV+SDGSV F+E+DGIDYAAVTVQLPGGERVPFLFT+KQL A+GKP+SF+G+F
Sbjct  172  DEIEGPFEVASDGSVNFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLDASGKPDSFTGKF  231

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  232  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  259


 Score =   124 bits (310),  Expect(2) = 9e-68, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KEN+KN A+S G+IT  VT SKPETGEVIGVFESLQPSDTDLGAK PK+V
Sbjct  262  GGRGDEEELVKENVKNTAASVGEITLKVTKSKPETGEVIGVFESLQPSDTDLGAKVPKDV  321

Query  312  KIQGIWYAQLE  280
            KIQG+WY QLE
Sbjct  322  KIQGVWYGQLE  332



>gb|AAL08257.1| AT5g66570/K1F13_25 [Arabidopsis thaliana]
Length=332

 Score =   161 bits (407),  Expect(2) = 9e-68, Method: Compositional matrix adjust.
 Identities = 76/88 (86%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEV+SDGSV F+E+DGIDYAAVTVQLPGGERVPFLFT+KQL A+GKP+SF+G+F
Sbjct  172  DEIEGPFEVASDGSVNFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLDASGKPDSFTGKF  231

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  232  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  259


 Score =   124 bits (310),  Expect(2) = 9e-68, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KEN+KN A+S G+IT  VT SKPETGEVIGVFESLQPSDTDLGAK PK+V
Sbjct  262  GGRGDEEELVKENVKNTAASVGEITLKVTKSKPETGEVIGVFESLQPSDTDLGAKVPKDV  321

Query  312  KIQGIWYAQLE  280
            KIQG+WY QLE
Sbjct  322  KIQGVWYGQLE  332



>gb|AAM65169.1| 33 kDa polypeptide of oxygen-evolving complex (OEC) in photosystem 
II [Arabidopsis thaliana]
Length=332

 Score =   161 bits (407),  Expect(2) = 9e-68, Method: Compositional matrix adjust.
 Identities = 76/88 (86%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEV+SDGSV F+E+DGIDYAAVTVQLPGGERVPFLFT+KQL A+GKP+SF+G+F
Sbjct  172  DEIEGPFEVASDGSVNFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLDASGKPDSFTGKF  231

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  232  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  259


 Score =   124 bits (310),  Expect(2) = 9e-68, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KEN+KN A+S G+IT  VT SKPETGEVIGVFESLQPSDTDLGAK PK+V
Sbjct  262  GGRGDEEELVKENVKNTAASVGEITLKVTKSKPETGEVIGVFESLQPSDTDLGAKVPKDV  321

Query  312  KIQGIWYAQLE  280
            KIQG+WY QLE
Sbjct  322  KIQGVWYGQLE  332



>ref|NP_201458.1| PS II oxygen-evolving complex 1 [Arabidopsis thaliana]
 sp|P23321.2|PSBO1_ARATH RecName: Full=Oxygen-evolving enhancer protein 1-1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=Manganese-stabilizing protein 
1; Short=MSP-1; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAL11619.1|AF424626_1 AT5g66570/K1F13_25 [Arabidopsis thaliana]
 emb|CAA75629.1| 33 kDa polypeptide of oxygen-evolving complex (OEC) in photosystem 
II [Arabidopsis thaliana]
 dbj|BAB10933.1| 33 kDa polypeptide of oxygen-evolving complex [Arabidopsis thaliana]
 gb|AAK96492.1| AT5g66570/K1F13_25 [Arabidopsis thaliana]
 gb|AAL31251.1| AT5g66570/K1F13_25 [Arabidopsis thaliana]
 gb|AED98230.1| PS II oxygen-evolving complex 1 [Arabidopsis thaliana]
Length=332

 Score =   161 bits (407),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 76/88 (86%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEV+SDGSV F+E+DGIDYAAVTVQLPGGERVPFLFT+KQL A+GKP+SF+G+F
Sbjct  172  DEIEGPFEVASDGSVNFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLDASGKPDSFTGKF  231

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  232  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  259


 Score =   124 bits (310),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KEN+KN A+S G+IT  VT SKPETGEVIGVFESLQPSDTDLGAK PK+V
Sbjct  262  GGRGDEEELVKENVKNTAASVGEITLKVTKSKPETGEVIGVFESLQPSDTDLGAKVPKDV  321

Query  312  KIQGIWYAQLE  280
            KIQG+WY QLE
Sbjct  322  KIQGVWYGQLE  332



>ref|XP_010515458.1| PREDICTED: oxygen-evolving enhancer protein 1-2, chloroplastic-like 
[Camelina sativa]
Length=333

 Score =   163 bits (412),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 78/88 (89%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEV SDGSVKF+E+DGIDYAAVTVQLPGGERVPFLFT+KQL A+GKPE+FSG+F
Sbjct  173  DEIEGPFEVGSDGSVKFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLEASGKPENFSGKF  232

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  233  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  260


 Score =   122 bits (305),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KEN+KN A S G IT  +T SKPETGEVIGVFESLQPSDTDLGAK PK+V
Sbjct  263  GGRGDEEELSKENVKNTAGSVGDITLKITKSKPETGEVIGVFESLQPSDTDLGAKVPKDV  322

Query  312  KIQGIWYAQLE  280
            KIQG+WY Q+E
Sbjct  323  KIQGVWYGQIE  333



>gb|AAK49614.1|AF372898_1 AT5g66570/K1F13_25 [Arabidopsis thaliana]
Length=332

 Score =   161 bits (407),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 76/88 (86%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEV+SDGSV F+E+DGIDYAAVTVQLPGGERVPFLFT+KQL A+GKP+SF+G+F
Sbjct  172  DEIEGPFEVASDGSVNFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLDASGKPDSFTGKF  231

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  232  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  259


 Score =   123 bits (308),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KEN+KN A+S G+IT  VT SKPETGEVIGVFESLQPSDTDLGAK PK+V
Sbjct  262  GGRGDEEELVKENVKNSAASVGEITLKVTKSKPETGEVIGVFESLQPSDTDLGAKVPKDV  321

Query  312  KIQGIWYAQLE  280
            KIQG+WY QLE
Sbjct  322  KIQGVWYGQLE  332



>gb|KFK34331.1| hypothetical protein AALP_AA5G131000 [Arabis alpina]
Length=331

 Score =   161 bits (408),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 77/88 (88%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEV SDGSVKF+E+DGIDYAAVTVQLPGGERVPFLFT+KQL A+GKP++FSG+F
Sbjct  171  DEIEGPFEVGSDGSVKFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLEASGKPDNFSGKF  230

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  231  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  258


 Score =   122 bits (307),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KEN+KN A+S G+IT  +T SKPETGEVIGVFES+QPSDTDLGAK PK+V
Sbjct  261  GGRGDEEELAKENVKNTAASVGEITLKITKSKPETGEVIGVFESIQPSDTDLGAKVPKDV  320

Query  312  KIQGIWYAQLE  280
            KIQG+WY QLE
Sbjct  321  KIQGVWYGQLE  331



>ref|XP_010465252.1| PREDICTED: oxygen-evolving enhancer protein 1-1, chloroplastic-like 
[Camelina sativa]
Length=331

 Score =   160 bits (404),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 75/88 (85%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEV+SDGSV F+E+DGIDYAAVTVQLPGGERVPFLFT+KQL A+GKP++F+G+F
Sbjct  171  DEIEGPFEVASDGSVNFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLDASGKPDNFTGKF  230

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  231  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  258


 Score =   124 bits (310),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KEN+KN A+S G+IT  VT SKPETGEVIGVFESLQPSDTDLGAK PK+V
Sbjct  261  GGRGDEEELVKENVKNTAASVGEITLKVTKSKPETGEVIGVFESLQPSDTDLGAKVPKDV  320

Query  312  KIQGIWYAQLE  280
            KIQG+WY QLE
Sbjct  321  KIQGVWYGQLE  331



>ref|XP_010484624.1| PREDICTED: oxygen-evolving enhancer protein 1-1, chloroplastic 
[Camelina sativa]
Length=332

 Score =   160 bits (404),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 75/88 (85%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEV+SDGSV F+E+DGIDYAAVTVQLPGGERVPFLFT+KQL A+GKP++F+G+F
Sbjct  172  DEIEGPFEVASDGSVNFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLDASGKPDNFTGKF  231

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  232  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  259


 Score =   124 bits (310),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KEN+KN A+S G+IT  VT SKPETGEVIGVFESLQPSDTDLGAK PK+V
Sbjct  262  GGRGDEEELVKENVKNTAASVGEITLKVTKSKPETGEVIGVFESLQPSDTDLGAKVPKDV  321

Query  312  KIQGIWYAQLE  280
            KIQG+WY QLE
Sbjct  322  KIQGVWYGQLE  332



>ref|XP_010444775.1| PREDICTED: oxygen-evolving enhancer protein 1-1, chloroplastic-like 
[Camelina sativa]
Length=332

 Score =   160 bits (404),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 75/88 (85%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEV+SDGSV F+E+DGIDYAAVTVQLPGGERVPFLFT+KQL A+GKP++F+G+F
Sbjct  172  DEIEGPFEVASDGSVNFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLDASGKPDNFTGKF  231

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  232  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  259


 Score =   124 bits (310),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KEN+KN A+S G+IT  VT SKPETGEVIGVFESLQPSDTDLGAK PK+V
Sbjct  262  GGRGDEEELVKENVKNTAASVGEITLKVTKSKPETGEVIGVFESLQPSDTDLGAKVPKDV  321

Query  312  KIQGIWYAQLE  280
            KIQG+WY QLE
Sbjct  322  KIQGVWYGQLE  332



>ref|XP_006411950.1| hypothetical protein EUTSA_v10025711mg [Eutrema salsugineum]
 gb|ESQ53403.1| hypothetical protein EUTSA_v10025711mg [Eutrema salsugineum]
Length=325

 Score =   166 bits (421),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 80/88 (91%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEV+SDG VKF EKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESF G+F
Sbjct  167  DEIEGPFEVASDGKVKFIEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFGGDF  226

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  227  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  254


 Score =   117 bits (292),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 55/69 (80%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = -2

Query  486  RGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKI  307
            RGD+EEL KEN KN A+S GKIT SVT S PE+GEVIGVF+S+QPSDTDLGAK PK+VKI
Sbjct  257  RGDDEELAKENNKNTAASVGKITLSVTKSNPESGEVIGVFQSIQPSDTDLGAKTPKDVKI  316

Query  306  QGIWYAQLE  280
            QGIWYAQLE
Sbjct  317  QGIWYAQLE  325



>ref|XP_010424899.1| PREDICTED: oxygen-evolving enhancer protein 1-2, chloroplastic 
[Camelina sativa]
Length=334

 Score =   160 bits (406),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 77/88 (88%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEV  DGSVKF+E+DGIDYAAVTVQLPGGERVPFLFT+KQL A+GKPE+FSG+F
Sbjct  174  DEIEGPFEVGPDGSVKFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLEASGKPENFSGKF  233

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  234  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  261


 Score =   122 bits (306),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KEN+KN A+S G IT  +T SKPETGEVIGVFESLQPSDTDLGAK PK+V
Sbjct  264  GGRGDEEELSKENVKNTAASVGDITLKITKSKPETGEVIGVFESLQPSDTDLGAKVPKDV  323

Query  312  KIQGIWYAQLE  280
            KIQG+WY Q+E
Sbjct  324  KIQGVWYGQIE  334



>gb|AAT65501.1| photosystem II protein [Brassica oleracea]
Length=347

 Score =   159 bits (402),  Expect(2) = 5e-67, Method: Compositional matrix adjust.
 Identities = 75/88 (85%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVSSDGSV F+E+DGIDYAAVTVQLPGGERVPFLFT+KQL A+GKP++F+G+F
Sbjct  187  DEIEGPFEVSSDGSVNFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLDASGKPDNFTGKF  246

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRG SFLDPKGRGGSTGYDNAV  
Sbjct  247  LVPSYRGPSFLDPKGRGGSTGYDNAVAL  274


 Score =   123 bits (309),  Expect(2) = 5e-67, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KEN+KN A+S G+IT  VT SKPETGEVIGVF+SLQPSDTDLGAK PK+V
Sbjct  277  GGRGDEEELSKENVKNTAASVGEITLKVTKSKPETGEVIGVFQSLQPSDTDLGAKVPKDV  336

Query  312  KIQGIWYAQLE  280
            KIQG+WY QLE
Sbjct  337  KIQGVWYGQLE  347



>emb|CDX72613.1| BnaC07g46350D [Brassica napus]
Length=319

 Score =   164 bits (416),  Expect(2) = 5e-67, Method: Compositional matrix adjust.
 Identities = 78/88 (89%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPF+V+SDG+V+F EKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESF G+F
Sbjct  160  DEIEGPFDVASDGTVRFLEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFGGDF  219

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  220  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  247


 Score =   117 bits (294),  Expect(2) = 5e-67, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = -2

Query  489  GRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVK  310
             RGD+EEL KEN KN A+S G+ITFSVT SKPE+GEVIG+FES+QPSDTDLGAK PK+VK
Sbjct  249  ARGDDEELDKENNKNTAASVGEITFSVTKSKPESGEVIGLFESIQPSDTDLGAKTPKDVK  308

Query  309  IQGIWYAQLE  280
            IQGIWYA+LE
Sbjct  309  IQGIWYAKLE  318



>gb|AAK96774.1| 33 kDa polypeptide of oxygen-evolving complex [Arabidopsis thaliana]
Length=332

 Score =   158 bits (400),  Expect(2) = 5e-67, Method: Compositional matrix adjust.
 Identities = 75/88 (85%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEV+SDGSV F+E+DGIDYAAVTVQLPG ERVPFLFT+KQL A+GKP+SF+G+F
Sbjct  172  DEIEGPFEVASDGSVNFKEEDGIDYAAVTVQLPGCERVPFLFTVKQLDASGKPDSFTGKF  231

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  232  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  259


 Score =   124 bits (310),  Expect(2) = 5e-67, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KEN+KN A+S G+IT  VT SKPETGEVIGVFESLQPSDTDLGAK PK+V
Sbjct  262  GGRGDEEELVKENVKNTAASVGEITLKVTKSKPETGEVIGVFESLQPSDTDLGAKVPKDV  321

Query  312  KIQGIWYAQLE  280
            KIQG+WY QLE
Sbjct  322  KIQGVWYGQLE  332



>ref|XP_002866983.1| hypothetical protein ARALYDRAFT_328078 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43242.1| hypothetical protein ARALYDRAFT_328078 [Arabidopsis lyrata subsp. 
lyrata]
Length=328

 Score =   166 bits (419),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 80/88 (91%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEV+SDG VKF EKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESF G+F
Sbjct  169  DEIEGPFEVASDGKVKFLEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFGGDF  228

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  229  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  256


 Score =   114 bits (285),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -2

Query  489  GRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVK  310
             RGD+EEL KEN KN A+S GKIT SVT S PE+ EVIGVFES+QPSDTDLGAK PK+VK
Sbjct  258  ARGDDEELAKENSKNTAASLGKITLSVTKSNPESREVIGVFESIQPSDTDLGAKTPKDVK  317

Query  309  IQGIWYAQLE  280
            IQGIWYAQLE
Sbjct  318  IQGIWYAQLE  327



>ref|XP_010446730.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=332

 Score =   165 bits (418),  Expect(2) = 4e-66, Method: Compositional matrix adjust.
 Identities = 79/88 (90%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEV+SDG VKF EKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+G+PESF G+F
Sbjct  173  DEIEGPFEVASDGKVKFIEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGRPESFGGDF  232

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  233  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  260


 Score =   114 bits (285),  Expect(2) = 4e-66, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -2

Query  489  GRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVK  310
             RGD+EEL KEN K+  +S GKITFSVT S PE GEVIGVFES+QPSDTDLGAK PK+VK
Sbjct  262  ARGDDEELAKENNKDTTASLGKITFSVTKSNPERGEVIGVFESIQPSDTDLGAKNPKDVK  321

Query  309  IQGIWYAQLE  280
            IQGIWYAQLE
Sbjct  322  IQGIWYAQLE  331



>gb|EYU44326.1| hypothetical protein MIMGU_mgv1a009768mg [Erythranthe guttata]
Length=332

 Score =   172 bits (436),  Expect(2) = 5e-66, Method: Compositional matrix adjust.
 Identities = 82/88 (93%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVS DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESF+GEF
Sbjct  171  DEIEGPFEVSQDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFTGEF  230

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  231  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  258


 Score =   107 bits (266),  Expect(2) = 5e-66, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL+KEN KNVA+ TGKIT SVT SKPETGEVIGVFES+QPSDTDLG+KAPK+V
Sbjct  261  GGRGDEEELEKENNKNVAALTGKITLSVTKSKPETGEVIGVFESIQPSDTDLGSKAPKDV  320

Query  312  KIQGIWYAQLE  280
            KIQG+WYAQL+
Sbjct  321  KIQGVWYAQLD  331



>emb|CDY42709.1| BnaA03g53620D [Brassica napus]
Length=319

 Score =   164 bits (416),  Expect(2) = 9e-66, Method: Compositional matrix adjust.
 Identities = 78/88 (89%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEV+SDG+V+F EKDG DYAAVTVQLPGGER+PFLFTIKQLVATGKPESF G+F
Sbjct  160  DEIEGPFEVASDGTVRFLEKDGSDYAAVTVQLPGGERIPFLFTIKQLVATGKPESFGGDF  219

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  220  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  247


 Score =   114 bits (284),  Expect(2) = 9e-66, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = -2

Query  489  GRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVK  310
             RGD+EEL KEN KN A+S G+ITFSVT SKPE+GEVI +FES+QPSDTDLGAK P++VK
Sbjct  249  ARGDDEELDKENNKNTAASVGEITFSVTKSKPESGEVISLFESIQPSDTDLGAKTPEDVK  308

Query  309  IQGIWYAQLE  280
            IQGIWYA+LE
Sbjct  309  IQGIWYAKLE  318



>ref|XP_010432119.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=331

 Score =   166 bits (419),  Expect(2) = 9e-66, Method: Compositional matrix adjust.
 Identities = 79/88 (90%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEV+SDG VKF EKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+G+PESF G+F
Sbjct  172  DEIEGPFEVASDGKVKFIEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGRPESFGGDF  231

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  232  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  259


 Score =   112 bits (280),  Expect(2) = 9e-66, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -2

Query  489  GRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVK  310
             RGD+EEL KEN K+  +S GKITFSVT S P+T EVIGVFES+QPSDTDLGAK PK+VK
Sbjct  261  ARGDDEELSKENNKDTTASLGKITFSVTKSNPKTREVIGVFESIQPSDTDLGAKNPKDVK  320

Query  309  IQGIWYAQLE  280
            IQGIWYAQLE
Sbjct  321  IQGIWYAQLE  330



>emb|CDY26519.1| BnaC01g23800D [Brassica napus]
Length=373

 Score =   164 bits (416),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 78/88 (89%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVSSDGSVKF+E+DGIDYAAVTVQLPGGERVPFLFT+KQL A+GKP++FSG+F
Sbjct  173  DEIEGPFEVSSDGSVKFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLEASGKPDNFSGKF  232

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  233  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  260


 Score =   113 bits (283),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KEN+KN A+S G+IT  +T SKPETGEVIGVFESLQPSDTDLGAK PK+V
Sbjct  263  GGRGDEEELSKENVKNTAASVGEITLKITKSKPETGEVIGVFESLQPSDTDLGAKVPKDV  322

Query  312  KIQGIWYAQL  283
            KIQG+   +L
Sbjct  323  KIQGVCATEL  332



>ref|XP_011099252.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Sesamum indicum]
Length=331

 Score =   168 bits (425),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 80/88 (91%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVS DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKP++F GEF
Sbjct  171  DEIEGPFEVSQDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPDNFGGEF  230

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  231  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  258


 Score =   110 bits (274),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL+KEN KNVASSTGKIT SVT SKPETGEVIGVFES+QPSDTDLG+KAPK+V
Sbjct  261  GGRGDEEELEKENNKNVASSTGKITLSVTQSKPETGEVIGVFESIQPSDTDLGSKAPKDV  320

Query  312  KIQGIWYAQLE  280
            KIQG+WYAQL+
Sbjct  321  KIQGVWYAQLD  331



>ref|XP_011085527.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
[Sesamum indicum]
Length=330

 Score =   167 bits (424),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 81/88 (92%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPF VS DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESF GEF
Sbjct  169  DEIEGPFVVSEDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFGGEF  228

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  229  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  256


 Score =   109 bits (273),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 68/71 (96%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL+KEN KNVASSTGKIT SVT SKPETGEVIGVFES+QPSDTDLG+KAPK+V
Sbjct  259  GGRGDEEELEKENNKNVASSTGKITLSVTKSKPETGEVIGVFESVQPSDTDLGSKAPKDV  318

Query  312  KIQGIWYAQLE  280
            KIQG+WYAQL+
Sbjct  319  KIQGVWYAQLD  329



>emb|CDY33308.1| BnaA01g19750D [Brassica napus]
Length=381

 Score =   164 bits (415),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 78/88 (89%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVSSDGSVKF+E+DGIDYAAVTVQLPGGERVPFLFT+KQL A+GKP++FSG+F
Sbjct  173  DEIEGPFEVSSDGSVKFKEEDGIDYAAVTVQLPGGERVPFLFTVKQLEASGKPDNFSGKF  232

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  233  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  260


 Score =   113 bits (282),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KEN+KN A+S G+IT  +T SKPETGEVIGVFESLQPSDTDLGAK PK+V
Sbjct  263  GGRGDEEELSKENVKNTAASVGEITLKITKSKPETGEVIGVFESLQPSDTDLGAKVPKDV  322

Query  312  KIQGIWYAQL  283
            KIQG+   +L
Sbjct  323  KIQGVCATEL  332



>ref|XP_009138459.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic 
[Brassica rapa]
Length=314

 Score =   162 bits (410),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 77/88 (88%), Positives = 82/88 (93%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEV+SDG+V+F EKDG DYA VTVQLPGGER+PFLFTIKQLVATGKPESF G+F
Sbjct  155  DEIEGPFEVASDGTVRFLEKDGSDYATVTVQLPGGERIPFLFTIKQLVATGKPESFGGDF  214

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  215  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  242


 Score =   112 bits (279),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = -2

Query  489  GRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVK  310
             RGD+EEL KEN KN A+S G+ITFSVT SKPE+GEVI +FES+QPSDT+LGAK P++VK
Sbjct  244  ARGDDEELDKENNKNTAASVGEITFSVTKSKPESGEVISLFESIQPSDTNLGAKTPEDVK  303

Query  309  IQGIWYAQLE  280
            IQGIWYA+LE
Sbjct  304  IQGIWYAKLE  313



>ref|XP_010924332.1| PREDICTED: LOW QUALITY PROTEIN: oxygen-evolving enhancer protein 
1, chloroplastic-like [Elaeis guineensis]
Length=334

 Score =   148 bits (374),  Expect(2) = 7e-64, Method: Compositional matrix adjust.
 Identities = 75/89 (84%), Positives = 80/89 (90%), Gaps = 2/89 (2%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERV-PFLFTIKQLVATGKPESFSGE  587
            DEIEGP EVS DG+VKFEEKDGIDYAAVTV+LPGGERV PFLFTIKQLVA+GKPE+F  +
Sbjct  173  DEIEGPLEVSPDGTVKFEEKDGIDYAAVTVRLPGGERVPPFLFTIKQLVASGKPENFGVQ  232

Query  586  FLVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            FLVPSYRGSSFLDP  RGGSTGYDNAV  
Sbjct  233  FLVPSYRGSSFLDPX-RGGSTGYDNAVAL  260


 Score =   123 bits (309),  Expect(2) = 7e-64, Method: Compositional matrix adjust.
 Identities = 61/71 (86%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KENIKN +SSTG IT SVT SKPE+GEVIGVFESLQPSDTDLGAK PK+V
Sbjct  263  GGRGDEEELTKENIKNSSSSTGTITLSVTKSKPESGEVIGVFESLQPSDTDLGAKVPKDV  322

Query  312  KIQGIWYAQLE  280
            KIQGI YAQLE
Sbjct  323  KIQGIRYAQLE  333



>sp|P27665.1|PSBO_WHEAT RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; AltName: Full=33 kDa subunit of oxygen evolving 
system of photosystem II; AltName: Full=33 kDa thylakoid 
membrane protein; AltName: Full=OEC 33 kDa subunit; Flags: 
Precursor [Triticum aestivum]
 pir||S16260 photosystem II oxygen-evolving complex protein 1 - common wheat 
x Sanduri wheat
 emb|CAA40670.1| 33kDa oxygen evolving protein of photosystem II [Triticum aestivum]
Length=325

 Score =   145 bits (367),  Expect(2) = 7e-62, Method: Compositional matrix adjust.
 Identities = 72/85 (85%), Positives = 76/85 (89%), Gaps = 1/85 (1%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DE+EGP EV    ++KFEEKDGIDYAAVTVQLPGGERV FLFT+KQLVATGKPESF   F
Sbjct  166  DEMEGPLEVRRRRTLKFEEKDGIDYAAVTVQLPGGERVAFLFTVKQLVATGKPESFR-PF  224

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNA  509
            LVPSYRGSSFLDPKGRGGSTGYDNA
Sbjct  225  LVPSYRGSSFLDPKGRGGSTGYDNA  249


 Score =   119 bits (299),  Expect(2) = 7e-62, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 64/71 (90%), Gaps = 2/71 (3%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KEN+KN +SSTG IT SVT SKPETGEVIGVFES+QPSDTDL  +APK+V
Sbjct  255  GGRGDEEELAKENVKNASSSTGNITLSVTKSKPETGEVIGVFESVQPSDTDL--EAPKDV  312

Query  312  KIQGIWYAQLE  280
            KIQG+WYAQLE
Sbjct  313  KIQGVWYAQLE  323



>ref|XP_010446731.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=329

 Score =   165 bits (418),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 79/88 (90%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEV+SDG VKF EKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+G+PESF G+F
Sbjct  173  DEIEGPFEVASDGKVKFIEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGRPESFGGDF  232

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  233  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  260


 Score = 99.4 bits (246),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 49/65 (75%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = -2

Query  489  GRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVK  310
             RGD+EEL KEN K+  +S GKITFSVT S PE GEVIGVFES+QPSDTDLGAK PK+VK
Sbjct  262  ARGDDEELAKENNKDTTASLGKITFSVTKSNPERGEVIGVFESIQPSDTDLGAKNPKDVK  321

Query  309  IQGIW  295
            IQGI 
Sbjct  322  IQGIC  326



>ref|XP_010432121.1| PREDICTED: oxygen-evolving enhancer protein 1, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=324

 Score =   166 bits (420),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 79/88 (90%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEV+SDG VKF EKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+G+PESF G+F
Sbjct  172  DEIEGPFEVASDGKVKFIEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGRPESFGGDF  231

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  232  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  259


 Score = 97.4 bits (241),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = -2

Query  489  GRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVK  310
             RGD+EEL KEN K+  +S GKITFSVT S P+T EVIGVFES+QPSDTDLGAK PK+VK
Sbjct  261  ARGDDEELSKENNKDTTASLGKITFSVTKSNPKTREVIGVFESIQPSDTDLGAKNPKDVK  320

Query  309  IQGI  298
            IQGI
Sbjct  321  IQGI  324



>dbj|BAF94218.1| 33kDa oxygen evolving protein of photosystem II [Chara braunii]
Length=337

 Score =   164 bits (415),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 78/88 (89%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLF++K+LVATG+P SF G++
Sbjct  177  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFSVKELVATGRPSSFGGKY  236

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  237  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  264


 Score = 98.2 bits (243),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GG GD ++L+KEN+K+ +++ G I F+V  S PE+GEV+G FES+QPSDTDLGAK  KEV
Sbjct  267  GGSGDRDDLEKENLKSTSAAEGNIVFTVAQSNPESGEVVGTFESVQPSDTDLGAKQAKEV  326

Query  312  KIQGIWYAQLE  280
            KI GIWY QL+
Sbjct  327  KISGIWYGQLK  337



>ref|XP_001784751.1| predicted protein [Physcomitrella patens]
 gb|EDQ50440.1| predicted protein [Physcomitrella patens]
Length=274

 Score =   154 bits (389),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 74/88 (84%), Positives = 81/88 (92%), Gaps = 1/88 (1%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGP  +S +G++KFEEKDGIDYAAVTVQLPGGERVPFLFTIK+LVATGKPE+F G +
Sbjct  115  DEIEGPLTIS-NGNLKFEEKDGIDYAAVTVQLPGGERVPFLFTIKELVATGKPEAFGGSY  173

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  174  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  201


 Score =   103 bits (258),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GG GDEEEL KEN KN A+  G ITFS+  S  ETGE+ G FES+QPSDTDLG+KAPKEV
Sbjct  204  GGAGDEEELAKENEKNTAALNGNITFSIAKSNVETGEIAGTFESIQPSDTDLGSKAPKEV  263

Query  312  KIQGIWYAQLE  280
            KI+GI+YAQ+E
Sbjct  264  KIEGIFYAQVE  274



>ref|XP_001763258.1| predicted protein [Physcomitrella patens]
 gb|EDQ71788.1| predicted protein [Physcomitrella patens]
Length=327

 Score =   151 bits (382),  Expect(2) = 5e-59, Method: Compositional matrix adjust.
 Identities = 73/88 (83%), Positives = 79/88 (90%), Gaps = 1/88 (1%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGP  VS +G+++FEEKDGIDYAAVTVQLPGGERVPFLFT+K+LVA GKPE F G F
Sbjct  167  DEIEGPLTVS-NGNLRFEEKDGIDYAAVTVQLPGGERVPFLFTVKELVAEGKPEKFGGSF  225

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  226  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  253


 Score =   104 bits (259),  Expect(2) = 5e-59, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GG GDEEEL KEN KN A+  G ITFS+  S  ETGE+ G FES+QPSDTDLG+K PKEV
Sbjct  256  GGAGDEEELAKENEKNTAALNGNITFSIAKSNTETGEIAGTFESIQPSDTDLGSKTPKEV  315

Query  312  KIQGIWYAQLE  280
            KI+GI+YAQLE
Sbjct  316  KIEGIFYAQLE  326



>ref|XP_001781590.1| predicted protein [Physcomitrella patens]
 gb|EDQ53641.1| predicted protein [Physcomitrella patens]
Length=326

 Score =   150 bits (379),  Expect(2) = 5e-59, Method: Compositional matrix adjust.
 Identities = 72/88 (82%), Positives = 78/88 (89%), Gaps = 1/88 (1%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGP  V   G+++FEEKDGIDYAAVTVQLPGGERVPFLFT+K+LVA GKPE+F G F
Sbjct  167  DEIEGPLTVKG-GNLRFEEKDGIDYAAVTVQLPGGERVPFLFTVKELVAEGKPEAFGGSF  225

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  226  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  253


 Score =   105 bits (262),  Expect(2) = 5e-59, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GG GDEEEL KEN KN A+  G ITFS+  S  ETGE+ G FES+QPSDTDLG+KAPKEV
Sbjct  256  GGAGDEEELAKENEKNTAALNGNITFSIAKSNTETGEIAGTFESIQPSDTDLGSKAPKEV  315

Query  312  KIQGIWYAQLE  280
            KI+GI+YAQL+
Sbjct  316  KIEGIFYAQLD  326



>gb|KCW55052.1| hypothetical protein EUGRSUZ_I01025 [Eucalyptus grandis]
Length=247

 Score =   127 bits (320),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 69/88 (78%), Gaps = 16/88 (18%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVS DG+VKFEEKDGIDYAAVT                QLVA+GKPESFSGEF
Sbjct  102  DEIEGPFEVSPDGTVKFEEKDGIDYAAVT----------------QLVASGKPESFSGEF  145

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  146  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  173


 Score =   127 bits (319),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 60/71 (85%), Positives = 66/71 (93%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEE+L KENIKN +SSTGKIT SVT +KPETGEVIGVFES+QPSDTDLGAK PK+V
Sbjct  176  GGRGDEEDLTKENIKNASSSTGKITLSVTKTKPETGEVIGVFESVQPSDTDLGAKVPKDV  235

Query  312  KIQGIWYAQLE  280
            KIQG+WYAQLE
Sbjct  236  KIQGVWYAQLE  246



>ref|XP_002991827.1| hypothetical protein SELMODRAFT_272235 [Selaginella moellendorffii]
 gb|EFJ07089.1| hypothetical protein SELMODRAFT_272235 [Selaginella moellendorffii]
Length=328

 Score =   145 bits (365),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 70/88 (80%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIE    V   G++K  EKDGIDYAAVTVQLPGGERVPFLFTIK+LVATG P+ FSG F
Sbjct  168  DEIEADLSVDEKGNLKLVEKDGIDYAAVTVQLPGGERVPFLFTIKELVATGSPDGFSGSF  227

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  228  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  255


 Score =   107 bits (267),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GG GDEEEL KEN+K+ + STG IT  V  S   TGE+ GVFES+QPSDTDLG+KAPKEV
Sbjct  258  GGAGDEEELGKENLKDTSGSTGNITLKVAESNTATGEIAGVFESIQPSDTDLGSKAPKEV  317

Query  312  KIQGIWYAQLE  280
            KIQGIWYAQL+
Sbjct  318  KIQGIWYAQLD  328



>ref|XP_002992987.1| hypothetical protein SELMODRAFT_187141 [Selaginella moellendorffii]
 ref|XP_002994511.1| hypothetical protein SELMODRAFT_449377 [Selaginella moellendorffii]
 gb|EFJ04419.1| hypothetical protein SELMODRAFT_449377 [Selaginella moellendorffii]
 gb|EFJ05933.1| hypothetical protein SELMODRAFT_187141 [Selaginella moellendorffii]
Length=328

 Score =   145 bits (365),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 70/88 (80%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIE    V   G++K  EKDGIDYAAVTVQLPGGERVPFLFTIK+LVATG P+ FSG F
Sbjct  168  DEIEADLSVDEKGNLKLVEKDGIDYAAVTVQLPGGERVPFLFTIKELVATGSPDGFSGSF  227

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  228  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  255


 Score =   107 bits (267),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GG GDEEEL KEN+K+ + STG IT  V  S   TGE+ GVFES+QPSDTDLG+KAPKEV
Sbjct  258  GGAGDEEELGKENLKDTSGSTGNITLKVAESNTATGEIAGVFESIQPSDTDLGSKAPKEV  317

Query  312  KIQGIWYAQLE  280
            KIQGIWYAQL+
Sbjct  318  KIQGIWYAQLD  328



>ref|XP_001756893.1| predicted protein [Physcomitrella patens]
 gb|EDQ78124.1| predicted protein [Physcomitrella patens]
Length=326

 Score =   148 bits (374),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 71/88 (81%), Positives = 78/88 (89%), Gaps = 1/88 (1%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGP  V  +G+++FEE DGIDYAAVTVQLPGGERVPFLFT+K+LVA GKPE+F G F
Sbjct  167  DEIEGPLTVQ-NGNLRFEEVDGIDYAAVTVQLPGGERVPFLFTVKELVAEGKPEAFGGSF  225

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  226  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  253


 Score =   103 bits (257),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GG GDEEEL KEN KN A+  G ITFS+  S  +TGE+ G FES QPSDTDLG+KAPKEV
Sbjct  256  GGAGDEEELAKENEKNTAALNGNITFSIAKSNVQTGEIAGTFESFQPSDTDLGSKAPKEV  315

Query  312  KIQGIWYAQLE  280
            KI+GI+YAQL+
Sbjct  316  KIEGIFYAQLD  326



>gb|ACS34663.1| chloroplast manganese stabilizing protein-II [Solanum tuberosum]
Length=294

 Score =   170 bits (431),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 82/88 (93%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVS DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESFSG+F
Sbjct  161  DEIEGPFEVSPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFSGDF  220

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  221  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  248


 Score = 77.4 bits (189),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 37/44 (84%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFES  361
            GGRGDEEELQKEN+KN AS TGKITF+VT S P+TGEVIGVFES
Sbjct  251  GGRGDEEELQKENVKNTASLTGKITFTVTKSNPQTGEVIGVFES  294



>ref|XP_002994513.1| hypothetical protein SELMODRAFT_138743, partial [Selaginella 
moellendorffii]
 gb|EFJ04421.1| hypothetical protein SELMODRAFT_138743, partial [Selaginella 
moellendorffii]
Length=244

 Score =   143 bits (361),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 70/88 (80%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIE    V   G++K  EKDGIDYAAVTVQLPGGERVPFLFTIK+LVATG P+ FSG F
Sbjct  84   DEIEADLSVDEKGNLKLVEKDGIDYAAVTVQLPGGERVPFLFTIKELVATGSPDGFSGSF  143

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  144  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  171


 Score =   102 bits (254),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GG GDEEEL KEN+K+ + STG IT  V  S   TGE+ GVFES+QPSDTDLG+KAPKEV
Sbjct  174  GGAGDEEELGKENLKDTSGSTGNITLKVAESNTATGEIAGVFESIQPSDTDLGSKAPKEV  233

Query  312  KIQGIWYAQLE  280
            KIQGIW AQL+
Sbjct  234  KIQGIWCAQLD  244



>gb|AAR85969.1| ERT12 [Nicotiana tabacum]
Length=132

 Score =   129 bits (323),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 61/70 (87%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL+KEN+KN +SSTGKIT SVT SKPETGEVIGVFES+QPSDTDLGAK PK+V
Sbjct  63   GGRGDEEELEKENVKNTSSSTGKITLSVTNSKPETGEVIGVFESIQPSDTDLGAKVPKDV  122

Query  312  KIQGIWYAQL  283
            KIQGIWYAQL
Sbjct  123  KIQGIWYAQL  132


 Score =   115 bits (287),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 55/60 (92%), Positives = 55/60 (92%), Gaps = 0/60 (0%)
 Frame = -1

Query  679  TVQLPGGERVPFLFTIKQLVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            TVQLPGGERVPFLFTIKQL A GKPESFSGEFLVPSYRGSSFLDPKGRGGST YDNAV  
Sbjct  1    TVQLPGGERVPFLFTIKQLAANGKPESFSGEFLVPSYRGSSFLDPKGRGGSTSYDNAVAL  60



>gb|AGI15761.1| collinsiaXIII-like protein, partial [Collinsia linearis]
Length=167

 Score =   167 bits (424),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 81/88 (92%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVS DGSVKFEEKDGIDYAAVTVQLPGGERVPFLFT+KQLVA+GKP+SFSG+F
Sbjct  37   DEIEGPFEVSPDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQLVASGKPDSFSGDF  96

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  97   LVPSYRGSSFLDPKGRGGSTGYDNAVAL  124


 Score = 73.6 bits (179),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 37/41 (90%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGV  370
            GGRGDEEELQKEN KNVASSTGKIT SVT SKPETGE+IGV
Sbjct  127  GGRGDEEELQKENNKNVASSTGKITLSVTKSKPETGEIIGV  167



>gb|ABS29557.1| chloroplast photosynthetic water oxidation complex 33kDa subunit 
precursor [Morus nigra]
Length=265

 Score =   172 bits (436),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 82/88 (93%), Positives = 86/88 (98%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEV++DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESFSGEF
Sbjct  135  DEIEGPFEVANDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFSGEF  194

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  195  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  222


 Score = 68.6 bits (166),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVI  376
            GGRGDEEEL KENIKN ASSTGKIT SVT SKPETGE+I
Sbjct  225  GGRGDEEELTKENIKNTASSTGKITLSVTKSKPETGELI  263



>gb|AGI15739.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
Length=167

 Score =   167 bits (424),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 81/88 (92%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVS DGSVKFEEKDGIDYAAVTVQLPGGERVPFLFT+KQLVA+GKP+SFSG+F
Sbjct  38   DEIEGPFEVSPDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQLVASGKPDSFSGDF  97

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  98   LVPSYRGSSFLDPKGRGGSTGYDNAVAL  125


 Score = 71.6 bits (174),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 36/40 (90%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIG  373
            GGRGDEEELQKEN KNVASSTGKIT SVT SKPETGE+IG
Sbjct  128  GGRGDEEELQKENNKNVASSTGKITLSVTKSKPETGEIIG  167



>gb|AGI15756.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15757.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15758.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15759.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15760.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
Length=166

 Score =   167 bits (424),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 81/88 (92%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVS DGSVKFEEKDGIDYAAVTVQLPGGERVPFLFT+KQLVA+GKP+SFSG+F
Sbjct  37   DEIEGPFEVSPDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQLVASGKPDSFSGDF  96

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  97   LVPSYRGSSFLDPKGRGGSTGYDNAVAL  124


 Score = 72.0 bits (175),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 36/40 (90%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIG  373
            GGRGDEEELQKEN KNVASSTGKIT SVT SKPETGE+IG
Sbjct  127  GGRGDEEELQKENNKNVASSTGKITLSVTKSKPETGEIIG  166



>dbj|BAF94214.1| 33kDa oxygen evolving protein of photosystem II [Oedogonium obesum]
Length=291

 Score =   139 bits (349),  Expect(2) = 7e-54, Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEI G   V S+GSV+ +E+DGIDYA VTVQLPGGERVPFLFTIKQL A G  E FSG+F
Sbjct  133  DEISGKLTVGSNGSVELKEEDGIDYAPVTVQLPGGERVPFLFTIKQLEAKGTLEGFSGDF  192

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
             VPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  193  TVPSYRGSSFLDPKGRGGSTGYDNAVAL  220


 Score = 99.8 bits (247),  Expect(2) = 7e-54, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = -2

Query  486  RGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKI  307
            R D EEL KEN K+VA+S G   FSV    P TGE+ GVFES+QPSDTDLGAKAPK++KI
Sbjct  223  RADSEELAKENTKSVAASKGSAAFSVAVVDPATGEIAGVFESIQPSDTDLGAKAPKDIKI  282

Query  306  QGIWYAQLE  280
            +G+WYAQL+
Sbjct  283  KGLWYAQLK  291



>gb|AGI15762.1| collinsiaXIII-like protein, partial [Collinsia linearis]
Length=158

 Score =   168 bits (426),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 81/88 (92%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVS DGSVKFEEKDGIDYAAVTVQLPGGERVPFLFT+KQLVA+GKP+SFSG+F
Sbjct  31   DEIEGPFEVSPDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQLVASGKPDSFSGDF  90

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  91   LVPSYRGSSFLDPKGRGGSTGYDNAVAL  118


 Score = 67.8 bits (164),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 34/38 (89%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEV  379
            GGRGDEEELQKEN KNVASSTGKIT SVT SKPETGE+
Sbjct  121  GGRGDEEELQKENNKNVASSTGKITLSVTKSKPETGEI  158



>gb|AGI15742.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15743.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15744.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15745.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15746.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15747.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15748.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15749.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15750.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15751.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15752.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15753.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15754.1| collinsiaXIII-like protein, partial [Collinsia linearis]
 gb|AGI15755.1| collinsiaXIII-like protein, partial [Collinsia linearis]
Length=164

 Score =   167 bits (424),  Expect(2) = 6e-53, Method: Compositional matrix adjust.
 Identities = 81/88 (92%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVS DGSVKFEEKDGIDYAAVTVQLPGGERVPFLFT+KQLVA+GKP+SFSG+F
Sbjct  37   DEIEGPFEVSPDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQLVASGKPDSFSGDF  96

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  97   LVPSYRGSSFLDPKGRGGSTGYDNAVAL  124


 Score = 67.8 bits (164),  Expect(2) = 6e-53, Method: Compositional matrix adjust.
 Identities = 34/38 (89%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEV  379
            GGRGDEEELQKEN KNVASSTGKIT SVT SKPETGE+
Sbjct  127  GGRGDEEELQKENNKNVASSTGKITLSVTKSKPETGEI  164



>dbj|BAF94220.1| 33kDa oxygen evolving protein of photosystem II [Closterium peracerosum-strigosum-littorale 
complex]
Length=325

 Score =   132 bits (333),  Expect(2) = 8e-52, Method: Compositional matrix adjust.
 Identities = 64/88 (73%), Positives = 74/88 (84%), Gaps = 1/88 (1%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGP EV+ + ++KF E DGIDYAAVTVQL GGERVPFLFT+K+LVA+G  +SF G F
Sbjct  166  DEIEGPLEVNGN-NLKFTEVDGIDYAAVTVQLAGGERVPFLFTVKELVASGPADSFGGSF  224

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRG++FLDPKGRGGS GYD AV  
Sbjct  225  LVPSYRGATFLDPKGRGGSQGYDTAVAL  252


 Score = 99.4 bits (246),  Expect(2) = 8e-52, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GG GDE+ LQKEN K+  + +G ITFSV  S  ETGE+ GVF S+QPSDTD+GAK PK+V
Sbjct  255  GGFGDEDALQKENQKSYKALSGNITFSVAKSNVETGEIGGVFTSVQPSDTDMGAKVPKDV  314

Query  312  KIQGIWYAQLE  280
            KI+GIWYAQL+
Sbjct  315  KIEGIWYAQLD  325



>dbj|BAF94217.1| 33kDa oxygen evolving protein of photosystem II, partial [Nephroselmis 
olivacea]
Length=260

 Score =   137 bits (344),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            D+I G F+V +DGSV F E+DGIDYAA TVQLPGGERVPFLFTIK+LVA G    F G+F
Sbjct  102  DDISGKFKVGADGSVTFTEEDGIDYAATTVQLPGGERVPFLFTIKELVAKGNTSQFGGDF  161

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            +VPSYRGSSFLDPKGRG STGYD AV  
Sbjct  162  VVPSYRGSSFLDPKGRGASTGYDTAVAL  189


 Score = 93.6 bits (231),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = -2

Query  483  GDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQ  304
            GD EEL KEN K+ AS TG   F+V      TGE+ GVFES+QPSDTDLGAKAPK+VKI 
Sbjct  193  GDAEELAKENNKSAASLTGSAVFNVAKYDAATGEIAGVFESIQPSDTDLGAKAPKDVKIT  252

Query  303  GIWYAQLE  280
            G+WYAQL+
Sbjct  253  GLWYAQLK  260



>gb|AGI15740.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
 gb|AGI15741.1| collinsiaXIII-like protein, partial [Collinsia rattanii]
Length=160

 Score =   167 bits (424),  Expect(2) = 6e-51, Method: Compositional matrix adjust.
 Identities = 81/88 (92%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVS DGSVKFEEKDGIDYAAVTVQLPGGERVPFLFT+KQLVA+GKP+SFSG+F
Sbjct  37   DEIEGPFEVSPDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQLVASGKPDSFSGDF  96

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  97   LVPSYRGSSFLDPKGRGGSTGYDNAVAL  124


 Score = 61.2 bits (147),  Expect(2) = 6e-51, Method: Compositional matrix adjust.
 Identities = 31/34 (91%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPE  391
            GGRGDEEELQKEN KNVASSTGKIT SVT SKPE
Sbjct  127  GGRGDEEELQKENNKNVASSTGKITLSVTKSKPE  160



>ref|XP_003063851.1| photosystem II manganese-stabilizing polypeptide [Micromonas 
pusilla CCMP1545]
 gb|EEH52224.1| photosystem II manganese-stabilizing polypeptide [Micromonas 
pusilla CCMP1545]
Length=303

 Score =   131 bits (330),  Expect(2) = 5e-50, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 70/88 (80%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            D + G F+V SDGSV  +E+DG+DYA VTVQLPGGERVPFLFT+K+    G    F G+F
Sbjct  145  DGMTGSFKVGSDGSVAIQERDGLDYAPVTVQLPGGERVPFLFTLKEFTGKGNTSQFGGDF  204

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            +VPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  205  VVPSYRGSSFLDPKGRGGSTGYDNAVAL  232


 Score = 94.4 bits (233),  Expect(2) = 5e-50, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = -2

Query  486  RGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKI  307
            + D +EL KEN KNVA+  G   F+V    P TGEV GVFES+QPSDTDLG+KAPK+VKI
Sbjct  235  KSDADELLKENNKNVAALKGSAVFNVAKYDPVTGEVAGVFESIQPSDTDLGSKAPKDVKI  294

Query  306  QGIWYAQLE  280
             G+WYAQL+
Sbjct  295  TGLWYAQLQ  303



>gb|ABR17376.1| unknown [Picea sitchensis]
Length=327

 Score =   162 bits (409),  Expect(2) = 5e-50, Method: Compositional matrix adjust.
 Identities = 76/88 (86%), Positives = 82/88 (93%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGP EVS DG +KFEEKDGIDYAAVTVQLPGGERVPFLFT+KQLVA+G P+SFSG+F
Sbjct  179  DEIEGPLEVSQDGKLKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQLVASGTPDSFSGQF  238

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVP+YRGSSFLDPKGRGGSTGYDNAV  
Sbjct  239  LVPAYRGSSFLDPKGRGGSTGYDNAVAL  266


 Score = 63.9 bits (154),  Expect(2) = 5e-50, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFE  364
            GGRGDEEEL KENIK+V++S G+ITFSV+ SKP+TGEVI V E
Sbjct  269  GGRGDEEELVKENIKDVSASKGEITFSVSKSKPDTGEVICVRE  311



>ref|XP_001422458.1| psbO, PSII-O, OEE1, photosystem II polypeptide, oxygen evolving 
enhancer 1 [Ostreococcus lucimarinus CCE9901]
 gb|ABP00775.1| psbO, PSII-O, OEE1, photosystem II polypeptide, oxygen evolving 
enhancer 1 [Ostreococcus lucimarinus CCE9901]
Length=302

 Score =   130 bits (328),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 69/88 (78%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            D + G F+V SDGSV  +E DG+DYA VTVQLPGGERVPFLFT+K+    G    F G+F
Sbjct  142  DGMTGSFKVGSDGSVNVQENDGLDYAPVTVQLPGGERVPFLFTLKEFTGKGNTSQFGGDF  201

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            +VPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  202  VVPSYRGSSFLDPKGRGGSTGYDNAVAL  229


 Score = 94.7 bits (234),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -2

Query  486  RGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKI  307
            R D EELQKEN KN A+  G   F+V    P TGE+ GVFES+QPSDTDLGAK PK+VKI
Sbjct  232  RADSEELQKENQKNTAALKGSAVFNVAKYDPATGEIAGVFESIQPSDTDLGAKVPKDVKI  291

Query  306  QGIWYAQL  283
             G+WYA L
Sbjct  292  TGLWYANL  299



>ref|XP_005644574.1| 33kDa oxygen evolving protein of photosystem II [Coccomyxa subellipsoidea 
C-169]
 gb|EIE20030.1| 33kDa oxygen evolving protein of photosystem II [Coccomyxa subellipsoidea 
C-169]
Length=315

 Score =   133 bits (334),  Expect(2) = 7e-50, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEI G F V   G+V F+E+DGIDYA VTVQLPGGERVPFLFTIK+L A G    F G+F
Sbjct  157  DEISGKFSVDGSGNVNFKEEDGIDYAPVTVQLPGGERVPFLFTIKELNAKGSLGGFGGDF  216

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            +VPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  217  VVPSYRGSSFLDPKGRGGSTGYDNAVAL  244


 Score = 92.4 bits (228),  Expect(2) = 7e-50, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = -2

Query  489  GRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVK  310
            GR D EEL KEN K+  +  G+  FSV    P TGE+ GVFES+QPSDTDLG+KAPK+VK
Sbjct  246  GRSDSEELAKENNKSTVALKGQAVFSVAKVDPATGEIAGVFESIQPSDTDLGSKAPKDVK  305

Query  309  IQGIWYAQL  283
            I G+WY QL
Sbjct  306  ITGLWYGQL  314



>gb|ABA01139.1| chloroplast oxygen-evolving enhancer protein 1 [Chlamydomonas 
incerta]
Length=291

 Score =   129 bits (325),  Expect(2) = 7e-50, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 69/88 (78%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            D + G F+V SDGS + +E DGIDYAA TVQLPGGERV FLFTIKQ    G  ++  G+F
Sbjct  133  DAMSGSFKVGSDGSAELKEDDGIDYAATTVQLPGGERVAFLFTIKQFDGKGTLDNIKGDF  192

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  193  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  220


 Score = 95.5 bits (236),  Expect(2) = 7e-50, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = -2

Query  486  RGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKI  307
            R D EEL KEN+KN  +  G   FSV    P TGE+ GVFES+QPSDTDLGAKAPK++K+
Sbjct  223  RADAEELLKENVKNTKALKGSAVFSVAKVDPVTGEIAGVFESIQPSDTDLGAKAPKDIKV  282

Query  306  QGIWYAQLE  280
             G+WYAQL+
Sbjct  283  TGLWYAQLK  291



>dbj|BAF94213.1| 33kDa oxygen evolving protein of photosystem II [Hafniomonas 
montana]
Length=290

 Score =   137 bits (344),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DE+ G F+V   G V+ +E+DGIDYAA TVQLPGGERVPFLFTIKQL A G  +SFSG+F
Sbjct  131  DEMSGTFKVDGSGKVELQEEDGIDYAATTVQLPGGERVPFLFTIKQLNAKGTLDSFSGDF  190

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            +VPSYRGSSFLDPKGRG STGYDNAV  
Sbjct  191  VVPSYRGSSFLDPKGRGASTGYDNAVAL  218


 Score = 87.0 bits (214),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = -2

Query  486  RGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKI  307
            R D EEL KEN K+ ASS G   FS+    P TGEV GVFES+QPSDTDLGAK PK++KI
Sbjct  221  RADAEELAKENSKSAASSKGSAVFSIAKVDPVTGEVAGVFESIQPSDTDLGAKTPKDIKI  280

Query  306  QGIWYAQLE  280
             GIWYAQL+
Sbjct  281  TGIWYAQLQ  289



>ref|XP_005843863.1| hypothetical protein CHLNCDRAFT_32868 [Chlorella variabilis]
 gb|EFN51761.1| hypothetical protein CHLNCDRAFT_32868 [Chlorella variabilis]
Length=297

 Score =   130 bits (326),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DE+ G F+V   G+V+ +E+DGIDYA VTVQLPGGERVPFLF++KQL A G  + F GEF
Sbjct  139  DEMSGSFKVDGSGNVELKEEDGIDYAPVTVQLPGGERVPFLFSVKQLEAKGNADGFGGEF  198

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            +VPSYRGS+FLDPKGRG +TGYDNAV  
Sbjct  199  VVPSYRGSTFLDPKGRGAATGYDNAVAL  226


 Score = 93.2 bits (230),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = -2

Query  480  DEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQG  301
            D EE  KENIK+ A+  G+  FS+    P TGE+ GVFES+QPSDTDLGAKAPK+VKI G
Sbjct  231  DAEEFLKENIKSTAAMKGQAVFSIAKVDPVTGEIAGVFESVQPSDTDLGAKAPKDVKITG  290

Query  300  IWYAQL  283
            +WYAQL
Sbjct  291  LWYAQL  296



>gb|AAR20846.1| oxygen-evolving enhancer protein 1 [Pseudochlorella pringsheimii]
Length=173

 Score =   130 bits (327),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEI G F++   G+V+ +E+DGIDYAAVTV +PGGERVPFLFTIK+L A G  ++F GEF
Sbjct  14   DEISGDFKIDGSGNVELKEEDGIDYAAVTVXMPGGERVPFLFTIKELEAKGTADAFGGEF  73

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
             VPSYRGSSFLDPKGRGGSTGYDNA   
Sbjct  74   TVPSYRGSSFLDPKGRGGSTGYDNAXAL  101


 Score = 92.8 bits (229),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = -2

Query  486  RGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKI  307
            R D +ELQKEN K+VA+  G+  FS+    P TGE+ GVFES+QPSDTDLG+KAPK+VKI
Sbjct  104  RSDPDELQKENNKSVAALKGQAVFSIAKVDPATGEIAGVFESIQPSDTDLGSKAPKDVKI  163

Query  306  QGIWYAQL  283
             G+WY QL
Sbjct  164  IGLWYGQL  171



>ref|XP_003637254.1| Oxygen-evolving enhancer protein, partial [Medicago truncatula]
Length=255

 Score =   173 bits (438),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 83/88 (94%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESFSGE+
Sbjct  168  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFSGEY  227

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRG STGYDNAV  
Sbjct  228  LVPSYRGSSFLDPKGRGASTGYDNAVAL  255



>dbj|BAF94216.1| 33kDa oxygen evolving protein of photosystem II [Tetraselmis 
cordiformis]
Length=308

 Score =   131 bits (330),  Expect(2) = 6e-49, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            D++ G   + SDG V F+E+DGIDYA VTVQLPGGERVPFLFT+++L A G  +SFSG+F
Sbjct  148  DDMSGKMTIGSDGKVTFKEEDGIDYAPVTVQLPGGERVPFLFTVRELDAKGTLDSFSGDF  207

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
             V SYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  208  TVTSYRGSSFLDPKGRGGSTGYDNAVAL  235


 Score = 90.9 bits (224),  Expect(2) = 6e-49, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -2

Query  486  RGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKI  307
            R D+EEL KEN KN A+  G I  SV      TGE+ GVFES+QPSDTDLG+KAPK+VKI
Sbjct  238  RSDDEELFKENNKNTAALKGSIVLSVAKVDASTGEIAGVFESIQPSDTDLGSKAPKDVKI  297

Query  306  QGIWYAQL  283
             G+WY QL
Sbjct  298  TGLWYGQL  305



>gb|AEH95324.1| 33 kDa manganese stabilizing chloroplast protein [Allium cepa]
Length=238

 Score =   167 bits (423),  Expect(2) = 7e-49, Method: Compositional matrix adjust.
 Identities = 81/88 (92%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVS D +VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESFSG+F
Sbjct  111  DEIEGPFEVSPDSTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFSGDF  170

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  171  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  198


 Score = 54.7 bits (130),  Expect(2) = 7e-49, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSK  397
            GGRGDEEELQKEN+KN AS TGKITF+VT S+
Sbjct  201  GGRGDEEELQKENVKNTASLTGKITFTVTKSQ  232



>gb|ACF24544.1| photosystem II oxygen evolving enhancer protein 1 [Gymnochlora 
stellata]
Length=331

 Score =   124 bits (311),  Expect(2) = 7e-49, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 70/88 (80%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            D + G  +V S G+++F+E+DGIDYA  TVQLPGG RVPFLFT+K+L A G  E+FSGEF
Sbjct  170  DAMSGTMKVGSGGAIEFKEEDGIDYAPTTVQLPGGSRVPFLFTVKELEAKGDIEAFSGEF  229

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
             VPSYRGS+FLDPKGRG +TGYD AV  
Sbjct  230  SVPSYRGSTFLDPKGRGAATGYDTAVAI  257


 Score = 97.8 bits (242),  Expect(2) = 7e-49, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GG GDEEEL KEN K++   +GK   S+    P TGEV GVF+S+QPSDTDLGAK PK++
Sbjct  260  GGAGDEEELVKENNKSIKPLSGKAVLSIAKYDPATGEVAGVFQSVQPSDTDLGAKVPKDI  319

Query  312  KIQGIWYAQL  283
            KIQG+WYAQL
Sbjct  320  KIQGLWYAQL  329



>ref|XP_002505809.1| photosystem II manganese-stabilizing polypeptide [Micromonas 
sp. RCC299]
 gb|ACO67067.1| photosystem II manganese-stabilizing polypeptide [Micromonas 
sp. RCC299]
Length=303

 Score =   132 bits (331),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 70/88 (80%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            D + G F+V SDGSV  +E+DG+DYA VTVQLPGGERVPFLFT+K+    G    F G+F
Sbjct  144  DGMTGSFKVGSDGSVAVQERDGLDYAPVTVQLPGGERVPFLFTLKEFTGKGNTSQFGGDF  203

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            +VPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  204  VVPSYRGSSFLDPKGRGGSTGYDNAVAL  231


 Score = 89.4 bits (220),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -2

Query  486  RGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKI  307
            + D +EL KEN KNVA+  G   F+V      TGE+ GVFES+QPSDTDLG+KAPK+VKI
Sbjct  234  KSDADELLKENNKNVAALKGSAVFNVAKYDEVTGEIAGVFESIQPSDTDLGSKAPKDVKI  293

Query  306  QGIWYAQL  283
             G+WYAQL
Sbjct  294  TGLWYAQL  301



>emb|CEG01950.1| Photosystem II PsbO, manganese-stabilising [Ostreococcus tauri]
Length=302

 Score =   130 bits (327),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 70/88 (80%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            D + G F+V SDGSV+ +E DG+DYA VTVQLPGGERVPFLFT+K+    G    F G+F
Sbjct  143  DGMTGDFKVGSDGSVQIKENDGLDYAPVTVQLPGGERVPFLFTLKEFTGKGNTSQFGGDF  202

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            +VPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  203  VVPSYRGSSFLDPKGRGGSTGYDNAVAL  230


 Score = 89.7 bits (221),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 49/68 (72%), Gaps = 0/68 (0%)
 Frame = -2

Query  486  RGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKI  307
            R D EELQKEN K+ A+  G   F++    P TGE+ GVFES+QPSDTDLGAK PK+VKI
Sbjct  233  RADSEELQKENNKSAAALKGSAVFNIAKYDPATGEIAGVFESIQPSDTDLGAKVPKDVKI  292

Query  306  QGIWYAQL  283
             G+WY  +
Sbjct  293  TGLWYGNI  300



>ref|XP_007513615.1| predicted protein [Bathycoccus prasinos]
 emb|CCO16140.1| predicted protein [Bathycoccus prasinos]
Length=331

 Score =   128 bits (322),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 68/88 (77%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            D + G F+V SDGSV   EKDGIDYA  TVQL GGERVPFLFT+K+L A G    F G+F
Sbjct  173  DAMSGDFKVGSDGSVNVVEKDGIDYAPTTVQLAGGERVPFLFTLKELQAKGNTSQFGGDF  232

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            +V SYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  233  VVASYRGSSFLDPKGRGGSTGYDNAVAL  260


 Score = 91.7 bits (226),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = -2

Query  486  RGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKI  307
            R D ++LQKEN KNVA+  G   F+V      TGE+ GVFES+QPSDTDLG+KAPK+VKI
Sbjct  263  RSDADDLQKENNKNVAALKGSAVFNVAKYDETTGEIAGVFESIQPSDTDLGSKAPKDVKI  322

Query  306  QGIWYAQLE  280
             G+WY QL+
Sbjct  323  TGLWYMQLQ  331



>ref|XP_011400268.1| Oxygen-evolving enhancer protein 1, chloroplastic [Auxenochlorella 
protothecoides]
 gb|KFM27301.1| Oxygen-evolving enhancer protein 1, chloroplastic [Auxenochlorella 
protothecoides]
Length=303

 Score =   133 bits (335),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 64/88 (73%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEI G  ++   G V+F+E+DGIDYAAVTVQLPGGERVPFLFTIK+L A G  + F GEF
Sbjct  145  DEISGQMKIDGSGGVEFKEEDGIDYAAVTVQLPGGERVPFLFTIKELDAKGTADGFKGEF  204

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
             VPSYRGSSFLDPKGRG STGYDNAV  
Sbjct  205  TVPSYRGSSFLDPKGRGASTGYDNAVAL  232


 Score = 86.7 bits (213),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 49/67 (73%), Gaps = 0/67 (0%)
 Frame = -2

Query  483  GDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQ  304
            GD EEL+KEN K+  +  G+  FS+      TGEV G+FES+QPSDTDLGAK PKEVKI 
Sbjct  236  GDSEELEKENNKSTKALKGEAIFSIAKVDAGTGEVAGIFESIQPSDTDLGAKVPKEVKIT  295

Query  303  GIWYAQL  283
            G+WY QL
Sbjct  296  GLWYGQL  302



>ref|XP_001694699.1| oxygen-evolving enhancer protein 1 of photosystem II [Chlamydomonas 
reinhardtii]
 gb|EDP02283.1| oxygen-evolving enhancer protein 1 of photosystem II [Chlamydomonas 
reinhardtii]
Length=291

 Score =   129 bits (324),  Expect(2) = 5e-48, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 69/88 (78%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            D + G F+V SDGS + +E DGIDYAA TVQLPGGERV FLFTIKQ    G  ++  G+F
Sbjct  133  DAMSGSFKVGSDGSAELKEDDGIDYAATTVQLPGGERVAFLFTIKQFDGKGTLDNIKGDF  192

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  193  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  220


 Score = 89.7 bits (221),  Expect(2) = 5e-48, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = -2

Query  486  RGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKI  307
            R D EEL KEN+K   +  G   FSV    P TGE+ GVFES+QPSDTDLGAK PK++K+
Sbjct  223  RADAEELLKENVKITKALKGSAVFSVAKVDPVTGEIAGVFESIQPSDTDLGAKPPKDIKV  282

Query  306  QGIWYAQLE  280
             G+WYAQL+
Sbjct  283  TGLWYAQLK  291



>sp|P12853.1|PSBO_CHLRE RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; Flags: Precursor [Chlamydomonas reinhardtii]
 emb|CAA32053.1| OEE1 precursor protein [Chlamydomonas reinhardtii]
 prf||1807335A photosystem II OEE1 protein
Length=291

 Score =   128 bits (322),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 68/88 (77%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            D + G F+V SDGS + +E DGIDYAA TVQLPGGERV FLFTIKQ    G  +   G+F
Sbjct  133  DAMSGSFKVGSDGSAELKEDDGIDYAATTVQLPGGERVAFLFTIKQFDGKGTLDGIKGDF  192

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  193  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  220


 Score = 89.7 bits (221),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = -2

Query  486  RGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKI  307
            R D EEL KEN+K   +  G   FSV    P TGE+ GVFES+QPSDTDLGAK PK++K+
Sbjct  223  RADAEELLKENVKITKALKGSAVFSVAKVDPVTGEIAGVFESIQPSDTDLGAKPPKDIKV  282

Query  306  QGIWYAQLE  280
             G+WYAQL+
Sbjct  283  TGLWYAQLK  291



>gb|KIY97139.1| Oxygen-evolving enhancer protein 1 [Monoraphidium neglectum]
Length=289

 Score =   121 bits (303),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 70/88 (80%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            D + G F+V   G+V+ +E DGIDYA VTVQLPGGERVPFLF++KQ+ A G  ++F G+F
Sbjct  131  DGMTGTFKVDGSGNVELKEDDGIDYAPVTVQLPGGERVPFLFSVKQITAKGAADAFGGDF  190

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            +VPSYRGS+FLDPKGRG S GY++A+  
Sbjct  191  VVPSYRGSTFLDPKGRGASQGYESAIAL  218


 Score = 96.7 bits (239),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = -2

Query  480  DEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQG  301
            D+E + KEN+K+VA+S G   FSV    P TGE+ GVFES+QPSDTDLGAKAPK+VKI G
Sbjct  223  DDEFVLKENVKSVAASKGSAVFSVAKVDPSTGEIAGVFESVQPSDTDLGAKAPKDVKITG  282

Query  300  IWYAQLE  280
            +WYAQL+
Sbjct  283  LWYAQLQ  289



>gb|ADB07372.1| chloroplast managanese stabilizing protein [Capsicum annuum]
Length=281

 Score =   169 bits (428),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 81/88 (92%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVS DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKP+SFSG+F
Sbjct  161  DEIEGPFEVSPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPDSFSGDF  220

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            LVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  221  LVPSYRGSSFLDPKGRGGSTGYDNAVAL  248



>dbj|BAF94215.1| 33kDa oxygen evolving protein of photosystem II [Pyramimonas 
parkeae]
Length=303

 Score =   121 bits (303),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEI G   V + G V F E+DGIDYA VTVQLPGGERVPFLFT+K+L A G    F G+F
Sbjct  145  DEISGALTVGAAGDVTFVEEDGIDYAPVTVQLPGGERVPFLFTVKELNAKGNLSQFGGDF  204

Query  583  LVPSYRGSSFLDPKGRGGSTGYDN  512
             VPSYRG++FLDPKGRG +TGYDN
Sbjct  205  TVPSYRGATFLDPKGRGNATGYDN  228


 Score = 93.2 bits (230),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = -2

Query  474  EELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQGIW  295
            EEL KEN+KN A+  G   F+V    P+TGEV GVFES+QPSDTDLGAKAPK+VKI G+W
Sbjct  239  EELLKENVKNTAALKGSAVFNVAKFDPKTGEVAGVFESIQPSDTDLGAKAPKDVKITGLW  298

Query  294  YAQL  283
            YAQ+
Sbjct  299  YAQI  302



>ref|XP_002954867.1| subunit of oxygen evolving complex of photosystem II [Volvox 
carteri f. nagariensis]
 gb|EFJ44066.1| subunit of oxygen evolving complex of photosystem II [Volvox 
carteri f. nagariensis]
Length=297

 Score =   127 bits (318),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 69/88 (78%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            D + G  +V SDGS + +E+DGIDYAA TVQLPGGERV FLFTIKQ    G  ++  G+F
Sbjct  138  DAMSGTLKVGSDGSAELKEEDGIDYAATTVQLPGGERVAFLFTIKQFDGKGTLDNIKGDF  197

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            +VPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  198  VVPSYRGSSFLDPKGRGGSTGYDNAVAL  225


 Score = 87.0 bits (214),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 48/68 (71%), Gaps = 0/68 (0%)
 Frame = -2

Query  486  RGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKI  307
            R D EEL KEN+K+  +  G   FSV      TGE+ GVFES+QPSDTDLGAK PK++KI
Sbjct  228  RADAEELLKENVKSTKALKGSAVFSVAKVNTATGEIAGVFESIQPSDTDLGAKPPKDIKI  287

Query  306  QGIWYAQL  283
             G+WY QL
Sbjct  288  TGLWYGQL  295



>gb|AAP79149.1| photosystem II protein PsbO [Bigelowiella natans]
Length=327

 Score =   122 bits (306),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 69/88 (78%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            D + G  +V S G+++F+E+DGIDYA  TVQLPGG RVPFLFT+K+L A G   SFSG+F
Sbjct  166  DAMSGSMKVGSGGAIEFKEEDGIDYAPTTVQLPGGARVPFLFTVKELDAKGDVSSFSGDF  225

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
             VPSYRGS+FLDPKGRG +TGYD AV  
Sbjct  226  AVPSYRGSTFLDPKGRGAATGYDTAVAI  253


 Score = 91.3 bits (225),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GG GDE+ L KEN K++    GK   S+      TGEV GVF+S+QPSDTDLGAK PK++
Sbjct  256  GGAGDEDALGKENNKSIKPLAGKAQLSIAKYDAATGEVAGVFQSIQPSDTDLGAKVPKDI  315

Query  312  KIQGIWYAQLE  280
            KIQG+WYAQL+
Sbjct  316  KIQGLWYAQLQ  326



>sp|Q9SBN6.1|PSBO_VOLCA RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; Flags: Precursor [Volvox carteri]
 gb|AAD55562.1|AF110780_1 oxygen-evolving enhancer protein 1 precursor [Volvox carteri 
f. nagariensis]
Length=293

 Score =   126 bits (317),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 69/88 (78%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            D + G  +V SDGS + +E+DGIDYAA TVQLPGGERV FLFTIKQ    G  ++  G+F
Sbjct  134  DAMSGTLKVGSDGSAELKEEDGIDYAATTVQLPGGERVAFLFTIKQFDGKGTLDNIKGDF  193

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            +VPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  194  VVPSYRGSSFLDPKGRGGSTGYDNAVAL  221


 Score = 87.0 bits (214),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 48/68 (71%), Gaps = 0/68 (0%)
 Frame = -2

Query  486  RGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKI  307
            R D EEL KEN+K+  +  G   FSV      TGE+ GVFES+QPSDTDLGAK PK++KI
Sbjct  224  RADAEELLKENVKSTKALKGSAVFSVAKVNTATGEIAGVFESIQPSDTDLGAKPPKDIKI  283

Query  306  QGIWYAQL  283
             G+WY QL
Sbjct  284  TGLWYGQL  291



>gb|KJB43587.1| hypothetical protein B456_007G208000 [Gossypium raimondii]
Length=262

 Score =   123 bits (308),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GGRGDEEEL KEN K+ ASS+GKIT SVT SKPETGEVIGVFESLQPSDTDLGAK PK+V
Sbjct  191  GGRGDEEELAKENNKSAASSSGKITLSVTKSKPETGEVIGVFESLQPSDTDLGAKTPKDV  250

Query  312  KIQGIWYAQLE  280
            KI G+WYAQL+
Sbjct  251  KITGVWYAQLD  261


 Score = 90.1 bits (222),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = -1

Query  649  PFLFTIKQLVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            P  FT+KQLVA+GKP+SF G+FLVPSYRGSSFLDPKGRGGSTGYDNAV  
Sbjct  139  PTSFTVKQLVASGKPDSFGGDFLVPSYRGSSFLDPKGRGGSTGYDNAVAL  188



>gb|ACE98011.1| putative protein, partial [Populus tremula]
 gb|ACE98012.1| putative protein, partial [Populus tremula]
 gb|ACE98013.1| putative protein, partial [Populus tremula]
 gb|ACE98014.1| putative protein, partial [Populus tremula]
 gb|ACE98015.1| putative protein, partial [Populus tremula]
 gb|ACE98016.1| putative protein, partial [Populus tremula]
 gb|ACE98017.1| putative protein, partial [Populus tremula]
 gb|ACE98018.1| putative protein, partial [Populus tremula]
 gb|ACE98019.1| putative protein, partial [Populus tremula]
 gb|ACE98020.1| putative protein, partial [Populus tremula]
 gb|ACE98021.1| putative protein, partial [Populus tremula]
 gb|ACE98022.1| putative protein, partial [Populus tremula]
 gb|ACE98023.1| putative protein, partial [Populus tremula]
 gb|ACE98024.1| putative protein, partial [Populus tremula]
 gb|ACE98025.1| putative protein, partial [Populus tremula]
 gb|ACE98026.1| putative protein, partial [Populus tremula]
 gb|ACE98027.1| putative protein, partial [Populus tremula]
 gb|ACE98028.1| putative protein, partial [Populus tremula]
 gb|ACE98029.1| putative protein, partial [Populus tremula]
 gb|ACE98030.1| putative protein, partial [Populus tremula]
 gb|ACE98031.1| putative protein, partial [Populus tremula]
 gb|ACE98032.1| putative protein, partial [Populus tremula]
 gb|ACE98033.1| putative protein, partial [Populus tremula]
 gb|ACE98034.1| putative protein, partial [Populus tremula]
 gb|ACE98035.1| putative protein, partial [Populus tremula]
 gb|ACE98036.1| putative protein, partial [Populus tremula]
 gb|ACE98037.1| putative protein, partial [Populus tremula]
 gb|ACE98038.1| putative protein, partial [Populus tremula]
 gb|ACE98039.1| putative protein, partial [Populus tremula]
 gb|ACE98040.1| putative protein, partial [Populus tremula]
 gb|ACE98041.1| putative protein, partial [Populus tremula]
 gb|ACE98042.1| putative protein, partial [Populus tremula]
 gb|ACE98043.1| putative protein, partial [Populus tremula]
 gb|ACE98044.1| putative protein, partial [Populus tremula]
 gb|ACE98045.1| putative protein, partial [Populus tremula]
 gb|ACE98046.1| putative protein, partial [Populus tremula]
Length=170

 Score =   163 bits (413),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVS DG++KFEEKDGIDYAAVTVQLPGGERVPFLFT+KQL A+GKPESFSGEF
Sbjct  87   DEIEGPFEVSPDGTIKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQLTASGKPESFSGEF  146

Query  583  LVPSYRGSSFLDPKGRGGSTGYDN  512
            LVPSYRGSSFLDPKGRGGSTGYDN
Sbjct  147  LVPSYRGSSFLDPKGRGGSTGYDN  170



>gb|ABV57472.1| chloroplast PsbO [Phyllostachys edulis]
Length=160

 Score =   161 bits (407),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/86 (90%), Positives = 82/86 (95%), Gaps = 0/86 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGP EV +DG++KF EKDGIDYAAVTVQLPGGERVPFLFT+KQL+ATGKPESFSG F
Sbjct  74   DEIEGPLEVGADGTIKFVEKDGIDYAAVTVQLPGGERVPFLFTVKQLIATGKPESFSGSF  133

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAV  506
            LVPSYRGSSFLDPKGRGGSTGYDNAV
Sbjct  134  LVPSYRGSSFLDPKGRGGSTGYDNAV  159



>dbj|BAF94212.1| 33kDa oxygen evolving protein of photosystem II [Chlorarachnion 
reptans]
Length=328

 Score =   115 bits (287),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 66/88 (75%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            D + G  +V S G+++F E+DGID A  TVQLPGG RVPFLFT+K+L A G   +F G+F
Sbjct  166  DAMSGSMKVGSGGAIEFAEEDGIDNAPTTVQLPGGSRVPFLFTVKELNAKGDISAFGGDF  225

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
             VPSYRGS+FLDPKGRG +TGYD AV  
Sbjct  226  SVPSYRGSTFLDPKGRGAATGYDTAVAI  253


 Score = 94.7 bits (234),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            GG GDEE L KEN K++    GK   S+    P TGEV GVF+S+QPSDTDLGAK PK++
Sbjct  256  GGAGDEEALGKENNKSIKPLVGKAQLSIAKYDPATGEVAGVFQSVQPSDTDLGAKVPKDI  315

Query  312  KIQGIWYAQL  283
            K+QG+WYAQL
Sbjct  316  KVQGVWYAQL  325



>dbj|BAF94219.1| 33kDa oxygen evolving protein of photosystem II [Bryopsis plumosa]
Length=302

 Score =   120 bits (300),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 67/89 (75%), Gaps = 1/89 (1%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFE-EKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGE  587
            D + G   V SDGSV F+ + +GID+A  TVQLPGGERVPFLFT KQ    G  + FSG+
Sbjct  143  DGLSGKMTVGSDGSVDFKKDNEGIDFAPTTVQLPGGERVPFLFTFKQFAGKGTVDGFSGD  202

Query  586  FLVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
            F VPSYRGSSFLDPKGRGGSTGYD AVG 
Sbjct  203  FTVPSYRGSSFLDPKGRGGSTGYDTAVGL  231


 Score = 89.7 bits (221),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = -2

Query  486  RGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKI  307
            +GD EEL KENIK+ A+  G   FSV      TGEV G+FES+QPSDTDLGAK PK+VKI
Sbjct  234  KGDAEELLKENIKSTAALKGSAVFSVAKVDSGTGEVAGIFESVQPSDTDLGAKVPKDVKI  293

Query  306  QGIWYAQL  283
             G+WY Q+
Sbjct  294  TGVWYGQI  301



>dbj|BAA03529.2| oxygen-evolving enhancer protein 1 precursor [Euglena gracilis]
Length=384

 Score =   118 bits (295),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 64/88 (73%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            D I     V  DGS   +EKDG+DYAA TVQL GGERVPFLFTIK L+A G    F G+F
Sbjct  223  DAISADLNVGGDGSWTIQEKDGLDYAATTVQLAGGERVPFLFTIKNLLAKGDAGQFLGQF  282

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
             VPSYRG++FLDPKGRGG++GYD AV  
Sbjct  283  DVPSYRGATFLDPKGRGGASGYDTAVAL  310


 Score = 91.7 bits (226),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = -2

Query  483  GDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQ  304
            GD+EE  KEN K+ A+S G I F V     ETGE+ GVFES+QPSDTDLGAK PK++K  
Sbjct  314  GDDEEYAKENSKSTAASVGTIAFKVAKVNAETGEIAGVFESIQPSDTDLGAKVPKDIKTS  373

Query  303  GIWYAQL  283
            G+WYAQ+
Sbjct  374  GVWYAQI  380



>sp|P46483.2|PSBO_EUGGR RecName: Full=Oxygen-evolving enhancer protein 1, chloroplastic; 
Short=OEE1; Flags: Precursor [Euglena gracilis]
Length=338

 Score =   117 bits (294),  Expect(2) = 7e-45, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 64/88 (73%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            D I     V  DGS   +EKDG+DYAA TVQL GGERVPFLFTIK L+A G    F G+F
Sbjct  177  DAISADLNVGGDGSWTIQEKDGLDYAATTVQLAGGERVPFLFTIKNLLAKGDAGQFLGQF  236

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
             VPSYRG++FLDPKGRGG++GYD AV  
Sbjct  237  DVPSYRGATFLDPKGRGGASGYDTAVAL  264


 Score = 90.9 bits (224),  Expect(2) = 7e-45, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = -2

Query  483  GDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQ  304
            GD+EE  KEN K+ A+S G I F V     ETGE+ GVFES+QPSDTDLGAK PK++K  
Sbjct  268  GDDEEYAKENSKSTAASVGTIAFKVAKVNAETGEIAGVFESIQPSDTDLGAKVPKDIKTS  327

Query  303  GIWYAQL  283
            G+WYAQ+
Sbjct  328  GVWYAQI  334



>dbj|BAF94211.1| 33kDa oxygen evolving protein of photosystem II [Eutreptiella 
gymnastica]
Length=346

 Score =   115 bits (288),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 63/88 (72%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            D I     V  DGS K +E DGIDYAA TVQL GGERVPFLFT+K L A+G    F G+F
Sbjct  186  DGIRADLAVGGDGSWKIKEIDGIDYAATTVQLAGGERVPFLFTVKNLAASGDAGQFLGQF  245

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
             V SYRG++FLDPKGRG +TGYDNAV  
Sbjct  246  DVASYRGATFLDPKGRGAATGYDNAVAL  273


 Score = 91.3 bits (225),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = -2

Query  480  DEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQG  301
            D EEL KEN KN+A S G I F V     ETGEV GVFES+QPSDTDLG+K PK++K  G
Sbjct  278  DTEELAKENTKNIAGSVGTIAFKVAKVNTETGEVAGVFESIQPSDTDLGSKVPKDIKTAG  337

Query  300  IWYAQL  283
            +WY Q+
Sbjct  338  VWYGQI  343



>emb|CCC15104.1| 33kDa oxygen evolving protein of photosystem II [Lepidodinium 
chlorophorum]
Length=341

 Score =   129 bits (325),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 70/88 (80%), Gaps = 0/88 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            D+I G  ++ SDG V FEE+DGIDYA  T+QLPGGERV FLFT+KQL A+G   + +GEF
Sbjct  196  DDISGKLKLGSDGKVTFEEEDGIDYAPTTIQLPGGERVAFLFTVKQLRASGSLSNLAGEF  255

Query  583  LVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
             VPSYRGSSFLDPKGRGGSTGYD AV  
Sbjct  256  NVPSYRGSSFLDPKGRGGSTGYDTAVAL  283


 Score = 71.2 bits (173),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = -2

Query  486  RGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPK  319
            RGD+E L KEN KN A+  G I  S     P TGE+ GVF+S+QPSDTDLGAK+PK
Sbjct  286  RGDDEGLAKENSKNTAALKGSIVLSAAKVDPATGEIAGVFQSIQPSDTDLGAKSPK  341



>ref|WP_026721744.1| Photosystem II manganese-stabilizing polypeptide [Fischerella 
sp. PCC 9431]
Length=277

 Score =   119 bits (298),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 60/96 (63%), Positives = 69/96 (72%), Gaps = 8/96 (8%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKP-------  605
            D+IEG   V+SDGS+ F EKDG D+ A TVQLPGGERVPFLFTIK LVA  +P       
Sbjct  107  DQIEGDLNVNSDGSLTFVEKDGFDFQATTVQLPGGERVPFLFTIKGLVAQSQPGMTSINT  166

Query  604  -ESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
               F G F VPSYRG++FLDPKGRG ++GYDNAV  
Sbjct  167  STDFEGSFRVPSYRGATFLDPKGRGVASGYDNAVAL  202


 Score = 77.8 bits (190),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 48/67 (72%), Gaps = 0/67 (0%)
 Frame = -2

Query  480  DEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQG  301
            D+EEL + N+K V    GKI+ SV      TGE+ G FES QPSDTDLGA  PK+VK++G
Sbjct  207  DDEELLRANVKRVDVLNGKISLSVAKVDSSTGEIAGTFESDQPSDTDLGAGEPKDVKVRG  266

Query  300  IWYAQLE  280
            I+YA+LE
Sbjct  267  IFYARLE  273



>ref|WP_016865127.1| Photosystem II manganese-stabilizing polypeptide [Fischerella 
muscicola]
Length=277

 Score =   116 bits (291),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 69/96 (72%), Gaps = 8/96 (8%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKP-------  605
            D+IEG  +V+ DGS+ F EKDG D+ A TVQLPGGERVPFLFTIK LVA  +P       
Sbjct  107  DQIEGDLKVNPDGSLTFVEKDGFDFQATTVQLPGGERVPFLFTIKGLVAQSQPGMTSINT  166

Query  604  -ESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
               F G F VPSYRG++FLDPKGRG +TGYD+AV  
Sbjct  167  STDFEGTFRVPSYRGATFLDPKGRGVATGYDSAVAL  202


 Score = 77.4 bits (189),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = -2

Query  486  RGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKI  307
            + D+EEL + N+K      GKI+ SV      TGE+ G FES QPSDTDLGA  PKEVK+
Sbjct  205  QSDDEELLRANVKRADVLNGKISLSVAKVDSSTGEIAGTFESEQPSDTDLGAGEPKEVKV  264

Query  306  QGIWYAQLE  280
            +GI+YA+LE
Sbjct  265  RGIFYARLE  273



>ref|WP_017720228.1| Photosystem II manganese-stabilizing polypeptide [Oscillatoria 
sp. PCC 10802]
Length=274

 Score =   122 bits (305),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 71/94 (76%), Gaps = 8/94 (9%)
 Frame = -1

Query  760  EIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKP--------  605
            +I+G  +  SDG++ FEEKDGID+ A+TVQLPGGE VPFLFTIK LVAT +P        
Sbjct  106  QIQGALKFGSDGTLTFEEKDGIDFQAITVQLPGGEGVPFLFTIKNLVATSQPGLTEINTS  165

Query  604  ESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVG  503
              F G+F VPSYRGSSFLDPKGRG +TGYDNAV 
Sbjct  166  TDFEGQFKVPSYRGSSFLDPKGRGEATGYDNAVA  199


 Score = 71.6 bits (174),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 47/67 (70%), Gaps = 0/67 (0%)
 Frame = -2

Query  480  DEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQG  301
            D EEL + N+K    S GKI+  ++     TGE+ G+FES QPSDTDLGA+ P EVKI+G
Sbjct  205  DREELIRANVKRAEVSKGKISLQISKVDSSTGEIAGIFESEQPSDTDLGAQEPLEVKIRG  264

Query  300  IWYAQLE  280
            ++Y +++
Sbjct  265  VFYGRVQ  271



>ref|WP_026733494.1| Photosystem II manganese-stabilizing polypeptide [Fischerella 
sp. PCC 9605]
Length=276

 Score =   118 bits (295),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 70/96 (73%), Gaps = 8/96 (8%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKP-------  605
            D+I+G  +++SDGS+ F EKDG D+ A TVQLPGGERVPFLFTIK LVA  +P       
Sbjct  106  DQIQGDLKINSDGSLTFVEKDGFDFQASTVQLPGGERVPFLFTIKGLVAQSQPGMTSINT  165

Query  604  -ESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
               F G F VPSYRG++FLDPKGRG +TGYDNAV  
Sbjct  166  STDFEGAFRVPSYRGATFLDPKGRGVATGYDNAVAL  201


 Score = 75.1 bits (183),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 47/67 (70%), Gaps = 0/67 (0%)
 Frame = -2

Query  480  DEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQG  301
            D+EEL + N+K      GKI+ SV      TGE+ G FES QPSDTDLGA  PK+VKI+G
Sbjct  206  DDEELTRANVKRTDILNGKISLSVAKVDSATGEIAGTFESEQPSDTDLGAGEPKDVKIRG  265

Query  300  IWYAQLE  280
            I+YA++E
Sbjct  266  IFYARVE  272



>ref|WP_016860504.1| Photosystem II manganese-stabilizing polypeptide [Fischerella 
muscicola]
Length=277

 Score =   118 bits (296),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 70/96 (73%), Gaps = 8/96 (8%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKP-------  605
            D+IEG  +++SDGS+ F EKDG D+ A TVQLPGGERVPFLFT+K LVA  +P       
Sbjct  107  DQIEGDLKINSDGSLTFVEKDGFDFQATTVQLPGGERVPFLFTVKGLVAQSQPGMTSINT  166

Query  604  -ESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
               F G F VPSYRG++FLDPKGRG ++GYDNAV  
Sbjct  167  STDFEGAFRVPSYRGATFLDPKGRGVASGYDNAVAL  202


 Score = 74.7 bits (182),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = -2

Query  486  RGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKI  307
            + D+EEL + N+K      GKI+ SV      +GE+ G FES QPSDTDLGA  PK+VK+
Sbjct  205  QSDDEELLRANVKRADVLNGKISLSVAKVDSSSGEIAGTFESDQPSDTDLGAGEPKDVKV  264

Query  306  QGIWYAQLE  280
            +GI+YA+LE
Sbjct  265  RGIFYARLE  273



>gb|AFW90569.1| chloroplast manganese stabilizing protein-II [Solanum tuberosum]
Length=293

 Score =   151 bits (381),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 73/77 (95%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGPFEVS DG+VKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA+GKPESFSG+F
Sbjct  161  DEIEGPFEVSPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFSGDF  220

Query  583  LVPSYRGSSFLDPKGRG  533
            LVPSYRGSSFLDPKGRG
Sbjct  221  LVPSYRGSSFLDPKGRG  237



>ref|WP_017310215.1| Photosystem II manganese-stabilizing polypeptide [Fischerella 
sp. PCC 9339]
Length=277

 Score =   115 bits (289),  Expect(2) = 6e-40, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 69/96 (72%), Gaps = 8/96 (8%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKP-------  605
            D+IEG  +++SDGS+ F EKDG D+ A TVQL GGERVPFLFTIK LVA  +P       
Sbjct  107  DQIEGDLKINSDGSLTFVEKDGFDFQATTVQLAGGERVPFLFTIKGLVAQSQPGMTSINT  166

Query  604  -ESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
               F G F VPSYRG++FLDPKGRG ++GYDNAV  
Sbjct  167  STDFEGAFRVPSYRGATFLDPKGRGVASGYDNAVAL  202


 Score = 76.3 bits (186),  Expect(2) = 6e-40, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = -2

Query  486  RGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKI  307
            + D+EEL + N+K      GKI+ SV      TGE+ G FES QPSDTDLGA  PK+VK+
Sbjct  205  QSDDEELLRANVKRADVLNGKISLSVAKVDSSTGEIAGTFESDQPSDTDLGAGEPKDVKV  264

Query  306  QGIWYAQLE  280
            +GI+YA+LE
Sbjct  265  RGIFYARLE  273



>ref|WP_009456798.1| MULTISPECIES: photosystem II manganese-stabilizing protein PsbO 
[Fischerella]
 gb|EHC13949.1| photosystem II manganese-stabilizing protein PsbO [Fischerella 
sp. JSC-11]
Length=277

 Score =   114 bits (286),  Expect(2) = 6e-40, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 68/96 (71%), Gaps = 8/96 (8%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKP-------  605
            D+IEG  +++ DGS+ F EKDG D+   TVQLPGGERVPFLFTIK LVA  +P       
Sbjct  107  DQIEGDLKINPDGSLTFVEKDGFDFQPTTVQLPGGERVPFLFTIKGLVAQSQPGMTSINT  166

Query  604  -ESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
               F G F VPSYRG++FLDPKGRG ++GYDNAV  
Sbjct  167  STDFEGTFRVPSYRGATFLDPKGRGVASGYDNAVAL  202


 Score = 77.8 bits (190),  Expect(2) = 6e-40, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 47/67 (70%), Gaps = 0/67 (0%)
 Frame = -2

Query  480  DEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQG  301
            D+EEL + N+K      GKI+ SV      TGE+ G FES QPSDTDLGA  PKEVK++G
Sbjct  207  DDEELLRANVKRADVMNGKISLSVAKVDSSTGEIAGTFESEQPSDTDLGAGEPKEVKVRG  266

Query  300  IWYAQLE  280
            I+YA+LE
Sbjct  267  IFYARLE  273



>ref|WP_012411115.1| photosystem II manganese-stabilizing protein PsbO [Nostoc punctiforme]
 gb|ACC83159.1| photosystem II manganese-stabilizing protein PsbO [Nostoc punctiforme 
PCC 73102]
Length=277

 Score =   119 bits (298),  Expect(2) = 9e-40, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 70/96 (73%), Gaps = 8/96 (8%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPE------  602
            D+++G  +++SD S+ FEE DG+D+ A+TVQLPGGERVPFLFTIK LVA  +P       
Sbjct  107  DQVQGNLKINSDNSLTFEETDGLDFQAITVQLPGGERVPFLFTIKNLVAQTQPSLSSINT  166

Query  601  --SFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
               F G F VPSYRG++FLDPKGRG  +GYDNAV  
Sbjct  167  STDFEGTFKVPSYRGAAFLDPKGRGVVSGYDNAVAL  202


 Score = 72.4 bits (176),  Expect(2) = 9e-40, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 48/70 (69%), Gaps = 0/70 (0%)
 Frame = -2

Query  489  GRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVK  310
             + D+EEL + N+K   +  GKI+  +      +GE+ G FES QPSDTDLGA  PKEVK
Sbjct  204  AQADDEELTRTNVKRAENLNGKISLQIAKVDSSSGEIAGTFESEQPSDTDLGAGEPKEVK  263

Query  309  IQGIWYAQLE  280
            I+G+++A++E
Sbjct  264  IRGLFFARVE  273



>ref|WP_015117115.1| Manganese-stabilising protein / photosystem II polypeptide [Rivularia 
sp. PCC 7116]
 gb|AFY53537.1| Manganese-stabilising protein / photosystem II polypeptide [Rivularia 
sp. PCC 7116]
Length=279

 Score =   120 bits (302),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 73/96 (76%), Gaps = 8/96 (8%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPE------  602
            D+I+G  +V+ DGS+ FEEKDG D+ A+TVQLPGGE+VPFLFT+K LVA  +P+      
Sbjct  110  DQIQGDLKVNQDGSLTFEEKDGFDFQAITVQLPGGEQVPFLFTVKDLVAQTQPDLTSINT  169

Query  601  --SFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
               F G+F VPSYRG++FLDPKGRG ++GYDNAV  
Sbjct  170  STDFEGDFKVPSYRGATFLDPKGRGVASGYDNAVAL  205


 Score = 69.3 bits (168),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = -2

Query  486  RGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKI  307
            + D EEL++ N+K V S  G I+ +V     ETGE+ G F S QPSDTDLGA    +VK+
Sbjct  208  QADSEELRRANVKRVESGNGHISLNVAKVDSETGEIAGTFVSDQPSDTDLGAGEALDVKV  267

Query  306  QGIWYAQLE  280
            +G++YA++E
Sbjct  268  RGLFYARVE  276



>ref|WP_009768009.1| Manganese-stabilising protein / photosystem II polypeptide [Oscillatoriales 
cyanobacterium JSC-12]
 gb|EKQ68898.1| Manganese-stabilising protein / photosystem II polypeptide [Oscillatoriales 
cyanobacterium JSC-12]
Length=274

 Score =   121 bits (304),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 73/96 (76%), Gaps = 8/96 (8%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKP-------  605
            DE++G  +++ DGS+ F E+DG+D+ A+TVQLPGGERVPFLFTIK+LVAT +P       
Sbjct  105  DEVQGQLKLNPDGSLTFIEEDGLDFQAITVQLPGGERVPFLFTIKELVATTQPGLSAINA  164

Query  604  -ESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
               F GEF VPSYR ++FLDPKGRG +TGYDNAV  
Sbjct  165  STDFEGEFKVPSYRTANFLDPKGRGLTTGYDNAVAL  200


 Score = 68.6 bits (166),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 46/70 (66%), Gaps = 0/70 (0%)
 Frame = -2

Query  489  GRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVK  310
             + D EEL KEN+K      GKI+  VT     TGE+ G FES QPS+TD+G+   KEVK
Sbjct  202  AQADSEELVKENVKRFQLDKGKISLQVTRVDGSTGEIAGNFESNQPSETDMGSHEAKEVK  261

Query  309  IQGIWYAQLE  280
            I+G++Y ++E
Sbjct  262  IRGVFYGRVE  271



>ref|WP_015115272.1| photosystem II manganese-stabilizing protein PsbO [Nostoc sp. 
PCC 7107]
 gb|AFY45079.1| photosystem II manganese-stabilizing protein PsbO [Nostoc sp. 
PCC 7107]
Length=277

 Score =   117 bits (294),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 71/96 (74%), Gaps = 8/96 (8%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGK--------  608
            D+++GP + +SDGS+ F E+DG+D+ A+TVQLPGGERVPFLFTIK LVA  +        
Sbjct  107  DQVQGPLKFNSDGSLTFVEEDGLDFQAITVQLPGGERVPFLFTIKDLVAQTQSGLTSINT  166

Query  607  PESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
               F GEF VPSYRG++FLDPKGRG  +GYDNAV  
Sbjct  167  STDFEGEFKVPSYRGAAFLDPKGRGIVSGYDNAVAL  202


 Score = 72.0 bits (175),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = -2

Query  489  GRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVK  310
             + D+EEL + N+K      GKI+  V      +GE+ G FES QPSDTDLGA  PKEVK
Sbjct  204  AQADDEELTRANVKRAEILKGKISLQVAKIDNSSGEIAGTFESEQPSDTDLGAGEPKEVK  263

Query  309  IQGIWYAQLE  280
            I+G++YA++E
Sbjct  264  IRGLFYARVE  273



>ref|WP_037222014.1| Photosystem II manganese-stabilizing protein (PsbO) [Richelia 
intracellularis]
 emb|CDN14735.1| Photosystem II manganese-stabilizing protein (PsbO) [Richelia 
intracellularis]
Length=280

 Score =   113 bits (283),  Expect(2) = 9e-39, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 67/94 (71%), Gaps = 8/94 (9%)
 Frame = -1

Query  757  IEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPE--------  602
            IEGP  ++ D S+ FEEKDG+D+ A+TV LPGGE +PFLFTIK LVA  +P+        
Sbjct  112  IEGPLNINQDKSLTFEEKDGLDFQAITVGLPGGESIPFLFTIKGLVAQTQPDITSINTST  171

Query  601  SFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
               G F VPSYRG++FLDPKGRG ++GYDNAV  
Sbjct  172  DLKGSFRVPSYRGATFLDPKGRGVASGYDNAVAL  205


 Score = 74.7 bits (182),  Expect(2) = 9e-39, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 48/68 (71%), Gaps = 0/68 (0%)
 Frame = -2

Query  483  GDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQ  304
             D+ EL + N+K+ +   G I+ SV      TGE+ G FES+QPSDTDLGA  P+EVKI+
Sbjct  209  ADDTELARANVKSFSVLDGNISMSVAKVDSSTGEIAGTFESIQPSDTDLGADEPEEVKIR  268

Query  303  GIWYAQLE  280
            G++YA++E
Sbjct  269  GLFYARIE  276



>ref|XP_005652213.1| 33kDa oxygen evolving protein of photosystem II, partial [Coccomyxa 
subellipsoidea C-169]
 gb|EIE27669.1| 33kDa oxygen evolving protein of photosystem II, partial [Coccomyxa 
subellipsoidea C-169]
Length=270

 Score = 95.5 bits (236),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 65/105 (62%), Gaps = 21/105 (20%)
 Frame = -1

Query  760  EIEGPFEVSSDGSVKFEEKDG--IDYAAVTVQLPGGERVPFLFTIK--------------  629
            +IE   +V  +G+V  +E D   ++ A +TVQLPGGERVPFLFTIK              
Sbjct  92   DIEADLKVGPNGAVVLKESDSYSLNLAPITVQLPGGERVPFLFTIKARPHHNTFGYYSSS  151

Query  628  -----QLVATGKPESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNA  509
                 +L A+G   SF G+  VPSYRGS+FLDPKGRGGSTGYD A
Sbjct  152  SHMPLELEASGDLSSFGGQIRVPSYRGSTFLDPKGRGGSTGYDTA  196


 Score = 92.8 bits (229),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -2

Query  486  RGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKI  307
            R D+E L+ EN+K   S  G++ FSV    P TGEV GVFES+QPSDTD+GAK PK+VK+
Sbjct  202  RADDEALESENLKKFDSGIGQVVFSVAKVDPGTGEVAGVFESVQPSDTDMGAKVPKQVKV  261

Query  306  QGIWYAQL  283
            QG+WY QL
Sbjct  262  QGLWYGQL  269



>emb|CAA33560.1| manganese-stabilzing protein (MSP) precursor [Nostoc sp. PCC 
7120]
Length=273

 Score =   114 bits (286),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 67/96 (70%), Gaps = 8/96 (8%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKP-------  605
            D++ G  + + D S+ F EKDG+D+ A+TVQLPGGERVPFLFTIK LVA  +P       
Sbjct  107  DQVSGDLKFNDDSSLTFVEKDGLDFQAITVQLPGGERVPFLFTIKNLVAQTQPGLSSLNT  166

Query  604  -ESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
               F G F VPSYRGS+FLDPKGRG  +GYDNAV  
Sbjct  167  STDFEGTFKVPSYRGSAFLDPKGRGVVSGYDNAVAL  202


 Score = 73.6 bits (179),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = -2

Query  489  GRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVK  310
             + D+E+L + N+K      GKI+  +      +GE+ G FES QPSDTDLGA  PKEVK
Sbjct  204  AQADDEDLTRTNVKRAEILNGKISLQIAKVDSSSGEIAGTFESEQPSDTDLGADEPKEVK  263

Query  309  IQGIWYAQLE  280
            I+GI+YA++E
Sbjct  264  IRGIFYARVE  273



>ref|WP_008233010.1| Photosystem II manganese-stabilizing protein (PsbO) [Richelia 
intracellularis]
 emb|CCH66961.1| Photosystem II manganese-stabilizing protein (PsbO) [Richelia 
intracellularis HH01]
Length=280

 Score =   115 bits (288),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 70/95 (74%), Gaps = 8/95 (8%)
 Frame = -1

Query  760  EIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPE-------  602
             IEGP  ++S+ S+ F+EKDG+D+ A+TV+LPGGE +PFLFT+K LVA  +P+       
Sbjct  111  NIEGPLNINSNRSLTFKEKDGLDFQAITVKLPGGESIPFLFTVKGLVAETQPDITNINTS  170

Query  601  -SFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
              F G F VPSYRG++FLDPKGRG +TGYDNAV  
Sbjct  171  TDFKGSFRVPSYRGATFLDPKGRGVATGYDNAVAL  205


 Score = 72.4 bits (176),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 47/68 (69%), Gaps = 0/68 (0%)
 Frame = -2

Query  483  GDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQ  304
             D+ +L + N+K+ +   G I+ SV      TGE+ G FES+QPSDTDLGA  P+EVKI+
Sbjct  209  ADDTDLNRANVKSFSVLDGSISLSVAKVDGSTGEIAGTFESIQPSDTDLGADEPEEVKIR  268

Query  303  GIWYAQLE  280
            G++YA +E
Sbjct  269  GLFYALIE  276



>ref|WP_044259457.1| Photosystem II manganese-stabilizing protein (PsbO), partial 
[Richelia intracellularis]
Length=217

 Score =   115 bits (287),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 70/94 (74%), Gaps = 8/94 (9%)
 Frame = -1

Query  757  IEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPE--------  602
            IEGP  ++S+ S+ F+EKDG+D+ A+TV+LPGGE +PFLFT+K LVA  +P+        
Sbjct  49   IEGPLNINSNRSLTFKEKDGLDFQAITVKLPGGESIPFLFTVKGLVAETQPDVTNINTST  108

Query  601  SFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
             F G F VPSYRG++FLDPKGRG +TGYDNAV  
Sbjct  109  DFKGSFRVPSYRGATFLDPKGRGVATGYDNAVAL  142


 Score = 72.4 bits (176),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 47/68 (69%), Gaps = 0/68 (0%)
 Frame = -2

Query  483  GDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQ  304
             D+ +L + N+K+ +   G I+ SV      TGE+ G FES+QPSDTDLGA  P+EVKI+
Sbjct  146  ADDTDLNRANVKSFSVLDGNISLSVAKVDGSTGEIAGTFESIQPSDTDLGADEPEEVKIR  205

Query  303  GIWYAQLE  280
            G++YA +E
Sbjct  206  GLFYALIE  213



>gb|ACT83791.1| putative photosystem II oxygen evolving system 33 kDa subunit 
[Lemna minor]
Length=151

 Score =   143 bits (360),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/81 (86%), Positives = 73/81 (90%), Gaps = 0/81 (0%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPESFSGEF  584
            DEIEGP EVSSDG++KFEEKDGIDYAAVTVQLPGGERVPFLFT+KQLVATG P  F G F
Sbjct  68   DEIEGPLEVSSDGTIKFEEKDGIDYAAVTVQLPGGERVPFLFTVKQLVATGTPGKFGGSF  127

Query  583  LVPSYRGSSFLDPKGRGGSTG  521
            LVPSYRGSSFLDPKGRGG  G
Sbjct  128  LVPSYRGSSFLDPKGRGGPKG  148



>emb|CCH65457.1| Photosystem II manganese-stabilizing protein (PsbO) [Richelia 
intracellularis HM01]
Length=209

 Score =   115 bits (287),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 70/94 (74%), Gaps = 8/94 (9%)
 Frame = -1

Query  757  IEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPE--------  602
            IEGP  ++S+ S+ F+EKDG+D+ A+TV+LPGGE +PFLFT+K LVA  +P+        
Sbjct  41   IEGPLNINSNRSLTFKEKDGLDFQAITVKLPGGESIPFLFTVKGLVAETQPDVTNINTST  100

Query  601  SFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
             F G F VPSYRG++FLDPKGRG +TGYDNAV  
Sbjct  101  DFKGSFRVPSYRGATFLDPKGRGVATGYDNAVAL  134


 Score = 72.4 bits (176),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 47/68 (69%), Gaps = 0/68 (0%)
 Frame = -2

Query  483  GDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQ  304
             D+ +L + N+K+ +   G I+ SV      TGE+ G FES+QPSDTDLGA  P+EVKI+
Sbjct  138  ADDTDLNRANVKSFSVLDGNISLSVAKVDGSTGEIAGTFESIQPSDTDLGADEPEEVKIR  197

Query  303  GIWYAQLE  280
            G++YA +E
Sbjct  198  GLFYALIE  205



>ref|WP_015209602.1| Manganese-stabilising protein / photosystem II polypeptide [Cylindrospermum 
stagnale]
 gb|AFZ26360.1| Manganese-stabilising protein / photosystem II polypeptide [Cylindrospermum 
stagnale PCC 7417]
Length=277

 Score =   114 bits (284),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 68/96 (71%), Gaps = 8/96 (8%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPE------  602
            D+++G  +++ D S+ F E DG+D+ A+TVQLPGGERVPFLFTIK LVA  +P       
Sbjct  107  DQVQGNLKINPDNSLTFVETDGLDFQAITVQLPGGERVPFLFTIKNLVAQTQPSLTSINT  166

Query  601  --SFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
               F G F VPSYRG++FLDPKGRG  +GYDNAV  
Sbjct  167  STDFEGTFKVPSYRGAAFLDPKGRGVVSGYDNAVAL  202


 Score = 73.2 bits (178),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 48/70 (69%), Gaps = 0/70 (0%)
 Frame = -2

Query  489  GRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVK  310
             + D+EEL + N+K     +GKI+  V      +GE+ G FES QPSDTDLGA  PKEVK
Sbjct  204  AQADDEELTRTNVKRAEILSGKISLQVAKVDNSSGEIAGTFESEQPSDTDLGAGEPKEVK  263

Query  309  IQGIWYAQLE  280
            I+G++YA++E
Sbjct  264  IRGLFYARVE  273



>ref|WP_040939353.1| Photosystem II manganese-stabilizing polypeptide [Prochloron 
didemni]
Length=277

 Score =   116 bits (290),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 69/96 (72%), Gaps = 8/96 (8%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKP-------  605
            D++ G  +V+ DGS+ F E+DGID+ A+TVQ+PGGE+ PF FTIK LVAT KP       
Sbjct  108  DQVSGSIKVNEDGSLTFLEEDGIDFQAITVQVPGGEQTPFFFTIKNLVATTKPGQDKIDS  167

Query  604  -ESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
               F GEF VPSYRG+ FLDPKGRG +TGY+NAV  
Sbjct  168  STDFEGEFKVPSYRGAGFLDPKGRGAATGYENAVAL  203


 Score = 70.1 bits (170),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 46/67 (69%), Gaps = 0/67 (0%)
 Frame = -2

Query  480  DEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQG  301
            D +E  + N+K + +  G I+  +T     TGE+ GVFES QPSDTDLGA  P+EVKI+G
Sbjct  208  DRDEYARSNMKQIDTGKGNISLQITKVDGTTGEIAGVFESEQPSDTDLGADEPEEVKIKG  267

Query  300  IWYAQLE  280
            I+Y +++
Sbjct  268  IFYGRIQ  274



>ref|WP_010997995.1| manganese-stabilzing protein [Nostoc sp. PCC 7120]
 sp|P13907.2|PSBO_NOSS1 RecName: Full=Photosystem II manganese-stabilizing polypeptide; 
Short=MSP; Flags: Precursor [Nostoc sp. PCC 7120]
 dbj|BAB75553.1| manganese-stabilzing protein precursor [Nostoc sp. PCC 7120]
Length=273

 Score =   113 bits (282),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 67/96 (70%), Gaps = 8/96 (8%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKP-------  605
            D++ G  + + D S+ F EKDG+D+ A+TVQLPGGERVPFLFTIK LVA  +P       
Sbjct  107  DQVSGDLKFNDDSSLTFVEKDGLDFQAITVQLPGGERVPFLFTIKNLVAQTQPGLSSLNT  166

Query  604  -ESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
               F G F VPSYRG++FLDPKGRG  +GYDNAV  
Sbjct  167  STDFEGTFKVPSYRGAAFLDPKGRGVVSGYDNAVAL  202


 Score = 73.2 bits (178),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = -2

Query  489  GRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVK  310
             + D+E+L + N+K      GKI+  +      +GE+ G FES QPSDTDLGA  PKEVK
Sbjct  204  AQADDEDLTRTNVKRAEILNGKISLQIAKVDSSSGEIAGTFESEQPSDTDLGADEPKEVK  263

Query  309  IQGIWYAQLE  280
            I+GI+YA++E
Sbjct  264  IRGIFYARVE  273



>ref|WP_011318645.1| photosystem II manganese-stabilizing protein PsbO [Anabaena variabilis]
 gb|ABA21465.1| Photosystem II manganese-stabilizing protein PsbO [Anabaena variabilis 
ATCC 29413]
Length=273

 Score =   113 bits (282),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 67/96 (70%), Gaps = 8/96 (8%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKP-------  605
            D++ G  + + D S+ F EKDG+D+ A+TVQLPGGERVPFLFTIK LVA  +P       
Sbjct  107  DQVSGDLKFNDDSSLTFVEKDGLDFQAITVQLPGGERVPFLFTIKNLVAQTQPGLSSLNT  166

Query  604  -ESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
               F G F VPSYRG++FLDPKGRG  +GYDNAV  
Sbjct  167  STDFEGTFKVPSYRGAAFLDPKGRGVVSGYDNAVAL  202


 Score = 73.2 bits (178),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = -2

Query  489  GRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVK  310
             + D+E+L + N+K      GKI+  +      +GE+ G FES QPSDTDLGA  PKEVK
Sbjct  204  AQADDEDLTRTNVKRAEILNGKISLQIAKVDSSSGEIAGTFESEQPSDTDLGADEPKEVK  263

Query  309  IQGIWYAQLE  280
            I+GI+YA++E
Sbjct  264  IRGIFYARVE  273



>ref|WP_019494816.1| Photosystem II manganese-stabilizing polypeptide [Calothrix sp. 
PCC 7103]
Length=276

 Score =   111 bits (278),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 68/96 (71%), Gaps = 8/96 (8%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPE------  602
            D+I+G   V+ DGS+ F EKDG D+ A TV+LPGGE +PFLFT+K LVAT +P       
Sbjct  107  DQIQGDVNVNPDGSLTFIEKDGFDFQATTVKLPGGELIPFLFTVKGLVATTQPNLTSINT  166

Query  601  --SFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
               F G F VPSYRG++FLDPKGRG ++GYDNAV  
Sbjct  167  STDFEGSFRVPSYRGATFLDPKGRGVASGYDNAVAL  202


 Score = 74.7 bits (182),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = -2

Query  486  RGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKI  307
            R D EEL +EN+K      G ++ SV      +GE+ G FES+QPSDTDLG+  PKEVKI
Sbjct  205  RSDAEELTRENVKRAQVLEGNVSLSVAKINSASGEIAGTFESIQPSDTDLGSGDPKEVKI  264

Query  306  QGIWYAQLE  280
            +GI+Y ++E
Sbjct  265  RGIFYGRIE  273



>ref|WP_015127963.1| photosystem II manganese-stabilizing protein PsbO [Calothrix 
sp. PCC 7507]
 gb|AFY32146.1| photosystem II manganese-stabilizing protein PsbO [Calothrix 
sp. PCC 7507]
Length=278

 Score =   115 bits (289),  Expect(2) = 4e-38, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 69/96 (72%), Gaps = 8/96 (8%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKP-------  605
            D+++G  +++ D S+ F EKDG+D+ A+TVQLPGGERVPFLFTIK LVA  +P       
Sbjct  108  DQVQGDLKINPDNSLTFVEKDGLDFQAITVQLPGGERVPFLFTIKNLVAQSQPGLSSVST  167

Query  604  -ESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
               F G F VPSYRG++FLDPKGRG  +GYDNAV  
Sbjct  168  STDFEGTFKVPSYRGAAFLDPKGRGVVSGYDNAVAL  203


 Score = 70.1 bits (170),  Expect(2) = 4e-38, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 48/70 (69%), Gaps = 0/70 (0%)
 Frame = -2

Query  489  GRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVK  310
             + D++EL + N+K   + +GKI+  V      +GE+ G FES QPSDTDLGA  PKEVK
Sbjct  205  AQADDDELTRTNVKRAENLSGKISLQVAKIDGVSGEIAGTFESEQPSDTDLGAGEPKEVK  264

Query  309  IQGIWYAQLE  280
            I+G++Y ++E
Sbjct  265  IRGLFYGRVE  274



>ref|WP_015139796.1| Manganese-stabilising protein / photosystem II polypeptide [Nostoc 
sp. PCC 7524]
 gb|AFY49369.1| Manganese-stabilising protein / photosystem II polypeptide [Nostoc 
sp. PCC 7524]
Length=277

 Score =   112 bits (279),  Expect(2) = 5e-38, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 67/96 (70%), Gaps = 8/96 (8%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKP-------  605
            D++ G  +++ D S+ F E DG+D+ A+TVQLPGGERVPFLFTIK LVA  +P       
Sbjct  107  DQVSGDLKINPDNSLTFVENDGLDFQAITVQLPGGERVPFLFTIKGLVAQTQPGLTSVNT  166

Query  604  -ESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
               F G F VPSYRG++FLDPKGRG  +GYDNAV  
Sbjct  167  STDFEGSFKVPSYRGAAFLDPKGRGIVSGYDNAVAL  202


 Score = 73.9 bits (180),  Expect(2) = 5e-38, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = -2

Query  489  GRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVK  310
             + D+EEL + N+K      GKI+  V      +GE+ G FES QPSDTDLGA  PKEVK
Sbjct  204  AQADDEELTRANVKRAEILNGKISLQVAKVDSSSGEIAGTFESNQPSDTDLGADEPKEVK  263

Query  309  IQGIWYAQLE  280
            I+G++YA++E
Sbjct  264  IRGLFYARVE  273



>ref|WP_007354116.1| MULTISPECIES: photosystem II manganese-stabilizing protein PsbO 
[Kamptonema]
 emb|CBN54893.1| photosystem II manganese-stabilizing protein PsbO [ [[Oscillatoria] 
sp. PCC 6506]
Length=279

 Score =   117 bits (294),  Expect(2) = 6e-38, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 72/96 (75%), Gaps = 8/96 (8%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPES-----  599
            D+++G  +VSSDG++ F+E+DG+D+ A+TVQLPGGE+VPFLFTIK+LVA  +P S     
Sbjct  107  DQVQGRLKVSSDGTLTFKEEDGLDFQAITVQLPGGEQVPFLFTIKELVAKSEPGSATLNT  166

Query  598  ---FSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
                 G F VPSYR + FLDPKGRG STGYDNAV  
Sbjct  167  STDLEGTFNVPSYRSAGFLDPKGRGVSTGYDNAVAL  202


 Score = 67.8 bits (164),  Expect(2) = 6e-38, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 50/72 (69%), Gaps = 2/72 (3%)
 Frame = -2

Query  489  GRGDEEELQKENIKNVASST--GKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKE  316
            G+G++ EL + N+K   + T  GKI+  V      TGE+ G+FES QPSDTDLGA+   E
Sbjct  204  GKGEQGELTRANVKLADTQTKAGKISLQVAKVNGSTGEIGGIFESEQPSDTDLGARPSLE  263

Query  315  VKIQGIWYAQLE  280
            VKI+G++YA++E
Sbjct  264  VKIRGLFYARIE  275



>ref|WP_036480960.1| Photosystem II manganese-stabilizing polypeptide [Myxosarcina 
sp. GI1]
Length=275

 Score =   108 bits (271),  Expect(2) = 6e-38, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 66/96 (69%), Gaps = 8/96 (8%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPES-----  599
            D++ G  E + DGS+ F E DGID+ A TVQLPGGE VPFLFTIK+LVAT K  S     
Sbjct  106  DQVRGTVESNEDGSLTFTELDGIDFQAATVQLPGGEEVPFLFTIKELVATSKSGSSSIDS  165

Query  598  ---FSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
               F GEF VPSYRG  FLDPKGR  ++GYDNAV  
Sbjct  166  STDFEGEFSVPSYRGQVFLDPKGRSLASGYDNAVAL  201


 Score = 76.3 bits (186),  Expect(2) = 6e-38, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = -2

Query  489  GRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVK  310
             R D+EE  + N+K   S  G+++ +VT    ETGE+ GVFES QPS TDLGA+ P+EVK
Sbjct  203  ARADDEEFTRANVKEFVSRKGRMSLNVTKVDTETGEIAGVFESEQPSATDLGAEEPEEVK  262

Query  309  IQGIWYAQLE  280
            ++GI+Y ++E
Sbjct  263  VRGIFYGRVE  272



>ref|WP_035156929.1| Photosystem II manganese-stabilizing polypeptide [Calothrix sp. 
336/3]
 gb|KFB85527.1| Photosystem II manganese-stabilizing polypeptide [Calothrix sp. 
336/3]
Length=276

 Score =   111 bits (278),  Expect(2) = 6e-38, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 67/96 (70%), Gaps = 8/96 (8%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKP-------  605
            D+I+G   V+ DGS+ F+E DG D+ A+TVQLPGGERVPF FT+K LVA  +        
Sbjct  107  DQIQGDLIVNKDGSITFKEIDGFDFQAITVQLPGGERVPFFFTVKNLVAQSQAGLTSINT  166

Query  604  -ESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
               F G F VPSYRG++FLDPKGRG ++GYDNAV  
Sbjct  167  STDFEGAFRVPSYRGATFLDPKGRGVASGYDNAVAL  202


 Score = 73.9 bits (180),  Expect(2) = 6e-38, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 48/70 (69%), Gaps = 0/70 (0%)
 Frame = -2

Query  489  GRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVK  310
             + D+EEL + N+K      GKI+ ++      TGE+ G FES QPSDTDLGA  PKEVK
Sbjct  204  AQSDDEELTRANVKRTEVLNGKISLNIAKVNSSTGEIAGTFESEQPSDTDLGAGEPKEVK  263

Query  309  IQGIWYAQLE  280
            ++G++YA++E
Sbjct  264  VRGLFYARVE  273



>ref|WP_015196540.1| photosystem II manganese-stabilizing protein PsbO [Calothrix 
parietina]
 gb|AFY99885.1| photosystem II manganese-stabilizing protein PsbO [Calothrix 
sp. PCC 6303]
Length=276

 Score =   111 bits (277),  Expect(2) = 8e-38, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 67/96 (70%), Gaps = 8/96 (8%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVA--------TGK  608
            D+I+G   V+SDGS+ FEEKDG D+ A TV+LPGGE +PFLFT+K LVA           
Sbjct  107  DQIQGDLNVNSDGSLTFEEKDGFDFQATTVKLPGGESIPFLFTVKGLVAQTQSGLTSINT  166

Query  607  PESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
               F G F VPSYRG++FLDPKGRG ++GYDNAV  
Sbjct  167  STDFKGGFRVPSYRGATFLDPKGRGVASGYDNAVAL  202


 Score = 73.6 bits (179),  Expect(2) = 8e-38, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 48/70 (69%), Gaps = 0/70 (0%)
 Frame = -2

Query  489  GRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVK  310
             R D EEL +EN+K      G+I+ SV      +GE+ G FES QPSDTDLG+  PKEVK
Sbjct  204  ARSDAEELTRENVKRAQVLEGEISLSVAKIDSVSGEIAGTFESNQPSDTDLGSGDPKEVK  263

Query  309  IQGIWYAQLE  280
            I+G++YA++E
Sbjct  264  IRGVFYARVE  273



>gb|ADC54897.1| oxygen-evolving enhancer protein, partial [Cladophora coelothrix]
Length=235

 Score =   117 bits (294),  Expect(2) = 9e-38, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 72/88 (82%), Gaps = 1/88 (1%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPE-SFSGE  587
            DE+EG F V SDGS++  E++G+D+AAVTVQ+PGGERVPFLFT+K+L   GK + +  G 
Sbjct  82   DEMEGKFVVGSDGSLRVTEEEGLDFAAVTVQMPGGERVPFLFTVKELDLKGKVDGNLEGS  141

Query  586  FLVPSYRGSSFLDPKGRGGSTGYDNAVG  503
            FLVPSYRGS+FLDPKGRGGSTGY+   G
Sbjct  142  FLVPSYRGSTFLDPKGRGGSTGYNVVQG  169


 Score = 67.4 bits (163),  Expect(2) = 9e-38, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 42/67 (63%), Gaps = 0/67 (0%)
 Frame = -2

Query  492  GGRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEV  313
            G + D E  + +N K   S TGK  FS+    P TG V GVFE++ PSDTDLGAK  ++V
Sbjct  169  GVQADAENEEFKNEKTTESGTGKAVFSIAKVDPSTGGVAGVFETVSPSDTDLGAKEARDV  228

Query  312  KIQGIWY  292
            K  GIWY
Sbjct  229  KTNGIWY  235



>ref|WP_015204171.1| photosystem II manganese-stabilizing protein PsbO [Crinalium 
epipsammum]
 gb|AFZ14065.1| photosystem II manganese-stabilizing protein PsbO [Crinalium 
epipsammum PCC 9333]
Length=277

 Score =   109 bits (273),  Expect(2) = 9e-38, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 68/96 (71%), Gaps = 8/96 (8%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKP-------  605
            D+I G  +VS +GS+ F E+DGID+  +TV+L GGE+VPF FTIK LVA+ +P       
Sbjct  107  DQISGTIKVSKNGSLTFTEEDGIDFQPITVRLAGGEQVPFFFTIKNLVASSQPGMDSINT  166

Query  604  -ESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
               F GEF VPSYRG+ FLDPKGRG ++GYDNAV  
Sbjct  167  STDFEGEFNVPSYRGAVFLDPKGRGVASGYDNAVAL  202


 Score = 75.5 bits (184),  Expect(2) = 9e-38, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 47/67 (70%), Gaps = 0/67 (0%)
 Frame = -2

Query  483  GDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQ  304
             D E+L++ N+K V +  GKI+  V      TGEV G FES QPSDTDLGA  PKEVK++
Sbjct  206  ADSEQLRRANVKRVETGKGKISLQVAKVDSNTGEVAGTFESEQPSDTDLGADDPKEVKVR  265

Query  303  GIWYAQL  283
            GI+YA++
Sbjct  266  GIFYARI  272



>ref|WP_028090302.1| Photosystem II manganese-stabilizing polypeptide [Dolichospermum 
circinale]
Length=276

 Score =   114 bits (285),  Expect(2) = 9e-38, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 68/96 (71%), Gaps = 8/96 (8%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPE------  602
            D+++G   V+SD S+ F EKDG+D+ A+TV+LPGGE VPFLFTIK LVA  +P       
Sbjct  107  DQVQGKLTVNSDNSLTFTEKDGLDFQAITVKLPGGELVPFLFTIKNLVAQTQPNLTSINT  166

Query  601  --SFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
               F G F VPSYRG++FLDPKGRG  +GYDNAV  
Sbjct  167  STDFEGTFKVPSYRGAAFLDPKGRGVVSGYDNAVAL  202


 Score = 70.5 bits (171),  Expect(2) = 9e-38, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 46/70 (66%), Gaps = 0/70 (0%)
 Frame = -2

Query  489  GRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVK  310
             + D+EEL + N+K      GKI+  V      +GE+ G FES QPSDTDLGA  PKEVK
Sbjct  204  AQADDEELTRTNVKRAEVLKGKISLQVAKVDNTSGEIAGTFESEQPSDTDLGAGEPKEVK  263

Query  309  IQGIWYAQLE  280
            I+G++Y ++E
Sbjct  264  IRGLFYGRIE  273



>ref|WP_017286598.1| hypothetical protein [Leptolyngbya boryana]
Length=275

 Score =   120 bits (302),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 60/96 (63%), Positives = 71/96 (74%), Gaps = 8/96 (8%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPES-----  599
            D + G  + +SDGS+ F E+DG+D+ A+TVQLPGGERVPFLFTIK LVAT  P S     
Sbjct  106  DAVSGTLKSNSDGSLTFTEEDGLDFQAITVQLPGGERVPFLFTIKGLVATTDPGSSSINT  165

Query  598  ---FSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
               F+GEF VPSYR S+FLDPKGRG +TGYDNAV  
Sbjct  166  STDFTGEFRVPSYRTSNFLDPKGRGLTTGYDNAVAL  201


 Score = 63.9 bits (154),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = -2

Query  483  GDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKIQ  304
             D EEL+KEN+K      G I+  V      +GE+ G FES QPS+TD+G++   EVKI+
Sbjct  205  ADSEELRKENVKRFQLDKGTISLQVAKIDSASGEIAGTFESDQPSETDMGSREASEVKIR  264

Query  303  GIWYAQL  283
            G++YA++
Sbjct  265  GLFYARV  271



>ref|WP_016872421.1| Photosystem II manganese-stabilizing polypeptide [Chlorogloeopsis 
fritschii]
Length=277

 Score =   111 bits (278),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 68/96 (71%), Gaps = 8/96 (8%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKP-------  605
            D+I+G  +V+ DGS+ F EKDG D+ A TV+LPGGE VPFLFT+K LVA  +P       
Sbjct  107  DQIQGDLKVNPDGSLTFVEKDGFDFQAATVKLPGGEMVPFLFTVKGLVAQSQPGMTSINT  166

Query  604  -ESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
               F G F VPSYRG++FLDPKGRG ++GYDNAV  
Sbjct  167  STDFEGSFRVPSYRGATFLDPKGRGVASGYDNAVAL  202


 Score = 73.2 bits (178),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = -2

Query  486  RGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKI  307
            + DEE+L + N+K      GKI+ S+      TGE+ G FES QPSDTDLGA  P+EVK+
Sbjct  205  QSDEEQLLRANVKRADVLEGKISLSIAKVDSATGEIAGTFESEQPSDTDLGADEPEEVKV  264

Query  306  QGIWYAQLE  280
            +GI+YA++E
Sbjct  265  RGIFYARVE  273



>ref|WP_039748810.1| Photosystem II manganese-stabilizing polypeptide [Hassallia byssoidea]
 gb|KIF33095.1| Photosystem II manganese-stabilizing polypeptide [Hassallia byssoidea 
VB512170]
Length=276

 Score =   117 bits (292),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 69/96 (72%), Gaps = 8/96 (8%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKP-------  605
            D+++G  +V+ D S+ F EKDG+D+ A TVQLPGGERVPFLFTIK LVA  +P       
Sbjct  107  DQVQGDIKVNPDNSLTFVEKDGLDFQATTVQLPGGERVPFLFTIKNLVAKSQPGLTSINT  166

Query  604  -ESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
               F GEF VPSYRG++FLDPKGRG  +GYDNAV  
Sbjct  167  STDFEGEFKVPSYRGAAFLDPKGRGVVSGYDNAVAL  202


 Score = 67.8 bits (164),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = -2

Query  489  GRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVK  310
             + D+++L + N+K      G+I+ S+      TGE+ G F+S QPSDTDLGA  PKEVK
Sbjct  204  AQADKKDLTRTNVKRAEVLKGRISLSIAKVDSATGEIAGTFQSDQPSDTDLGAGEPKEVK  263

Query  309  IQGIWYAQLE  280
            I+G++Y ++E
Sbjct  264  IRGLFYGRVE  273



>ref|WP_035997199.1| Photosystem II manganese-stabilizing polypeptide [Leptolyngbya 
sp. JSC-1]
Length=274

 Score =   103 bits (256),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 65/96 (68%), Gaps = 8/96 (8%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKP-------  605
            D+++G  E ++DGS+ F E++G D+  +TV+LP GE VPFLFT+K LVA   P       
Sbjct  106  DQVKGKLEFNADGSLTFIEEEGFDFQPITVKLPNGELVPFLFTVKDLVAKTLPGFEGINT  165

Query  604  -ESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
               F GEF VPSYR S+FLDPKGRG + GYDNAV  
Sbjct  166  STDFEGEFRVPSYRTSNFLDPKGRGLTAGYDNAVAL  201


 Score = 81.3 bits (199),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = -2

Query  486  RGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKI  307
            R D EE+ KEN+K   + TG+I+  V      TGEV G FES+QPSDTD+G+KAP +VKI
Sbjct  204  RADSEEILKENLKRFDTGTGRISLQVAKVNSTTGEVAGTFESIQPSDTDMGSKAPVDVKI  263

Query  306  QGIWYAQLE  280
            +G++YA++E
Sbjct  264  RGLFYARVE  272



>ref|WP_016949009.1| Photosystem II manganese-stabilizing polypeptide [Anabaena sp. 
PCC 7108]
Length=277

 Score =   113 bits (282),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 69/96 (72%), Gaps = 8/96 (8%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPES-----  599
            D+++G  +++SD S+ F E DG+D+ A+TV+LPGGE VPFLFTIK LVA  +P S     
Sbjct  107  DQVQGNLKINSDNSLTFVEADGLDFQAITVKLPGGELVPFLFTIKNLVAQTQPNSTSINT  166

Query  598  ---FSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
               F G F VPSYRG++FLDPKGRG  +GYDNAV  
Sbjct  167  STDFEGSFKVPSYRGAAFLDPKGRGVVSGYDNAVAL  202


 Score = 71.2 bits (173),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = -2

Query  489  GRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVK  310
             + D+EEL + N+K     +GKI+  V      +GE+ G FES QPSDTDLGA  PKEVK
Sbjct  204  AQADDEELTRTNVKRAEILSGKISLRVAKVDSASGEIAGTFESEQPSDTDLGAGEPKEVK  263

Query  309  IQGIWYAQLE  280
            I+G++Y ++E
Sbjct  264  IRGLFYGRVE  273



>ref|WP_017656098.1| Photosystem II manganese-stabilizing polypeptide [Microchaete 
sp. PCC 7126]
Length=277

 Score =   115 bits (287),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 69/96 (72%), Gaps = 8/96 (8%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKP-------  605
            D+++G  +++ D S+ F E+DG+D+ A+TVQLPGGERVPFLFTIK LVA  +P       
Sbjct  107  DQVQGDLKINQDNSLTFVEQDGLDFQAITVQLPGGERVPFLFTIKNLVAQSQPGLSSVST  166

Query  604  -ESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
               F G F VPSYRG++FLDPKGRG  +GYDNAV  
Sbjct  167  STDFEGTFKVPSYRGAAFLDPKGRGVVSGYDNAVAL  202


 Score = 69.3 bits (168),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = -2

Query  489  GRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVK  310
             + D++EL + N+K     +GKI+  V      +GE+ G FES QPSDTDLGA  PKEVK
Sbjct  204  AQADDDELTRTNVKRTDILSGKISLQVAKIDSGSGEIAGTFESEQPSDTDLGAGEPKEVK  263

Query  309  IQGIWYAQLE  280
            I+G++Y ++E
Sbjct  264  IRGLFYGRVE  273



>ref|WP_041036292.1| Photosystem II manganese-stabilizing polypeptide [Tolypothrix 
campylonemoides]
 gb|KIJ75950.1| Photosystem II manganese-stabilizing polypeptide [Tolypothrix 
campylonemoides VB511288]
Length=277

 Score =   109 bits (273),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 67/96 (70%), Gaps = 8/96 (8%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKP-------  605
            D+I G  +V+ D S+ F EKDG D+ A+TV+LPGGE VPFLFT+K LVA  +P       
Sbjct  107  DQIIGDLKVNPDNSLTFVEKDGFDFQAITVKLPGGESVPFLFTVKGLVAQTQPGLTSINT  166

Query  604  -ESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
               F G F VPSYRG+SFLDPKGRG ++GYDNAV  
Sbjct  167  STDFEGSFRVPSYRGASFLDPKGRGVTSGYDNAVAL  202


 Score = 74.3 bits (181),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 49/70 (70%), Gaps = 0/70 (0%)
 Frame = -2

Query  489  GRGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVK  310
             + D+EEL++ N+K      GKI+  V      TGE+ G FES QPSDTDLGAK P+EVK
Sbjct  204  AQSDDEELRRANVKQAEILKGKISLQVAKVDNSTGEIAGTFESEQPSDTDLGAKEPEEVK  263

Query  309  IQGIWYAQLE  280
            ++G++YA++E
Sbjct  264  VRGLFYARVE  273



>ref|WP_015125988.1| Manganese-stabilising protein / photosystem II polypeptide [Synechococcus 
sp. PCC 6312]
 gb|AFY62451.1| Manganese-stabilising protein / photosystem II polypeptide [Synechococcus 
sp. PCC 6312]
Length=274

 Score =   119 bits (298),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 73/96 (76%), Gaps = 8/96 (8%)
 Frame = -1

Query  763  DEIEGPFEVSSDGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVATGKPE------  602
            D+++GP +++SDGS+ F E+DG D+ A+TVQ+PGGERVPFLF++K LVA+ +P       
Sbjct  105  DQVQGPLKINSDGSLTFIEEDGFDFQAITVQMPGGERVPFLFSVKNLVASTEPNITSITT  164

Query  601  --SFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVGF  500
               F GE+ VPSYR S+FLDPKGRG +TGYDNAV  
Sbjct  165  STDFKGEYSVPSYRTSNFLDPKGRGLTTGYDNAVAI  200


 Score = 64.3 bits (155),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = -2

Query  486  RGDEEELQKENIKNVASSTGKITFSVTGSKPETGEVIGVFESLQPSDTDLGAKAPKEVKI  307
            + D EEL K N+K    S G I+  V+     TGE+ G F S Q SD DLGA   KE+KI
Sbjct  203  KADSEELLKANVKRFGLSKGNISLEVSKVDGRTGEIAGTFLSEQLSDDDLGAHEAKEMKI  262

Query  306  QGIWYAQLE  280
            QG++YA++E
Sbjct  263  QGVFYARIE  271



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1441039810680