BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF008N07

Length=688
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KHN43447.1|  DEAD-box ATP-dependent RNA helicase 24                  183   7e-50   Glycine soja [wild soybean]
ref|XP_003554554.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    183   9e-50   Glycine max [soybeans]
ref|XP_009610165.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    181   3e-49   Nicotiana tomentosiformis
ref|XP_003521597.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    181   5e-49   Glycine max [soybeans]
gb|KHN19202.1|  DEAD-box ATP-dependent RNA helicase 24                  181   5e-49   Glycine soja [wild soybean]
ref|XP_011079538.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    175   5e-47   Sesamum indicum [beniseed]
ref|XP_009758471.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    174   1e-46   Nicotiana sylvestris
ref|XP_004494431.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    173   3e-46   Cicer arietinum [garbanzo]
ref|XP_006349177.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    173   3e-46   Solanum tuberosum [potatoes]
ref|XP_004494432.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    173   3e-46   Cicer arietinum [garbanzo]
ref|XP_002277419.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    172   5e-46   Vitis vinifera
emb|CAN74586.1|  hypothetical protein VITISV_041989                     172   5e-46   Vitis vinifera
ref|XP_004229381.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    168   3e-44   Solanum lycopersicum
ref|XP_007163191.1|  hypothetical protein PHAVU_001G214100g             166   9e-44   Phaseolus vulgaris [French bean]
gb|AGV54423.1|  DEAD-box ATP-dependent RNA helicase 24-like protein     166   1e-43   Phaseolus vulgaris [French bean]
gb|KDO86968.1|  hypothetical protein CISIN_1g003881mg                   164   9e-43   Citrus sinensis [apfelsine]
ref|XP_006444514.1|  hypothetical protein CICLE_v10018925mg             164   9e-43   Citrus clementina [clementine]
ref|XP_010069832.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    163   1e-42   Eucalyptus grandis [rose gum]
ref|XP_003625986.1|  DEAD-box ATP-dependent RNA helicase                162   5e-42   Medicago truncatula
gb|EYU46816.1|  hypothetical protein MIMGU_mgv1a001735mg                160   2e-41   Erythranthe guttata [common monkey flower]
ref|XP_011042271.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    157   2e-40   Populus euphratica
gb|KJB22489.1|  hypothetical protein B456_004G050200                    155   1e-39   Gossypium raimondii
gb|KJB22487.1|  hypothetical protein B456_004G050200                    155   1e-39   Gossypium raimondii
gb|KJB22491.1|  hypothetical protein B456_004G050200                    155   2e-39   Gossypium raimondii
ref|XP_002301515.2|  DEAD/DEAH box helicase family protein              154   5e-39   
ref|XP_010267974.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    153   7e-39   Nelumbo nucifera [Indian lotus]
gb|KHG13095.1|  DEAD-box ATP-dependent RNA helicase 24 -like protein    152   9e-39   Gossypium arboreum [tree cotton]
gb|KHG13094.1|  DEAD-box ATP-dependent RNA helicase 24 -like protein    152   1e-38   Gossypium arboreum [tree cotton]
gb|KHG18820.1|  DEAD-box ATP-dependent RNA helicase 24 -like protein    152   1e-38   Gossypium arboreum [tree cotton]
ref|XP_004156816.1|  PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP...    152   1e-38   
gb|KHG30147.1|  DEAD-box ATP-dependent RNA helicase 24 -like protein    150   2e-38   Gossypium arboreum [tree cotton]
gb|KJB22485.1|  hypothetical protein B456_004G050000                    149   1e-37   Gossypium raimondii
emb|CDP17060.1|  unnamed protein product                                147   6e-37   Coffea canephora [robusta coffee]
ref|XP_008454276.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    147   1e-36   Cucumis melo [Oriental melon]
ref|XP_004152219.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    146   1e-36   Cucumis sativus [cucumbers]
ref|XP_010087224.1|  DEAD-box ATP-dependent RNA helicase 24             144   5e-36   
ref|XP_010679397.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    145   6e-36   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002515267.1|  hypothetical protein RCOM_1346600                  144   8e-36   Ricinus communis
ref|XP_007051129.1|  P-loop containing nucleoside triphosphate hy...    144   1e-35   
ref|XP_007051128.1|  P-loop containing nucleoside triphosphate hy...    143   4e-35   
ref|XP_006840470.1|  hypothetical protein AMTR_s00045p00182070          142   4e-35   
ref|XP_010938236.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    142   5e-35   Elaeis guineensis
gb|KFK37476.1|  hypothetical protein AALP_AA4G262200                    141   8e-35   Arabis alpina [alpine rockcress]
ref|XP_009416320.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    141   9e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011468779.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    141   9e-35   Fragaria vesca subsp. vesca
ref|XP_009403707.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    141   1e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004288535.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    141   1e-34   Fragaria vesca subsp. vesca
ref|XP_009142546.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    141   1e-34   Brassica rapa
emb|CDX80096.1|  BnaA05g00600D                                          140   2e-34   
ref|XP_006293732.1|  hypothetical protein CARUB_v10022694mg             140   2e-34   Capsella rubella
ref|XP_010921475.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    139   4e-34   Elaeis guineensis
ref|XP_009370603.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    139   5e-34   Pyrus x bretschneideri [bai li]
emb|CDY37796.1|  BnaC04g00290D                                          137   3e-33   Brassica napus [oilseed rape]
ref|XP_009349922.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    137   3e-33   Pyrus x bretschneideri [bai li]
emb|CDX95719.1|  BnaC03g26000D                                          137   4e-33   
ref|XP_008781128.1|  PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP...    136   6e-33   Phoenix dactylifera
ref|XP_007221465.1|  hypothetical protein PRUPE_ppa001666mg             136   6e-33   Prunus persica
gb|KDP28272.1|  hypothetical protein JCGZ_14043                         136   7e-33   Jatropha curcas
ref|XP_010506769.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    135   1e-32   Camelina sativa [gold-of-pleasure]
ref|XP_010506768.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    135   1e-32   Camelina sativa [gold-of-pleasure]
gb|EPS66709.1|  hypothetical protein M569_08067                         135   2e-32   Genlisea aurea
ref|XP_006397925.1|  hypothetical protein EUTSA_v10001321mg             134   3e-32   Eutrema salsugineum [saltwater cress]
ref|XP_008227876.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    134   4e-32   Prunus mume [ume]
ref|XP_008808687.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    134   5e-32   Phoenix dactylifera
ref|XP_008343158.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    133   9e-32   
ref|XP_008381412.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    133   9e-32   
ref|XP_010518432.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    131   4e-31   Camelina sativa [gold-of-pleasure]
ref|NP_566099.1|  DEAD-box ATP-dependent RNA helicase 24                129   3e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006649971.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    127   6e-30   
ref|XP_010544963.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    124   2e-28   Tarenaya hassleriana [spider flower]
ref|XP_002467976.1|  hypothetical protein SORBIDRAFT_01g037410          121   9e-28   Sorghum bicolor [broomcorn]
ref|XP_004984607.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    117   4e-26   Setaria italica
ref|XP_001779387.1|  predicted protein                                  116   5e-26   
ref|XP_008654950.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    114   3e-25   Zea mays [maize]
ref|XP_008654947.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    114   3e-25   Zea mays [maize]
ref|XP_003558073.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    113   6e-25   Brachypodium distachyon [annual false brome]
gb|AFW88580.1|  putative DEAD-box ATP-dependent RNA helicase fami...    107   5e-23   
ref|NP_001147596.1|  pre-mRNA-processing ATP-dependent RNA helica...    107   6e-23   Zea mays [maize]
gb|EEC75096.1|  hypothetical protein OsI_11255                          107   7e-23   Oryza sativa Indica Group [Indian rice]
gb|EEE58924.1|  hypothetical protein OsJ_10575                          107   9e-23   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ97115.1|  predicted protein                                      107   1e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001049904.1|  Os03g0308500                                       107   1e-22   
ref|XP_002882116.1|  hypothetical protein ARALYDRAFT_483908             107   1e-22   
gb|EMS61774.1|  DEAD-box ATP-dependent RNA helicase 24                99.0    6e-20   Triticum urartu
gb|EMT30425.1|  DEAD-box ATP-dependent RNA helicase 24                97.8    2e-19   
ref|XP_006388446.1|  hypothetical protein POPTR_0184s002101g          82.0    7e-16   
ref|XP_002980961.1|  hypothetical protein SELMODRAFT_51367            84.7    3e-15   
ref|XP_009135930.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  84.0    5e-15   
emb|CDX83333.1|  BnaA03g21730D                                        84.0    5e-15   
ref|XP_002989340.1|  hypothetical protein SELMODRAFT_41331            82.8    1e-14   
ref|XP_006388445.1|  hypothetical protein POPTR_0184s002103g          72.4    1e-12   
gb|KJB22488.1|  hypothetical protein B456_004G050200                  63.5    1e-12   Gossypium raimondii
gb|KJB22484.1|  hypothetical protein B456_004G050000                  63.5    1e-12   Gossypium raimondii
ref|XP_010507898.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  70.9    9e-11   Camelina sativa [gold-of-pleasure]
gb|KJB22490.1|  hypothetical protein B456_004G050200                  70.5    1e-10   Gossypium raimondii
ref|XP_010518433.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  65.5    6e-09   Camelina sativa [gold-of-pleasure]
ref|XP_006444513.1|  hypothetical protein CICLE_v10018925mg           63.5    3e-08   
ref|XP_007051130.1|  P-loop containing nucleoside triphosphate hy...  63.5    3e-08   
ref|XP_011079539.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  61.2    1e-07   Sesamum indicum [beniseed]
gb|KDO86973.1|  hypothetical protein CISIN_1g003881mg                 60.5    2e-07   Citrus sinensis [apfelsine]
ref|XP_010507901.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  52.0    1e-05   Camelina sativa [gold-of-pleasure]
ref|XP_010679398.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  55.5    1e-05   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008353905.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  55.1    1e-05   
ref|XP_009758479.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  55.1    2e-05   Nicotiana sylvestris
ref|XP_009610166.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  55.1    2e-05   Nicotiana tomentosiformis
emb|CEI91338.1|  hypothetical protein RMCBS344292_05633               55.1    2e-05   Rhizopus microsporus
emb|CEG84746.1|  Putative Adenosinetriphosphatase                     54.7    2e-05   Rhizopus microsporus
emb|CEI97815.1|  Putative Adenosinetriphosphatase                     54.7    2e-05   Rhizopus microsporus
emb|CEG65407.1|  hypothetical protein RMATCC62417_02199               54.7    2e-05   Rhizopus microsporus
ref|XP_005643999.1|  DEAD-domain-containing protein                   54.7    2e-05   Coccomyxa subellipsoidea C-169
dbj|GAN07211.1|  ATP-dependent RNA helicase DDX42-like                53.9    5e-05   Mucor ambiguus
emb|CEP11906.1|  hypothetical protein                                 52.4    2e-04   Parasitella parasitica



>gb|KHN43447.1| DEAD-box ATP-dependent RNA helicase 24 [Glycine soja]
Length=686

 Score =   183 bits (464),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 137/158 (87%), Gaps = 0/158 (0%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrskrdarkgggkrakgrggsgrgv  509
            T KEARFAGELVNSL+ AGQNV  ELMDLAMKDGRFRSKRDARKGGGK+ KGRGG GRGV
Sbjct  495  TLKEARFAGELVNSLVAAGQNVSVELMDLAMKDGRFRSKRDARKGGGKKGKGRGGGGRGV  554

Query  508  rgvDYGLGIGYSAESSNAPTTTVPSRSAAVNSLRTGMMAQFKSNFVAASSNLQNQALGNS  329
            RGVD+GLGIGY++ES+NAP+TT PSRSAAVNSLRTGMM+QFKSNFVAASSN QNQ  G++
Sbjct  555  RGVDFGLGIGYNSESNNAPSTTAPSRSAAVNSLRTGMMSQFKSNFVAASSNSQNQGFGSN  614

Query  328  SGMNPNKKMALPGFVSGGTIGGDTNASRTSSISNAATS  215
            + M  NK+ ALPGFVSGG+IGGD N  + ++  N ATS
Sbjct  615  TSMAANKRPALPGFVSGGSIGGDINTYQNTASPNPATS  652



>ref|XP_003554554.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Glycine 
max]
Length=768

 Score =   183 bits (465),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 137/158 (87%), Gaps = 0/158 (0%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrskrdarkgggkrakgrggsgrgv  509
            T KEARFAGELVNSL+ AGQNV  ELMDLAMKDGRFRSKRDARKGGGK+ KGRGG GRGV
Sbjct  577  TLKEARFAGELVNSLVAAGQNVSVELMDLAMKDGRFRSKRDARKGGGKKGKGRGGGGRGV  636

Query  508  rgvDYGLGIGYSAESSNAPTTTVPSRSAAVNSLRTGMMAQFKSNFVAASSNLQNQALGNS  329
            RGVD+GLGIGY++ES+NAP+TT PSRSAAVNSLRTGMM+QFKSNFVAASSN QNQ  G++
Sbjct  637  RGVDFGLGIGYNSESNNAPSTTAPSRSAAVNSLRTGMMSQFKSNFVAASSNSQNQGFGSN  696

Query  328  SGMNPNKKMALPGFVSGGTIGGDTNASRTSSISNAATS  215
            + M  NK+ ALPGFVSGG+IGGD N  + ++  N ATS
Sbjct  697  TSMAANKRPALPGFVSGGSIGGDINTYQNTASPNPATS  734



>ref|XP_009610165.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 isoform X1 
[Nicotiana tomentosiformis]
Length=777

 Score =   181 bits (460),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 137/195 (70%), Positives = 151/195 (77%), Gaps = 6/195 (3%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrskrdarkgggkrakgrggsgrgv  509
            TQKEARFAGEL NSL+ AGQ V  ELMDLAMKDGRFRSKRDARKGGGKRAKGRGG     
Sbjct  583  TQKEARFAGELANSLVAAGQTVSIELMDLAMKDGRFRSKRDARKGGGKRAKGRGGGNNRG  642

Query  508  rgv-DYGLGIGYSAESSNAPTTTVPSRSAAVNSLRTGMMAQFKSNFVAASSNLQNQALGN  332
                D+GLGIGY+AES+N P    PSRSAAVNSLRTGMMAQFKSNFVAASSN QNQ + N
Sbjct  643  VRGVDFGLGIGYNAESNNPPQNAAPSRSAAVNSLRTGMMAQFKSNFVAASSNSQNQGMNN  702

Query  331  SSGMNPNKKMALPGFVSGGTIGGDTNASRTSSISNAAT-----SVQKPREDASHLssgss  167
            ++G  PNK M L GFVSGGTIGG++NASR SS   AAT     S Q  R+ A+  SS SS
Sbjct  703  TAGAYPNKGMVLQGFVSGGTIGGESNASRISSTFAAATPGAYSSSQPARDGANQKSSESS  762

Query  166  rdrqrerrrpSGWDR  122
            +++ RERRRPSGWDR
Sbjct  763  KEKSRERRRPSGWDR  777



>ref|XP_003521597.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Glycine 
max]
Length=782

 Score =   181 bits (459),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 135/161 (84%), Gaps = 3/161 (2%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrskrdarkgggkrakgrggsgrgv  509
            T KEARFAGELVNSL+ AGQNV  ELMDLAMKDGRFRSKRDARKGGGK+ KGRGG G G 
Sbjct  588  TLKEARFAGELVNSLVAAGQNVSVELMDLAMKDGRFRSKRDARKGGGKKGKGRGGGGGGG  647

Query  508  rgv---DYGLGIGYSAESSNAPTTTVPSRSAAVNSLRTGMMAQFKSNFVAASSNLQNQAL  338
            RGV   D+GLGIGY+ ES+NAP+TT PSRSAAVNSLRTGMM+QFKSNFVAASSN QNQ  
Sbjct  648  RGVRGVDFGLGIGYNPESNNAPSTTAPSRSAAVNSLRTGMMSQFKSNFVAASSNSQNQGF  707

Query  337  GNSSGMNPNKKMALPGFVSGGTIGGDTNASRTSSISNAATS  215
            GN++ M  NK+ ALPGFVSGG+IGGD N  ++++  N ATS
Sbjct  708  GNNTSMTANKRTALPGFVSGGSIGGDINTYQSTASPNPATS  748



>gb|KHN19202.1| DEAD-box ATP-dependent RNA helicase 24 [Glycine soja]
Length=784

 Score =   181 bits (459),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 135/161 (84%), Gaps = 3/161 (2%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrskrdarkgggkrakgrggsgrgv  509
            T KEARFAGELVNSL+ AGQNV  ELMDLAMKDGRFRSKRDARKGGGK+ KGRGG G G 
Sbjct  590  TLKEARFAGELVNSLVAAGQNVSVELMDLAMKDGRFRSKRDARKGGGKKGKGRGGGGGGG  649

Query  508  rgv---DYGLGIGYSAESSNAPTTTVPSRSAAVNSLRTGMMAQFKSNFVAASSNLQNQAL  338
            RGV   D+GLGIGY+ ES+NAP+TT PSRSAAVNSLRTGMM+QFKSNFVAASSN QNQ  
Sbjct  650  RGVRGVDFGLGIGYNPESNNAPSTTAPSRSAAVNSLRTGMMSQFKSNFVAASSNSQNQGF  709

Query  337  GNSSGMNPNKKMALPGFVSGGTIGGDTNASRTSSISNAATS  215
            GN++ M  NK+ ALPGFVSGG+IGGD N  ++++  N ATS
Sbjct  710  GNNTSMTANKRTALPGFVSGGSIGGDINTYQSTASPNPATS  750



>ref|XP_011079538.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 isoform X1 
[Sesamum indicum]
Length=770

 Score =   175 bits (444),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 135/192 (70%), Positives = 156/192 (81%), Gaps = 6/192 (3%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrskrdarkgggkrakgrggsgrgv  509
            TQKEARFAGELVNSLI AGQNV  ELMDLAMKDGRFRSKRD+RKGGGKRAKGRGG GRGV
Sbjct  582  TQKEARFAGELVNSLIAAGQNVSTELMDLAMKDGRFRSKRDSRKGGGKRAKGRGGGGRGV  641

Query  508  rgvDYGLGIGYSAESSNAPTTTVPSRSAAVNSLRTGMMAQFKSNFVAASSNLQNQALGNS  329
            RGVDYGLGIGYS +S NA ++  P+RS AVNSLRTGMMAQF++NFV ASSN QN  + NS
Sbjct  642  RGVDYGLGIGYSPDS-NAASSVTPTRSVAVNSLRTGMMAQFRNNFVPASSNSQNHFVQNS  700

Query  328  SGMNPNKKMALPGFVSGGTIGGDTNASRTSSISNAAT---SVQKPREDASHLssgssrdr  158
            +G+  NK+M LPGFVSGGTIGGD +A + +S ++AA+   ++   RE A    + S RD+
Sbjct  701  TGVQTNKRMVLPGFVSGGTIGGDMHAVQINSTTSAASASNTILNSREIAKQ--TPSERDK  758

Query  157  qrerrrpSGWDR  122
             RERRRPSGWDR
Sbjct  759  ARERRRPSGWDR  770



>ref|XP_009758471.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 isoform X1 
[Nicotiana sylvestris]
 ref|XP_009758473.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 isoform X1 
[Nicotiana sylvestris]
Length=762

 Score =   174 bits (442),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 126/152 (83%), Gaps = 1/152 (1%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrskrdarkgggkrakgrggsgrgv  509
            TQKEARFAGEL NSL+ AGQ V  ELMDLAMKDGRFRSKRDARKGGGKRAKGRGG     
Sbjct  583  TQKEARFAGELANSLVAAGQTVSIELMDLAMKDGRFRSKRDARKGGGKRAKGRGGGSNRG  642

Query  508  rg-vDYGLGIGYSAESSNAPTTTVPSRSAAVNSLRTGMMAQFKSNFVAASSNLQNQALGN  332
               VD+GLGIGY++ES+N P  T PSRSAAVNSLRTGMMAQFKS+FVAASSN QNQ + N
Sbjct  643  VRGVDFGLGIGYNSESNNPPQNTAPSRSAAVNSLRTGMMAQFKSSFVAASSNSQNQGMNN  702

Query  331  SSGMNPNKKMALPGFVSGGTIGGDTNASRTSS  236
            ++G  PNK M L GFVSGGTIGG++NASR SS
Sbjct  703  TAGAYPNKGMVLQGFVSGGTIGGESNASRISS  734



>ref|XP_004494431.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like isoform 
X1 [Cicer arietinum]
Length=776

 Score =   173 bits (439),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 133/161 (83%), Gaps = 3/161 (2%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrskrdarkgggkrakgrggsgrgv  509
            TQKEARFAGELVNSL+ AGQNV  ELMDLAMKDGRFRSKRDARKGGG++ KGRGG G G 
Sbjct  581  TQKEARFAGELVNSLVAAGQNVSTELMDLAMKDGRFRSKRDARKGGGRKGKGRGGGGAGG  640

Query  508  rgv---DYGLGIGYSAESSNAPTTTVPSRSAAVNSLRTGMMAQFKSNFVAASSNLQNQAL  338
            +GV   D+GLGIGY+AE +NAP+ TVPSRSAAVNSLRTGMM+QF+SNFVAASSN QN+  
Sbjct  641  KGVRGVDFGLGIGYTAEPNNAPSNTVPSRSAAVNSLRTGMMSQFRSNFVAASSNSQNEGF  700

Query  337  GNSSGMNPNKKMALPGFVSGGTIGGDTNASRTSSISNAATS  215
             N++ +  NK+ AL GFVSGG+IGGD N  + ++  N ATS
Sbjct  701  SNNTSITVNKRPALAGFVSGGSIGGDINTHQHTASYNPATS  741



>ref|XP_006349177.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Solanum 
tuberosum]
Length=774

 Score =   173 bits (439),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 133/195 (68%), Positives = 148/195 (76%), Gaps = 6/195 (3%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrskrdarkgggkrakgrggsgrgv  509
            T KEARFAGEL NSL+ AGQ V  ELMDLAMKDGRFRSKRDARKGGGKRAKGRGG     
Sbjct  580  THKEARFAGELANSLVAAGQTVSVELMDLAMKDGRFRSKRDARKGGGKRAKGRGGGNNKG  639

Query  508  rg-vDYGLGIGYSAESSNAPTTTVPSRSAAVNSLRTGMMAQFKSNFVAASSNLQNQALGN  332
               VD+GLGIGY+ ES+N P +  PSRSAAVNSLRTGMMAQFKS+FVAASS  QNQ + N
Sbjct  640  VRGVDFGLGIGYNPESNNPPQSAAPSRSAAVNSLRTGMMAQFKSSFVAASSKSQNQGMNN  699

Query  331  SSGMNPNKKMALPGFVSGGTIGGDTNASRTSSISNAA-----TSVQKPREDASHLssgss  167
            + G  PNKKM L GFVSGGTIGG++N S  SS   AA     TS Q  R+ A+  SS SS
Sbjct  700  TEGTFPNKKMVLQGFVSGGTIGGNSNTSHNSSTFTAATSGAYTSSQPARDGANQKSSESS  759

Query  166  rdrqrerrrpSGWDR  122
            +++ RERRRPSGWDR
Sbjct  760  KEKSRERRRPSGWDR  774



>ref|XP_004494432.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like isoform 
X2 [Cicer arietinum]
Length=775

 Score =   173 bits (438),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 133/161 (83%), Gaps = 3/161 (2%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrskrdarkgggkrakgrggsgrgv  509
            TQKEARFAGELVNSL+ AGQNV  ELMDLAMKDGRFRSKRDARKGGG++ KGRGG G G 
Sbjct  581  TQKEARFAGELVNSLVAAGQNVSTELMDLAMKDGRFRSKRDARKGGGRKGKGRGGGGAGG  640

Query  508  rgv---DYGLGIGYSAESSNAPTTTVPSRSAAVNSLRTGMMAQFKSNFVAASSNLQNQAL  338
            +GV   D+GLGIGY+AE +NAP+ TVPSRSAAVNSLRTGMM+QF+SNFVAASSN QN+  
Sbjct  641  KGVRGVDFGLGIGYTAEPNNAPSNTVPSRSAAVNSLRTGMMSQFRSNFVAASSNSQNEGF  700

Query  337  GNSSGMNPNKKMALPGFVSGGTIGGDTNASRTSSISNAATS  215
             N++ +  NK+ AL GFVSGG+IGGD N  + ++  N ATS
Sbjct  701  SNNTSITVNKRPALAGFVSGGSIGGDINTHQHTASYNPATS  741



>ref|XP_002277419.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 [Vitis vinifera]
 emb|CBI36962.3| unnamed protein product [Vitis vinifera]
Length=771

 Score =   172 bits (437),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 140/195 (72%), Positives = 155/195 (79%), Gaps = 6/195 (3%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrskrdarkgggkrakgrggsgrgv  509
            T KEARFAGELV SLI AGQNVP ELMDLAMKDGRFRSKRDARKGGGK++KG+GG+GRGV
Sbjct  577  THKEARFAGELVGSLIAAGQNVPMELMDLAMKDGRFRSKRDARKGGGKKSKGKGGNGRGV  636

Query  508  rgvDYGLGIGYSAESSNAPTTTVPSRSAAVNSLRTGMMAQFKSNFVAASSNLQNQALGNS  329
            RGVD+GLGIGY+ ES+N  + TVPSR+AAVNSLRTGMMAQFKSNFVAA+S  QNQ   NS
Sbjct  637  RGVDFGLGIGYNPESNNPSSQTVPSRAAAVNSLRTGMMAQFKSNFVAATSGSQNQGSNNS  696

Query  328  SGMNPNKKMALPGFVSGGTIGGDTN-ASRTSSISNAATSV-----QKPREDASHLssgss  167
                 NK+  L GFVSGG+IGGD N A  TSS S A TS      Q   E+ASH +S +S
Sbjct  697  PSTYANKRPVLQGFVSGGSIGGDMNRAQTTSSFSPAPTSAGKTSGQNSGENASHRNSENS  756

Query  166  rdrqrerrrpSGWDR  122
            RDR RERRRPSGWDR
Sbjct  757  RDRSRERRRPSGWDR  771



>emb|CAN74586.1| hypothetical protein VITISV_041989 [Vitis vinifera]
Length=771

 Score =   172 bits (437),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 140/195 (72%), Positives = 155/195 (79%), Gaps = 6/195 (3%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrskrdarkgggkrakgrggsgrgv  509
            T KEARFAGELV SLI AGQNVP ELMDLAMKDGRFRSKRDARKGGGK++KG+GG+GRGV
Sbjct  577  THKEARFAGELVGSLIAAGQNVPMELMDLAMKDGRFRSKRDARKGGGKKSKGKGGNGRGV  636

Query  508  rgvDYGLGIGYSAESSNAPTTTVPSRSAAVNSLRTGMMAQFKSNFVAASSNLQNQALGNS  329
            RGVD+GLGIGY+ ES+N  + TVPSR+AAVNSLRTGMMAQFKSNFVAA+S  QNQ   NS
Sbjct  637  RGVDFGLGIGYNPESNNPSSQTVPSRAAAVNSLRTGMMAQFKSNFVAATSGSQNQGSNNS  696

Query  328  SGMNPNKKMALPGFVSGGTIGGDTN-ASRTSSISNAATSV-----QKPREDASHLssgss  167
                 NK+  L GFVSGG+IGGD N A  TSS S A TS      Q   E+ASH +S +S
Sbjct  697  PSTYANKRPVLQGFVSGGSIGGDMNRAQTTSSFSPAPTSAGKTSGQNSGENASHRNSENS  756

Query  166  rdrqrerrrpSGWDR  122
            RDR RERRRPSGWDR
Sbjct  757  RDRSRERRRPSGWDR  771



>ref|XP_004229381.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 [Solanum lycopersicum]
 ref|XP_010322339.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 [Solanum lycopersicum]
Length=774

 Score =   168 bits (425),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 132/195 (68%), Positives = 148/195 (76%), Gaps = 6/195 (3%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrskrdarkgggkrakgrggsgrgv  509
            T KEARFAGEL NSL+ AGQ V  ELMDLAMKDGRFRSKRDARKGGGKRAKGRGG     
Sbjct  580  THKEARFAGELANSLVAAGQTVSVELMDLAMKDGRFRSKRDARKGGGKRAKGRGGGNNKG  639

Query  508  rg-vDYGLGIGYSAESSNAPTTTVPSRSAAVNSLRTGMMAQFKSNFVAASSNLQNQALGN  332
               VD+GLGIGY+ ES+N   +  PSRSAAVNSLRTGMM+QFKS+FVAASSN QNQ + N
Sbjct  640  VRGVDFGLGIGYNPESNNPLQSAAPSRSAAVNSLRTGMMSQFKSSFVAASSNSQNQGMNN  699

Query  331  SSGMNPNKKMALPGFVSGGTIGGDTNASRTSSISNAA-----TSVQKPREDASHLssgss  167
            ++G  PNKKM L GFVSGGTIGG++N    SS   AA     TS Q  R+ A+  SS SS
Sbjct  700  TAGAFPNKKMVLQGFVSGGTIGGNSNTPHISSTFTAATPGGYTSSQPARDGANQKSSESS  759

Query  166  rdrqrerrrpSGWDR  122
            ++R RERRRPSGWDR
Sbjct  760  KERSRERRRPSGWDR  774



>ref|XP_007163191.1| hypothetical protein PHAVU_001G214100g [Phaseolus vulgaris]
 gb|ESW35185.1| hypothetical protein PHAVU_001G214100g [Phaseolus vulgaris]
Length=760

 Score =   166 bits (421),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 130/161 (81%), Gaps = 6/161 (4%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrskrdarkgggkrakgrggsgrgv  509
            TQKEARFAGELVNSL+ AGQNV  ELMDLAMKDGRFRSKRDARKGGGK+ +GRGG G G 
Sbjct  572  TQKEARFAGELVNSLVAAGQNVSVELMDLAMKDGRFRSKRDARKGGGKKGRGRGGGGGGR  631

Query  508  rgv--DYGLGIGYSAESSNAPTTTVPSRSAAVNSLRTGMMAQFKSNFVAASSNLQNQALG  335
                 D+GLGIGY+ ESS    +TVP+RSAAVNSLRTGMM+QFKSNFVAASSN +NQ  G
Sbjct  632  GVRGVDFGLGIGYNPESS----STVPTRSAAVNSLRTGMMSQFKSNFVAASSNSENQGFG  687

Query  334  NSSGMNPNKKMALPGFVSGGTIGGDTNASRTSSISNAATSV  212
            N++ M  NK+ ALPGFVSGG+IGGD N  + ++   A+++V
Sbjct  688  NNTSMAANKRPALPGFVSGGSIGGDVNTYQHTASLPASSAV  728



>gb|AGV54423.1| DEAD-box ATP-dependent RNA helicase 24-like protein [Phaseolus 
vulgaris]
Length=760

 Score =   166 bits (420),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 130/161 (81%), Gaps = 6/161 (4%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrskrdarkgggkrakgrggsgrgv  509
            TQKEARFAGELVNSL+ AGQNV  ELMDLAMKDGRFRSKRDARKGGGK+ +GRGG G G 
Sbjct  572  TQKEARFAGELVNSLVAAGQNVSVELMDLAMKDGRFRSKRDARKGGGKKGRGRGGGGGGR  631

Query  508  rgv--DYGLGIGYSAESSNAPTTTVPSRSAAVNSLRTGMMAQFKSNFVAASSNLQNQALG  335
                 D+GLGIGY+ ESS    +TVP+RSAAVNSLRTGMM+QFKSNFVAASSN +NQ  G
Sbjct  632  GVRGVDFGLGIGYNPESS----STVPTRSAAVNSLRTGMMSQFKSNFVAASSNSENQGFG  687

Query  334  NSSGMNPNKKMALPGFVSGGTIGGDTNASRTSSISNAATSV  212
            N++ M  NK+ ALPGFVSGG+IGGD N  + ++   A+++V
Sbjct  688  NNTSMAANKRPALPGFVSGGSIGGDVNTYQHTASLPASSAV  728



>gb|KDO86968.1| hypothetical protein CISIN_1g003881mg [Citrus sinensis]
Length=787

 Score =   164 bits (414),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 111/153 (73%), Positives = 130/153 (85%), Gaps = 0/153 (0%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrskrdarkgggkrakgrggsgrgv  509
            TQKEARFAGELVNSLI AGQNV  ELMDLAMKDGRFRSKRDARKGGGK+ KGRGG+GRGV
Sbjct  576  TQKEARFAGELVNSLIAAGQNVSMELMDLAMKDGRFRSKRDARKGGGKKGKGRGGAGRGV  635

Query  508  rgvDYGLGIGYSAESSNAPTTTVPSRSAAVNSLRTGMMAQFKSNFVAASSNLQNQALGNS  329
            RGVD+GLGIGY+ ES+N  + +VPSRSAAVNSL+TGMM QF+SNFVAASSN  ++   NS
Sbjct  636  RGVDFGLGIGYTPESNNTSSQSVPSRSAAVNSLKTGMMTQFRSNFVAASSNTPSEGFNNS  695

Query  328  SGMNPNKKMALPGFVSGGTIGGDTNASRTSSIS  230
            +    NK+ AL GFVSGG+IGGD N ++T+ ++
Sbjct  696  ASAYANKRPALRGFVSGGSIGGDVNGTQTTGLT  728



>ref|XP_006444514.1| hypothetical protein CICLE_v10018925mg [Citrus clementina]
 ref|XP_006492349.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Citrus 
sinensis]
 gb|ESR57754.1| hypothetical protein CICLE_v10018925mg [Citrus clementina]
 gb|KDO86969.1| hypothetical protein CISIN_1g003881mg [Citrus sinensis]
 gb|KDO86970.1| hypothetical protein CISIN_1g003881mg [Citrus sinensis]
Length=789

 Score =   164 bits (414),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 111/153 (73%), Positives = 130/153 (85%), Gaps = 0/153 (0%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrskrdarkgggkrakgrggsgrgv  509
            TQKEARFAGELVNSLI AGQNV  ELMDLAMKDGRFRSKRDARKGGGK+ KGRGG+GRGV
Sbjct  576  TQKEARFAGELVNSLIAAGQNVSMELMDLAMKDGRFRSKRDARKGGGKKGKGRGGAGRGV  635

Query  508  rgvDYGLGIGYSAESSNAPTTTVPSRSAAVNSLRTGMMAQFKSNFVAASSNLQNQALGNS  329
            RGVD+GLGIGY+ ES+N  + +VPSRSAAVNSL+TGMM QF+SNFVAASSN  ++   NS
Sbjct  636  RGVDFGLGIGYTPESNNTSSQSVPSRSAAVNSLKTGMMTQFRSNFVAASSNTPSEGFNNS  695

Query  328  SGMNPNKKMALPGFVSGGTIGGDTNASRTSSIS  230
            +    NK+ AL GFVSGG+IGGD N ++T+ ++
Sbjct  696  ASAYANKRPALRGFVSGGSIGGDVNGTQTTGLT  728



>ref|XP_010069832.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 [Eucalyptus 
grandis]
 gb|KCW58317.1| hypothetical protein EUGRSUZ_H01004 [Eucalyptus grandis]
Length=797

 Score =   163 bits (413),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 131/206 (64%), Positives = 152/206 (74%), Gaps = 18/206 (9%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrskrdarkgggkrakgrggsgrgv  509
            TQKEARF GELVNSLI AGQNVP ELMDLAMKDGRFRSKRD+RKGGG++ +GRGG G   
Sbjct  593  TQKEARFGGELVNSLIAAGQNVPMELMDLAMKDGRFRSKRDSRKGGGRKGRGRGGGGGSG  652

Query  508  rgv------------DYGLGIGYSAESSNAPTTTVPSRSAAVNSLRTGMMAQFKSNFVAA  365
             G             DYGLGIGY+AESS AP+   PSR AAVNSL+TGMMAQFKSNFVAA
Sbjct  653  GGSGGGGGGRGVRGVDYGLGIGYNAESS-APSQNAPSRPAAVNSLKTGMMAQFKSNFVAA  711

Query  364  SSNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASRTSSISNAAT-----SVQKPR  200
            +SN QNQ + +SS M  +K+ A+ GFVSGGTIGGD   ++T+  S+  T     +  +P 
Sbjct  712  ASNSQNQGINSSSNMYASKRPAMTGFVSGGTIGGDAYKAQTTKSSSTPTSGVNPTGHRPT  771

Query  199  EDASHLssgssrdrqrerrrpSGWDR  122
            E+A H SS SSRD+ RERRRPSGWDR
Sbjct  772  ENAGHRSSESSRDKTRERRRPSGWDR  797



>ref|XP_003625986.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
 gb|AES82204.1| DEAD-box ATP-dependent RNA helicase-like protein [Medicago truncatula]
Length=775

 Score =   162 bits (409),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 106/160 (66%), Positives = 124/160 (78%), Gaps = 2/160 (1%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrskrdarkgggkrakgrggsgrgv  509
            TQKEARFAGELVNSL+ AGQNV  ELMDLAMKDGRFRSKRDARKGGG++ KGRGG   G 
Sbjct  582  TQKEARFAGELVNSLVAAGQNVSTELMDLAMKDGRFRSKRDARKGGGRKGKGRGGGAGGK  641

Query  508  rgv--DYGLGIGYSAESSNAPTTTVPSRSAAVNSLRTGMMAQFKSNFVAASSNLQNQALG  335
                 D+GLGIGYS +S+NAP+  VP RSAAVNSLRTGMM+QF+S+FVAASS  QN+   
Sbjct  642  GVRGVDFGLGIGYSTDSNNAPSNAVPGRSAAVNSLRTGMMSQFRSSFVAASSTSQNEGFS  701

Query  334  NSSGMNPNKKMALPGFVSGGTIGGDTNASRTSSISNAATS  215
            N++ M  NK+  L GFVSGG+IGGD N  + ++  N A S
Sbjct  702  NNTSMAVNKRPTLAGFVSGGSIGGDINTHQQTASYNPAPS  741



>gb|EYU46816.1| hypothetical protein MIMGU_mgv1a001735mg [Erythranthe guttata]
Length=767

 Score =   160 bits (404),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 128/148 (86%), Gaps = 1/148 (1%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrskrdarkgggkrakgrggsgrgv  509
            TQKE RFAGEL+NSL+ AGQNVP ELMDLAMKDGRFRSKRDARKGGGKRAKGRG SGRGV
Sbjct  579  TQKEVRFAGELINSLVAAGQNVPMELMDLAMKDGRFRSKRDARKGGGKRAKGRGSSGRGV  638

Query  508  rgvDYGLGIGYSAESSNAPTTTVPSRSAAVNSLRTGMMAQFKSNFVAASSNLQNQALGNS  329
            RGVD+GLGIGY++ES  A   T PSR AAVNSLRTGMM+Q ++NFV ASSN QNQ L +S
Sbjct  639  RGVDFGLGIGYNSESKPASNAT-PSRPAAVNSLRTGMMSQARNNFVPASSNSQNQFLQSS  697

Query  328  SGMNPNKKMALPGFVSGGTIGGDTNASR  245
            +G+  +++ ALPGFVSGGTIGGD +A++
Sbjct  698  AGVQTHRRTALPGFVSGGTIGGDIHAAK  725



>ref|XP_011042271.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 [Populus euphratica]
Length=800

 Score =   157 bits (398),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 110/151 (73%), Positives = 125/151 (83%), Gaps = 0/151 (0%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrskrdarkgggkrakgrggsgrgv  509
            TQKEARFAGELVNSLI AGQNV  ELMDLAMKDGRFRSKRD+RKGGGK+ KGRGG  RGV
Sbjct  576  TQKEARFAGELVNSLIAAGQNVSVELMDLAMKDGRFRSKRDSRKGGGKKGKGRGGGSRGV  635

Query  508  rgvDYGLGIGYSAESSNAPTTTVPSRSAAVNSLRTGMMAQFKSNFVAASSNLQNQALGNS  329
            RGVD+GLGIGY+ ES++  +  V SRS AVNSLRTG+MAQFKSNFVAA+SN Q+  L  S
Sbjct  636  RGVDFGLGIGYNPESNSTSSPAVTSRSTAVNSLRTGVMAQFKSNFVAATSNSQSPGLNTS  695

Query  328  SGMNPNKKMALPGFVSGGTIGGDTNASRTSS  236
            S +  NK+ AL GFVSGG+IGGD N  +T+S
Sbjct  696  SSVYANKRPALRGFVSGGSIGGDMNRPQTTS  726



>gb|KJB22489.1| hypothetical protein B456_004G050200 [Gossypium raimondii]
Length=774

 Score =   155 bits (391),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 111/160 (69%), Positives = 125/160 (78%), Gaps = 5/160 (3%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrskr-darkgggkrakgrggsgrg  512
            TQKEARFAGELVNSLI AGQNV  ELMDLAMKDGRFRSKR   + G   R +G GGSGRG
Sbjct  583  TQKEARFAGELVNSLIAAGQNVSMELMDLAMKDGRFRSKRNARKGGMKGRGRGGGGSGRG  642

Query  511  vrgvDYGLGIGYSAESSNAPTTTVPSRSAAVNSLRTGMMAQFKSNFVAASSNLQNQALGN  332
            VRGVD+GLGIGY+ ESSNA +  V SR+AAVNSL+TGMMAQ KSNFVAASSN Q+Q   N
Sbjct  643  VRGVDFGLGIGYNPESSNASSQAVQSRNAAVNSLKTGMMAQMKSNFVAASSNSQSQGFNN  702

Query  331  SSGMNPNKKMALPGFVSGGTIGGDTNASR-TSSISNAATS  215
            SS +   ++  L GFVSGGTIGGD N S+ T+S + A TS
Sbjct  703  SSSI---RRPTLSGFVSGGTIGGDINRSQMTTSFNTAPTS  739



>gb|KJB22487.1| hypothetical protein B456_004G050200 [Gossypium raimondii]
Length=793

 Score =   155 bits (391),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 123/161 (76%), Gaps = 6/161 (4%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrsk--rdarkgggkrakgrggsgr  515
            TQKEARFAGELVNSLI AGQNV  ELMDLAMKDGRFRSK       G   R +G GGSGR
Sbjct  583  TQKEARFAGELVNSLIAAGQNVSMELMDLAMKDGRFRSKRNARKGGGKKGRGRGGGGSGR  642

Query  514  gvrgvDYGLGIGYSAESSNAPTTTVPSRSAAVNSLRTGMMAQFKSNFVAASSNLQNQALG  335
            GVRGVD+GLGIGY+ ESSNA +  V SR+AAVNSL+TGMMAQ KSNFVAASSN Q+Q   
Sbjct  643  GVRGVDFGLGIGYNPESSNASSQAVQSRNAAVNSLKTGMMAQMKSNFVAASSNSQSQGFN  702

Query  334  NSSGMNPNKKMALPGFVSGGTIGGDTNASR-TSSISNAATS  215
            NSS +   ++  L GFVSGGTIGGD N S+ T+S + A TS
Sbjct  703  NSSSI---RRPTLSGFVSGGTIGGDINRSQMTTSFNTAPTS  740



>gb|KJB22491.1| hypothetical protein B456_004G050200 [Gossypium raimondii]
 gb|KJB22492.1| hypothetical protein B456_004G050200 [Gossypium raimondii]
Length=775

 Score =   155 bits (391),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 123/161 (76%), Gaps = 6/161 (4%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrsk--rdarkgggkrakgrggsgr  515
            TQKEARFAGELVNSLI AGQNV  ELMDLAMKDGRFRSK       G   R +G GGSGR
Sbjct  583  TQKEARFAGELVNSLIAAGQNVSMELMDLAMKDGRFRSKRNARKGGGKKGRGRGGGGSGR  642

Query  514  gvrgvDYGLGIGYSAESSNAPTTTVPSRSAAVNSLRTGMMAQFKSNFVAASSNLQNQALG  335
            GVRGVD+GLGIGY+ ESSNA +  V SR+AAVNSL+TGMMAQ KSNFVAASSN Q+Q   
Sbjct  643  GVRGVDFGLGIGYNPESSNASSQAVQSRNAAVNSLKTGMMAQMKSNFVAASSNSQSQGFN  702

Query  334  NSSGMNPNKKMALPGFVSGGTIGGDTNASR-TSSISNAATS  215
            NSS +   ++  L GFVSGGTIGGD N S+ T+S + A TS
Sbjct  703  NSSSI---RRPTLSGFVSGGTIGGDINRSQMTTSFNTAPTS  740



>ref|XP_002301515.2| DEAD/DEAH box helicase family protein [Populus trichocarpa]
 gb|EEE80788.2| DEAD/DEAH box helicase family protein [Populus trichocarpa]
Length=807

 Score =   154 bits (388),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 112/158 (71%), Positives = 127/158 (80%), Gaps = 7/158 (4%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrskrdarkgggkrakgrggsgrgv  509
            TQKEARFAGELVNSLI AGQNV  ELMDLAMKDGRFRSKRD+RKGGGK+ KGRGG  RGV
Sbjct  576  TQKEARFAGELVNSLIAAGQNVSVELMDLAMKDGRFRSKRDSRKGGGKKGKGRGGGSRGV  635

Query  508  rgvDYGLGIGYSAES--SNAPTTT-----VPSRSAAVNSLRTGMMAQFKSNFVAASSNLQ  350
            RGVD+GLGIGY+ ES  +++P  T     V SRS AVNSLRTG+MAQFKSNFVAA+SN Q
Sbjct  636  RGVDFGLGIGYNPESNSTSSPAVTSRSPAVTSRSTAVNSLRTGVMAQFKSNFVAATSNSQ  695

Query  349  NQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASRTSS  236
            +  L  SS +  NK+ AL GFVSGG+IGGD N  +T+S
Sbjct  696  SPGLNTSSSVYANKRPALRGFVSGGSIGGDMNRPQTTS  733



>ref|XP_010267974.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 [Nelumbo nucifera]
Length=771

 Score =   153 bits (386),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 123/197 (62%), Positives = 144/197 (73%), Gaps = 11/197 (6%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrskrdarkgggkrakgrggsgrgv  509
            TQKEARFAGELVNSLI AGQNV  ELMDLAMKDGRFRSKRDARKG   +  G  G G G 
Sbjct  578  TQKEARFAGELVNSLIAAGQNVSVELMDLAMKDGRFRSKRDARKGSSGKRGGGRGKGSGG  637

Query  508  rgv---DYGLGIGYSAESSNAPTTTVPSRSAAVNSLRTGMMAQFKSNFVAASSNLQNQAL  338
            RGV   DYGLGIGY+ ES+N P+ +VPSRS+AVN+LRTGMMAQFKSNFVAA S+ QN + 
Sbjct  638  RGVRGVDYGLGIGYNPESANTPSQSVPSRSSAVNALRTGMMAQFKSNFVAAKSDSQNSSF  697

Query  337  GNSSGMNPNKKMALPGFVSGGTIGGDTNASRTSSISNAA-----TSVQKPREDASHLssg  173
             ++   N +K+  LPGFVSGG+IGGD N ++T++  N       T+    +E+ S     
Sbjct  698  SSA---NVSKRPVLPGFVSGGSIGGDANRTQTTTSFNPTPSGGQTTSGSSKENGSQKKME  754

Query  172  ssrdrqrerrrpSGWDR  122
            SS DR RERRRPSGWDR
Sbjct  755  SSGDRPRERRRPSGWDR  771



>gb|KHG13095.1| DEAD-box ATP-dependent RNA helicase 24 -like protein [Gossypium 
arboreum]
Length=731

 Score =   152 bits (384),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 104/158 (66%), Positives = 117/158 (74%), Gaps = 5/158 (3%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrsk--rdarkgggkrakgrggsgr  515
            TQKEARFAGELVNSLI AGQNV  ELMDLAMKDGRFRSK       G   R +G   SGR
Sbjct  539  TQKEARFAGELVNSLIAAGQNVSMELMDLAMKDGRFRSKRNARKGGGKKGRGRGGCRSGR  598

Query  514  gvrgvDYGLGIGYSAESSNAPTTTVPSRSAAVNSLRTGMMAQFKSNFVAASSNLQNQALG  335
            GVRGVDYG+GIGY+ ES NA +  V SR+AAVNSL+TGMMAQ KSNFVAASSN Q+Q   
Sbjct  599  GVRGVDYGMGIGYNPESGNASSQAVQSRNAAVNSLKTGMMAQMKSNFVAASSNSQSQGFN  658

Query  334  NSSGMNPNKKMALPGFVSGGTIGGDTNASRTSSISNAA  221
            NSS +   ++  L GFVSGGTIGGD N S+ ++  N A
Sbjct  659  NSSSI---RRPTLSGFVSGGTIGGDINRSQMATSFNTA  693



>gb|KHG13094.1| DEAD-box ATP-dependent RNA helicase 24 -like protein [Gossypium 
arboreum]
Length=775

 Score =   152 bits (384),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 104/158 (66%), Positives = 117/158 (74%), Gaps = 5/158 (3%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrsk--rdarkgggkrakgrggsgr  515
            TQKEARFAGELVNSLI AGQNV  ELMDLAMKDGRFRSK       G   R +G   SGR
Sbjct  583  TQKEARFAGELVNSLIAAGQNVSMELMDLAMKDGRFRSKRNARKGGGKKGRGRGGCRSGR  642

Query  514  gvrgvDYGLGIGYSAESSNAPTTTVPSRSAAVNSLRTGMMAQFKSNFVAASSNLQNQALG  335
            GVRGVDYG+GIGY+ ES NA +  V SR+AAVNSL+TGMMAQ KSNFVAASSN Q+Q   
Sbjct  643  GVRGVDYGMGIGYNPESGNASSQAVQSRNAAVNSLKTGMMAQMKSNFVAASSNSQSQGFN  702

Query  334  NSSGMNPNKKMALPGFVSGGTIGGDTNASRTSSISNAA  221
            NSS +   ++  L GFVSGGTIGGD N S+ ++  N A
Sbjct  703  NSSSI---RRPTLSGFVSGGTIGGDINRSQMATSFNTA  737



>gb|KHG18820.1| DEAD-box ATP-dependent RNA helicase 24 -like protein [Gossypium 
arboreum]
Length=775

 Score =   152 bits (384),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 104/158 (66%), Positives = 117/158 (74%), Gaps = 5/158 (3%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrsk--rdarkgggkrakgrggsgr  515
            TQKEARFAGELVNSLI AGQNV  ELMDLAMKDGRFRSK       G   R +G   SGR
Sbjct  583  TQKEARFAGELVNSLIAAGQNVSMELMDLAMKDGRFRSKRNARKGGGKKGRGRGGCRSGR  642

Query  514  gvrgvDYGLGIGYSAESSNAPTTTVPSRSAAVNSLRTGMMAQFKSNFVAASSNLQNQALG  335
            GVRGVDYG+GIGY+ ES NA +  V SR+AAVNSL+TGMMAQ KSNFVAASSN Q+Q   
Sbjct  643  GVRGVDYGMGIGYNPESGNASSQAVQSRNAAVNSLKTGMMAQMKSNFVAASSNSQSQGFN  702

Query  334  NSSGMNPNKKMALPGFVSGGTIGGDTNASRTSSISNAA  221
            NSS +   ++  L GFVSGGTIGGD N S+ ++  N A
Sbjct  703  NSSSI---RRPTLSGFVSGGTIGGDINRSQMATSFNTA  737



>ref|XP_004156816.1| PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP-dependent RNA helicase 
24-like [Cucumis sativus]
Length=774

 Score =   152 bits (384),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 128/191 (67%), Positives = 142/191 (74%), Gaps = 3/191 (2%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrskrdarkgggkrakgrggsgrgv  509
            TQKEARFAGELVNSLI AGQNV  ELMDLAMKDGRFRSKRDARK GGK+ K RG +GRGV
Sbjct  585  TQKEARFAGELVNSLIAAGQNVSVELMDLAMKDGRFRSKRDARKKGGKKGKSRGSNGRGV  644

Query  508  rgvDYGLGIGYSAES--SNAPTTTVPSRSAAVNSLRTGMMAQFKSNFVAASSNLQNQALG  335
            RGVD+GLGIGY+ E   S   TT V SRSAAVNSLRTGMMAQFKSNFVAASS   NQ   
Sbjct  645  RGVDFGLGIGYNPEGTGSTPSTTDVQSRSAAVNSLRTGMMAQFKSNFVAASSAPPNQGSS  704

Query  334  NSSGMNPNKKMALPGFVSGGTIGGDTNASRTSSISNAATSVQKPREDASHLssgssrdrq  155
            NS  +  NK+  L GFVSGG+IGG  N S    +S   + +  P E +S  ++ SS DR 
Sbjct  705  NSYNVPANKRPTLSGFVSGGSIGGGAN-SPAPPVSRGNSYMPNPVEYSSQKNTESSSDRP  763

Query  154  rerrrpSGWDR  122
            RER+RPSGWDR
Sbjct  764  RERKRPSGWDR  774



>gb|KHG30147.1| DEAD-box ATP-dependent RNA helicase 24 -like protein [Gossypium 
arboreum]
Length=689

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 108/161 (67%), Positives = 120/161 (75%), Gaps = 6/161 (4%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrsk--rdarkgggkrakgrggsgr  515
            TQKEARFAGELVNSLI AGQNV  ELMDLAMKDGRFRSK       G   R +G GGSGR
Sbjct  497  TQKEARFAGELVNSLIAAGQNVSMELMDLAMKDGRFRSKRNARKGGGKKGRGRGGGGSGR  556

Query  514  gvrgvDYGLGIGYSAESSNAPTTTVPSRSAAVNSLRTGMMAQFKSNFVAASSNLQNQALG  335
            GVRGVD+GLGIGY+ ES NA +  V SR+AAVNSL+TGMMAQ KSNFVAASSN  +Q   
Sbjct  557  GVRGVDFGLGIGYNPESCNASSQAVQSRNAAVNSLKTGMMAQMKSNFVAASSNSPSQGFN  616

Query  334  NSSGMNPNKKMALPGFVSGGTIGGDTNASR-TSSISNAATS  215
            NSS +   ++  L GFVSGGTIGGD N S+  +S S A TS
Sbjct  617  NSSSI---RRPTLSGFVSGGTIGGDINRSQMATSFSTAPTS  654



>gb|KJB22485.1| hypothetical protein B456_004G050000 [Gossypium raimondii]
Length=776

 Score =   149 bits (377),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 127/196 (65%), Positives = 143/196 (73%), Gaps = 10/196 (5%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrsk--rdarkgggkrakgrggsgr  515
            TQKEARFAGELVNSLI AGQNV  ELMDLAMKDGRFRSK       G   R +G GGSGR
Sbjct  584  TQKEARFAGELVNSLIAAGQNVSMELMDLAMKDGRFRSKRNARKGGGKKGRGRGGGGSGR  643

Query  514  gvrgvDYGLGIGYSAESSNAPTTTVPSRSAAVNSLRTGMMAQFKSNFVAASSNLQNQALG  335
            GVRGVD+G+GIGY+ ESSNA +  V SR+AAVNSL+TGMMAQ KSNFVAAS+N  +Q   
Sbjct  644  GVRGVDFGMGIGYNPESSNASSQAVQSRNAAVNSLKTGMMAQMKSNFVAASTNPPSQGFN  703

Query  334  NSSGMNPNKKMALPGFVSGGTIGGDTNASR-TSSISNAATS----VQKPREDASHLssgs  170
            NSS +   ++  L GFVSGGTIGGD N S+  +S S A TS     Q   E+ +  SS S
Sbjct  704  NSSSI---RRPTLSGFVSGGTIGGDINRSQMATSFSTAPTSGLNTSQNTGENTTQRSSES  760

Query  169  srdrqrerrrpSGWDR  122
            SRDR RERRRPSGWDR
Sbjct  761  SRDRPRERRRPSGWDR  776



>emb|CDP17060.1| unnamed protein product [Coffea canephora]
Length=778

 Score =   147 bits (372),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 133/197 (68%), Positives = 154/197 (78%), Gaps = 8/197 (4%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrskrdarkgggkrakgrggsgrgv  509
            TQKEARFAGELVNSLI AGQNV  ELMDLAMKDGRFRSKRDARKGGGKR KGRGG GRGV
Sbjct  582  TQKEARFAGELVNSLIAAGQNVSVELMDLAMKDGRFRSKRDARKGGGKRTKGRGGGGRGV  641

Query  508  rgvDYGLGIGYSAESSNAPTTTVPSRSAAV--NSLRTGMMAQFKSNFVAASSNLQNQALG  335
            RGVDYGLGIGYSAESS+  +++    S +V  NSLRTGMM+QFK+NFVAASSN QNQ + 
Sbjct  642  RGVDYGLGIGYSAESSSLSSSSAAVPSRSVAANSLRTGMMSQFKNNFVAASSNSQNQGVN  701

Query  334  NSSGMNPNKKMALPGFVSGGTIGGDTNASRTSSISNAAT------SVQKPREDASHLssg  173
            +SS M  NK+  L GFVSGGTIGG+T +++T+  + AAT      +    R+DA   +  
Sbjct  702  SSSSMYANKRTVLSGFVSGGTIGGNTGSAQTTGSAGAATIPSGNNAAGIARDDAIRKNLE  761

Query  172  ssrdrqrerrrpSGWDR  122
            SS++R RERRRPSGWDR
Sbjct  762  SSKERPRERRRPSGWDR  778



>ref|XP_008454276.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 [Cucumis melo]
Length=776

 Score =   147 bits (370),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 125/196 (64%), Positives = 140/196 (71%), Gaps = 8/196 (4%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrskrdarkgggkrakgrggsgrgv  509
            TQKEARFAGELVNSLI AGQNV  ELMDLAMKDGRFRSKRDARK GG    G+ G  RG 
Sbjct  582  TQKEARFAGELVNSLIAAGQNVSVELMDLAMKDGRFRSKRDARKKGGGGGGGKKGKSRGS  641

Query  508  -----rgvDYGLGIGYSAESS-NAPTTT-VPSRSAAVNSLRTGMMAQFKSNFVAASSNLQ  350
                 RGVD+GLGIGY+ E S + P+TT V SRSAAVNSLRTGMMAQFKSNFVAASS   
Sbjct  642  NGRGVRGVDFGLGIGYNPEGSGSTPSTTNVQSRSAAVNSLRTGMMAQFKSNFVAASSAPP  701

Query  349  NQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASRTSSISNAATSVQKPREDASHLssgs  170
            +Q   NS  M  NK+  L GFVSGG+IGG  N S    +S   + +  P E +S  ++ S
Sbjct  702  SQGSSNSYNMPANKRPTLSGFVSGGSIGGGAN-SPAPPVSRGNSYMPNPVEYSSQKNTES  760

Query  169  srdrqrerrrpSGWDR  122
            S DR RER+RPSGWDR
Sbjct  761  SSDRPRERKRPSGWDR  776



>ref|XP_004152219.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Cucumis 
sativus]
 gb|KGN52865.1| hypothetical protein Csa_4G004270 [Cucumis sativus]
Length=777

 Score =   146 bits (369),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 122/197 (62%), Positives = 134/197 (68%), Gaps = 9/197 (5%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrskrdarkgggkrakgrggsgrg-  512
            TQKEARFAGELVNSLI AGQNV  ELMDLAMKDGRFRSKRDARK GG    G        
Sbjct  582  TQKEARFAGELVNSLIAAGQNVSVELMDLAMKDGRFRSKRDARKKGGGGGGGGKKGKSRG  641

Query  511  -----vrgvDYGLGIGYSAES--SNAPTTTVPSRSAAVNSLRTGMMAQFKSNFVAASSNL  353
                 VRGVD+GLGIGY+ E   S   TT V SRSAAVNSLRTGMMAQFKSNFVAASS  
Sbjct  642  SNGRGVRGVDFGLGIGYNPEGTGSTPSTTNVQSRSAAVNSLRTGMMAQFKSNFVAASSAP  701

Query  352  QNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASRTSSISNAATSVQKPREDASHLssg  173
             NQ   NS  +  NK+  L GFVSGG+IGG  N S    +S   + +  P E +S  ++ 
Sbjct  702  PNQGSSNSYNVPANKRPTLSGFVSGGSIGGGAN-SPAPPVSRGNSYMPNPVEYSSQKNTE  760

Query  172  ssrdrqrerrrpSGWDR  122
            SS DR RER+RPSGWDR
Sbjct  761  SSSDRPRERKRPSGWDR  777



>ref|XP_010087224.1| DEAD-box ATP-dependent RNA helicase 24 [Morus notabilis]
 gb|EXB28574.1| DEAD-box ATP-dependent RNA helicase 24 [Morus notabilis]
Length=686

 Score =   144 bits (364),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 126/169 (75%), Gaps = 11/169 (7%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrskrdarkgggkrakgrggsgrgv  509
            TQKEARFAGELVNSLI AGQNV  ELMDLAMKDGRFRSKRDARKGGGK+ +GRGG G G 
Sbjct  482  TQKEARFAGELVNSLIAAGQNVSVELMDLAMKDGRFRSKRDARKGGGKKGRGRGGGGGGG  541

Query  508  rgv----------DYGLGIGYSAESSNAPTTTVPSRSAAVNSLRTGMMAQFKSNFVAASS  359
             G           D+GLGIGY+ ES+NA    VPSRSAAVNSLRTGMM QFKSNFVAASS
Sbjct  542  GGGGGGGRGVRGVDFGLGIGYNPESNNASPQAVPSRSAAVNSLRTGMMTQFKSNFVAASS  601

Query  358  NLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASRTS-SISNAATS  215
            N QNQ   N S    N + AL GFVSGG+IGGD   ++T+ S+S+  TS
Sbjct  602  NSQNQGSSNYSSAPTNNRPALAGFVSGGSIGGDIYRTQTTNSVSSVPTS  650



>ref|XP_010679397.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=772

 Score =   145 bits (365),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 110/163 (67%), Positives = 125/163 (77%), Gaps = 13/163 (8%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrskrda----rkgggkrakgrggs  521
            T KEARFAGE+VNSLI AGQNV  ELMDLAMKDGRFRSKRDA     K G  R  G GG 
Sbjct  581  THKEARFAGEMVNSLIAAGQNVTMELMDLAMKDGRFRSKRDARKGGGKKGKGRGGGGGGG  640

Query  520  grgvrgvDYGLGIGYSAESSNA---PTTTVPSRSAAVNSLRTGMMAQFKSNFVAASSNLQ  350
            GRGVRGVD+GLGIGY+ ES+NA   P T    R+AAVNSLRTGMMAQFKSNFVAASS+ Q
Sbjct  641  GRGVRGVDFGLGIGYNTESNNASFQPAT----RTAAVNSLRTGMMAQFKSNFVAASSSSQ  696

Query  349  NQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASRTSSISNAA  221
            NQA  NS+    NK+ +L GFV+GGTIGGD N  +++S++N A
Sbjct  697  NQATSNSNTFV-NKRPSLSGFVAGGTIGGD-NRPQSTSLTNYA  737



>ref|XP_002515267.1| hypothetical protein RCOM_1346600 [Ricinus communis]
 gb|EEF47251.1| hypothetical protein RCOM_1346600 [Ricinus communis]
Length=791

 Score =   144 bits (364),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 107/151 (71%), Positives = 120/151 (79%), Gaps = 7/151 (5%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrskrdarkgggkrakgrggsgrgv  509
            TQKEARFAGELVNSLI AGQNV  ELMDLAMKDGRFRSKRDARKG GK+ +GR G GRGV
Sbjct  575  TQKEARFAGELVNSLIAAGQNVSGELMDLAMKDGRFRSKRDARKGAGKKGRGRAGVGRGV  634

Query  508  rgvDYGLGIGYSAESSNAPTTTVPSRSAAVNSLRTGMMAQFKSNFVAASSNLQNQALGNS  329
            RGVD+GLGIGY+ ESS+  +  VPSRS AVNS R+GMMAQFKS+FVAASSN Q      S
Sbjct  635  RGVDFGLGIGYNPESSST-SQAVPSRSTAVNSARSGMMAQFKSSFVAASSNSQ------S  687

Query  328  SGMNPNKKMALPGFVSGGTIGGDTNASRTSS  236
                 N + AL GFVSGG+IGGD N ++T+S
Sbjct  688  PSAYANNRPALRGFVSGGSIGGDLNITQTTS  718



>ref|XP_007051129.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 2 [Theobroma cacao]
 gb|EOX95286.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 2 [Theobroma cacao]
Length=781

 Score =   144 bits (362),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 108/165 (65%), Positives = 122/165 (74%), Gaps = 10/165 (6%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrskrda------rkgggkrakgrg  527
            TQKEARFAGELVNSLI AGQNV  ELMDLAMKDGRFRSKRDA      +  G     G G
Sbjct  582  TQKEARFAGELVNSLIAAGQNVSMELMDLAMKDGRFRSKRDARKGGGKKGRGRGGGGGGG  641

Query  526  gsgrgvrgvDYGLGIGYSAESSNAPTTTVPSRSAAVNSLRTGMMAQFKSNFVAASSNLQN  347
            G GRGVRGVDYGLGIGY+ ESS + +    SR+AAVNSL+TGMMAQFKS+FVAASS  Q 
Sbjct  642  GGGRGVRGVDYGLGIGYNPESSISSSQAAQSRTAAVNSLKTGMMAQFKSSFVAASSTSQG  701

Query  346  QALGNSSGMNPNKKMALPGFVSGGTIGGDTNASRT-SSISNAATS  215
            Q   NSS +   ++  L GFVSGGTIGGD N ++T SS++ A TS
Sbjct  702  QGFSNSSSI---RRPTLAGFVSGGTIGGDINRAQTASSLTTAPTS  743



>ref|XP_007051128.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOX95285.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 1 [Theobroma cacao]
Length=838

 Score =   143 bits (360),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 108/165 (65%), Positives = 122/165 (74%), Gaps = 10/165 (6%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrskrda------rkgggkrakgrg  527
            TQKEARFAGELVNSLI AGQNV  ELMDLAMKDGRFRSKRDA      +  G     G G
Sbjct  582  TQKEARFAGELVNSLIAAGQNVSMELMDLAMKDGRFRSKRDARKGGGKKGRGRGGGGGGG  641

Query  526  gsgrgvrgvDYGLGIGYSAESSNAPTTTVPSRSAAVNSLRTGMMAQFKSNFVAASSNLQN  347
            G GRGVRGVDYGLGIGY+ ESS + +    SR+AAVNSL+TGMMAQFKS+FVAASS  Q 
Sbjct  642  GGGRGVRGVDYGLGIGYNPESSISSSQAAQSRTAAVNSLKTGMMAQFKSSFVAASSTSQG  701

Query  346  QALGNSSGMNPNKKMALPGFVSGGTIGGDTNASRT-SSISNAATS  215
            Q   NSS +   ++  L GFVSGGTIGGD N ++T SS++ A TS
Sbjct  702  QGFSNSSSI---RRPTLAGFVSGGTIGGDINRAQTASSLTTAPTS  743



>ref|XP_006840470.1| hypothetical protein AMTR_s00045p00182070 [Amborella trichopoda]
 gb|ERN02145.1| hypothetical protein AMTR_s00045p00182070 [Amborella trichopoda]
Length=768

 Score =   142 bits (358),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 103/174 (59%), Positives = 127/174 (73%), Gaps = 16/174 (9%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrskrdarkgggkrakgrggsgrgv  509
            TQKEARFAGELVNSLI AGQNVP ELMDLA+KDGRF++KRDARKG G +  G  G G G 
Sbjct  576  TQKEARFAGELVNSLIAAGQNVPPELMDLALKDGRFKAKRDARKGSGGKKGGGKGKGGGG  635

Query  508  rg--------vDYGLGIGYSAESSNAPT-TTVPSRSAAVNSLRTGMMAQFKSNFVAASSN  356
             G        VDYGLGIGY+ ES++AP+ +++PSRSAA+NSLRTGMMAQFKSNFVAA+S+
Sbjct  636  GGGTGRGVRGVDYGLGIGYNPESASAPSQSSIPSRSAAMNSLRTGMMAQFKSNFVAATSD  695

Query  355  ---LQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASRTSSISNAATSVQKP  203
                QN+   +S+    N+ + L GFVSGG+IGG+    ++S   N   S+ KP
Sbjct  696  DNSSQNEGRSSSNTSTGNRPV-LAGFVSGGSIGGEARGPQSSGAPN---SMSKP  745



>ref|XP_010938236.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Elaeis 
guineensis]
 ref|XP_010938237.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Elaeis 
guineensis]
 ref|XP_010938238.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Elaeis 
guineensis]
Length=769

 Score =   142 bits (358),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 119/197 (60%), Positives = 142/197 (72%), Gaps = 13/197 (7%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrskrdarkgggkrakgrggsgrgv  509
            TQKEARFAGELVNSL+TAGQNV  ELMDLAMKDGRFR+KRDARKGG K      G G   
Sbjct  578  TQKEARFAGELVNSLVTAGQNVSPELMDLAMKDGRFRAKRDARKGGKKGGGRGKGGGASG  637

Query  508  rgvD---YGLGIGYSAESSNAPTTTVPSRSAAVNSLRTGMMAQFKSNFVAASSN----LQ  350
            RGV    YGLGIGY+ ES+NA + + PSRS+ VNSLRTGMMA+FKSNFVAA+SN    ++
Sbjct  638  RGVRGVDYGLGIGYNPESANATSQSAPSRSSTVNSLRTGMMARFKSNFVAATSNSMGDVR  697

Query  349  NQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASR-TSSISNAATSVQKPREDASHLssg  173
            NQ+  +SSG     +  L GFVSGG IGG+   S+  +S + A+ S     E+ +  +S 
Sbjct  698  NQSSLSSSG-----RPVLSGFVSGGLIGGEAYKSQPATSFTPASKSGGNTSENGNQKNSE  752

Query  172  ssrdrqrerrrpSGWDR  122
            SSRDR RER+RPSGWDR
Sbjct  753  SSRDRPRERKRPSGWDR  769



>gb|KFK37476.1| hypothetical protein AALP_AA4G262200 [Arabis alpina]
Length=758

 Score =   141 bits (356),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 117/207 (57%), Positives = 148/207 (71%), Gaps = 26/207 (13%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrskrdarkgggkrakgrggsgrgv  509
            TQ+EARFAGELVNSL+ AGQNVP ELMDLAMKDGRF+SKRD RKGGGK+++GRGG G G 
Sbjct  558  TQREARFAGELVNSLVAAGQNVPPELMDLAMKDGRFKSKRDGRKGGGKKSRGRGGGGGGN  617

Query  508  rg---vDYGLGIGYSAESSNAPTTTVPSRSAAV--------------NSLRTGMMAQFKS  380
            RG   VD+GLGIG+++ESS  P+   PSRSAAV              NS+RTG+MAQFK+
Sbjct  618  RGVRGVDFGLGIGFNSESSGTPSQAAPSRSAAVPGRSAAAPSRTGAINSVRTGVMAQFKN  677

Query  379  NFVAA--SSNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASRTSSISNAATSVQK  206
            +FVAA  S+N QNQ         PNK+++L GFVSGGTIGGD + ++T +   AAT+   
Sbjct  678  SFVAATPSNNPQNQGY-------PNKRLSLTGFVSGGTIGGDMSRTQTQAPPVAATTHNP  730

Query  205  PREDASHLssgssrdrqrerrrpSGWD  125
              ++++  +  SS +R RER+R SGWD
Sbjct  731  SLQNSTQTNPHSSENRPRERKRRSGWD  757



>ref|XP_009416320.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Musa 
acuminata subsp. malaccensis]
Length=764

 Score =   141 bits (356),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 119/196 (61%), Positives = 144/196 (73%), Gaps = 14/196 (7%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrskrdarkgggkrakgrggsgrgv  509
            T KEARFAGELVNSLI AGQ+VPAELMDLAMKDGRFR+KRDARKG G +  GR G G   
Sbjct  576  THKEARFAGELVNSLIAAGQDVPAELMDLAMKDGRFRAKRDARKGSGGKKGGRRGKGGNG  635

Query  508  rg-----vDYGLGIGYSAESSNAPTT-TVPSRSAAVNSLRTGMMAQFKSNFVAASSNLQN  347
             G     VD+GLGIGY+ +++NA T+ +VPSRSAAVNSLRTGMMAQFKSNFVAASSN + 
Sbjct  636  SGRGVRGVDFGLGIGYNPDTANAATSHSVPSRSAAVNSLRTGMMAQFKSNFVAASSNSE-  694

Query  346  QALGNSSGMNPNKKMALPGFVSGGTIGGDTNASRTSSISNAATSVQKPR-EDASHLssgs  170
               GN+S      + +L GFVSGG+IGG+   +++ +    AT  +  R E+ +  +S S
Sbjct  695  ---GNTSSTT---RPSLSGFVSGGSIGGEAYKAQSLTTFIPATKNEGSRIENGNQKNSES  748

Query  169  srdrqrerrrpSGWDR  122
             RDR RER+RPSGWDR
Sbjct  749  VRDRPRERKRPSGWDR  764



>ref|XP_011468779.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 isoform X2 
[Fragaria vesca subsp. vesca]
Length=745

 Score =   141 bits (356),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 100/159 (63%), Positives = 120/159 (75%), Gaps = 9/159 (6%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrskrdarkgggkrakgrggsgrgv  509
            T KEARFAGELVNSL+ AGQNVP ELMDLAMKDGRFRSKRD+RKGGGK+ KGRGG   G 
Sbjct  576  THKEARFAGELVNSLVGAGQNVPVELMDLAMKDGRFRSKRDSRKGGGKKGKGRGGGRGGG  635

Query  508  rg---------vDYGLGIGYSAESSNAPTTTVPSRSAAVNSLRTGMMAQFKSNFVAASSN  356
             G         VD+GLGIGY+ ES+++P+  V SRSAAV SLRTGMM+QFK+ FV+A+SN
Sbjct  636  SGGNSGRGVRGVDFGLGIGYNPESNSSPSPAVTSRSAAVTSLRTGMMSQFKNKFVSATSN  695

Query  355  LQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASRTS  239
              +Q  GNS   + NK+ AL GFV+ G+IGG   A +T+
Sbjct  696  SPSQGSGNSLSAHANKRPALRGFVAAGSIGGGIYAPQTT  734



>ref|XP_009403707.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Musa 
acuminata subsp. malaccensis]
Length=768

 Score =   141 bits (356),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 98/158 (62%), Positives = 117/158 (74%), Gaps = 13/158 (8%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrskrdarkgggkrakgrggsgrgv  509
            TQKEARFAGELVNSLI AGQ+VP ELMDLAMKDGRFR+KRDARKG G +     G G   
Sbjct  582  TQKEARFAGELVNSLIAAGQDVPTELMDLAMKDGRFRAKRDARKGSGGKRGAGRGKGGSG  641

Query  508  rg-----vDYGLGIGYSAESSNA-PTTTVPSRSAAVNSLRTGMMAQFKSNFVAASSNLQN  347
             G     VDYGLGIGY+ ES+NA P+ +V SRSAAVNSL+TGMMAQFKSNFVAASSN   
Sbjct  642  SGRGVRGVDYGLGIGYNPESANAAPSHSVQSRSAAVNSLKTGMMAQFKSNFVAASSN---  698

Query  346  QALGNSSGMNPNKKMALPGFVSGGTIGGDTNASRTSSI  233
                +   ++ + K AL GFVSGG+IGG+   +++ ++
Sbjct  699  ----SKVPISSSTKPALRGFVSGGSIGGEAFKAQSVAV  732



>ref|XP_004288535.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 isoform X1 
[Fragaria vesca subsp. vesca]
Length=779

 Score =   141 bits (356),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 100/159 (63%), Positives = 120/159 (75%), Gaps = 9/159 (6%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrskrdarkgggkrakgrggsgrgv  509
            T KEARFAGELVNSL+ AGQNVP ELMDLAMKDGRFRSKRD+RKGGGK+ KGRGG   G 
Sbjct  576  THKEARFAGELVNSLVGAGQNVPVELMDLAMKDGRFRSKRDSRKGGGKKGKGRGGGRGGG  635

Query  508  rg---------vDYGLGIGYSAESSNAPTTTVPSRSAAVNSLRTGMMAQFKSNFVAASSN  356
             G         VD+GLGIGY+ ES+++P+  V SRSAAV SLRTGMM+QFK+ FV+A+SN
Sbjct  636  SGGNSGRGVRGVDFGLGIGYNPESNSSPSPAVTSRSAAVTSLRTGMMSQFKNKFVSATSN  695

Query  355  LQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASRTS  239
              +Q  GNS   + NK+ AL GFV+ G+IGG   A +T+
Sbjct  696  SPSQGSGNSLSAHANKRPALRGFVAAGSIGGGIYAPQTT  734



>ref|XP_009142546.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 [Brassica rapa]
Length=732

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 93/160 (58%), Positives = 116/160 (73%), Gaps = 9/160 (6%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrs--krdarkgggkrakgrggsgr  515
            TQ+EARFAGEL+NSL+ AGQNVP ELMDLAMKDGRF+S        G   R +G GG  R
Sbjct  548  TQREARFAGELINSLVAAGQNVPPELMDLAMKDGRFKSKRDGRKGGGKKGRGRGGGGGNR  607

Query  514  gvrgvDYGLGIGYSAESSNAPTTTVPSRSAAVNSLRTGMMAQFKSNFVAAS-SNLQNQAL  338
            GVRGVD+GLGIG+++ESS  P+   PSR   +NS+RTG+MAQFK++FVAA+ SN Q+Q  
Sbjct  608  GVRGVDFGLGIGFNSESSGTPSQAAPSRKGVINSVRTGVMAQFKNSFVAATPSNPQSQ--  665

Query  337  GNSSGMNPNKKMALPGFVSGGTIGGDTNASRTSSISNAAT  218
                G  PNK+ +L GFVSGGTIGGD   ++T +   AA+
Sbjct  666  ----GGYPNKRPSLMGFVSGGTIGGDMGRTQTQAPPVAAS  701



>emb|CDX80096.1| BnaA05g00600D [Brassica napus]
Length=728

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 93/160 (58%), Positives = 116/160 (73%), Gaps = 8/160 (5%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrs--krdarkgggkrakgrggsgr  515
            TQ+EARFAGEL+NSL+ AGQNVP ELMDLAMKDGRF+S        G   R +G GG  R
Sbjct  543  TQREARFAGELINSLVAAGQNVPPELMDLAMKDGRFKSKRDGRKGGGKKGRGRGGGGGNR  602

Query  514  gvrgvDYGLGIGYSAESSNAPTTTVPSRSAAVNSLRTGMMAQFKSNFVAAS-SNLQNQAL  338
            GVRGVD+GLGIG+++ESS  P+   PSR   +NS+RTG+MAQFK++FVAA+ SN Q    
Sbjct  603  GVRGVDFGLGIGFNSESSGTPSQAAPSRKGVINSVRTGVMAQFKNSFVAATPSNPQ----  658

Query  337  GNSSGMNPNKKMALPGFVSGGTIGGDTNASRTSSISNAAT  218
             +S G  PNK+ +L GFVSGGTIGGD   ++T +   AA+
Sbjct  659  -SSQGGYPNKRPSLMGFVSGGTIGGDMGRTQTQAPPVAAS  697



>ref|XP_006293732.1| hypothetical protein CARUB_v10022694mg [Capsella rubella]
 gb|EOA26630.1| hypothetical protein CARUB_v10022694mg [Capsella rubella]
Length=761

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 114/161 (71%), Gaps = 11/161 (7%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrs--krdarkgggkrakgrggsgr  515
            TQ+EARFAGELVNSL+ AGQNVP ELMDLAMKDGRF+S  +     G   R    GG  R
Sbjct  580  TQREARFAGELVNSLVAAGQNVPPELMDLAMKDGRFKSKREGRKGGGKKGRGGRGGGGNR  639

Query  514  gvrgvDYGLGIGYSAESSNAPT-TTVPSRSAAVNSLRTGMMAQFKSNFVAAS-SNLQNQA  341
            GVRGVD+GLGIG+S+E S  P+    PSRS  +NS+RTG+MAQFK++FVAA+ SN QNQA
Sbjct  640  GVRGVDFGLGIGFSSEPSGTPSFKAAPSRSGVINSVRTGVMAQFKNSFVAATPSNPQNQA  699

Query  340  LGNSSGMNPNKKMALPGFVSGGTIGGDTNASRTSSISNAAT  218
                    PNK+ +L GFVSGGTIGGD   +++   S A T
Sbjct  700  Y-------PNKRPSLIGFVSGGTIGGDMGRTQSQPPSVAPT  733



>ref|XP_010921475.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Elaeis 
guineensis]
 ref|XP_010921477.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Elaeis 
guineensis]
 ref|XP_010921478.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Elaeis 
guineensis]
Length=767

 Score =   139 bits (351),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 104/188 (55%), Positives = 122/188 (65%), Gaps = 29/188 (15%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrskrdarkgggkrakgrggsgrgv  509
            TQKEARFAGELVNSL+ AGQNV +ELM+LAMKDGRF++KRDARKGG K      G     
Sbjct  576  TQKEARFAGELVNSLVAAGQNVSSELMNLAMKDGRFKAKRDARKGGKKGGGRGKGGSGSG  635

Query  508  rgv---DYGLGIGYSAESSNAPTTTVPSRSAAVNSLRTGMMAQFKSNFVAASSNLQ----  350
            RGV   DYGLGIGY+ ES+N  + +VPSRSA VNSLRTGMMAQFKSNFVAA+S+ Q    
Sbjct  636  RGVRGVDYGLGIGYNPESANVTSQSVPSRSATVNSLRTGMMAQFKSNFVAATSSPQSDGR  695

Query  349  NQALGNSSGMNPNKKMALPGFVSGGTIGGDT-----------------NASRTSSISNAA  221
            NQ   +SSG     +  L GFVSGG IGG+                  N S   +  N+ 
Sbjct  696  NQCSISSSG-----RPVLRGFVSGGLIGGEAYRLQQAASFTPASKSGGNTSENGNQKNSE  750

Query  220  TSVQKPRE  197
            +S  +PRE
Sbjct  751  SSRDRPRE  758



>ref|XP_009370603.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Pyrus 
x bretschneideri]
Length=778

 Score =   139 bits (351),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 105/151 (70%), Positives = 124/151 (82%), Gaps = 2/151 (1%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrskrdarkgggkrakgrggsgrgv  509
            TQKEARFAGELVNSL+ AGQ V  ELMDLAMKDGRFRSKRD+RKGGGK+ +GRGG GRGV
Sbjct  584  TQKEARFAGELVNSLVAAGQIVSTELMDLAMKDGRFRSKRDSRKGGGKKGRGRGGGGRGV  643

Query  508  rgvDYGLGIGYSAESSNAPTTTVPSRSAAVNSLRTGMMAQFKSNFVAASSNLQNQALGNS  329
            RGVD+G GIGY+ ES+++ + TVPSRSAAV   RTGMM QFK+ FVAASSN  +Q  GNS
Sbjct  644  RGVDFGQGIGYNTESNSSSSNTVPSRSAAVTPQRTGMMPQFKTKFVAASSNSPSQGSGNS  703

Query  328  SGMNPNKKMALPGFVSGGTIGGDTNASRTSS  236
            S + PN+  AL GFVSGG+IGG+   ++T+S
Sbjct  704  SSV-PNRP-ALRGFVSGGSIGGNVYRTQTTS  732



>emb|CDY37796.1| BnaC04g00290D [Brassica napus]
Length=734

 Score =   137 bits (345),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 92/160 (58%), Positives = 115/160 (72%), Gaps = 9/160 (6%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrs--krdarkgggkrakgrggsgr  515
            TQ+EARFAGEL+NSL+ AGQNVP ELMDLAMKDGRF+S        G   R +G GG  R
Sbjct  550  TQREARFAGELINSLVAAGQNVPPELMDLAMKDGRFKSKRDGRKGGGKKGRGRGGGGGNR  609

Query  514  gvrgvDYGLGIGYSAESSNAPTTTVPSRSAAVNSLRTGMMAQFKSNFVAAS-SNLQNQAL  338
            GVRGVD+GLGIG+++ESS   +   PSR   +NS+RTG+MAQFK++FVAA+ SN Q+Q  
Sbjct  610  GVRGVDFGLGIGFNSESSGTLSQAAPSRKGVINSVRTGVMAQFKNSFVAATPSNPQSQ--  667

Query  337  GNSSGMNPNKKMALPGFVSGGTIGGDTNASRTSSISNAAT  218
                G  PNK+ +L GFVSGGTIGGD   ++T +   AA+
Sbjct  668  ----GGYPNKRPSLMGFVSGGTIGGDIGRTQTQTPPVAAS  703



>ref|XP_009349922.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Pyrus 
x bretschneideri]
Length=782

 Score =   137 bits (345),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 106/161 (66%), Positives = 126/161 (78%), Gaps = 6/161 (4%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrskrdarkgggkrakgrggsgrgv  509
            TQKEARFAGELVNSL+ AGQ V  ELMDLAMKDGRFRSKRD+RKGGGK+ +GRGG G G 
Sbjct  583  TQKEARFAGELVNSLVAAGQIVSTELMDLAMKDGRFRSKRDSRKGGGKKGRGRGGGGGGG  642

Query  508  rgv---DYGLGIGYSAESSNAPTTTVPSRSAAVNSLRTGMMAQFKSNFVAASSNLQNQAL  338
            RGV   D+GLGIGY+ ES+N+ + TV SRSA V  +RTGMM+QFK+ FVAASSN  +QA 
Sbjct  643  RGVRGVDFGLGIGYNTESNNSSSHTVASRSATVTPVRTGMMSQFKTKFVAASSNSPSQAS  702

Query  337  GNSSGMNPNKKMALPGFVSGGTIGGDTNASR-TSSISNAAT  218
            GNS    P++  AL GFVSGG+IGGD   ++ TS+I+ A T
Sbjct  703  GNSYSA-PSRP-ALRGFVSGGSIGGDVYRTQATSTIAPALT  741



>emb|CDX95719.1| BnaC03g26000D [Brassica napus]
Length=735

 Score =   137 bits (344),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 94/143 (66%), Positives = 115/143 (80%), Gaps = 8/143 (6%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrskrdarkgggkrakgrggsgrgv  509
            TQ+EARFAGEL+N L+ AGQNVP ELMDLAMKDGRF+SKRD RKGGGK+  GRGG  RGV
Sbjct  547  TQREARFAGELINILVAAGQNVPPELMDLAMKDGRFKSKRDGRKGGGKKGGGRGGGNRGV  606

Query  508  rgvDYGLGIGYSAESSNAPTTTVPSRSAAVNSLRTGMMAQFKSNFVAAS-SNLQNQALGN  332
            RGVD+GLGIG+++ESS   +   PSR   ++S+RTG+MAQFK++FVAA+ S+ Q+QA   
Sbjct  607  RGVDFGLGIGFNSESSGTSSQAAPSRKGVISSVRTGVMAQFKNSFVAATPSSQQSQAY--  664

Query  331  SSGMNPNKKMALPGFVSGGTIGG  263
                 PNK++AL GFVSGGTIGG
Sbjct  665  -----PNKRLALTGFVSGGTIGG  682



>ref|XP_008781128.1| PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP-dependent RNA helicase 
24-like [Phoenix dactylifera]
Length=765

 Score =   136 bits (343),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 96/156 (62%), Positives = 111/156 (71%), Gaps = 10/156 (6%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrskrdarkgggkrakgrggsgrgv  509
            TQKEARFAGELVNSL+ AGQNV  ELM+LAMKDGRFR+KRDARKGG K      G+    
Sbjct  576  TQKEARFAGELVNSLVAAGQNVSPELMNLAMKDGRFRAKRDARKGGRKGGSRGKGASGRG  635

Query  508  rg-vDYGLGIGYSAESSNAPTTTVPSRSAAVNSLRTGMMAQFKSNFVAASSNLQ----NQ  344
               VDYGLGIGY+ ES+NA +  VPSRSA VNSLRTGMM Q+KSNFVAA+S+ Q    NQ
Sbjct  636  VRGVDYGLGIGYNPESANATSQVVPSRSATVNSLRTGMMTQYKSNFVAATSSPQCDGRNQ  695

Query  343  ALGNSSGMNPNKKMALPGFVSGGTIGGDTNASRTSS  236
               +SSG     K  L GFVSGG I G+   S+ ++
Sbjct  696  CSISSSG-----KPVLRGFVSGGLISGEAYKSQPAT  726



>ref|XP_007221465.1| hypothetical protein PRUPE_ppa001666mg [Prunus persica]
 gb|EMJ22664.1| hypothetical protein PRUPE_ppa001666mg [Prunus persica]
Length=783

 Score =   136 bits (343),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 123/201 (61%), Positives = 147/201 (73%), Gaps = 15/201 (7%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrskrda-------rkgggkrakgr  530
            TQKEARFAGELVNSL+ AGQNV  ELMDLAMKDGRFRSKRD+        +G G    G 
Sbjct  584  TQKEARFAGELVNSLVAAGQNVSTELMDLAMKDGRFRSKRDSRKGGGKKGRGRGGGGGGG  643

Query  529  ggsgrgvrgvDYGLGIGYSAESSNAPTTTVPSRSAAVNSLRTGMMAQFKSNFVAASSNLQ  350
            GG GRGVRGVDYGLGIGY++ES+N+ + T  SRSAAV SLRTGMM+QFK+ FVAA+SN  
Sbjct  644  GGGGRGVRGVDYGLGIGYNSESNNSSSHTPTSRSAAVTSLRTGMMSQFKTKFVAAASNSP  703

Query  349  NQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASR-TSSISNAATSV-----QKPREDAS  188
            +Q  GNSS +   ++ AL GFVSGG+IGGD   ++ T++++ A TSV     Q   E+AS
Sbjct  704  SQGSGNSSSV--PQRPALRGFVSGGSIGGDIFRTQATNTVTPAPTSVVNISSQNSGENAS  761

Query  187  HLssgssrdrqrerrrpSGWD  125
               S SSRD+ RERRR SGWD
Sbjct  762  QKPSESSRDKPRERRRRSGWD  782



>gb|KDP28272.1| hypothetical protein JCGZ_14043 [Jatropha curcas]
Length=774

 Score =   136 bits (342),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 105/151 (70%), Positives = 116/151 (77%), Gaps = 6/151 (4%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrskrdarkgggkrakgrggsgrgv  509
            TQKEARFAGELVNSLI AGQNV  ELMDLAMKDGRFRSKRDARKGGGK+ KGR   GRGV
Sbjct  579  TQKEARFAGELVNSLIAAGQNVSVELMDLAMKDGRFRSKRDARKGGGKKGKGRSAGGRGV  638

Query  508  rgvDYGLGIGYSAESSNAPTTTVPSRSAAVNSLRTGMMAQFKSNFVAASSNLQNQALGNS  329
            RGVDYGLGIGY+ ES++  +   PSR    NS+RTG M QFKSNFV ASSN        S
Sbjct  639  RGVDYGLGIGYNPESNSTTSNVAPSRPNTGNSVRTGAMTQFKSNFVVASSN------SQS  692

Query  328  SGMNPNKKMALPGFVSGGTIGGDTNASRTSS  236
            S    NK+ ALPGFVSGG+IGGD N ++T+S
Sbjct  693  SNNYANKRSALPGFVSGGSIGGDINRTQTTS  723



>ref|XP_010506769.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like isoform 
X2 [Camelina sativa]
 ref|XP_010506771.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like isoform 
X3 [Camelina sativa]
Length=765

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 91/147 (62%), Positives = 107/147 (73%), Gaps = 11/147 (7%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrs--krdarkgggkrakgrggsgr  515
            TQ+EARFAGELVNSL+ AGQNVP ELMDLAMKDGRF+S  +     G   R    GG  R
Sbjct  581  TQREARFAGELVNSLVAAGQNVPPELMDLAMKDGRFKSKREGRKGGGKKGRGGRGGGGNR  640

Query  514  gvrgvDYGLGIGYSAESSNAPT-TTVPSRSAAVNSLRTGMMAQFKSNFVAA-SSNLQNQA  341
            GVRGVD+GLGIG+S+E S AP+     SRS  +NS+RTG+MAQFK++FVAA +SN QNQ 
Sbjct  641  GVRGVDFGLGIGFSSEPSGAPSFKAASSRSGVINSVRTGVMAQFKNSFVAATTSNPQNQG  700

Query  340  LGNSSGMNPNKKMALPGFVSGGTIGGD  260
                    PNK+ +L GFVSGGTIGGD
Sbjct  701  Y-------PNKRPSLMGFVSGGTIGGD  720



>ref|XP_010506768.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like isoform 
X1 [Camelina sativa]
Length=765

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 91/147 (62%), Positives = 107/147 (73%), Gaps = 11/147 (7%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrs--krdarkgggkrakgrggsgr  515
            TQ+EARFAGELVNSL+ AGQNVP ELMDLAMKDGRF+S  +     G   R    GG  R
Sbjct  581  TQREARFAGELVNSLVAAGQNVPPELMDLAMKDGRFKSKREGRKGGGKKGRGGRGGGGNR  640

Query  514  gvrgvDYGLGIGYSAESSNAPT-TTVPSRSAAVNSLRTGMMAQFKSNFVAA-SSNLQNQA  341
            GVRGVD+GLGIG+S+E S AP+     SRS  +NS+RTG+MAQFK++FVAA +SN QNQ 
Sbjct  641  GVRGVDFGLGIGFSSEPSGAPSFKAASSRSGVINSVRTGVMAQFKNSFVAATTSNPQNQG  700

Query  340  LGNSSGMNPNKKMALPGFVSGGTIGGD  260
                    PNK+ +L GFVSGGTIGGD
Sbjct  701  Y-------PNKRPSLMGFVSGGTIGGD  720



>gb|EPS66709.1| hypothetical protein M569_08067 [Genlisea aurea]
Length=753

 Score =   135 bits (339),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 101/165 (61%), Positives = 114/165 (69%), Gaps = 15/165 (9%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrskrdark----gggkrakgrggs  521
            T KEARFAGELVNSLI AGQ+VP ELMDLAMKDGRFR+KRDARK        R  G GG 
Sbjct  572  TSKEARFAGELVNSLIAAGQDVPQELMDLAMKDGRFRTKRDARKGGSKRARGRGGGGGGG  631

Query  520  grgvrgvDYGLGIGYSAESSNAPTTTVPS------RSAAVNSLRTGMMAQFKSNFVAASS  359
             RGVRGVDYGLGIGY+ ES++AP+    S      R AAV++L+TGMMAQF+SNFV ASS
Sbjct  632  SRGVRGVDYGLGIGYNPESNSAPSNRAASGGGGGGRPAAVSALKTGMMAQFRSNFVPASS  691

Query  358  NLQNQALGNSSG-----MNPNKKMALPGFVSGGTIGGDTNASRTS  239
            N +NQ +  SS       N   K  L GFVSGGTIGG   A+  S
Sbjct  692  NTENQFIQRSSNPPPAVQNDGSKRVLRGFVSGGTIGGQQTATPQS  736



>ref|XP_006397925.1| hypothetical protein EUTSA_v10001321mg [Eutrema salsugineum]
 gb|ESQ39378.1| hypothetical protein EUTSA_v10001321mg [Eutrema salsugineum]
Length=772

 Score =   134 bits (337),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 124/168 (74%), Gaps = 18/168 (11%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrskrdarkgggkrakgrggsgrgv  509
            TQ+EARFAGEL+NSL+ AGQNVP ELMDLAMKDGRF+SKRD RKGGGK+ +GRGG G G 
Sbjct  581  TQREARFAGELINSLVAAGQNVPPELMDLAMKDGRFKSKRDGRKGGGKKGRGRGGGGGGS  640

Query  508  rg---vDYGLGIGYSAESSNAPTTTVP-------SRSAAVNSLRTGMMAQFKSNFVAAS-  362
            RG   VD+GLGIG+++ESS  P    P       SRS A+NS+RTG+MAQFK++FVAA+ 
Sbjct  641  RGVRGVDFGLGIGFNSESSGTPAQAAPRRSGAAASRSGAINSVRTGVMAQFKNSFVAATP  700

Query  361  SNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASRTSSISNAAT  218
            SN Q+QA        PNK+ +L GFVSGGTIGG+   S++ +   A T
Sbjct  701  SNPQSQAY-------PNKRPSLMGFVSGGTIGGEMGRSQSQTPPVATT  741



>ref|XP_008227876.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 [Prunus mume]
Length=787

 Score =   134 bits (337),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 123/203 (61%), Positives = 147/203 (72%), Gaps = 17/203 (8%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrskrda---------rkgggkrak  536
            TQKEARFAGELVNSL+ AGQN   ELMDLAMKDGRFRSKRD+          +GGG    
Sbjct  586  TQKEARFAGELVNSLVAAGQNASTELMDLAMKDGRFRSKRDSRKGGGKKGRGRGGGGGGG  645

Query  535  grggsgrgvrgvDYGLGIGYSAESSNAPTTTVPSRSAAVNSLRTGMMAQFKSNFVAASSN  356
            G GG GRGVRGVDYGLGIGY++ES+N+ + T  SRSAAV SLRTGMM+QFK+ FVAA+SN
Sbjct  646  GGGGGGRGVRGVDYGLGIGYNSESNNSSSHTPTSRSAAVTSLRTGMMSQFKTKFVAAASN  705

Query  355  LQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASR-TSSISNAATSV-----QKPRED  194
              +Q  GNSS +   ++ AL GFVSGG+IGGD   ++ T++++ A TSV     Q   E+
Sbjct  706  SPSQGSGNSSSV--PQRSALRGFVSGGSIGGDIYRTQATNTVTPAPTSVVNISSQNSGEN  763

Query  193  ASHLssgssrdrqrerrrpSGWD  125
            AS   S SSRD+ RERRR SGWD
Sbjct  764  ASQKPSESSRDKPRERRRRSGWD  786



>ref|XP_008808687.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Phoenix 
dactylifera]
 ref|XP_008808688.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Phoenix 
dactylifera]
 ref|XP_008808689.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Phoenix 
dactylifera]
Length=771

 Score =   134 bits (336),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 96/150 (64%), Positives = 112/150 (75%), Gaps = 12/150 (8%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrskrdarkgggkrakgrggsgrgv  509
            TQKEARFAGELVNSL+ AGQNV  ELMDLAMKDGRFR+KRDARKGG K      G G   
Sbjct  580  TQKEARFAGELVNSLVAAGQNVSPELMDLAMKDGRFRAKRDARKGGKKVGGKGKGGGGSG  639

Query  508  rgv---DYGLGIGYSAESSNAPTTTVPSRSAAVNSLRTGMMAQFKSNFVAASSNL----Q  350
            RGV   DYGLGIGY+ ES+NA   +VP+RS+ V+SLRTGM AQFKSNFVAA+SN     +
Sbjct  640  RGVRGVDYGLGIGYNPESTNATLQSVPNRSSTVSSLRTGMRAQFKSNFVAATSNPFGDGR  699

Query  349  NQALGNSSGMNPNKKMALPGFVSGGTIGGD  260
            NQ+  +S+G     +  L GFVSGG+IGG+
Sbjct  700  NQSSVSSTG-----RPVLAGFVSGGSIGGE  724



>ref|XP_008343158.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Malus 
domestica]
Length=778

 Score =   133 bits (334),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 104/151 (69%), Positives = 123/151 (81%), Gaps = 2/151 (1%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrskrdarkgggkrakgrggsgrgv  509
            TQKEARFAGELVNSL+ AGQ V  ELMDLAMKDGRFRSKRD+RKGGGK+ +GRG  GRGV
Sbjct  584  TQKEARFAGELVNSLVAAGQIVSTELMDLAMKDGRFRSKRDSRKGGGKKGRGRGSGGRGV  643

Query  508  rgvDYGLGIGYSAESSNAPTTTVPSRSAAVNSLRTGMMAQFKSNFVAASSNLQNQALGNS  329
            RGVD+GLGIGY+ ES+N+ + TV SRSAAV   RTGMM+QFK+ FVAASSN  +   GNS
Sbjct  644  RGVDFGLGIGYNTESNNSSSNTVASRSAAVTPQRTGMMSQFKTKFVAASSNSPSHGSGNS  703

Query  328  SGMNPNKKMALPGFVSGGTIGGDTNASRTSS  236
            S + P++  AL GFVSGG+IGGD   ++T+S
Sbjct  704  SSV-PSRP-ALRGFVSGGSIGGDVYRTQTTS  732



>ref|XP_008381412.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Malus 
domestica]
Length=777

 Score =   133 bits (334),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 104/161 (65%), Positives = 124/161 (77%), Gaps = 6/161 (4%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrskrdarkgggkrakgrggsgrgv  509
            TQKEARFAGELVNSL+ AGQ V  ELMDLAMKDGRFRSKRD+RKGGGK+ +GRGG G G 
Sbjct  583  TQKEARFAGELVNSLVAAGQIVSTELMDLAMKDGRFRSKRDSRKGGGKKGRGRGGGGGGG  642

Query  508  rgv---DYGLGIGYSAESSNAPTTTVPSRSAAVNSLRTGMMAQFKSNFVAASSNLQNQAL  338
            RGV   D+GLGIGY+ ES+N+ + T  SR A V  +RTGMM+QFK+ FVAASSN  +QA 
Sbjct  643  RGVRGVDFGLGIGYNTESNNSSSHTXASRPATVTPVRTGMMSQFKTKFVAASSNSPSQAS  702

Query  337  GNSSGMNPNKKMALPGFVSGGTIGGDTNASR-TSSISNAAT  218
            GNS    P++  AL GFVSGG+IGGD   ++ TS+I+ A T
Sbjct  703  GNSYSA-PSRP-ALRGFVSGGSIGGDVYRTQATSTITPALT  741



>ref|XP_010518432.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 isoform X1 
[Camelina sativa]
Length=764

 Score =   131 bits (329),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 106/147 (72%), Gaps = 11/147 (7%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrs--krdarkgggkrakgrggsgr  515
            TQ+EARFAGELVNSL+ AGQNVP ELMDLAMKDGRF+S  +     G   R    GG  R
Sbjct  580  TQREARFAGELVNSLVAAGQNVPPELMDLAMKDGRFKSKREGRKGGGKKGRGGRGGGGNR  639

Query  514  gvrgvDYGLGIGYSAESSNAPT-TTVPSRSAAVNSLRTGMMAQFKSNFVAAS-SNLQNQA  341
            GVRGVD+GLGIG+S+E S A +     SRS  +NS+RTG+MAQFK++FVAA+ SN QNQ 
Sbjct  640  GVRGVDFGLGIGFSSEPSGASSFKAASSRSGVINSVRTGVMAQFKNSFVAATPSNPQNQG  699

Query  340  LGNSSGMNPNKKMALPGFVSGGTIGGD  260
                    PNK+ +L GFVSGGTIGGD
Sbjct  700  Y-------PNKRPSLMGFVSGGTIGGD  719



>ref|NP_566099.1| DEAD-box ATP-dependent RNA helicase 24 [Arabidopsis thaliana]
 sp|O22907.2|RH24_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 24 [Arabidopsis 
thaliana]
 gb|AAL15330.1| At2g47330/T8I13.17 [Arabidopsis thaliana]
 gb|AAB63833.2| putative ATP-dependent RNA helicase [Arabidopsis thaliana]
 gb|AAM70580.1| At2g47330/T8I13.17 [Arabidopsis thaliana]
 gb|AEC10828.1| DEAD-box ATP-dependent RNA helicase 24 [Arabidopsis thaliana]
Length=760

 Score =   129 bits (323),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 95/159 (60%), Positives = 116/159 (73%), Gaps = 10/159 (6%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrskrdarkgggkrakgrggsgrgv  509
            TQ+EARFAGELVNSL+ AGQNVP EL DLAMKDGRF+SKRD RKGG K   G GG+    
Sbjct  579  TQREARFAGELVNSLVAAGQNVPPELTDLAMKDGRFKSKRDGRKGGKKGRGGGGGNKGVR  638

Query  508  rgvDYGLGIGYSAESSNAPTTTV-PSRSAAVNSLRTGMMAQFKSNFVAAS-SNLQNQALG  335
                +GLGIG+S+ESS  P++   PSRS A+NS+RTG+MAQFK++FVAA+ SN QNQA  
Sbjct  639  GVD-FGLGIGFSSESSRTPSSKAAPSRSGAINSVRTGVMAQFKNSFVAATPSNPQNQAY-  696

Query  334  NSSGMNPNKKMALPGFVSGGTIGGDTNASRTSSISNAAT  218
                  PNK+ +L GFVSGGTIGGD   +++ +   A T
Sbjct  697  ------PNKRPSLMGFVSGGTIGGDMGRTQSQAPPVAPT  729



>ref|XP_006649971.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Oryza 
brachyantha]
Length=772

 Score =   127 bits (320),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 112/205 (55%), Positives = 135/205 (66%), Gaps = 21/205 (10%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrs-----------krdarkgggkr  542
            TQKE RFAGELV+ LI AGQNVP ELMDLAMKDGRFR+            +    GGG  
Sbjct  573  TQKEVRFAGELVHCLIAAGQNVPNELMDLAMKDGRFRANRDSRKGGKKSGKGKGGGGGGG  632

Query  541  akgrggsgrgvrgvDYGLGIGYSAESSNAPTTTVPS-RSAAVNSLRTGMMAQFKSNFVAA  365
              G  G GRGVRGVD+GLGIGY+AES     + VP+ RSAAVNSL+TGMM  FKS+FV+A
Sbjct  633  GSGARGRGRGVRGVDFGLGIGYNAESG----SQVPAPRSAAVNSLKTGMMQNFKSSFVSA  688

Query  364  SSNLQNQALGNSSGMNPN-KKMALPGFVSGGTIGGDTNASRTSSISNAATSVQKPREDAS  188
            SSN  + +   S G+ P+  + AL GFVSGGTIGGD N +R    + +     +P E+ +
Sbjct  689  SSNTPSNS-APSRGVPPSFVRPALRGFVSGGTIGGDANPARAVQPAPSFVPASRPAENTT  747

Query  187  H---LssgssrdrqrerrrpSGWDR  122
                 +  SSRDR RER+RPSGWDR
Sbjct  748  ENANPTPESSRDRPRERKRPSGWDR  772



>ref|XP_010544963.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 [Tarenaya hassleriana]
Length=774

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 96/152 (63%), Positives = 114/152 (75%), Gaps = 16/152 (11%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrskrdarkgggkrakgrggsgrgv  509
            +QKEARFAGELVNSLI AGQNVP ELMDLAMKDGRFRS+RD RKGGGK+++GRGG G G 
Sbjct  581  SQKEARFAGELVNSLIAAGQNVPPELMDLAMKDGRFRSRRDGRKGGGKKSRGRGGGGSGG  640

Query  508  rgvD-----YGLGIGYSAESSNAPTTTVPSRSA---AVNSLRTGMMAQFKSNFVAASSN-  356
             G       +G+GIGY+ ES++    T  + S+   AVNSLRTG+MAQFKS+FVAASSN 
Sbjct  641  GGRGVRGVDFGMGIGYNTESNSNAAATSQAASSRSGAVNSLRTGVMAQFKSSFVAASSNP  700

Query  355  LQNQALGNSSGMNPNKKMALPGFVSGGTIGGD  260
             QNQ         PN++ +L GFVSGGTIGG+
Sbjct  701  PQNQTY-------PNRRPSLTGFVSGGTIGGE  725



>ref|XP_002467976.1| hypothetical protein SORBIDRAFT_01g037410 [Sorghum bicolor]
 gb|EER94974.1| hypothetical protein SORBIDRAFT_01g037410 [Sorghum bicolor]
Length=766

 Score =   121 bits (304),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 104/176 (59%), Positives = 121/176 (69%), Gaps = 23/176 (13%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrskrdarkgggkrakgrggsgrgv  509
            TQKEARFAGELV+SLI AGQ+VP ELMDLAMKDGRFR+KRD+RKGG K  KG+GG G   
Sbjct  570  TQKEARFAGELVHSLIAAGQDVPNELMDLAMKDGRFRAKRDSRKGGKKGGKGKGGGGGAG  629

Query  508  rg-----vDYGLGIGYSAES-SNAPTTTVPSRSAAVNSLRTGMMAQFKSNFVAASSNLQN  347
            RG     VD+GLGIGY+AES S  P    P RSAAVNSL+TGMM QFKS+FV+ SSN  +
Sbjct  630  RGRGVRGVDFGLGIGYNAESGSQVP----PPRSAAVNSLKTGMMQQFKSSFVSGSSNTPS  685

Query  346  QALGNSSGMNPNKKMALPGFVSGGTIGGDTNASRT-------SSISNAATSVQKPR  200
             +    S + P    AL GFVSGGTIGGD   +++       S  +  A SV  PR
Sbjct  686  SS--APSFVRP----ALRGFVSGGTIGGDARPAQSAPTFVPASRPAQPAPSVPAPR  735



>ref|XP_004984607.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Setaria 
italica]
Length=768

 Score =   117 bits (292),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 111/157 (71%), Gaps = 17/157 (11%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrskrdarkgggkrakgrggsgrgv  509
            TQKEARFAGELV+SLI AGQ+VP ELMDLAMKDGRFR+KRD+RKGG K      G G G 
Sbjct  570  TQKEARFAGELVHSLIAAGQDVPNELMDLAMKDGRFRAKRDSRKGGKKGGGKGKGGGGGA  629

Query  508  rg------vDYGLGIGYSAESSNAPTTTVPS-RSAAVNSLRTGMMAQFKSNFVAASSNLQ  350
                    VD+GLGIGY+AES       VP+ R+AAVNSL+TGMM QFKS+FV+ SSN  
Sbjct  630  GRSRGVRGVDFGLGIGYNAESG----AQVPAPRTAAVNSLKTGMMQQFKSSFVSGSSNTP  685

Query  349  NQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASRTS  239
            + +    S + P    AL GFVSGGTIGGD+  ++++
Sbjct  686  SSS--APSFVRP----ALRGFVSGGTIGGDSRPAQSA  716



>ref|XP_001779387.1| predicted protein [Physcomitrella patens]
 gb|EDQ55777.1| predicted protein [Physcomitrella patens]
Length=741

 Score =   116 bits (291),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 98/127 (77%), Gaps = 9/127 (7%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrskrdarkgggkrakgrggsgrgv  509
            T KEARFAGELVNSLI AGQNVP ELMDLAMKDGR+R++R+ R+ GG + KG  G GR V
Sbjct  585  TGKEARFAGELVNSLIAAGQNVPTELMDLAMKDGRYRAQREGRRRGGGQGKGGRGGGRNV  644

Query  508  rgvDYGLGIGYSAESSNAPTTT--VPSRSAAVNSLRTGMMAQFKSNFVAASSNLQNQALG  335
            RGVD+GLGIGYSA+++NA  +   +PSR +AV+SLR GMMA+FKSNFVAA++        
Sbjct  645  RGVDFGLGIGYSADAANAAPSKEDIPSRGSAVDSLRQGMMARFKSNFVAANTP-------  697

Query  334  NSSGMNP  314
            NS G  P
Sbjct  698  NSVGYTP  704



>ref|XP_008654950.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like isoform 
X2 [Zea mays]
Length=750

 Score =   114 bits (286),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 94/156 (60%), Positives = 113/156 (72%), Gaps = 16/156 (10%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrskrdarkgggkrakgrggsgrgv  509
            TQKEA FAGELV+SLI AGQ+VP ELMDLAMKDGRFR+KRD+RKGG K  KG+GG G   
Sbjct  570  TQKEAHFAGELVHSLIAAGQDVPNELMDLAMKDGRFRAKRDSRKGGKKGGKGKGGVGGAG  629

Query  508  rgv-----DYGLGIGYSAES-SNAPTTTVPSRSAAVNSLRTGMMAQFKSNFVAASSNLQN  347
            RG      D+GLGIGY+AES S  P     +RSAAVNSL+TGM+ +FKS+FV+ SSN  +
Sbjct  630  RGRGVRGVDFGLGIGYNAESGSQVPA----ARSAAVNSLKTGMLQRFKSSFVSGSSNTPS  685

Query  346  QALGNSSGMNPNKKMALPGFVSGGTIGGDTNASRTS  239
             +    S + P    AL GFVSGGTIGGDT  ++ +
Sbjct  686  SS--APSFVRP----ALRGFVSGGTIGGDTRPAQAA  715



>ref|XP_008654947.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like isoform 
X1 [Zea mays]
 tpg|DAA45029.1| TPA: putative DEAD-box ATP-dependent RNA helicase family protein 
[Zea mays]
Length=766

 Score =   114 bits (286),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 94/156 (60%), Positives = 113/156 (72%), Gaps = 16/156 (10%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrskrdarkgggkrakgrggsgrgv  509
            TQKEA FAGELV+SLI AGQ+VP ELMDLAMKDGRFR+KRD+RKGG K  KG+GG G   
Sbjct  570  TQKEAHFAGELVHSLIAAGQDVPNELMDLAMKDGRFRAKRDSRKGGKKGGKGKGGVGGAG  629

Query  508  rgv-----DYGLGIGYSAES-SNAPTTTVPSRSAAVNSLRTGMMAQFKSNFVAASSNLQN  347
            RG      D+GLGIGY+AES S  P     +RSAAVNSL+TGM+ +FKS+FV+ SSN  +
Sbjct  630  RGRGVRGVDFGLGIGYNAESGSQVPA----ARSAAVNSLKTGMLQRFKSSFVSGSSNTPS  685

Query  346  QALGNSSGMNPNKKMALPGFVSGGTIGGDTNASRTS  239
             +    S + P    AL GFVSGGTIGGDT  ++ +
Sbjct  686  SS--APSFVRP----ALRGFVSGGTIGGDTRPAQAA  715



>ref|XP_003558073.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 [Brachypodium 
distachyon]
Length=767

 Score =   113 bits (283),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 89/180 (49%), Positives = 111/180 (62%), Gaps = 25/180 (14%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrs----------------krdark  557
            TQKE RFAGELV+SLI AGQ+VP ELMDLAMKDGRFR+                      
Sbjct  565  TQKETRFAGELVHSLIAAGQDVPNELMDLAMKDGRFRANRDSRKGGKKGGKGKGGGGGGG  624

Query  556  gggkrakgrggsgrgvrgvDYGLGIGYSAESSNAPTTTVPSRSAAVNSLRTGMMAQFKSN  377
              G    G  G GRG+RGVD+GLGIGYS ES   P    P RSA VN+L+TGMM  FKS+
Sbjct  625  SSGGGGGGARGRGRGIRGVDFGLGIGYSTES--GPQVPAP-RSATVNALKTGMMQNFKSS  681

Query  376  FVAASSNLQNQALGNSSGMNPNK--KMALPGFVSGGTIGGDTNASRTSSISNAATSVQKP  203
            FV+A+S++ +    NS+ +   +  + AL GFVSGGTIGGD  A+R +  + +  S  +P
Sbjct  682  FVSAASSMPS----NSAPLRAAQFVRPALRGFVSGGTIGGDAGAARPAPPAPSFVSTSRP  737



>gb|AFW88580.1| putative DEAD-box ATP-dependent RNA helicase family protein [Zea 
mays]
Length=768

 Score =   107 bits (268),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 98/180 (54%), Positives = 118/180 (66%), Gaps = 24/180 (13%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrskrdarkgggkrakgrggsgrgv  509
            TQKEARFAGELV SLI AGQ+VP ELMDLAMKD RFR+KRD+RKGG K  KG+GG G G 
Sbjct  570  TQKEARFAGELVQSLIAAGQDVPNELMDLAMKDVRFRAKRDSRKGGKKGGKGKGGVGGGA  629

Query  508  rgvD------YGLGIGYSAESSNAPTTTVPS-RSAAVNSLRTGMMAQFKSNFVAASSNLQ  350
                      +GLGIGY+AES     + VP+ RSAA+NSL+TG+M QFKS+FV+ SSN  
Sbjct  630  GRGRGVRGVDFGLGIGYNAESG----SQVPAPRSAAINSLKTGVMQQFKSSFVSGSSNTP  685

Query  349  NQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASRTSSI-------SNAATSVQKPREDA  191
            + +    S + P    AL GFVSGGTIGGDT  ++ +         + AA SV   R  A
Sbjct  686  SSSA--PSLVRP----ALRGFVSGGTIGGDTRPAQPAPTFVTASWPAQAAPSVPASRPAA  739



>ref|NP_001147596.1| pre-mRNA-processing ATP-dependent RNA helicase prp-5 [Zea mays]
 gb|ACG28038.1| pre-mRNA-processing ATP-dependent RNA helicase prp-5 [Zea mays]
Length=768

 Score =   107 bits (268),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 97/180 (54%), Positives = 117/180 (65%), Gaps = 24/180 (13%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrskrdarkgggkrakgrggsgrgv  509
            TQKEARFAGELV SLI AGQ+VP ELMDLAMKD RFR+KRD+RKG  K  KG+GG G G 
Sbjct  570  TQKEARFAGELVQSLIAAGQDVPNELMDLAMKDVRFRAKRDSRKGLKKGGKGKGGVGGGA  629

Query  508  rgvD------YGLGIGYSAESSNAPTTTVPS-RSAAVNSLRTGMMAQFKSNFVAASSNLQ  350
                      +GLGIGY+AES     + VP+ RSAA+NSL+TG+M QFKS+FV+ SSN  
Sbjct  630  GRGRGVRGVDFGLGIGYNAESG----SQVPAPRSAAINSLKTGVMQQFKSSFVSGSSNTP  685

Query  349  NQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASRTSSI-------SNAATSVQKPREDA  191
            + +    S + P    AL GFVSGGTIGGDT  ++ +         + AA SV   R  A
Sbjct  686  SSSA--PSLVRP----ALRGFVSGGTIGGDTRPAQPAPTFVTASWPAQAAPSVPASRPAA  739



>gb|EEC75096.1| hypothetical protein OsI_11255 [Oryza sativa Indica Group]
Length=1023

 Score =   107 bits (268),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 98/185 (53%), Positives = 114/185 (62%), Gaps = 29/185 (16%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrskrdarkgggkrakgrggsgrgv  509
            TQKE RFAGELV+ LI AGQ+VP ELMDLAMKDGRFR+ RD+RKGG K  KG+GG G G 
Sbjct  582  TQKEVRFAGELVHCLIAAGQDVPNELMDLAMKDGRFRANRDSRKGGKKSGKGKGGGGGGG  641

Query  508  rg----------------vDYGLGIGYSAESSNAPTTTVPSRSAAVNSLRTGMMAQFKSN  377
             G                VD+GLGIGY+AES + P      RSAAVNSL+TGMM  FKS+
Sbjct  642  GGGGGGSGACGRGRGVRGVDFGLGIGYNAESGSVPA----PRSAAVNSLKTGMMQNFKSS  697

Query  376  FVAAS-----SNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASRTSSISNAATSV  212
            FV+AS     SN        SS + P    AL GFVSGGTIGGD N +R    + +    
Sbjct  698  FVSASSSNTPSNSAPSRGAPSSFVRP----ALRGFVSGGTIGGDANQARAVQPAPSFVPA  753

Query  211  QKPRE  197
             +P E
Sbjct  754  SRPAE  758



>gb|EEE58924.1| hypothetical protein OsJ_10575 [Oryza sativa Japonica Group]
Length=696

 Score =   107 bits (266),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 93/165 (56%), Positives = 105/165 (64%), Gaps = 25/165 (15%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrs------------krdarkgggk  545
            TQKE RFAGELV+ LI AGQ+VP ELMDLAMKDGRFR+            K     GGG 
Sbjct  496  TQKEVRFAGELVHCLIAAGQDVPNELMDLAMKDGRFRANRDSRKGGKKSGKGKGGGGGGG  555

Query  544  rakgrggsgrgvrgvDYGLGIGYSAESSNAPTTTVPSRSAAVNSLRTGMMAQFKSNFVAA  365
               G  G GRGVRGVD+GLGIGY+AES + P      RSAA+NSL+TGMM  FKS+FV+A
Sbjct  556  GGSGARGRGRGVRGVDFGLGIGYNAESGSVPA----PRSAALNSLKTGMMQNFKSSFVSA  611

Query  364  S-----SNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASR  245
            S     SN        SS + P    AL GFVSGGTIGGD N +R
Sbjct  612  SSSNTPSNSAPSRGAPSSFVRP----ALRGFVSGGTIGGDANQAR  652



>dbj|BAJ97115.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=764

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 92/177 (52%), Positives = 113/177 (64%), Gaps = 22/177 (12%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrs------------krdarkgggk  545
            TQKE+RFAGELV+SLI AGQ+VP ELMDLAMKDGRFR+            K     GGG 
Sbjct  565  TQKESRFAGELVHSLIAAGQDVPNELMDLAMKDGRFRANRDSRKGGKKGGKGKGGGGGGG  624

Query  544  rakgrggsgrgvrgvDYGLGIGYSAESSNAPTTTVPSRSAAVNSLRTGMMAQFKSNFVAA  365
               G  G GRG+RGVD+GLGIGY +ES   P    P RSA VN+L+TGMM  FKS+FV+A
Sbjct  625  GGGGARGRGRGIRGVDFGLGIGYGSES--GPQVPAP-RSATVNTLKTGMMQNFKSSFVSA  681

Query  364  SSNLQNQAL---GNSSGMNPNKKMALPGFVSGGTIGGDTNASRTSSISNAATSVQKP  203
            SS+  + +    G  S + P    AL GFVSGGTIGGD+ A+R + +  +     +P
Sbjct  682  SSSAPSNSTPSRGTPSFVKP----ALRGFVSGGTIGGDSGAARPAPVVPSFVPASRP  734



>ref|NP_001049904.1| Os03g0308500 [Oryza sativa Japonica Group]
 sp|Q10MH8.1|RH24_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 24 [Oryza sativa 
Japonica Group]
 gb|ABF95549.1| DEAD/DEAH box helicase family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11818.1| Os03g0308500 [Oryza sativa Japonica Group]
 dbj|BAG96306.1| unnamed protein product [Oryza sativa Japonica Group]
Length=770

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 93/165 (56%), Positives = 105/165 (64%), Gaps = 25/165 (15%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrs------------krdarkgggk  545
            TQKE RFAGELV+ LI AGQ+VP ELMDLAMKDGRFR+            K     GGG 
Sbjct  570  TQKEVRFAGELVHCLIAAGQDVPNELMDLAMKDGRFRANRDSRKGGKKSGKGKGGGGGGG  629

Query  544  rakgrggsgrgvrgvDYGLGIGYSAESSNAPTTTVPSRSAAVNSLRTGMMAQFKSNFVAA  365
               G  G GRGVRGVD+GLGIGY+AES + P      RSAA+NSL+TGMM  FKS+FV+A
Sbjct  630  GGSGARGRGRGVRGVDFGLGIGYNAESGSVPA----PRSAALNSLKTGMMQNFKSSFVSA  685

Query  364  S-----SNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDTNASR  245
            S     SN        SS + P    AL GFVSGGTIGGD N +R
Sbjct  686  SSSNTPSNSAPSRGAPSSFVRP----ALRGFVSGGTIGGDANQAR  726



>ref|XP_002882116.1| hypothetical protein ARALYDRAFT_483908 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58375.1| hypothetical protein ARALYDRAFT_483908 [Arabidopsis lyrata subsp. 
lyrata]
Length=739

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 104/151 (69%), Gaps = 10/151 (7%)
 Frame = -1

Query  664  GELVNSLITAGQNVPAELMDLAMKDGRFrskrdarkgggkrakgrggsgrgvrgvDYGLG  485
            GELV SL+ AGQ VP ELMDLAMKDGRF+SKRD RKGG K   G   +        +GLG
Sbjct  566  GELVTSLVAAGQIVPPELMDLAMKDGRFKSKRDGRKGGKKGRGGGAANKGVRGVD-FGLG  624

Query  484  IGYSAESSNAPTTTV-PSRSAAVNSLRTGMMAQFKSNFVAAS-SNLQNQALGNSSGMNPN  311
            IG+S+ESS  P++   PSRS  +NS+RTG+MAQFK++FVAA+ SN Q+QA        PN
Sbjct  625  IGFSSESSGTPSSKAAPSRSGTINSVRTGVMAQFKNSFVAATPSNPQSQAY-------PN  677

Query  310  KKMALPGFVSGGTIGGDTNASRTSSISNAAT  218
            K+ +L GFVSGGTIGGD   +++ +   A T
Sbjct  678  KRPSLMGFVSGGTIGGDMGRTQSQAPPVAPT  708



>gb|EMS61774.1| DEAD-box ATP-dependent RNA helicase 24 [Triticum urartu]
Length=765

 Score = 99.0 bits (245),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 89/158 (56%), Positives = 105/158 (66%), Gaps = 19/158 (12%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrskrdarkgggkrakgrggsgrgv  509
            TQKE+RFAGELV+SLI AGQ+VP ELMDLAMKDGRFR+ RD+RKGG K  KG+GG G G 
Sbjct  565  TQKESRFAGELVHSLIAAGQDVPNELMDLAMKDGRFRANRDSRKGGKKGGKGKGGGGGGG  624

Query  508  rgvD--------------YGLGIGYSAESSNAPTTTVPSRSAAVNSLRTGMMAQFKSNFV  371
             G                +GLGIGY +ES   P    P RSA VN+L+TGMM  FKS+FV
Sbjct  625  GGGGGGGGARGRGIRGVDFGLGIGYGSES--GPQVPAP-RSATVNTLKTGMMQNFKSSFV  681

Query  370  AASSNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGDT  257
            +ASS+  + +        P  K AL GFVSGGTIGGD+
Sbjct  682  SASSSAPSNSAPLRGA--PFVKPALRGFVSGGTIGGDS  717



>gb|EMT30425.1| DEAD-box ATP-dependent RNA helicase 24 [Aegilops tauschii]
Length=789

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 103/161 (64%), Gaps = 24/161 (15%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrs--------------krdarkgg  551
            TQKE+RFAGELV+SLI AGQ+VP ELMDLAMKDGRFR+              K     GG
Sbjct  565  TQKESRFAGELVHSLIAAGQDVPNELMDLAMKDGRFRANRDSRKGGKKGGKGKGGGGGGG  624

Query  550  gkrakgrggsgrgvrgvDYGLGIGYSAESSNAPTTTVPSRSAAVNSLRTGMMAQFKSNFV  371
            G    G  G GRG+RGVD+GLGIGY +ES   P    P RSA VN L+TGMM  FKS+FV
Sbjct  625  GGGGGGARGRGRGIRGVDFGLGIGYGSES--GPQVPAP-RSATVNVLKTGMMQNFKSSFV  681

Query  370  AASSNLQNQAL---GNSSGMNPNKKMALPGFVSGGTIGGDT  257
            +ASS+  + +    G  S + P     L GFVSGGTIGGD+
Sbjct  682  SASSSAPSNSAPSRGAPSFVKPT----LRGFVSGGTIGGDS  718



>ref|XP_006388446.1| hypothetical protein POPTR_0184s002101g, partial [Populus trichocarpa]
 gb|ERP47360.1| hypothetical protein POPTR_0184s002101g, partial [Populus trichocarpa]
Length=151

 Score = 82.0 bits (201),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = -1

Query  442  VPSRSAAVNSLRTGMMAQFKSNFVAASSNLQNQALGNSSGMNPNKKMALPGFVSGGTIGG  263
            V SRS AVNSLRTG+MAQFK+NFVAA+SN Q+  L  SS +  NK+ AL GFVSGG+IGG
Sbjct  9    VTSRSTAVNSLRTGVMAQFKNNFVAATSNSQSPGLNTSSSVYANKRPALRGFVSGGSIGG  68

Query  262  DTNASRTSS  236
            D N  +T+S
Sbjct  69   DMNRPQTTS  77



>ref|XP_002980961.1| hypothetical protein SELMODRAFT_51367, partial [Selaginella moellendorffii]
 gb|EFJ18146.1| hypothetical protein SELMODRAFT_51367, partial [Selaginella moellendorffii]
Length=653

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 87/120 (73%), Gaps = 9/120 (8%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrskrd---arkgggkrakgrggsg  518
            TQKEARFAG+LVN  + AGQNVP+ELMDLAMKDGRFR++R+       GG R KG GG G
Sbjct  534  TQKEARFAGDLVNGFVAAGQNVPSELMDLAMKDGRFRAQREGRRKGGKGGGRGKGGGGGG  593

Query  517  rgvrgvDYGLGIGYSAESSNAPTTTVPS------RSAAVNSLRTGMMAQFKSNFVAASSN  356
            RGVRGVDYGLGIGYS ++S+ P+  V          AA +S  + MM +FK++FVAASS+
Sbjct  594  RGVRGVDYGLGIGYSRDASSNPSAPVHQARKSSGVGAASSSPSSSMMTRFKNSFVAASSS  653



>ref|XP_009135930.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like, partial 
[Brassica rapa]
Length=636

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrskrdarkgggkrakgrggsgrgv  509
            TQ+EARFAGEL+NSL+ AGQNVP ELMDLAMKDGRF+SKRD RKGGGK+  GRGG  RGV
Sbjct  550  TQREARFAGELINSLVAAGQNVPQELMDLAMKDGRFKSKRDGRKGGGKKGGGRGGGNRGV  609

Query  508  rgvDYGLGIGYSAESSNAPTTTVPSR  431
            RGVD+GLGIG+++ESS   +   PSR
Sbjct  610  RGVDFGLGIGFNSESSGTSSQAAPSR  635



>emb|CDX83333.1| BnaA03g21730D [Brassica napus]
Length=637

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrskrdarkgggkrakgrggsgrgv  509
            TQ+EARFAGEL+NSL+ AGQNVP ELMDLAMKDGRF+SKRD RKGGGK+  GRGG  RGV
Sbjct  550  TQREARFAGELINSLVAAGQNVPQELMDLAMKDGRFKSKRDGRKGGGKKGGGRGGGNRGV  609

Query  508  rgvDYGLGIGYSAESSNAPTTTVPSR  431
            RGVD+GLGIG+++ESS   +   PSR
Sbjct  610  RGVDFGLGIGFNSESSGTSSQAAPSR  635



>ref|XP_002989340.1| hypothetical protein SELMODRAFT_41331, partial [Selaginella moellendorffii]
 gb|EFJ09614.1| hypothetical protein SELMODRAFT_41331, partial [Selaginella moellendorffii]
Length=653

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 85/119 (71%), Gaps = 9/119 (8%)
 Frame = -1

Query  685  QKEARFAGELVNSLITAGQNVPAELMDLAMKDGRFrskrd---arkgggkrakgrggsgr  515
            QKEARFAG+LVN  + AGQNVP+ELMDLAMKDGRFR++R+       GG R KG GG GR
Sbjct  535  QKEARFAGDLVNGFVAAGQNVPSELMDLAMKDGRFRAQREGRRKGGKGGGRGKGGGGGGR  594

Query  514  gvrgvDYGLGIGYSAESSNAPTTTVPS------RSAAVNSLRTGMMAQFKSNFVAASSN  356
            GVRGVDYGLGIGYS ++S+ P+  V          AA +S  + MM +FK +FVAASS+
Sbjct  595  GVRGVDYGLGIGYSRDASSNPSAPVHQARKSSGVGAASSSPSSSMMTRFKDSFVAASSS  653



>ref|XP_006388445.1| hypothetical protein POPTR_0184s002103g, partial [Populus trichocarpa]
 gb|ERP47359.1| hypothetical protein POPTR_0184s002103g, partial [Populus trichocarpa]
Length=127

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  581
            TQKEARFAGELVNSLI AGQNV  ELMDLAMKDGRF
Sbjct  83   TQKEARFAGELVNSLIAAGQNVSVELMDLAMKDGRF  118



>gb|KJB22488.1| hypothetical protein B456_004G050200 [Gossypium raimondii]
Length=660

 Score = 63.5 bits (153),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGR  584
            TQKEARFAGELVNSLI AGQNV  ELMDLAMK GR
Sbjct  583  TQKEARFAGELVNSLIAAGQNVSMELMDLAMKVGR  617


 Score = 36.6 bits (83),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -2

Query  510  CVAWIMVWVLDTVQNQVMLQLPLFQ  436
            CV  I+VWVLD +QN VML L LF+
Sbjct  631  CVELILVWVLDIIQNPVMLHLRLFK  655



>gb|KJB22484.1| hypothetical protein B456_004G050000 [Gossypium raimondii]
Length=661

 Score = 63.5 bits (153),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGR  584
            TQKEARFAGELVNSLI AGQNV  ELMDLAMK GR
Sbjct  584  TQKEARFAGELVNSLIAAGQNVSMELMDLAMKVGR  618


 Score = 36.6 bits (83),  Expect(2) = 1e-12, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -2

Query  510  CVAWIMVWVLDTVQNQVMLQLPLFQ  436
            CV  I+VWVLD +QN VML L LF+
Sbjct  632  CVELILVWVLDIIQNPVMLHLRLFK  656



>ref|XP_010507898.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Camelina 
sativa]
Length=647

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  581
            TQ+EARFAG+LVNSL+ AGQNVP ELMDLAMKDGRF
Sbjct  580  TQREARFAGDLVNSLVAAGQNVPPELMDLAMKDGRF  615



>gb|KJB22490.1| hypothetical protein B456_004G050200 [Gossypium raimondii]
Length=636

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  581
            TQKEARFAGELVNSLI AGQNV  ELMDLAMKDGRF
Sbjct  583  TQKEARFAGELVNSLIAAGQNVSMELMDLAMKDGRF  618



>ref|XP_010518433.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 isoform X2 
[Camelina sativa]
Length=657

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGR  584
            TQ+EARFAGELVNSL+ AGQNVP ELMDLAMK GR
Sbjct  580  TQREARFAGELVNSLVAAGQNVPPELMDLAMKVGR  614



>ref|XP_006444513.1| hypothetical protein CICLE_v10018925mg [Citrus clementina]
 gb|ESR57753.1| hypothetical protein CICLE_v10018925mg [Citrus clementina]
 gb|KDO86971.1| hypothetical protein CISIN_1g003881mg [Citrus sinensis]
 gb|KDO86972.1| hypothetical protein CISIN_1g003881mg [Citrus sinensis]
Length=630

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGR  584
            TQKEARFAGELVNSLI AGQNV  ELMDLAMK GR
Sbjct  576  TQKEARFAGELVNSLIAAGQNVSMELMDLAMKVGR  610



>ref|XP_007051130.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 3, partial [Theobroma cacao]
 gb|EOX95287.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 3, partial [Theobroma cacao]
Length=622

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGR  584
            TQKEARFAGELVNSLI AGQNV  ELMDLAMK GR
Sbjct  582  TQKEARFAGELVNSLIAAGQNVSMELMDLAMKVGR  616



>ref|XP_011079539.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 isoform X2 
[Sesamum indicum]
Length=654

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDG  587
            TQKEARFAGELVNSLI AGQNV  ELMDLAMK G
Sbjct  582  TQKEARFAGELVNSLIAAGQNVSTELMDLAMKVG  615



>gb|KDO86973.1| hypothetical protein CISIN_1g003881mg [Citrus sinensis]
Length=618

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMK  593
            TQKEARFAGELVNSLI AGQNV  ELMDLAMK
Sbjct  576  TQKEARFAGELVNSLIAAGQNVSMELMDLAMK  607



>ref|XP_010507901.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Camelina 
sativa]
Length=86

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 35/47 (74%), Gaps = 8/47 (17%)
 Frame = -1

Query  397  MAQFKSNFVAAS-SNLQNQALGNSSGMNPNKKMALPGFVSGGTIGGD  260
            MAQFK++FVAA+ SN QNQA        PNK+ +L GFVSGGTIGGD
Sbjct  1    MAQFKNSFVAATPSNPQNQAY-------PNKRPSLMGFVSGGTIGGD  40



>ref|XP_010679398.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=666

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAM  596
            T KEARFAGE+VNSLI AGQNV  ELMDLAM
Sbjct  581  THKEARFAGEMVNSLIAAGQNVTMELMDLAM  611



>ref|XP_008353905.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24-like [Malus 
domestica]
Length=428

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = -1

Query  685  QKEARFAGELVNSLITAGQNVPAELMDLAMK  593
            QKEARFAGELVNSL+ AGQ V  ELMDLAMK
Sbjct  395  QKEARFAGELVNSLVAAGQIVSTELMDLAMK  425



>ref|XP_009758479.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 isoform X2 
[Nicotiana sylvestris]
Length=636

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMK  593
            TQKEARFAGEL NSL+ AGQ V  ELMDLAMK
Sbjct  583  TQKEARFAGELANSLVAAGQTVSIELMDLAMK  614



>ref|XP_009610166.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 24 isoform X2 
[Nicotiana tomentosiformis]
Length=636

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMK  593
            TQKEARFAGEL NSL+ AGQ V  ELMDLAMK
Sbjct  583  TQKEARFAGELANSLVAAGQTVSIELMDLAMK  614



>emb|CEI91338.1| hypothetical protein RMCBS344292_05633 [Rhizopus microsporus]
Length=699

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  581
            TQKE RFAGELV  L T+GQ VP+EL++LAMK+ RF
Sbjct  587  TQKEDRFAGELVRHLETSGQAVPSELLNLAMKNSRF  622



>emb|CEG84746.1| Putative Adenosinetriphosphatase [Rhizopus microsporus]
Length=477

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  581
            TQKE RFAGELV  L T+GQ VP+EL++LAMK+ RF
Sbjct  366  TQKEDRFAGELVRHLETSGQAVPSELLNLAMKNSRF  401



>emb|CEI97815.1| Putative Adenosinetriphosphatase [Rhizopus microsporus]
Length=495

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  581
            TQKE RFAGELV  L T+GQ VP+EL++LAMK+ RF
Sbjct  382  TQKEDRFAGELVRHLETSGQAVPSELLNLAMKNSRF  417



>emb|CEG65407.1| hypothetical protein RMATCC62417_02199 [Rhizopus microsporus]
Length=747

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  581
            TQKE RFAGELV  L T+GQ VP+EL++LAMK+ RF
Sbjct  633  TQKEDRFAGELVRHLETSGQAVPSELLNLAMKNSRF  668



>ref|XP_005643999.1| DEAD-domain-containing protein, partial [Coccomyxa subellipsoidea 
C-169]
 gb|EIE19455.1| DEAD-domain-containing protein, partial [Coccomyxa subellipsoidea 
C-169]
Length=561

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  581
            T +EARFAGELVNSL  A Q VP  LMDLA KDG F
Sbjct  510  TPREARFAGELVNSLAAANQQVPKALMDLAAKDGHF  545



>dbj|GAN07211.1| ATP-dependent RNA helicase DDX42-like [Mucor ambiguus]
Length=722

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -1

Query  688  TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  581
            TQKE RFAGELV  L T+GQ VP EL++LAMK+ RF
Sbjct  619  TQKEDRFAGELVTHLETSGQVVPPELLNLAMKNSRF  654



>emb|CEP11906.1| hypothetical protein [Parasitella parasitica]
Length=1218

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -1

Query  688   TQKEARFAGELVNSLITAGQNVPAELMDLAMKDGRF  581
             TQKE RFAGELV  L  +GQ VP EL+DLAMK+ RF
Sbjct  1111  TQKEDRFAGELVTHLEASGQIVPPELLDLAMKNSRF  1146



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1144913349700