BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF008M01

Length=654
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002540513.1|  glyceraldehyde 3-phosphate dehydrogenase, pu...    272   6e-89   Ricinus communis
ref|XP_011034836.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    281   7e-89   Populus euphratica
ref|XP_011041188.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    280   2e-88   Populus euphratica
ref|XP_002307806.1|  glyceraldehyde-3-phosphate dehydrogenase fam...    278   6e-88   Populus trichocarpa [western balsam poplar]
ref|XP_006383783.1|  hypothetical protein POPTR_0005s27550g             277   7e-88   
ref|XP_002300632.2|  hypothetical protein POPTR_0002s00840g             279   9e-88   
gb|KJB14201.1|  hypothetical protein B456_002G114000                    278   9e-88   Gossypium raimondii
ref|XP_007018105.1|  Glyceraldehyde-3-phosphate dehydrogenase B s...    278   1e-87   
gb|KHG00663.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    278   1e-87   Gossypium arboreum [tree cotton]
ref|XP_004238446.2|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    275   7e-87   
emb|CDP07271.1|  unnamed protein product                                276   8e-87   Coffea canephora [robusta coffee]
gb|ACU20783.1|  unknown                                                 275   8e-87   Glycine max [soybeans]
ref|XP_002510706.1|  glyceraldehyde 3-phosphate dehydrogenase, pu...    275   1e-86   Ricinus communis
ref|NP_001237135.1|  glyceraldehyde-3-phosphate dehydrogenase B s...    275   1e-86   
ref|XP_006581071.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    275   1e-86   
gb|KJB57938.1|  hypothetical protein B456_009G186400                    273   1e-86   Gossypium raimondii
gb|KHN20097.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    275   1e-86   Glycine soja [wild soybean]
ref|XP_010539030.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    275   1e-86   Tarenaya hassleriana [spider flower]
ref|XP_006577850.1|  PREDICTED: uncharacterized protein LOC100806...    275   1e-86   Glycine max [soybeans]
ref|NP_001240080.1|  uncharacterized protein LOC100806482               275   2e-86   Glycine max [soybeans]
ref|XP_008346447.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    275   2e-86   Malus domestica [apple tree]
gb|ABF74607.1|  chloroplast glyceraldehyde-3-phosphate dehydrogen...    265   2e-86   Agave tequilana
ref|XP_010500213.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    274   2e-86   Camelina sativa [gold-of-pleasure]
ref|XP_006435406.1|  hypothetical protein CICLE_v10001114mg             274   2e-86   Citrus clementina [clementine]
ref|XP_006342156.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    274   3e-86   
gb|KHG26323.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    274   3e-86   Gossypium arboreum [tree cotton]
ref|XP_006473831.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    274   4e-86   Citrus sinensis [apfelsine]
gb|KJB57936.1|  hypothetical protein B456_009G186400                    273   5e-86   Gossypium raimondii
ref|XP_009362871.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    273   8e-86   Pyrus x bretschneideri [bai li]
gb|KDP36765.1|  hypothetical protein JCGZ_08056                         273   8e-86   Jatropha curcas
gb|AFG28405.1|  glyceraldehyde-3-phosphate dehydrogenase B              273   8e-86   Pyrus x bretschneideri [bai li]
ref|XP_010270515.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    273   1e-85   Nelumbo nucifera [Indian lotus]
ref|XP_002891244.1|  glyceraldehyde-3-phosphate dehydrogenase B s...    272   1e-85   
gb|AAD10210.1|  glyceraldehyde 3-phosphate dehydrogenase B subunit      271   1e-85   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009786329.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    272   2e-85   Nicotiana sylvestris
ref|XP_006307502.1|  hypothetical protein CARUB_v10009127mg             272   2e-85   Capsella rubella
ref|NP_174996.1|  glyceraldehyde-3-phosphate dehydrogenase B            272   2e-85   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009595874.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    272   2e-85   Nicotiana tomentosiformis
ref|XP_002273754.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    272   2e-85   Vitis vinifera
ref|XP_011034837.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    272   2e-85   Populus euphratica
emb|CAN69459.1|  hypothetical protein VITISV_021576                     272   2e-85   Vitis vinifera
ref|NP_001289237.1|  glyceraldehyde-3-phosphate dehydrogenase B, ...    271   3e-85   Pyrus x bretschneideri [bai li]
ref|XP_011074072.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    271   4e-85   Sesamum indicum [beniseed]
ref|XP_008237955.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    271   4e-85   Prunus mume [ume]
ref|XP_009780936.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    271   4e-85   Nicotiana sylvestris
ref|XP_009629570.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    271   4e-85   Nicotiana tomentosiformis
ref|XP_010478985.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    269   6e-85   Camelina sativa [gold-of-pleasure]
gb|KFK29151.1|  hypothetical protein AALP_AA7G095400                    270   7e-85   Arabis alpina [alpine rockcress]
ref|XP_010478986.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    270   8e-85   Camelina sativa [gold-of-pleasure]
gb|AEO45784.1|  glyceraldehyde-3-phosphate dehydrogenase B              270   8e-85   Scoparia dulcis [escobilla]
ref|XP_007135965.1|  hypothetical protein PHAVU_009G006600g             270   1e-84   Phaseolus vulgaris [French bean]
emb|CDY69523.1|  BnaC08g46180D                                          268   1e-84   Brassica napus [oilseed rape]
gb|AES74101.2|  glyceraldehyde-3-phosphate dehydrogenase B              266   1e-84   Medicago truncatula
ref|XP_009107645.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    270   2e-84   Brassica rapa
ref|XP_004300121.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    270   2e-84   Fragaria vesca subsp. vesca
ref|XP_010918353.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    270   2e-84   Elaeis guineensis
gb|AIU56855.1|  glyceraldehyde-3-phosphate dehydrogenase B              266   3e-84   Brassica rapa subsp. chinensis [bok-choy]
ref|XP_007211185.1|  hypothetical protein PRUPE_ppa005598mg             269   4e-84   Prunus persica
gb|KGN49135.1|  hypothetical protein Csa_6G514950                       260   4e-84   Cucumis sativus [cucumbers]
ref|XP_009384599.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    268   4e-84   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009384600.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    268   5e-84   Musa acuminata subsp. malaccensis [pisang utan]
emb|CBL43264.1|  glyceraldehyde-3-phosphate dehydrogenase               268   6e-84   Solanum tuberosum [potatoes]
ref|XP_003603851.1|  Glyceraldehyde-3-phosphate dehydrogenase           268   8e-84   Medicago truncatula
sp|P12859.2|G3PB_PEA  RecName: Full=Glyceraldehyde-3-phosphate de...    268   9e-84   Pisum sativum [garden pea]
emb|CAA33262.1|  unnamed protein product                                267   1e-83   Pisum sativum [garden pea]
ref|XP_006395998.1|  hypothetical protein EUTSA_v10004217mg             267   1e-83   Eutrema salsugineum [saltwater cress]
ref|XP_006342537.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    267   1e-83   Solanum tuberosum [potatoes]
ref|XP_004253122.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    266   2e-83   Solanum lycopersicum
gb|EPS70760.1|  hypothetical protein M569_03997                         266   4e-83   Genlisea aurea
ref|XP_008786670.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    266   5e-83   Phoenix dactylifera
ref|XP_004500847.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    267   8e-83   Cicer arietinum [garbanzo]
gb|ACJ84309.1|  unknown                                                 265   1e-82   Medicago truncatula
ref|XP_009362872.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    264   2e-82   
gb|ABF93789.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    259   4e-82   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009382077.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    263   9e-82   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008452998.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    262   1e-81   Cucumis melo [Oriental melon]
ref|XP_008452997.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    262   1e-81   
ref|XP_004145550.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    261   2e-81   Cucumis sativus [cucumbers]
ref|XP_006649326.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    261   3e-81   
dbj|BAJ86633.1|  predicted protein                                      261   3e-81   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ87214.1|  predicted protein                                      260   6e-81   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS49604.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    260   6e-81   Triticum urartu
ref|NP_001048847.1|  Os03g0129300                                       260   6e-81   
ref|XP_010061201.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    260   7e-81   Eucalyptus grandis [rose gum]
ref|XP_002981126.1|  hypothetical protein SELMODRAFT_271457             258   2e-80   
ref|XP_003558903.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    258   3e-80   
ref|XP_002982608.1|  hypothetical protein SELMODRAFT_179517             258   3e-80   Selaginella moellendorffii
ref|XP_010094540.1|  Glyceraldehyde-3-phosphate dehydrogenase B         270   6e-80   
ref|XP_010686856.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    255   5e-79   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006855683.1|  hypothetical protein AMTR_s00044p00131190          254   6e-79   
gb|ABS72003.1|  putative chloroplast glyceradehyde-3-phosphate de...    244   2e-78   Olea europaea
pdb|2PKQ|O  Chain O, Crystal Structure Of The Photosynthetic A2b2...    246   3e-76   Spinacia oleracea
sp|P12860.1|G3PB_SPIOL  RecName: Full=Glyceraldehyde-3-phosphate ...    247   7e-76   Spinacia oleracea
ref|XP_003603850.1|  Glyceraldehyde-3-phosphate dehydrogenase           246   4e-75   
emb|CAC80378.2|  glyceraldehyde-3-phosphate dehydrogenase               240   6e-73   Chara vulgaris
gb|EMT30317.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    238   2e-72   
gb|ACN40006.1|  unknown                                                 238   4e-72   Picea sitchensis
gb|ABK24645.1|  unknown                                                 238   4e-72   Picea sitchensis
gb|ACN40526.1|  unknown                                                 237   6e-72   Picea sitchensis
ref|XP_008650588.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    237   7e-72   
gb|ABD37964.1|  glyceraldehyde-3-phosphate dehydrogenase subunit B      233   2e-70   Chlorokybus atmophyticus
gb|ABD37965.1|  glyceraldehyde-3-phosphate dehydrogenase subunit B      229   4e-69   Mesostigma viride
pdb|2PKR|O  Chain O, Crystal Structure Of (a+cte)4 Chimeric Form ...    226   9e-69   Spinacia oleracea
emb|CAC80389.2|  glyceraldehyde-3-phosphate dehydrogenase               229   1e-68   Marchantia polymorpha
gb|ABK00057.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    224   1e-67   Mesostigma viride
sp|P09044.1|G3PB_TOBAC  RecName: Full=Glyceraldehyde-3-phosphate ...    224   5e-67   Nicotiana tabacum [American tobacco]
ref|XP_003056194.1|  hypothetical protein MICPUCDRAFT_25339             216   3e-64   Micromonas pusilla CCMP1545
ref|XP_007515295.1|  glyceraldehyde-3-phosphate dehydrogenase           214   2e-63   Bathycoccus prasinos
ref|XP_004985859.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    214   3e-63   Setaria italica
ref|XP_002507103.1|  glyceraldehyde-3-phosphate dehydrogenase B         213   5e-63   Micromonas commoda
ref|XP_001415434.1|  predicted protein                                  211   1e-62   Ostreococcus lucimarinus CCE9901
emb|CEF96577.1|  Glyceraldehyde 3-phosphate dehydrogenase, NAD(P)...    206   2e-60   Ostreococcus tauri
gb|ABG85191.1|  chloroplast glyceraldehyde-3-phosphate dehydrogen...    205   1e-59   Ostreococcus tauri
ref|XP_003074208.1|  NADP-glyceraldehyde-3-phosphate dehydrogenas...    204   1e-59   
gb|ABK00067.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    200   4e-59   Chlorokybus atmophyticus
gb|ABD37959.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      199   2e-58   Chlorokybus atmophyticus
sp|P09672.1|G3PA_SINAL  RecName: Full=Glyceraldehyde-3-phosphate ...    193   2e-57   Sinapis alba [bai jie]
gb|ABK00052.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    197   2e-57   Marchantia polymorpha
gb|ABY20971.1|  glyceraldehyde-3-phosphate dehydrogenase A subunit      189   3e-57   Hypericum perforatum
ref|XP_009148557.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    195   3e-57   
emb|CAC80388.1|  glyceraldehyde-3-phosphate dehydrogenase               197   3e-57   Marchantia polymorpha
gb|ADU04755.1|  glyceraldehyde-3-phosphate dehydrogenase                194   5e-57   Mesostigma viride
dbj|BAD93961.1|  glyceraldehyde 3-phosphate dehydrogenase A subunit     189   5e-57   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001077529.1|  glyceraldehyde 3-phosphate dehydrogenase GAPA2     194   5e-57   Arabidopsis thaliana [mouse-ear cress]
gb|KIY93372.1|  NADP-dependent glyceraldehydephosphatedehydrogena...    190   5e-57   Monoraphidium neglectum
ref|XP_010476270.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    194   6e-57   Camelina sativa [gold-of-pleasure]
ref|XP_010494750.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    194   7e-57   Camelina sativa [gold-of-pleasure]
gb|ADU04754.1|  glyceraldehyde-3-phosphate dehydrogenase                193   8e-57   Mesostigma viride
ref|XP_002503470.1|  glyceraldehyde-3-phosphate dehydrogenase a c...    195   1e-56   Micromonas commoda
gb|ABK00056.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    193   1e-56   Mesostigma viride
pir||DESPGA  glyceraldehyde-3-phosphate dehydrogenase (NADP)  (ph...    194   2e-56
dbj|BAK05515.1|  predicted protein                                      187   2e-56   Hordeum vulgare subsp. vulgare [two-rowed barley]
pdb|1JN0|O  Chain O, Crystal Structure Of The Non-regulatory A4 I...    193   3e-56   Spinacia oleracea
ref|XP_010425376.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    192   3e-56   Camelina sativa [gold-of-pleasure]
ref|XP_003055659.1|  hypothetical protein MICPUCDRAFT_49403             194   3e-56   Micromonas pusilla CCMP1545
ref|XP_009118049.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    192   3e-56   Brassica rapa
gb|EPS59235.1|  hypothetical protein M569_15573                         194   4e-56   Genlisea aurea
ref|XP_010502598.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    192   4e-56   Camelina sativa [gold-of-pleasure]
gb|ABD37961.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      192   7e-56   Mesostigma viride
ref|XP_002985183.1|  hypothetical protein SELMODRAFT_181561             194   8e-56   Selaginella moellendorffii
pdb|1RM5|O  Chain O, Crystal Structure Of Mutant S188a Of Photosy...    191   1e-55   Spinacia oleracea
pdb|1RM3|O  Chain O, Crystal Structure Of Mutant T33a Of Photosyn...    191   1e-55   Spinacia oleracea
pdb|1NBO|O  Chain O, The Dual Coenzyme Specificity Of Photosynthe...    191   1e-55   Spinacia oleracea
ref|NP_001117276.1|  glyceraldehyde 3-phosphate dehydrogenase GAPA2     192   1e-55   Arabidopsis thaliana [mouse-ear cress]
dbj|BAP91041.1|  glyceraldehyde 3-phosphate dehydrogenase-A             193   1e-55   Nicotiana benthamiana
ref|XP_010494747.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    193   1e-55   Camelina sativa [gold-of-pleasure]
ref|XP_009800449.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    193   1e-55   Nicotiana sylvestris
ref|XP_006417176.1|  hypothetical protein EUTSA_v10007809mg             192   1e-55   
ref|XP_009148556.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    193   1e-55   Brassica rapa
ref|XP_009631078.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    193   2e-55   Nicotiana tomentosiformis
ref|XP_006304985.1|  hypothetical protein CARUB_v10009349mg             193   2e-55   
ref|XP_010476269.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    193   2e-55   Camelina sativa [gold-of-pleasure]
ref|NP_172750.1|  glyceraldehyde 3-phosphate dehydrogenase GAPA2        193   2e-55   Arabidopsis thaliana [mouse-ear cress]
emb|CDY19412.1|  BnaC05g09210D                                          193   2e-55   Brassica napus [oilseed rape]
ref|XP_006417177.1|  hypothetical protein EUTSA_v10007809mg             192   2e-55   Eutrema salsugineum [saltwater cress]
ref|XP_002892719.1|  GAPA-2                                             192   2e-55   Arabidopsis lyrata subsp. lyrata
gb|AES74103.2|  glyceraldehyde-3-phosphate dehydrogenase B              193   2e-55   Medicago truncatula
sp|P19866.2|G3PA_SPIOL  RecName: Full=Glyceraldehyde-3-phosphate ...    192   2e-55   Spinacia oleracea
ref|XP_002970103.1|  hypothetical protein SELMODRAFT_270825             192   3e-55   Selaginella moellendorffii
dbj|BAK02737.1|  predicted protein                                      190   3e-55   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AIU56856.1|  glyceraldehyde-3-phosphate dehydrogenase A              191   3e-55   Brassica rapa subsp. chinensis [bok-choy]
gb|KHN46369.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    192   3e-55   Glycine soja [wild soybean]
ref|NP_001238484.1|  glyceraldehyde-3-phosphate dehydrogenase A s...    192   4e-55   
gb|KJB11770.1|  hypothetical protein B456_001G276400                    189   4e-55   Gossypium raimondii
gb|KHN46819.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    192   4e-55   Glycine soja [wild soybean]
emb|CDX83635.1|  BnaC07g23750D                                          191   4e-55   
gb|KDO85174.1|  hypothetical protein CISIN_1g012940mg                   192   4e-55   Citrus sinensis [apfelsine]
emb|CDY26599.1|  BnaA09g46780D                                          192   5e-55   Brassica napus [oilseed rape]
emb|CDY16038.1|  BnaC08g40850D                                          191   5e-55   Brassica napus [oilseed rape]
gb|KFK33590.1|  hypothetical protein AALP_AA5G033500                    191   5e-55   Arabis alpina [alpine rockcress]
ref|XP_006395535.1|  hypothetical protein EUTSA_v10004349mg             191   5e-55   Eutrema salsugineum [saltwater cress]
ref|XP_010028899.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    192   5e-55   Eucalyptus grandis [rose gum]
dbj|BAJ34149.1|  unnamed protein product                                191   5e-55   Eutrema halophilum
ref|XP_010694632.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    191   6e-55   Beta vulgaris subsp. vulgaris [field beet]
gb|KFK43560.1|  hypothetical protein AALP_AA1G142100                    191   7e-55   Arabis alpina [alpine rockcress]
ref|XP_009152035.1|  PREDICTED: LOW QUALITY PROTEIN: glyceraldehy...    191   7e-55   Brassica rapa
ref|XP_010425375.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    191   8e-55   Camelina sativa [gold-of-pleasure]
gb|ABD37956.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      187   8e-55   Spermatozopsis similis
ref|XP_010502597.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    191   8e-55   Camelina sativa [gold-of-pleasure]
ref|XP_003579898.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    191   1e-54   Brachypodium distachyon [annual false brome]
ref|XP_003548805.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    191   1e-54   
ref|XP_009118048.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    191   1e-54   Brassica rapa
ref|XP_006359279.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    191   1e-54   Solanum tuberosum [potatoes]
ref|XP_002512790.1|  glyceraldehyde 3-phosphate dehydrogenase, pu...    191   1e-54   Ricinus communis
emb|CDY13649.1|  BnaA06g32740D                                          190   1e-54   Brassica napus [oilseed rape]
ref|XP_007161788.1|  hypothetical protein PHAVU_001G098100g             191   2e-54   Phaseolus vulgaris [French bean]
emb|CDY28536.1|  BnaC02g36240D                                          190   2e-54   Brassica napus [oilseed rape]
gb|ACU21011.1|  unknown                                                 190   2e-54   Glycine max [soybeans]
pdb|3K2B|A  Chain A, Crystal Structure Of Photosynthetic A4 Isofo...    188   2e-54   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH57068.1|  AT1G12900                                              189   2e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007510189.1|  glyceraldehyde-3-phosphate dehydrogenase           189   2e-54   Bathycoccus prasinos
gb|AAD10209.1|  glyceraldehyde 3-phosphate dehydrogenase A subunit      189   2e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009362873.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    190   2e-54   
ref|XP_010514317.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    190   3e-54   
ref|NP_566796.2|  glyceraldehyde-3-phosphate dehydrogenase A subunit    189   3e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002955293.1|  hypothetical protein VOLCADRAFT_76662              189   3e-54   Volvox carteri f. nagariensis
dbj|BAG68209.1|  glyceraldehyde-3-phosphate dehydrogenase               187   3e-54   Brassica rapa subsp. chinensis [bok-choy]
gb|AAA32793.1|  glyceraldehyde 3-phosphate dehydrogenase                189   3e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010250427.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    189   3e-54   Nelumbo nucifera [Indian lotus]
gb|KDP41897.1|  hypothetical protein JCGZ_26915                         189   4e-54   Jatropha curcas
gb|KHG29734.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    188   4e-54   Gossypium arboreum [tree cotton]
ref|XP_002875330.1|  gapa                                               189   4e-54   Arabidopsis lyrata subsp. lyrata
gb|AHZ58488.1|  glyceraldehyde-3-phosphate dehydrogenase                189   4e-54   Syntrichia caninervis
gb|AHA84230.1|  glyceraldehyde-3-phosphate dehydrogenase A              189   4e-54   Phaseolus vulgaris [French bean]
ref|XP_004231523.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    189   4e-54   Solanum lycopersicum
dbj|BAJ10475.1|  glyceraldehyde-3-phosphate dehydrogenase               189   5e-54   Brassica rapa subsp. chinensis [bok-choy]
ref|XP_001689871.1|  glyceraldehyde-3-phosphate dehydrogenase           188   6e-54   Chlamydomonas reinhardtii
dbj|BAA94304.1|  NADP-glyceraldehyde-3-phosphate dehydrogenase          188   6e-54   Chlamydomonas sp. W80
dbj|BAJ90885.1|  predicted protein                                      189   6e-54   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ90530.1|  predicted protein                                      189   6e-54   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAG23800.1|  chloroplast NADP-dependent glyceraldehyde 3-phosp...    182   7e-54   Cucurbita pepo
gb|EMT31124.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    189   7e-54   
ref|XP_006291258.1|  hypothetical protein CARUB_v10017390mg             188   1e-53   Capsella rubella
ref|XP_006652373.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    188   1e-53   Oryza brachyantha
ref|XP_006652372.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    188   1e-53   
gb|ABA01125.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    187   1e-53   Chlamydomonas incerta
gb|KJB11771.1|  hypothetical protein B456_001G276400                    188   1e-53   Gossypium raimondii
ref|XP_001771209.1|  predicted protein                                  187   2e-53   
gb|KJB70724.1|  hypothetical protein B456_011G088800                    185   2e-53   Gossypium raimondii
gb|ABG85189.1|  chloroplast glyceraldehyde-3-phosphate dehydrogen...    187   2e-53   Ostreococcus tauri
ref|XP_003081785.1|  NADP-glyceraldehyde-3-phosphate dehydrogenas...    187   2e-53   
ref|XP_001771246.1|  predicted protein                                  187   2e-53   
ref|XP_004304578.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    187   3e-53   Fragaria vesca subsp. vesca
emb|CDY48981.1|  BnaA02g28150D                                          186   3e-53   Brassica napus [oilseed rape]
gb|AEH04452.1|  glyceraldehyde-3-phosphate dehydrogenase                186   5e-53   Arachis hypogaea [goober]
gb|AFC88822.1|  glyceraldehyde-3-phosphate dehydrogenase-like pro...    184   6e-53   Miscanthus sinensis
ref|XP_008797069.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    187   6e-53   
gb|ACX37507.1|  chloroplast glyceraldehyde 3-phosphate dehydrogenase    186   6e-53   Botryococcus braunii
ref|XP_001779769.1|  predicted protein                                  186   6e-53   
ref|XP_001779753.1|  predicted protein                                  186   8e-53   
emb|CAC80374.1|  glyceraldehyde-3-phosphate dehydrogenase               184   8e-53   Capsicum annuum
ref|XP_004975847.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    186   9e-53   Setaria italica
gb|ABD37966.1|  glyceraldehyde-3-phosphate dehydrogenase subunit B      184   1e-52   Spirogyra sp. SAG 170.80
gb|ACT21568.1|  glyceraldehyde-3-phosphate dehydrogenase                186   1e-52   Bruguiera gymnorhiza [Burma mangrove]
gb|ABD37962.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A1     185   1e-52   Physcomitrella patens
ref|XP_010090946.1|  Glyceraldehyde-3-phosphate dehydrogenase A         185   1e-52   Morus notabilis
gb|ABD37957.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      185   1e-52   Cladophora rupestris
tpg|DAA37469.1|  TPA: glyceraldehyde-3-phosphate dehydrogenase1         185   2e-52   
ref|NP_001105414.1|  glyceraldehyde-3-phosphate dehydrogenase A, ...    185   2e-52   Zea mays [maize]
ref|XP_009378072.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    184   2e-52   Pyrus x bretschneideri [bai li]
ref|XP_001753934.1|  predicted protein                                  185   2e-52   
ref|XP_011399143.1|  Glyceraldehyde-3-phosphate dehydrogenase A, ...    185   2e-52   Auxenochlorella protothecoides
emb|CAA30152.1|  GADPH (383 AA)                                         184   2e-52   Zea mays [maize]
gb|KHG21941.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    184   2e-52   Gossypium arboreum [tree cotton]
gb|ABD37963.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A2     182   2e-52   Physcomitrella patens
ref|XP_007032095.1|  Glyceraldehyde 3-phosphate dehydrogenase A s...    185   2e-52   Theobroma cacao [chocolate]
ref|XP_008362077.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    184   3e-52   Malus domestica [apple tree]
ref|XP_009378071.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    184   3e-52   Pyrus x bretschneideri [bai li]
ref|XP_008379036.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    184   3e-52   Malus domestica [apple tree]
ref|XP_008231212.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    184   3e-52   Prunus mume [ume]
ref|XP_007217883.1|  hypothetical protein PRUPE_ppa006610mg             184   3e-52   Prunus persica
gb|ABK00053.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    184   3e-52   Marchantia polymorpha
ref|XP_001766703.1|  predicted protein                                  184   4e-52   
ref|NP_001052984.1|  Os04g0459500                                       184   4e-52   
gb|KJB70723.1|  hypothetical protein B456_011G088800                    184   7e-52   Gossypium raimondii
ref|XP_004493116.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    182   2e-51   Cicer arietinum [garbanzo]
gb|ACV32597.1|  putative glyceraldehyde-3-phosphate dehydrogenase       182   3e-51   Medicago sativa [alfalfa]
ref|XP_003548929.2|  PREDICTED: LOW QUALITY PROTEIN: glyceraldehy...    180   3e-51   
ref|XP_003624553.1|  Glyceraldehyde-3-phosphate dehydrogenase A         182   3e-51   Medicago truncatula
gb|ABG85190.1|  chloroplast glyceraldehyde-3-phosphate dehydrogen...    181   3e-51   Ostreococcus sp. 'lucimarinus'
emb|CAA33264.1|  unnamed protein product                                181   4e-51   Pisum sativum [garden pea]
ref|XP_001420043.1|  predicted protein                                  180   4e-51   Ostreococcus lucimarinus CCE9901
gb|ABD37953.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      179   4e-51   Chlorella sp. JP-2005
sp|P12858.2|G3PA_PEA  RecName: Full=Glyceraldehyde-3-phosphate de...    181   4e-51   Pisum sativum [garden pea]
ref|NP_001289256.1|  glyceraldehyde-3-phosphate dehydrogenase A, ...    181   5e-51   Pyrus x bretschneideri [bai li]
gb|ABD37955.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      180   1e-50   Scherffelia dubia
ref|WP_015160704.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    177   4e-50   Chamaesiphon minutus
gb|ADH43199.1|  glyceraldehyde-3-phosphate dehydrogenase                178   5e-50   Vicia sativa [spring vetch]
ref|XP_010528120.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    175   7e-50   Tarenaya hassleriana [spider flower]
gb|ABW89104.1|  glyceraldehyde-3-phosphate dehydrogenase                172   8e-50   Helianthus annuus
gb|ABW89099.1|  glyceraldehyde-3-phosphate dehydrogenase                172   8e-50   Helianthus annuus
gb|ABG35250.1|  glyceraldehyde-3-phosphate dehydrogenase                172   2e-49   Helianthus annuus
gb|ABG35254.1|  glyceraldehyde-3-phosphate dehydrogenase                172   2e-49   Helianthus annuus
ref|XP_006844714.1|  hypothetical protein AMTR_s00016p00251680          176   6e-49   Amborella trichopoda
emb|CAC80390.1|  glyceraldehyde-3-phosphate dehydrogenase               173   7e-49   Coleochaete scutata
gb|ABG35267.1|  glyceraldehyde-3-phosphate dehydrogenase                170   9e-49   Helianthus annuus
ref|XP_010528117.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    174   2e-48   Tarenaya hassleriana [spider flower]
gb|AEO45783.1|  glyceraldehyde-3-phosphate dehydrogenase A              174   2e-48   Scoparia dulcis [escobilla]
ref|XP_005644071.1|  glyceraldehyde-3-phosphate dehydrogenase           174   3e-48   Coccomyxa subellipsoidea C-169
gb|KDO63479.1|  hypothetical protein CISIN_1g013492mg                   171   3e-48   
ref|WP_039753495.1|  glyceraldehyde-3-phosphate dehydrogenase           172   3e-48   
ref|XP_011070460.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    174   3e-48   
emb|CAC80393.1|  glyceraldehyde-3-phosphate dehydrogenase               171   4e-48   
gb|AHZ94971.1|  glyceraldehyde-3-phosphate dehydrogenase                172   5e-48   
gb|ABD37954.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      173   7e-48   
ref|XP_010507000.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    164   7e-48   
gb|EYU35565.1|  hypothetical protein MIMGU_mgv1a005886mg                174   8e-48   
gb|ERT05629.1|  glyceraldehyde-3-phosphate dehydrogenase, type I        169   1e-47   
ref|XP_009420999.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    172   1e-47   
gb|ACA35006.1|  glyceraldehyde-3-phosphate dehydrogenase                171   2e-47   
gb|ADX97321.1|  glyceraldehyde-3-phosphate dehydrogenase                172   2e-47   
gb|ABD37958.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      169   2e-47   
ref|XP_010430771.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    163   3e-47   
gb|AAA33780.1|  glyceraldehyde-phosphate dehydrogenase                  171   3e-47   
ref|XP_004236849.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    171   3e-47   
ref|WP_040484381.1|  glyceraldehyde-3-phosphate dehydrogenase           170   3e-47   
gb|ACN39951.1|  unknown                                                 169   3e-47   
gb|ABK94956.1|  unknown                                                 171   4e-47   
ref|XP_006386825.1|  hypothetical protein POPTR_0002s22600g             171   4e-47   
gb|ABK96233.1|  unknown                                                 171   4e-47   
ref|XP_009404713.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    171   4e-47   
emb|CAC80392.1|  glyceraldehyde-3-phosphate dehydrogenase               169   4e-47   
gb|ACN40000.1|  unknown                                                 171   5e-47   
ref|XP_008663258.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    171   5e-47   
gb|ACN40537.1|  unknown                                                 171   5e-47   
gb|ABK25233.1|  unknown                                                 171   5e-47   
ref|XP_008663264.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    171   5e-47   
ref|XP_010249379.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    171   5e-47   
gb|ABK96725.1|  unknown                                                 171   6e-47   
sp|P09043.1|G3PA_TOBAC  RecName: Full=Glyceraldehyde-3-phosphate ...    170   6e-47   
ref|XP_006446865.1|  hypothetical protein CICLE_v10015476mg             170   7e-47   
gb|AFW58485.1|  hypothetical protein ZEAMMB73_956640                    169   7e-47   
ref|XP_006468948.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    170   8e-47   
gb|KDO63477.1|  hypothetical protein CISIN_1g013492mg                   170   8e-47   
ref|WP_029637377.1|  glyceraldehyde-3-phosphate dehydrogenase [         168   9e-47   
ref|XP_010929533.1|  PREDICTED: LOW QUALITY PROTEIN: glyceraldehy...    166   1e-46   
ref|XP_008664191.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    170   2e-46   
gb|KDO63476.1|  hypothetical protein CISIN_1g013492mg                   170   2e-46   
gb|ABC00187.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    169   2e-46   
gb|ABK24313.1|  unknown                                                 169   2e-46   
ref|WP_044492436.1|  glyceraldehyde-3-phosphate dehydrogenase           167   3e-46   
gb|EGJ33840.1|  glyceraldehyde 3-phosphate dehydrogenase, NADP+         167   3e-46   
ref|WP_036481597.1|  glyceraldehyde-3-phosphate dehydrogenase           167   3e-46   
ref|XP_002321065.2|  hypothetical protein POPTR_0014s13660g             168   3e-46   
ref|XP_011033706.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    168   4e-46   
ref|XP_010942312.1|  PREDICTED: LOW QUALITY PROTEIN: glyceraldehy...    169   4e-46   
gb|EMS61784.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    167   6e-46   
ref|XP_002278352.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    168   6e-46   
emb|CAN78872.1|  hypothetical protein VITISV_021726                     168   6e-46   
ref|XP_010660642.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    168   6e-46   
emb|CCF55355.1|  Glyceraldehyde-3-phosphate dehydrogenase A             167   7e-46   
ref|XP_004161334.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    167   7e-46   
ref|XP_011003600.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    167   7e-46   
ref|XP_004145622.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    167   8e-46   
ref|WP_008231341.1|  NADPH-dependent glyceraldehyde-3-phosphate d...    166   9e-46   
gb|AGJ50596.1|  GAPDH                                                   167   1e-45   
ref|WP_022607378.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    166   1e-45   
ref|XP_008449975.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    167   1e-45   
ref|WP_015199557.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    165   1e-45   
ref|XP_008449974.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    167   1e-45   
ref|WP_018398495.1|  glyceraldehyde-3-phosphate dehydrogenase           165   1e-45   
ref|WP_026103380.1|  glyceraldehyde-3-phosphate dehydrogenase           165   2e-45   
gb|ELS46726.1|  glyceraldehyde-3-phosphate dehydrogenase 2              164   2e-45   
gb|AHJ31016.1|  NADPH-dependent glyceraldehyde-3-phosphate dehydr...    162   2e-45   
ref|WP_007307714.1|  glyceraldehyde-3-phosphate dehydrogenase           164   3e-45   
gb|ADB81492.1|  glyceraldehyde-3-phosphate dehydrogenase                164   3e-45   
ref|WP_009787048.1|  glyceraldehyde-3-phosphate dehydrogenase           164   3e-45   
ref|WP_042151414.1|  glyceraldehyde-3-phosphate dehydrogenase           164   4e-45   
ref|WP_026787014.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    164   5e-45   
ref|WP_015191528.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    164   5e-45   
gb|ADB81490.1|  glyceraldehyde-3-phosphate dehydrogenase                159   5e-45   
ref|WP_016876187.1|  glyceraldehyde-3-phosphate dehydrogenase           164   5e-45   
ref|WP_026098586.1|  glyceraldehyde-3-phosphate dehydrogenase           164   6e-45   
ref|WP_039200023.1|  glyceraldehyde-3-phosphate dehydrogenase           164   6e-45   
ref|WP_027404344.1|  glyceraldehyde-3-phosphate dehydrogenase           163   7e-45   
ref|WP_011319102.1|  glyceraldehyde-3-phosphate dehydrogenase           163   7e-45   
ref|WP_012265625.1|  glyceraldehyde-3-phosphate dehydrogenase           163   8e-45   
ref|WP_040932844.1|  glyceraldehyde-3-phosphate dehydrogenase           163   8e-45   
ref|WP_009626155.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    163   9e-45   
ref|WP_012407249.1|  glyceraldehyde-3-phosphate dehydrogenase           163   9e-45   
ref|WP_015954248.1|  glyceraldehyde-3-phosphate dehydrogenase           163   9e-45   
dbj|GAL93645.1|  NADPH-dependent glyceraldehyde-3-phosphate dehyd...    163   9e-45   
ref|WP_015141410.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    163   1e-44   
ref|WP_002731954.1|  glyceraldehyde-3-phosphate dehydrogenase           163   1e-44   
ref|WP_002780388.1|  Glyceraldehyde-3-phosphate dehydrogenase 2         163   1e-44   
emb|CCH97953.1|  Glyceraldehyde-3-phosphate dehydrogenase 2             163   1e-44   
ref|WP_035157424.1|  glyceraldehyde-3-phosphate dehydrogenase           162   1e-44   
emb|CCH91489.1|  Glyceraldehyde-3-phosphate dehydrogenase 2             163   1e-44   
emb|CCI19184.1|  Glyceraldehyde-3-phosphate dehydrogenase 2             163   2e-44   
ref|WP_010999188.1|  glyceraldehyde-3-phosphate dehydrogenase           162   2e-44   
gb|ADB81483.1|  glyceraldehyde-3-phosphate dehydrogenase                157   2e-44   
ref|WP_015080375.1|  type I glyceraldehyde-3-phosphate dehydrogenase    162   2e-44   
ref|WP_026731665.1|  glyceraldehyde-3-phosphate dehydrogenase           162   2e-44   
gb|AGW80488.1|  glyceraldehyde 3 phosphate dehydrogenase                162   2e-44   
ref|WP_026099703.1|  glyceraldehyde-3-phosphate dehydrogenase           162   2e-44   
ref|WP_026100517.1|  glyceraldehyde-3-phosphate dehydrogenase           162   2e-44   
ref|WP_015172689.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    162   2e-44   
ref|WP_006634268.1|  glyceraldehyde-3-phosphate dehydrogenase           162   3e-44   
ref|WP_015145817.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    162   3e-44   
ref|WP_006197155.1|  glyceraldehyde-3-phosphate dehydrogenase           162   3e-44   
ref|WP_009544928.1|  glyceraldehyde-3-phosphate dehydrogenase           162   3e-44   
ref|WP_039900510.1|  glyceraldehyde-3-phosphate dehydrogenase           162   3e-44   
gb|ACN57670.1|  At3g26650-like protein                                  155   3e-44   
ref|WP_008276272.1|  glyceraldehyde-3-phosphate dehydrogenase           162   3e-44   
ref|WP_016865320.1|  glyceraldehyde-3-phosphate dehydrogenase           162   4e-44   
ref|WP_013324586.1|  glyceraldehyde-3-phosphate dehydrogenase           162   4e-44   
ref|WP_035985041.1|  glyceraldehyde-3-phosphate dehydrogenase           162   4e-44   
ref|WP_015116915.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    162   4e-44   
gb|AAA21996.1|  glyceraldehyde-3-phosphate dehydrogenase                161   4e-44   
ref|WP_041226596.1|  glyceraldehyde-3-phosphate dehydrogenase           161   4e-44   
ref|WP_002799040.1|  glyceraldehyde-3-phosphate dehydrogenase           161   4e-44   
ref|WP_004268080.1|  glyceraldehyde-3-phosphate dehydrogenase           161   4e-44   
ref|WP_009459769.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    161   4e-44   
emb|CCI33980.1|  Glyceraldehyde-3-phosphate dehydrogenase 2             162   5e-44   
gb|AFZ13204.1|  glyceraldehyde 3-phosphate dehydrogenase (NADP+)        162   6e-44   
ref|WP_015178398.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    161   6e-44   
gb|EDZ94203.1|  glyceraldehyde-3-phosphate dehydrogenase, type I        161   6e-44   
ref|WP_039933175.1|  glyceraldehyde-3-phosphate dehydrogenase           161   7e-44   
emb|CAC80372.1|  glyceraldehyde-3-phosphate dehydrogenase               160   7e-44   
ref|WP_012595832.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    161   7e-44   
ref|WP_008050956.1|  glyceraldehyde-3-phosphate dehydrogenase           161   7e-44   
ref|WP_015168952.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    160   7e-44   
ref|WP_007358062.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    160   9e-44   
ref|WP_017320834.1|  glyceraldehyde-3-phosphate dehydrogenase           160   9e-44   
ref|WP_028085442.1|  glyceraldehyde-3-phosphate dehydrogenase           160   9e-44   
gb|ACN57671.1|  At3g26650-like protein                                  154   1e-43   
ref|WP_015222961.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    160   1e-43   
ref|WP_028089468.1|  glyceraldehyde-3-phosphate dehydrogenase           160   2e-43   
gb|AAD10216.1|  glyceraldehyde-3-phosphate dehydrogenase                162   2e-43   
ref|WP_019493013.1|  glyceraldehyde-3-phosphate dehydrogenase           160   2e-43   
ref|WP_009555393.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    159   2e-43   
ref|WP_036001291.1|  glyceraldehyde-3-phosphate dehydrogenase           159   3e-43   
gb|ABA01156.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    159   3e-43   
gb|KIJ84331.1|  glyceraldehyde-3-phosphate dehydrogenase                159   3e-43   
ref|WP_006279110.1|  glyceraldehyde-3-phosphate dehydrogenase           159   3e-43   
ref|WP_015113093.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    159   3e-43   
ref|WP_006528243.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    159   3e-43   
gb|ABR18416.1|  unknown                                                 162   4e-43   
ref|WP_026079517.1|  glyceraldehyde-3-phosphate dehydrogenase           159   4e-43   
ref|WP_015146993.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    159   5e-43   
sp|P80505.3|G3P2_SYNY3  RecName: Full=Glyceraldehyde-3-phosphate ...    159   5e-43   
emb|CAA58550.1|  glyceraldehyde-3-phosphate dehydrogenase (NADP+)...    159   5e-43   
ref|WP_010874115.1|  glyceraldehyde-3-phosphate dehydrogenase           159   5e-43   
gb|AAM68969.1|AF406629_1  glyceraldehyde-3-phosphate dehydrogenase      154   5e-43   
ref|WP_027840812.1|  glyceraldehyde-3-phosphate dehydrogenase           159   5e-43   
ref|WP_017293448.1|  glyceraldehyde-3-phosphate dehydrogenase           158   6e-43   
ref|WP_028954384.1|  glyceraldehyde-3-phosphate dehydrogenase           158   7e-43   
ref|WP_015220848.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    158   7e-43   
ref|WP_023075014.1|  glyceraldehyde 3-phosphate dehydrogenase (na...    158   7e-43   
sp|P34919.1|G3PA_CHOCR  RecName: Full=Glyceraldehyde-3-phosphate ...    160   7e-43   
ref|XP_005715477.1|  glyceraldehyde-3-phosphate dehydrogenase           160   7e-43   
ref|WP_015132368.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    158   7e-43   
ref|WP_028949102.1|  glyceraldehyde-3-phosphate dehydrogenase           158   9e-43   
ref|WP_042341685.1|  glyceraldehyde-3-phosphate dehydrogenase           158   9e-43   
ref|WP_017312563.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    158   9e-43   
ref|WP_016860363.1|  glyceraldehyde-3-phosphate dehydrogenase           158   9e-43   
ref|WP_026719817.1|  glyceraldehyde-3-phosphate dehydrogenase           158   1e-42   
gb|EDX87031.1|  glyceraldehyde-3-phosphate dehydrogenase, type I        157   1e-42   
ref|WP_009343864.1|  glyceraldehyde-3-phosphate dehydrogenase           157   1e-42   
ref|WP_015210633.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    157   1e-42   
ref|WP_011613378.1|  glyceraldehyde-3-phosphate dehydrogenase           157   1e-42   
gb|ADB81480.1|  glyceraldehyde-3-phosphate dehydrogenase                152   1e-42   
dbj|BAI88897.1|  glyceraldehyde-3-phosphate dehydrogenase               157   1e-42   
ref|WP_006619928.1|  glyceraldehyde-3-phosphate dehydrogenase           157   1e-42   
ref|WP_026082358.1|  glyceraldehyde-3-phosphate dehydrogenase           157   2e-42   
gb|AFY30551.1|  glyceraldehyde 3-phosphate dehydrogenase (NADP+)        158   2e-42   
ref|WP_006625490.1|  glyceraldehyde-3-phosphate dehydrogenase           157   2e-42   
gb|EDX77136.1|  glyceraldehyde-3-phosphate dehydrogenase, type I        157   2e-42   
ref|WP_019504971.1|  glyceraldehyde-3-phosphate dehydrogenase           157   2e-42   
ref|WP_015156647.1|  MULTISPECIES: glyceraldehyde 3-phosphate deh...    157   2e-42   
ref|WP_044205566.1|  glyceraldehyde-3-phosphate dehydrogenase           157   2e-42   
ref|WP_017291296.1|  glyceraldehyde-3-phosphate dehydrogenase           157   3e-42   
ref|WP_038015315.1|  glyceraldehyde-3-phosphate dehydrogenase           157   3e-42   
sp|P30724.1|G3PA_GRAGA  RecName: Full=Glyceraldehyde-3-phosphate ...    158   3e-42   
gb|ADB81495.1|  glyceraldehyde-3-phosphate dehydrogenase                151   3e-42   
ref|WP_015182060.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    156   4e-42   
ref|WP_013190254.1|  glyceraldehyde-3-phosphate dehydrogenase           156   4e-42   
ref|WP_026072888.1|  glyceraldehyde-3-phosphate dehydrogenase           156   4e-42   
ref|WP_041036790.1|  glyceraldehyde-3-phosphate dehydrogenase           156   4e-42   
ref|XP_005704189.1|  glyceraldehyde-3-phosphate dehydrogenase (NA...    157   5e-42   
ref|WP_013781101.1|  glyceraldehyde-3-phosphate dehydrogenase           155   6e-42   
sp|Q8VXQ9.1|G3PA_SCEVA  RecName: Full=Glyceraldehyde-3-phosphate ...    155   7e-42   
ref|WP_006510998.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    155   8e-42   
ref|WP_007556447.1|  glyceraldehyde-3-phosphate dehydrogenase           155   9e-42   
ref|WP_016951733.1|  glyceraldehyde-3-phosphate dehydrogenase           155   9e-42   
ref|WP_007133015.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    155   1e-41   
ref|WP_015189930.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    155   1e-41   
ref|WP_017742837.1|  glyceraldehyde-3-phosphate dehydrogenase           155   1e-41   
ref|WP_024545764.1|  glyceraldehyde-3-phosphate dehydrogenase           155   1e-41   
ref|WP_012305745.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    154   2e-41   
ref|WP_011244659.1|  glyceraldehyde-3-phosphate dehydrogenase           154   2e-41   
ref|WP_011378166.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    154   2e-41   
ref|WP_017659782.1|  glyceraldehyde-3-phosphate dehydrogenase           154   2e-41   
ref|WP_015212526.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    154   3e-41   
dbj|GAK42869.1|  glyceraldehyde-3-phosphate dehydrogenase               154   3e-41   
ref|WP_036532393.1|  glyceraldehyde-3-phosphate dehydrogenase           154   3e-41   
gb|AAM68968.1|AF406628_1  glyceraldehyde-3-phosphate dehydrogenase      155   4e-41   
emb|CAC80373.1|  glyceraldehyde-3-phosphate dehydrogenase               153   5e-41   
ref|WP_015109880.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    153   6e-41   
ref|WP_012626430.1|  glyceraldehyde-3-phosphate dehydrogenase           153   6e-41   
ref|WP_019422012.1|  glyceraldehyde-3-phosphate dehydrogenase           153   7e-41   
ref|WP_009593640.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    152   9e-41   
ref|WP_007554130.1|  glyceraldehyde-3-phosphate dehydrogenase           152   9e-41   
ref|WP_023172550.1|  glyceraldehyde-3-phosphate dehydrogenase           152   1e-40   
ref|WP_016423763.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    152   1e-40   
ref|WP_037218187.1|  glyceraldehyde-3-phosphate dehydrogenase           152   1e-40   
gb|KIE07728.1|  glyceraldehyde-3-phosphate dehydrogenase                152   1e-40   
ref|WP_015163373.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    152   2e-40   
ref|WP_021252824.1|  MULTISPECIES: GapA                                 151   2e-40   
ref|WP_021258216.1|  MULTISPECIES: GapA                                 151   2e-40   
ref|WP_038262010.1|  glyceraldehyde-3-phosphate dehydrogenase [         151   3e-40   
gb|ADB81481.1|  glyceraldehyde-3-phosphate dehydrogenase                147   3e-40   
ref|WP_008859280.1|  glyceraldehyde-3-phosphate dehydrogenase           151   3e-40   
ref|WP_022382428.1|  glyceraldehyde-3-phosphate dehydrogenase type I    151   3e-40   
ref|WP_006207583.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    151   4e-40   
ref|WP_010272964.1|  glyceraldehyde-3-phosphate dehydrogenase           151   4e-40   
ref|WP_025961703.1|  hypothetical protein                               145   4e-40   
ref|WP_011140533.1|  glyceraldehyde-3-phosphate dehydrogenase           150   5e-40   
ref|WP_019477438.1|  glyceraldehyde-3-phosphate dehydrogenase           150   6e-40   
ref|WP_036761887.1|  glyceraldehyde-3-phosphate dehydrogenase           150   7e-40   



>ref|XP_002540513.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
 gb|EEF21870.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
Length=193

 Score =   272 bits (696),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 148/162 (91%), Positives = 157/162 (97%), Gaps = 0/162 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKGLTAEDVNAAFR
Sbjct  32   NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFR  91

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA++GPLKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  92   KAAEGPLKGILDVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  151

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  105
            VVDLAHLVA+KWPG + AGSGD LED+C+TNP DKECKVFE+
Sbjct  152  VVDLAHLVAAKWPGASAAGSGDALEDFCETNPADKECKVFES  193



>ref|XP_011034836.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X1 [Populus euphratica]
Length=452

 Score =   281 bits (718),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 151/162 (93%), Positives = 159/162 (98%), Gaps = 0/162 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFR
Sbjct  291  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFR  350

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA++GPLKGVLDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM+KVVAWYDNEWGYSQR
Sbjct  351  KAAEGPLKGVLDVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMIKVVAWYDNEWGYSQR  410

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  105
            VVDLAHLVASKWPGVA AGSGDPLED+CKTNP D+ECKV+EA
Sbjct  411  VVDLAHLVASKWPGVAAAGSGDPLEDFCKTNPADEECKVYEA  452



>ref|XP_011041188.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Populus euphratica]
Length=452

 Score =   280 bits (715),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 150/162 (93%), Positives = 158/162 (98%), Gaps = 0/162 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVN AFR
Sbjct  291  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNGAFR  350

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA++GPLKGVLDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM+KVVAWYDNEWGYSQR
Sbjct  351  KAAEGPLKGVLDVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMIKVVAWYDNEWGYSQR  410

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  105
            VVDLAHLVASKWPGVA AGSGDPLED+CKTNP D+ECKV+EA
Sbjct  411  VVDLAHLVASKWPGVAAAGSGDPLEDFCKTNPADEECKVYEA  452



>ref|XP_002307806.1| glyceraldehyde-3-phosphate dehydrogenase family protein [Populus 
trichocarpa]
 gb|EEE94802.1| glyceraldehyde-3-phosphate dehydrogenase family protein [Populus 
trichocarpa]
Length=452

 Score =   278 bits (712),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 149/162 (92%), Positives = 158/162 (98%), Gaps = 0/162 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVN AFR
Sbjct  291  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNGAFR  350

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA++GPLKGVLDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM+KVVAWYDNEWGYSQR
Sbjct  351  KAAEGPLKGVLDVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMIKVVAWYDNEWGYSQR  410

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  105
            VVDLAHLVA+KWPGVA AGSGDPLED+CKTNP D+ECKV+EA
Sbjct  411  VVDLAHLVANKWPGVAAAGSGDPLEDFCKTNPADEECKVYEA  452



>ref|XP_006383783.1| hypothetical protein POPTR_0005s27550g [Populus trichocarpa]
 gb|ERP61580.1| hypothetical protein POPTR_0005s27550g [Populus trichocarpa]
Length=421

 Score =   277 bits (709),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 149/162 (92%), Positives = 158/162 (98%), Gaps = 0/162 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVN AFR
Sbjct  260  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNGAFR  319

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA++GPLKGVLDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM+KVVAWYDNEWGYSQR
Sbjct  320  KAAEGPLKGVLDVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMIKVVAWYDNEWGYSQR  379

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  105
            VVDLAHLVA+KWPGVA AGSGDPLED+CKTNP D+ECKV+EA
Sbjct  380  VVDLAHLVANKWPGVAAAGSGDPLEDFCKTNPADEECKVYEA  421



>ref|XP_002300632.2| hypothetical protein POPTR_0002s00840g [Populus trichocarpa]
 gb|EEE79905.2| hypothetical protein POPTR_0002s00840g [Populus trichocarpa]
Length=474

 Score =   279 bits (713),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 150/162 (93%), Positives = 158/162 (98%), Gaps = 0/162 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFR
Sbjct  313  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFR  372

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA++GPLKGVLDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM+KVVAWYDNEWGYSQR
Sbjct  373  KAAEGPLKGVLDVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMIKVVAWYDNEWGYSQR  432

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  105
            VVDL HLVASKWPGVA AGSGDPLED+CKTNP D+ECKV+EA
Sbjct  433  VVDLGHLVASKWPGVAAAGSGDPLEDFCKTNPADEECKVYEA  474



>gb|KJB14201.1| hypothetical protein B456_002G114000 [Gossypium raimondii]
Length=454

 Score =   278 bits (711),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 150/162 (93%), Positives = 159/162 (98%), Gaps = 0/162 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFR
Sbjct  293  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFR  352

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            K+++GPLKGVL+VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  353  KSAEGPLKGVLEVCDIPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  412

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  105
            VVDLAHLVASKWPG+ VAGSGDPLEDYCKTNP D+ECKV+EA
Sbjct  413  VVDLAHLVASKWPGMPVAGSGDPLEDYCKTNPADEECKVYEA  454



>ref|XP_007018105.1| Glyceraldehyde-3-phosphate dehydrogenase B subunit [Theobroma 
cacao]
 gb|EOY15330.1| Glyceraldehyde-3-phosphate dehydrogenase B subunit [Theobroma 
cacao]
Length=452

 Score =   278 bits (710),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 150/162 (93%), Positives = 157/162 (97%), Gaps = 0/162 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFR
Sbjct  291  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFR  350

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA++GPLKGVLDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  351  KAAEGPLKGVLDVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  410

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  105
            VVDLAHLVASKWPGV  AGS DPLED+CKTNP D+ECKV+EA
Sbjct  411  VVDLAHLVASKWPGVPAAGSADPLEDFCKTNPADEECKVYEA  452



>gb|KHG00663.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Gossypium 
arboreum]
Length=454

 Score =   278 bits (710),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 150/162 (93%), Positives = 158/162 (98%), Gaps = 0/162 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFR
Sbjct  293  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFR  352

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA++GPLKGVL+VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  353  KAAEGPLKGVLEVCDIPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  412

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  105
            VVDLAHLVASKWPG+ VAGSGDPLEDYCK NP D+ECKV+EA
Sbjct  413  VVDLAHLVASKWPGMPVAGSGDPLEDYCKANPADEECKVYEA  454



>ref|XP_004238446.2| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Solanum lycopersicum]
Length=450

 Score =   275 bits (704),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 148/161 (92%), Positives = 158/161 (98%), Gaps = 0/161 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFR
Sbjct  290  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFR  349

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA+DGPLKG+LDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  350  KAADGPLKGILDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  409

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  108
            VVDLAHLVASKWPGVA  GSGDPL+++C+TNP D+ECKV+E
Sbjct  410  VVDLAHLVASKWPGVAAPGSGDPLDEFCETNPSDEECKVYE  450



>emb|CDP07271.1| unnamed protein product [Coffea canephora]
Length=458

 Score =   276 bits (705),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 148/162 (91%), Positives = 158/162 (98%), Gaps = 0/162 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+K+GLTAEDVNAAFR
Sbjct  297  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKRGLTAEDVNAAFR  356

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA+DGPLKG+LDVCDAPLVSVDF+C+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  357  KAADGPLKGILDVCDAPLVSVDFKCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  416

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  105
            VVDLAHLVASKWPG+ + GSGDPLEDYCKTN  D+ECKV+EA
Sbjct  417  VVDLAHLVASKWPGLFIDGSGDPLEDYCKTNAADEECKVYEA  458



>gb|ACU20783.1| unknown [Glycine max]
Length=452

 Score =   275 bits (704),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 148/161 (92%), Positives = 157/161 (98%), Gaps = 0/161 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKGLTAEDVNAAFR
Sbjct  292  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFR  351

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA++GPLKGVLDVCD PLVS+DFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  352  KAAEGPLKGVLDVCDVPLVSIDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  411

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  108
            VVDLAHLVASKWPG A AGSGDPLE++C+TNP D+ECKV+E
Sbjct  412  VVDLAHLVASKWPGTAKAGSGDPLEEFCETNPADEECKVYE  452



>ref|XP_002510706.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
 gb|EEF52893.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
Length=458

 Score =   275 bits (704),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 148/162 (91%), Positives = 157/162 (97%), Gaps = 0/162 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKGLTAEDVNAAFR
Sbjct  297  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFR  356

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA++GPLKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  357  KAAEGPLKGILDVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  416

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  105
            VVDLAHLVA+KWPG + AGSGD LED+C+TNP DKECKVFE+
Sbjct  417  VVDLAHLVAAKWPGASAAGSGDALEDFCETNPADKECKVFES  458



>ref|NP_001237135.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Glycine max]
 gb|ABA86964.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Glycine max]
Length=451

 Score =   275 bits (703),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 148/161 (92%), Positives = 157/161 (98%), Gaps = 0/161 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKGLTAEDVNAAFR
Sbjct  291  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFR  350

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA++GPLKGVLDVCD PLVS+DFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  351  KAAEGPLKGVLDVCDVPLVSIDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  410

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  108
            VVDLAHLVASKWPG A AGSGDPLE++C+TNP D+ECKV+E
Sbjct  411  VVDLAHLVASKWPGAAKAGSGDPLEEFCETNPADEECKVYE  451



>ref|XP_006581071.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B subunit 
isoform X1 [Glycine max]
Length=453

 Score =   275 bits (704),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 148/161 (92%), Positives = 157/161 (98%), Gaps = 0/161 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKGLTAEDVNAAFR
Sbjct  293  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFR  352

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA++GPLKGVLDVCD PLVS+DFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  353  KAAEGPLKGVLDVCDVPLVSIDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  412

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  108
            VVDLAHLVASKWPG A AGSGDPLE++C+TNP D+ECKV+E
Sbjct  413  VVDLAHLVASKWPGAAKAGSGDPLEEFCETNPADEECKVYE  453



>gb|KJB57938.1| hypothetical protein B456_009G186400 [Gossypium raimondii]
Length=399

 Score =   273 bits (699),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 148/162 (91%), Positives = 155/162 (96%), Gaps = 0/162 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFR
Sbjct  238  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFR  297

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA+ GPLKGVLDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  298  KAAKGPLKGVLDVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  357

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  105
            VVDLAHLVASKWPG+   GS DPLED+CKTNP D+ECKV+EA
Sbjct  358  VVDLAHLVASKWPGMPAGGSSDPLEDFCKTNPADEECKVYEA  399



>gb|KHN20097.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Glycine 
soja]
Length=452

 Score =   275 bits (703),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 148/161 (92%), Positives = 157/161 (98%), Gaps = 0/161 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKGLTAEDVNAAFR
Sbjct  292  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFR  351

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA++GPLKGVLDVCD PLVS+DFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  352  KAAEGPLKGVLDVCDVPLVSIDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  411

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  108
            VVDLAHLVASKWPG A AGSGDPLE++C+TNP D+ECKV+E
Sbjct  412  VVDLAHLVASKWPGAAKAGSGDPLEEFCETNPADEECKVYE  452



>ref|XP_010539030.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
[Tarenaya hassleriana]
Length=453

 Score =   275 bits (703),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 149/162 (92%), Positives = 154/162 (95%), Gaps = 0/162 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKGLTAEDVNAAFR
Sbjct  292  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFR  351

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA+ GPL G+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  352  KAASGPLNGILDVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  411

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  105
            VVDLAHLVASKWPG A   SGDPLED+C+TNP DKECKVFEA
Sbjct  412  VVDLAHLVASKWPGAAAGSSGDPLEDFCETNPADKECKVFEA  453



>ref|XP_006577850.1| PREDICTED: uncharacterized protein LOC100806482 isoform X1 [Glycine 
max]
Length=452

 Score =   275 bits (703),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 148/161 (92%), Positives = 156/161 (97%), Gaps = 0/161 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKGLTAEDVNAAFR
Sbjct  292  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFR  351

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA++GPLKGVLDVCD PLVS+DFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  352  KAAEGPLKGVLDVCDVPLVSIDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  411

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  108
            VVDLAHLVASKWPG   AGSGDPLED+C+TNP D+ECKV+E
Sbjct  412  VVDLAHLVASKWPGAPKAGSGDPLEDFCETNPADEECKVYE  452



>ref|NP_001240080.1| uncharacterized protein LOC100806482 [Glycine max]
 gb|ACU18570.1| unknown [Glycine max]
 gb|KHN33783.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Glycine 
soja]
Length=451

 Score =   275 bits (702),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 148/161 (92%), Positives = 156/161 (97%), Gaps = 0/161 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKGLTAEDVNAAFR
Sbjct  291  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFR  350

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA++GPLKGVLDVCD PLVS+DFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  351  KAAEGPLKGVLDVCDVPLVSIDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  410

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  108
            VVDLAHLVASKWPG   AGSGDPLED+C+TNP D+ECKV+E
Sbjct  411  VVDLAHLVASKWPGAPKAGSGDPLEDFCETNPADEECKVYE  451



>ref|XP_008346447.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Malus domestica]
Length=452

 Score =   275 bits (702),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 147/162 (91%), Positives = 157/162 (97%), Gaps = 0/162 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV KKG++AEDVNAAFR
Sbjct  291  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVAKKGISAEDVNAAFR  350

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA+DGPLKG+L VCD PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  351  KAADGPLKGILAVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  410

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  105
            VVDLAHLVASKWPG AVAGSGDPLED+C+TNP D+ECKV+EA
Sbjct  411  VVDLAHLVASKWPGAAVAGSGDPLEDFCQTNPADEECKVYEA  452



>gb|ABF74607.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase B subunit 
[Agave tequilana]
Length=174

 Score =   265 bits (677),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 144/164 (88%), Positives = 155/164 (95%), Gaps = 0/164 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFR
Sbjct  11   NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFR  70

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA++GPLKG+L VCD PLVSVDFRC+DVSSTID+SLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  71   KAANGPLKGILAVCDVPLVSVDFRCTDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQR  130

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA*F  99
            VVDLAHLVASKWPG+   GS DPLED+CKTNP  +ECKV+EA F
Sbjct  131  VVDLAHLVASKWPGMPAQGSSDPLEDFCKTNPETEECKVYEAGF  174



>ref|XP_010500213.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic-like 
[Camelina sativa]
Length=447

 Score =   274 bits (701),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 145/161 (90%), Positives = 156/161 (97%), Gaps = 0/161 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKGLTAEDVN AFR
Sbjct  287  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLTAEDVNEAFR  346

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA++GP+KG+LDVCDAPLVSVDFRCSDVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  347  KAANGPMKGILDVCDAPLVSVDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  406

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  108
            VVDLAHLVASKWPG    G+GDPLED+C+TNPGD+ECKVFE
Sbjct  407  VVDLAHLVASKWPGEKAVGTGDPLEDFCQTNPGDEECKVFE  447



>ref|XP_006435406.1| hypothetical protein CICLE_v10001114mg [Citrus clementina]
 gb|ESR48646.1| hypothetical protein CICLE_v10001114mg [Citrus clementina]
Length=453

 Score =   274 bits (701),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 147/162 (91%), Positives = 157/162 (97%), Gaps = 0/162 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFR
Sbjct  292  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFR  351

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA++GPLKG+L VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  352  KAAEGPLKGILAVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  411

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  105
            VVDLAHLVA+KWPGVA  GSGDPLED+C+TNP D+ECKV+EA
Sbjct  412  VVDLAHLVATKWPGVAAGGSGDPLEDFCQTNPADEECKVYEA  453



>ref|XP_006342156.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Solanum tuberosum]
Length=450

 Score =   274 bits (701),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 146/161 (91%), Positives = 158/161 (98%), Gaps = 0/161 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFR
Sbjct  290  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFR  349

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA+DGPLKG+LDVCDAPLVSVDFRCSDVS+TIDSSLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  350  KAADGPLKGILDVCDAPLVSVDFRCSDVSATIDSSLTMVMGDDMVKVIAWYDNEWGYSQR  409

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  108
            VVDLAHLVASKWPGVA  GSGDPL+++C+TNP D+ECKV+E
Sbjct  410  VVDLAHLVASKWPGVAAPGSGDPLDEFCETNPSDEECKVYE  450



>gb|KHG26323.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Gossypium 
arboreum]
Length=455

 Score =   274 bits (701),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 148/162 (91%), Positives = 156/162 (96%), Gaps = 0/162 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFR
Sbjct  294  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFR  353

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA++GPLKGVLDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  354  KAAEGPLKGVLDVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  413

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  105
            VVDLAHLVASKWPG+   GS DPLED+CKTNP D+ECKV+EA
Sbjct  414  VVDLAHLVASKWPGMPAGGSSDPLEDFCKTNPADEECKVYEA  455



>ref|XP_006473831.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Citrus sinensis]
 gb|KDO85173.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=453

 Score =   274 bits (700),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 146/162 (90%), Positives = 157/162 (97%), Gaps = 0/162 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLV+PQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFR
Sbjct  292  NIVPTSTGAAKAVSLVMPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFR  351

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA++GPLKG+L VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  352  KAAEGPLKGILAVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  411

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  105
            VVDLAHLVA+KWPGVA  GSGDPLED+C+TNP D+ECKV+EA
Sbjct  412  VVDLAHLVATKWPGVAAGGSGDPLEDFCQTNPADEECKVYEA  453



>gb|KJB57936.1| hypothetical protein B456_009G186400 [Gossypium raimondii]
Length=455

 Score =   273 bits (699),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 148/162 (91%), Positives = 155/162 (96%), Gaps = 0/162 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFR
Sbjct  294  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFR  353

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA+ GPLKGVLDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  354  KAAKGPLKGVLDVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  413

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  105
            VVDLAHLVASKWPG+   GS DPLED+CKTNP D+ECKV+EA
Sbjct  414  VVDLAHLVASKWPGMPAGGSSDPLEDFCKTNPADEECKVYEA  455



>ref|XP_009362871.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
Length=452

 Score =   273 bits (698),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 147/162 (91%), Positives = 156/162 (96%), Gaps = 0/162 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV KKG++AEDVNAAFR
Sbjct  291  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVAKKGISAEDVNAAFR  350

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA+DGPLKG+L VCD PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  351  KAADGPLKGILAVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  410

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  105
            VVDLAHLVASKWPG A AGSGDPLED+CKTNP D+ECKV+EA
Sbjct  411  VVDLAHLVASKWPGTAQAGSGDPLEDFCKTNPADEECKVYEA  452



>gb|KDP36765.1| hypothetical protein JCGZ_08056 [Jatropha curcas]
Length=452

 Score =   273 bits (698),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 145/162 (90%), Positives = 157/162 (97%), Gaps = 0/162 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFR
Sbjct  291  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFR  350

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA+DGPLKG+LDVCD PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  351  KAADGPLKGILDVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  410

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  105
            VVDLAHLVA++WPGVA  GSGDPLE++C+ NP D+ECKV+EA
Sbjct  411  VVDLAHLVANEWPGVAATGSGDPLEEFCEKNPADEECKVYEA  452



>gb|AFG28405.1| glyceraldehyde-3-phosphate dehydrogenase B [Pyrus x bretschneideri]
Length=452

 Score =   273 bits (698),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 146/162 (90%), Positives = 156/162 (96%), Gaps = 0/162 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV KKG++AEDVNAAFR
Sbjct  291  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVAKKGISAEDVNAAFR  350

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA+DGPLKG+L VCD PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  351  KAADGPLKGILAVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  410

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  105
            VVDLAHLVASKWPG AV GSGDPLED+C+TNP D+ECKV+EA
Sbjct  411  VVDLAHLVASKWPGAAVVGSGDPLEDFCQTNPADEECKVYEA  452



>ref|XP_010270515.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Nelumbo nucifera]
Length=452

 Score =   273 bits (697),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 146/162 (90%), Positives = 157/162 (97%), Gaps = 0/162 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLP+LKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFR
Sbjct  291  NIVPTSTGAAKAVSLVLPKLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFR  350

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA++GPLKG+L VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM+KVVAWYDNEWGYSQR
Sbjct  351  KAAEGPLKGILAVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMLKVVAWYDNEWGYSQR  410

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  105
            VVDLAHLVASKWPG A +GSGDPLED+CKTNP D+ECKV+EA
Sbjct  411  VVDLAHLVASKWPGAAASGSGDPLEDFCKTNPADEECKVYEA  452



>ref|XP_002891244.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH67503.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Arabidopsis 
lyrata subsp. lyrata]
Length=447

 Score =   272 bits (696),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 145/161 (90%), Positives = 155/161 (96%), Gaps = 0/161 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKGLTAEDVN AFR
Sbjct  287  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLTAEDVNEAFR  346

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA++GP+KG+LDVCDAPLVSVDFRCSDVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  347  KAANGPMKGILDVCDAPLVSVDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  406

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  108
            VVDLAHLVASKWPG    GSGDPLED+CKTNP D+ECKV+E
Sbjct  407  VVDLAHLVASKWPGEEAVGSGDPLEDFCKTNPADEECKVYE  447



>gb|AAD10210.1| glyceraldehyde 3-phosphate dehydrogenase B subunit [Arabidopsis 
thaliana]
Length=402

 Score =   271 bits (692),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 144/161 (89%), Positives = 155/161 (96%), Gaps = 0/161 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKGLTAEDVN AFR
Sbjct  242  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLTAEDVNEAFR  301

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA++GP+KG+LDVCDAPLVSVDFRCSDVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  302  KAANGPMKGILDVCDAPLVSVDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  361

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  108
            VVDLAHLVASKWPG    GSGDPLED+CKTNP D+ECKV++
Sbjct  362  VVDLAHLVASKWPGAEAVGSGDPLEDFCKTNPADEECKVYD  402



>ref|XP_009786329.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Nicotiana sylvestris]
Length=449

 Score =   272 bits (695),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 148/161 (92%), Positives = 156/161 (97%), Gaps = 0/161 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG+TAEDVNAAFR
Sbjct  289  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGITAEDVNAAFR  348

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA+DGPLKGVL VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  349  KAADGPLKGVLAVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  408

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  108
            VVDLAHLVA+KWPGVAV GSGDPL+++CKTNP D+ECKV+E
Sbjct  409  VVDLAHLVANKWPGVAVPGSGDPLDEFCKTNPADEECKVYE  449



>ref|XP_006307502.1| hypothetical protein CARUB_v10009127mg [Capsella rubella]
 gb|EOA40400.1| hypothetical protein CARUB_v10009127mg [Capsella rubella]
Length=447

 Score =   272 bits (695),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 143/161 (89%), Positives = 156/161 (97%), Gaps = 0/161 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKG+TAE+VN AFR
Sbjct  287  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGITAEEVNEAFR  346

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA++GP+KG+LDVCDAPLVSVDFRCSDVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  347  KAANGPMKGILDVCDAPLVSVDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  406

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  108
            VVDLAHLVASKWPG    GSGDPLED+C+TNPG++ECKVFE
Sbjct  407  VVDLAHLVASKWPGEKAVGSGDPLEDFCQTNPGEEECKVFE  447



>ref|NP_174996.1| glyceraldehyde-3-phosphate dehydrogenase B [Arabidopsis thaliana]
 sp|P25857.2|G3PB_ARATH RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase GAPB, 
chloroplastic; AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase B; Flags: Precursor [Arabidopsis thaliana]
 gb|AAG51517.1|AC068324_5 glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis thaliana]
 gb|AAA32795.1| glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis thaliana]
 gb|AAK62594.1| At1g42970/F13A11_3 [Arabidopsis thaliana]
 gb|AAK64065.1| putative glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis 
thaliana]
 gb|AAL85133.1| putative glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis 
thaliana]
 gb|AAM19948.1| At1g42970/F13A11_3 [Arabidopsis thaliana]
 gb|AAM98232.1| unknown protein [Arabidopsis thaliana]
 gb|AAN72278.1| At1g42970/F13A11_3 [Arabidopsis thaliana]
 dbj|BAF02115.1| putative glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis 
thaliana]
 gb|AEE31933.1| glyceraldehyde-3-phosphate dehydrogenase B [Arabidopsis thaliana]
Length=447

 Score =   272 bits (695),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 144/161 (89%), Positives = 155/161 (96%), Gaps = 0/161 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKGLTAEDVN AFR
Sbjct  287  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLTAEDVNEAFR  346

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA++GP+KG+LDVCDAPLVSVDFRCSDVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  347  KAANGPMKGILDVCDAPLVSVDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  406

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  108
            VVDLAHLVASKWPG    GSGDPLED+CKTNP D+ECKV++
Sbjct  407  VVDLAHLVASKWPGAEAVGSGDPLEDFCKTNPADEECKVYD  447



>ref|XP_009595874.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Nicotiana tomentosiformis]
Length=449

 Score =   272 bits (695),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 148/161 (92%), Positives = 156/161 (97%), Gaps = 0/161 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG+TAEDVNAAFR
Sbjct  289  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGITAEDVNAAFR  348

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA+DGPLKGVL VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  349  KAADGPLKGVLAVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  408

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  108
            VVDLAHLVA+KWPGVAV GSGDPL+++CKTNP D+ECKV+E
Sbjct  409  VVDLAHLVANKWPGVAVPGSGDPLDEFCKTNPADEECKVYE  449



>ref|XP_002273754.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Vitis vinifera]
 emb|CBI40744.3| unnamed protein product [Vitis vinifera]
Length=453

 Score =   272 bits (695),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 146/162 (90%), Positives = 156/162 (96%), Gaps = 0/162 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFR
Sbjct  292  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFR  351

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA+DGPLKG+L VCD PLVSVDF+CSDVSSTID+SLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  352  KAADGPLKGILAVCDVPLVSVDFKCSDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQR  411

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  105
            VVDLAHLVA+KWPG A  GSGDPLED+CKTNP D+ECKV+EA
Sbjct  412  VVDLAHLVAAKWPGFAAEGSGDPLEDFCKTNPADEECKVYEA  453



>ref|XP_011034837.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X2 [Populus euphratica]
Length=450

 Score =   272 bits (695),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 149/162 (92%), Positives = 157/162 (97%), Gaps = 2/162 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFR
Sbjct  291  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFR  350

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA++GPLKGVLDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDM+KVVAWYDNEWGY  R
Sbjct  351  KAAEGPLKGVLDVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMIKVVAWYDNEWGY--R  408

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  105
            VVDLAHLVASKWPGVA AGSGDPLED+CKTNP D+ECKV+EA
Sbjct  409  VVDLAHLVASKWPGVAAAGSGDPLEDFCKTNPADEECKVYEA  450



>emb|CAN69459.1| hypothetical protein VITISV_021576 [Vitis vinifera]
Length=453

 Score =   272 bits (695),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 146/162 (90%), Positives = 156/162 (96%), Gaps = 0/162 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFR
Sbjct  292  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFR  351

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA+DGPLKG+L VCD PLVSVDF+CSDVSSTID+SLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  352  KAADGPLKGILAVCDVPLVSVDFKCSDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQR  411

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  105
            VVDLAHLVA+KWPG A  GSGDPLED+CKTNP D+ECKV+EA
Sbjct  412  VVDLAHLVAAKWPGFAAEGSGDPLEDFCKTNPADEECKVYEA  453



>ref|NP_001289237.1| glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Pyrus 
x bretschneideri]
 gb|AHM26621.1| glyceraldehyde-3-phosphate dehydrogenase B [Pyrus x bretschneideri]
Length=452

 Score =   271 bits (694),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 146/162 (90%), Positives = 155/162 (96%), Gaps = 0/162 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV KKG++AEDVNAAFR
Sbjct  291  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVAKKGISAEDVNAAFR  350

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA+DGPLKG+L VCD PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  351  KAADGPLKGILAVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  410

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  105
            VVDLAHLVASKWPG A  GSGDPLED+CKTNP D+ECKV+EA
Sbjct  411  VVDLAHLVASKWPGAAEVGSGDPLEDFCKTNPADEECKVYEA  452



>ref|XP_011074072.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Sesamum indicum]
Length=452

 Score =   271 bits (693),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 146/162 (90%), Positives = 154/162 (95%), Gaps = 0/162 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFR
Sbjct  291  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFR  350

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA++GPL GVLDVCD PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  351  KAAEGPLAGVLDVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  410

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  105
            VVDLAHLVA KWPG    GSGDPLED+CKTNP D+ECKV+EA
Sbjct  411  VVDLAHLVADKWPGATAEGSGDPLEDFCKTNPADEECKVYEA  452



>ref|XP_008237955.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Prunus mume]
Length=452

 Score =   271 bits (693),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 144/162 (89%), Positives = 157/162 (97%), Gaps = 0/162 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKG++AEDVNAAFR
Sbjct  291  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGISAEDVNAAFR  350

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA++GPL+G+L VCD PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  351  KAAEGPLQGILAVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  410

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  105
            VVDLAHLVASKWPG + AGSGDPLED+CKTNP D+ECKV+EA
Sbjct  411  VVDLAHLVASKWPGTSQAGSGDPLEDFCKTNPADEECKVYEA  452



>ref|XP_009780936.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Nicotiana sylvestris]
Length=449

 Score =   271 bits (693),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 146/161 (91%), Positives = 154/161 (96%), Gaps = 0/161 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVN++KKG++AEDVNAAFR
Sbjct  289  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKKGISAEDVNAAFR  348

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA+DGPL G+L VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  349  KAADGPLNGILAVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  408

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  108
            VVDLAHLVASKWPG +V GSGD LEDYCKTNP DKECKV+E
Sbjct  409  VVDLAHLVASKWPGSSVEGSGDALEDYCKTNPADKECKVYE  449



>ref|XP_009629570.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=449

 Score =   271 bits (692),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 147/161 (91%), Positives = 154/161 (96%), Gaps = 0/161 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG++AEDVNAAFR
Sbjct  289  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGISAEDVNAAFR  348

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA+DGPL G+L VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  349  KAADGPLNGILAVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  408

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  108
            VVDLAHLVASKWPG +V GSGD LEDYCKTNP DKECKV+E
Sbjct  409  VVDLAHLVASKWPGSSVEGSGDSLEDYCKTNPADKECKVYE  449



>ref|XP_010478985.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
isoform X1 [Camelina sativa]
Length=402

 Score =   269 bits (688),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 143/161 (89%), Positives = 155/161 (96%), Gaps = 0/161 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKGLTAEDVN AFR
Sbjct  242  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLTAEDVNEAFR  301

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA++GP+KG+LDVCDAPLVSVDFRCSDVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  302  KAANGPMKGILDVCDAPLVSVDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  361

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  108
            VVDLAHLVASKWPG    GSGDPLED+C+TNP ++ECKV+E
Sbjct  362  VVDLAHLVASKWPGEKAVGSGDPLEDFCQTNPANEECKVYE  402



>gb|KFK29151.1| hypothetical protein AALP_AA7G095400 [Arabis alpina]
Length=448

 Score =   270 bits (691),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 144/162 (89%), Positives = 154/162 (95%), Gaps = 0/162 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKGLTAEDVN AFR
Sbjct  287  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLTAEDVNEAFR  346

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA+ GP+KG+LDVCD PLVS DFRCSDVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  347  KAAAGPMKGILDVCDTPLVSCDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  406

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  105
            VVDLAHLVA+KWPG   AGSGDPLED+CKTNP D+ECKV+EA
Sbjct  407  VVDLAHLVAAKWPGEVAAGSGDPLEDFCKTNPADEECKVYEA  448



>ref|XP_010478986.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
isoform X2 [Camelina sativa]
Length=445

 Score =   270 bits (691),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 143/161 (89%), Positives = 155/161 (96%), Gaps = 0/161 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKGLTAEDVN AFR
Sbjct  285  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLTAEDVNEAFR  344

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA++GP+KG+LDVCDAPLVSVDFRCSDVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  345  KAANGPMKGILDVCDAPLVSVDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  404

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  108
            VVDLAHLVASKWPG    GSGDPLED+C+TNP ++ECKV+E
Sbjct  405  VVDLAHLVASKWPGEKAVGSGDPLEDFCQTNPANEECKVYE  445



>gb|AEO45784.1| glyceraldehyde-3-phosphate dehydrogenase B [Scoparia dulcis]
Length=452

 Score =   270 bits (691),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 145/161 (90%), Positives = 155/161 (96%), Gaps = 0/161 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVN+AFR
Sbjct  291  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNSAFR  350

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA++GPL GVLDVCD PLVSVDFRCSDVSSTIDSSLTMV+GDDMVKVVAWYDNEWGYSQR
Sbjct  351  KAANGPLAGVLDVCDVPLVSVDFRCSDVSSTIDSSLTMVLGDDMVKVVAWYDNEWGYSQR  410

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  108
            VVDLAHLVA KWPG  V+GSGDPLED+CKTNP D+ECKV+E
Sbjct  411  VVDLAHLVAYKWPGATVSGSGDPLEDFCKTNPADEECKVYE  451



>ref|XP_007135965.1| hypothetical protein PHAVU_009G006600g [Phaseolus vulgaris]
 gb|ESW07959.1| hypothetical protein PHAVU_009G006600g [Phaseolus vulgaris]
Length=451

 Score =   270 bits (690),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 145/161 (90%), Positives = 155/161 (96%), Gaps = 0/161 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLP+LKGKLNGIALRVPTPNVSVVDLVVNV+KKGLTAEDVN AFR
Sbjct  291  NIVPTSTGAAKAVSLVLPKLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNGAFR  350

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA++GPLKGVLDVCD PLVS+DFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  351  KAAEGPLKGVLDVCDVPLVSIDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  410

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  108
            VVDLAHLVASKWPG   AGSGDPLE++C+TNP D+ECKV+E
Sbjct  411  VVDLAHLVASKWPGTPKAGSGDPLEEFCETNPADEECKVYE  451



>emb|CDY69523.1| BnaC08g46180D, partial [Brassica napus]
Length=402

 Score =   268 bits (686),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 145/162 (90%), Positives = 154/162 (95%), Gaps = 0/162 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKGLTAEDVN AFR
Sbjct  241  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLTAEDVNEAFR  300

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA+ GPLKGVL+VCD PLVS DFRCSDVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  301  KAAAGPLKGVLEVCDTPLVSCDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  360

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  105
            VVDLAHLVA+KWPG   AGSGDPLED+CKTNP D+ECKV+EA
Sbjct  361  VVDLAHLVAAKWPGEVAAGSGDPLEDFCKTNPADEECKVYEA  402



>gb|AES74101.2| glyceraldehyde-3-phosphate dehydrogenase B [Medicago truncatula]
Length=317

 Score =   266 bits (679),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 145/161 (90%), Positives = 153/161 (95%), Gaps = 0/161 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG++AEDVNAAFR
Sbjct  157  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGISAEDVNAAFR  216

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA++GPLKGVLDVCD PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  217  KAAEGPLKGVLDVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  276

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  108
            VVDLAHLVA+KWPG   AGSGDPLED+C+TNP   ECKVFE
Sbjct  277  VVDLAHLVANKWPGTPQAGSGDPLEDFCETNPSTDECKVFE  317



>ref|XP_009107645.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
[Brassica rapa]
 emb|CDY35800.1| BnaA08g04610D [Brassica napus]
Length=448

 Score =   270 bits (689),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 145/162 (90%), Positives = 154/162 (95%), Gaps = 0/162 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKGLTAEDVN AFR
Sbjct  287  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLTAEDVNEAFR  346

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA+ GPLKGVL+VCD PLVS DFRCSDVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  347  KAAAGPLKGVLEVCDTPLVSCDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  406

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  105
            VVDLAHLVA+KWPG   AGSGDPLED+CKTNP D+ECKV+EA
Sbjct  407  VVDLAHLVAAKWPGEVAAGSGDPLEDFCKTNPADEECKVYEA  448



>ref|XP_004300121.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=452

 Score =   270 bits (689),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 145/162 (90%), Positives = 153/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV KKG+TAEDVN AFR
Sbjct  291  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVAKKGITAEDVNGAFR  350

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA+DGPLKG+L VCD PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  351  KAADGPLKGILAVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  410

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  105
            VVDLAHLVASKWPG  V GSGDPLED+CK NP D+ECKV+EA
Sbjct  411  VVDLAHLVASKWPGTPVEGSGDPLEDFCKDNPADEECKVYEA  452



>ref|XP_010918353.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Elaeis guineensis]
Length=452

 Score =   270 bits (689),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 144/162 (89%), Positives = 156/162 (96%), Gaps = 0/162 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVN AFR
Sbjct  291  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNQAFR  350

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA++GPLKG+LDVCD PLVSVDFRC+DVSSTID+SLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  351  KAANGPLKGILDVCDVPLVSVDFRCTDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQR  410

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  105
            VVDLAHLVASKWPG+ V GSGDPLED+CKT+P  +ECKV+EA
Sbjct  411  VVDLAHLVASKWPGMPVQGSGDPLEDFCKTSPATEECKVYEA  452



>gb|AIU56855.1| glyceraldehyde-3-phosphate dehydrogenase B, partial [Brassica 
rapa subsp. chinensis]
Length=367

 Score =   266 bits (680),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 144/161 (89%), Positives = 153/161 (95%), Gaps = 0/161 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKGLTAEDVN AFR
Sbjct  207  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLTAEDVNEAFR  266

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA+ GPLKGVL+VCD PLVS DFRCSDVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  267  KAAAGPLKGVLEVCDTPLVSCDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  326

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  108
            VVDLAHLVA+KWPG   AGSGDPLED+CKTNP D+ECKV+E
Sbjct  327  VVDLAHLVAAKWPGEVAAGSGDPLEDFCKTNPADEECKVYE  367



>ref|XP_007211185.1| hypothetical protein PRUPE_ppa005598mg [Prunus persica]
 gb|EMJ12384.1| hypothetical protein PRUPE_ppa005598mg [Prunus persica]
Length=452

 Score =   269 bits (687),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 143/162 (88%), Positives = 156/162 (96%), Gaps = 0/162 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKG++AEDVNAAFR
Sbjct  291  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGISAEDVNAAFR  350

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA++GPL+G+L VCD PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  351  KAAEGPLQGILAVCDIPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  410

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  105
            VVDLAHLVASKWPG   AGSGDPLE++CKTNP D+ECKV+EA
Sbjct  411  VVDLAHLVASKWPGTPQAGSGDPLEEFCKTNPADEECKVYEA  452



>gb|KGN49135.1| hypothetical protein Csa_6G514950 [Cucumis sativus]
Length=191

 Score =   260 bits (664),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 140/162 (86%), Positives = 153/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVN++KKG++A+DVNAAFR
Sbjct  30   NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKKGISADDVNAAFR  89

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA+DGPLKGVL VCD PLVSVDF+C+DVSSTIDSSLTMVMGDDM+KVVAWYDNEWGYSQR
Sbjct  90   KAADGPLKGVLAVCDIPLVSVDFKCTDVSSTIDSSLTMVMGDDMLKVVAWYDNEWGYSQR  149

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  105
            VVDLAHLVA KWPG     SGDPLED+C+TNP D+ECKV+EA
Sbjct  150  VVDLAHLVADKWPGAGSGKSGDPLEDFCQTNPADEECKVYEA  191



>ref|XP_009384599.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=449

 Score =   268 bits (686),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 146/162 (90%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG+TAEDVN AFR
Sbjct  288  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGMTAEDVNNAFR  347

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA+ GPLKG+L VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  348  KAAQGPLKGILAVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  407

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  105
            VVDLAHLVASKWPGV   GSGDPLED+C+TNP  KECKV+EA
Sbjct  408  VVDLAHLVASKWPGVPAQGSGDPLEDFCQTNPETKECKVYEA  449



>ref|XP_009384600.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=447

 Score =   268 bits (685),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 146/162 (90%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG+TAEDVN AFR
Sbjct  286  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGMTAEDVNNAFR  345

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA+ GPLKG+L VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  346  KAAQGPLKGILAVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  405

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  105
            VVDLAHLVASKWPGV   GSGDPLED+C+TNP  KECKV+EA
Sbjct  406  VVDLAHLVASKWPGVPAQGSGDPLEDFCQTNPETKECKVYEA  447



>emb|CBL43264.1| glyceraldehyde-3-phosphate dehydrogenase [Solanum tuberosum]
Length=450

 Score =   268 bits (685),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 144/161 (89%), Positives = 153/161 (95%), Gaps = 0/161 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKGL+AEDVNAAFR
Sbjct  290  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLSAEDVNAAFR  349

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA+DGPL G+L VCD PLVSVDFRCSDVS+TIDSSLTMVMGDDMVK+VAWYDNEWGYSQR
Sbjct  350  KAADGPLNGILAVCDEPLVSVDFRCSDVSTTIDSSLTMVMGDDMVKIVAWYDNEWGYSQR  409

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  108
            VVDLAHLVA+KWPG A  GSGD LEDYCKTNP DKECKV+E
Sbjct  410  VVDLAHLVANKWPGSAAEGSGDALEDYCKTNPADKECKVYE  450



>ref|XP_003603851.1| Glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
 gb|AES74102.1| glyceraldehyde-3-phosphate dehydrogenase B [Medicago truncatula]
Length=451

 Score =   268 bits (684),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 145/161 (90%), Positives = 153/161 (95%), Gaps = 0/161 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG++AEDVNAAFR
Sbjct  291  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGISAEDVNAAFR  350

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA++GPLKGVLDVCD PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  351  KAAEGPLKGVLDVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  410

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  108
            VVDLAHLVA+KWPG   AGSGDPLED+C+TNP   ECKVFE
Sbjct  411  VVDLAHLVANKWPGTPQAGSGDPLEDFCETNPSTDECKVFE  451



>sp|P12859.2|G3PB_PEA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit B; Flags: Precursor [Pisum sativum]
 gb|AAA84543.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Pisum sativum]
Length=451

 Score =   268 bits (684),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 143/161 (89%), Positives = 154/161 (96%), Gaps = 0/161 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG++AEDVNAAFR
Sbjct  291  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGISAEDVNAAFR  350

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA++GPLKG+LDVCD PLVSVDFRCSDVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  351  KAAEGPLKGILDVCDVPLVSVDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  410

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  108
            VVDLAHLVA+KWPG    GSGDPLED+C+TNP D+ECKV+E
Sbjct  411  VVDLAHLVANKWPGTPKVGSGDPLEDFCETNPADEECKVYE  451



>emb|CAA33262.1| unnamed protein product [Pisum sativum]
Length=447

 Score =   267 bits (683),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 143/161 (89%), Positives = 154/161 (96%), Gaps = 0/161 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG++AEDVNAAFR
Sbjct  287  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGISAEDVNAAFR  346

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA++GPLKG+LDVCD PLVSVDFRCSDVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  347  KAAEGPLKGILDVCDVPLVSVDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  406

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  108
            VVDLAHLVA+KWPG    GSGDPLED+C+TNP D+ECKV+E
Sbjct  407  VVDLAHLVANKWPGTPKVGSGDPLEDFCETNPADEECKVYE  447



>ref|XP_006395998.1| hypothetical protein EUTSA_v10004217mg [Eutrema salsugineum]
 dbj|BAJ34314.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ33284.1| hypothetical protein EUTSA_v10004217mg [Eutrema salsugineum]
Length=447

 Score =   267 bits (683),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 146/161 (91%), Positives = 152/161 (94%), Gaps = 0/161 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKGLTAEDVN AFR
Sbjct  287  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGLTAEDVNEAFR  346

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA+DGPLKGVL VCD PLVS DFRCSDVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  347  KAADGPLKGVLAVCDIPLVSCDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  406

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  108
            VVDLAHLVA+KWPG   AGSGDPLED+CKTNP D+ECKV+E
Sbjct  407  VVDLAHLVANKWPGEVAAGSGDPLEDFCKTNPADEECKVYE  447



>ref|XP_006342537.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Solanum tuberosum]
Length=450

 Score =   267 bits (682),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 144/161 (89%), Positives = 152/161 (94%), Gaps = 0/161 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV KKG++AEDVNAAFR
Sbjct  290  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVAKKGISAEDVNAAFR  349

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA+DGPL G+L VCD PLVSVDFRCSDVS+TIDSSLTMVMGDDMVK+VAWYDNEWGYSQR
Sbjct  350  KAADGPLNGILAVCDEPLVSVDFRCSDVSTTIDSSLTMVMGDDMVKIVAWYDNEWGYSQR  409

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  108
            VVDLAHLVASKWPG A  GSGD LEDYCKTNP DKECKV+E
Sbjct  410  VVDLAHLVASKWPGSAAEGSGDALEDYCKTNPADKECKVYE  450



>ref|XP_004253122.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Solanum lycopersicum]
Length=450

 Score =   266 bits (681),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 143/161 (89%), Positives = 152/161 (94%), Gaps = 0/161 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKG++AEDVNAAFR
Sbjct  290  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGISAEDVNAAFR  349

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA+DGPL G+L VCD PLVSVDFRCSDVS+TIDSSLTMVMGDDMVK+VAWYDNEWGYSQR
Sbjct  350  KAADGPLNGILAVCDEPLVSVDFRCSDVSTTIDSSLTMVMGDDMVKIVAWYDNEWGYSQR  409

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  108
            VVDLAHLVA KWPG A  GSGD LEDYCKTNP DKECKV+E
Sbjct  410  VVDLAHLVADKWPGSAAEGSGDALEDYCKTNPADKECKVYE  450



>gb|EPS70760.1| hypothetical protein M569_03997, partial [Genlisea aurea]
Length=440

 Score =   266 bits (679),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 145/162 (90%), Positives = 156/162 (96%), Gaps = 1/162 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+ AED+N+AFR
Sbjct  279  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGIAAEDINSAFR  338

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA++GPLKGVLDVCDAPLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  339  KAAEGPLKGVLDVCDAPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  398

Query  230  VVDLAHLVASKWPGVAVA-GSGDPLEDYCKTNPGDKECKVFE  108
            VVDLAHLVA+KWPG   A GSGDPLEDYCKT+P D+ECKV+E
Sbjct  399  VVDLAHLVANKWPGATPAEGSGDPLEDYCKTSPADEECKVYE  440



>ref|XP_008786670.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Phoenix dactylifera]
Length=452

 Score =   266 bits (679),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 143/162 (88%), Positives = 155/162 (96%), Gaps = 0/162 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVN AFR
Sbjct  291  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNQAFR  350

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA+DGPLKG+L VCD PLVSVDFRC+DVSSTID+SLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  351  KAADGPLKGILAVCDVPLVSVDFRCTDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQR  410

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  105
            VVDLAHLVASKWPG+ V GSGDPLED+C+T+P  +ECKV+EA
Sbjct  411  VVDLAHLVASKWPGMPVQGSGDPLEDFCQTSPDTEECKVYEA  452



>ref|XP_004500847.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Cicer arietinum]
Length=525

 Score =   267 bits (683),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 143/161 (89%), Positives = 153/161 (95%), Gaps = 0/161 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV KKG++AEDVNAAFR
Sbjct  365  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVAKKGISAEDVNAAFR  424

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA++GPLKGVLDVCD PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  425  KAAEGPLKGVLDVCDLPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  484

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  108
            VVDLAHLVA+KWPG    GSGDPLED+C+TNP D ECKV+E
Sbjct  485  VVDLAHLVANKWPGTPQKGSGDPLEDFCETNPADDECKVYE  525



>gb|ACJ84309.1| unknown [Medicago truncatula]
 gb|AFK44245.1| unknown [Medicago truncatula]
Length=451

 Score =   265 bits (676),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 144/161 (89%), Positives = 152/161 (94%), Gaps = 0/161 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG++AEDVNAAFR
Sbjct  291  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGISAEDVNAAFR  350

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA++GPLKGVLDVCD PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEW YSQR
Sbjct  351  KAAEGPLKGVLDVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWDYSQR  410

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  108
            VVDLAHLVA+KWPG   AGSGDPLED+C+TNP   ECKVFE
Sbjct  411  VVDLAHLVANKWPGTPQAGSGDPLEDFCETNPSTDECKVFE  451



>ref|XP_009362872.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
Length=450

 Score =   264 bits (675),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 145/162 (90%), Positives = 154/162 (95%), Gaps = 2/162 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV KKG++AEDVNAAFR
Sbjct  291  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVAKKGISAEDVNAAFR  350

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA+DGPLKG+L VCD PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGY  R
Sbjct  351  KAADGPLKGILAVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGY--R  408

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  105
            VVDLAHLVASKWPG A AGSGDPLED+CKTNP D+ECKV+EA
Sbjct  409  VVDLAHLVASKWPGTAQAGSGDPLEDFCKTNPADEECKVYEA  450



>gb|ABF93789.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplast precursor, 
putative, expressed [Oryza sativa Japonica Group]
 dbj|BAG90581.1| unnamed protein product [Oryza sativa Japonica Group]
Length=318

 Score =   259 bits (662),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 140/161 (87%), Positives = 149/161 (93%), Gaps = 0/161 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVSVVDLV+N  K G+TA+DVNAAFR
Sbjct  157  NIVPTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVINTVKTGITADDVNAAFR  216

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA+ GPL G+LDVCD PLVSVDFRCSDVSSTID+SLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  217  KAAAGPLSGILDVCDVPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQR  276

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  108
            VVDLAHLVASKWPG AV GSGDPLED+CK NP   ECKV+E
Sbjct  277  VVDLAHLVASKWPGAAVQGSGDPLEDFCKDNPETDECKVYE  317



>ref|XP_009382077.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=452

 Score =   263 bits (671),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 143/161 (89%), Positives = 151/161 (94%), Gaps = 0/161 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVN AFR
Sbjct  291  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGMTAEDVNDAFR  350

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA++GP  GVL VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  351  KAANGPSNGVLAVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  410

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  108
            VVDLAHLVASKWPG+   GSGDPLED+C+TNP  KECKV+E
Sbjct  411  VVDLAHLVASKWPGIPAQGSGDPLEDFCQTNPETKECKVYE  451



>ref|XP_008452998.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X2 [Cucumis melo]
Length=451

 Score =   262 bits (669),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 140/162 (86%), Positives = 154/162 (95%), Gaps = 0/162 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVN++KKG++A+DVNAAFR
Sbjct  290  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKKGISADDVNAAFR  349

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA+DGPLKGVL VCD PLVSVDF+C+DVSSTIDSSLTMVMGDDM+KVVAWYDNEWGYSQR
Sbjct  350  KAADGPLKGVLAVCDIPLVSVDFKCTDVSSTIDSSLTMVMGDDMLKVVAWYDNEWGYSQR  409

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  105
            VVDLAHLVA+KWPG     SGDPLED+C+TNP D+ECKV+EA
Sbjct  410  VVDLAHLVATKWPGAGSGKSGDPLEDFCQTNPADEECKVYEA  451



>ref|XP_008452997.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X1 [Cucumis melo]
Length=452

 Score =   262 bits (669),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 140/162 (86%), Positives = 154/162 (95%), Gaps = 0/162 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVN++KKG++A+DVNAAFR
Sbjct  291  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKKGISADDVNAAFR  350

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA+DGPLKGVL VCD PLVSVDF+C+DVSSTIDSSLTMVMGDDM+KVVAWYDNEWGYSQR
Sbjct  351  KAADGPLKGVLAVCDIPLVSVDFKCTDVSSTIDSSLTMVMGDDMLKVVAWYDNEWGYSQR  410

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  105
            VVDLAHLVA+KWPG     SGDPLED+C+TNP D+ECKV+EA
Sbjct  411  VVDLAHLVATKWPGAGSGKSGDPLEDFCQTNPADEECKVYEA  452



>ref|XP_004145550.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004157068.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Cucumis sativus]
 gb|KGN55522.1| hypothetical protein Csa_4G664300 [Cucumis sativus]
Length=451

 Score =   261 bits (668),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 140/162 (86%), Positives = 153/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVN++KKG++A+DVNAAFR
Sbjct  290  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKKGISADDVNAAFR  349

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA+DGPLKGVL VCD PLVSVDF+C+DVSSTIDSSLTMVMGDDM+KVVAWYDNEWGYSQR
Sbjct  350  KAADGPLKGVLAVCDIPLVSVDFKCTDVSSTIDSSLTMVMGDDMLKVVAWYDNEWGYSQR  409

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  105
            VVDLAHLVA KWPG     SGDPLED+C+TNP D+ECKV+EA
Sbjct  410  VVDLAHLVADKWPGAGSGKSGDPLEDFCQTNPADEECKVYEA  451



>ref|XP_006649326.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Oryza brachyantha]
Length=444

 Score =   261 bits (666),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 140/161 (87%), Positives = 149/161 (93%), Gaps = 0/161 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVSVVDLV+N  K G+TA+DVNAAFR
Sbjct  283  NIVPTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVINTVKTGITADDVNAAFR  342

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA+ GPL G+LDVCD PLVSVDFRCSDVSSTID+SLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  343  KAASGPLNGILDVCDVPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQR  402

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  108
            VVDLAHLVASKWPGVA  GSGDPLED+CK NP   ECKV+E
Sbjct  403  VVDLAHLVASKWPGVAAQGSGDPLEDFCKDNPETDECKVYE  443



>dbj|BAJ86633.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=444

 Score =   261 bits (666),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = -2

Query  653  GDQrlldashrdlrraraaaLNIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvv  474
            GDQRLLDASHRDLRRARAA LNIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVV
Sbjct  262  GDQRLLDASHRDLRRARAAELNIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVV  321

Query  473  dlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMV  294
            DLV+N  K G+TA+DVNAAFRKA+DGPLKG+LDVCD PLVSVDFRCSDVS++ID+SLTMV
Sbjct  322  DLVINTVKTGITADDVNAAFRKAADGPLKGILDVCDEPLVSVDFRCSDVSTSIDASLTMV  381

Query  293  MGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKV  114
            MGDDMVKVVAWYDNEWGYSQRVVDLAHLVA+KWPG    GSGDPLEDYCKT+P   ECKV
Sbjct  382  MGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAKWPGAGTGGSGDPLEDYCKTDPNAVECKV  441

Query  113  FE  108
            F+
Sbjct  442  FD  443



>dbj|BAJ87214.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=444

 Score =   260 bits (664),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 139/161 (86%), Positives = 150/161 (93%), Gaps = 0/161 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+N  K G+TA+DVNAAFR
Sbjct  283  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINTVKTGITADDVNAAFR  342

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA+DGPLKG+LDVCD PLVSVDFRCSDVS++ID+SLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  343  KAADGPLKGILDVCDEPLVSVDFRCSDVSTSIDASLTMVMGDDMVKVVAWYDNEWGYSQR  402

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  108
            VVDLAHLVA+KWPG    GSGDPLEDYCKT+P   ECKVF+
Sbjct  403  VVDLAHLVAAKWPGAGTGGSGDPLEDYCKTDPNAVECKVFD  443



>gb|EMS49604.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Triticum 
urartu]
Length=444

 Score =   260 bits (664),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 139/161 (86%), Positives = 150/161 (93%), Gaps = 0/161 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+N  K G+TA+DVNAAFR
Sbjct  283  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINTVKTGITADDVNAAFR  342

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA+DGPLKG+LDVCD PLVSVDFRCSDVS++ID+SLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  343  KAADGPLKGILDVCDEPLVSVDFRCSDVSTSIDASLTMVMGDDMVKVVAWYDNEWGYSQR  402

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  108
            VVDLAHLVA+KWPG    GSGDPLEDYCKT+P   ECKVF+
Sbjct  403  VVDLAHLVAAKWPGAGTGGSGDPLEDYCKTDPNAVECKVFD  443



>ref|NP_001048847.1| Os03g0129300 [Oryza sativa Japonica Group]
 dbj|BAA85402.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AAN17393.1| Putative glyceraldehyde-3-phosphate dehydrogenase [Oryza sativa 
Japonica Group]
 gb|ABF93788.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplast precursor, 
putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF10761.1| Os03g0129300 [Oryza sativa Japonica Group]
 gb|EAY88378.1| hypothetical protein OsI_09835 [Oryza sativa Indica Group]
 gb|EAZ25455.1| hypothetical protein OsJ_09272 [Oryza sativa Japonica Group]
Length=444

 Score =   260 bits (664),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 140/161 (87%), Positives = 149/161 (93%), Gaps = 0/161 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVSVVDLV+N  K G+TA+DVNAAFR
Sbjct  283  NIVPTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVINTVKTGITADDVNAAFR  342

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA+ GPL G+LDVCD PLVSVDFRCSDVSSTID+SLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  343  KAAAGPLSGILDVCDVPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQR  402

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  108
            VVDLAHLVASKWPG AV GSGDPLED+CK NP   ECKV+E
Sbjct  403  VVDLAHLVASKWPGAAVQGSGDPLEDFCKDNPETDECKVYE  443



>ref|XP_010061201.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
[Eucalyptus grandis]
 gb|KCW68119.1| hypothetical protein EUGRSUZ_F01793 [Eucalyptus grandis]
Length=454

 Score =   260 bits (665),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 143/162 (88%), Positives = 153/162 (94%), Gaps = 1/162 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKGLTAEDVNAAFR
Sbjct  292  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFR  351

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
             A++GPLKG+L VCD PLVSVDFRCSDVSSTIDSSL+MVMGDDMVKVVAWYDNEWGYSQR
Sbjct  352  DAAEGPLKGILAVCDDPLVSVDFRCSDVSSTIDSSLSMVMGDDMVKVVAWYDNEWGYSQR  411

Query  230  VVDLAHLVASKWPGVAVAGS-GDPLEDYCKTNPGDKECKVFE  108
            VVDLAHLVA KWPG+ + GS GDPLED+CK NP D+ECKV+E
Sbjct  412  VVDLAHLVAVKWPGIEIPGSTGDPLEDFCKKNPADEECKVYE  453



>ref|XP_002981126.1| hypothetical protein SELMODRAFT_271457 [Selaginella moellendorffii]
 gb|EFJ17827.1| hypothetical protein SELMODRAFT_271457 [Selaginella moellendorffii]
Length=431

 Score =   258 bits (659),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 142/162 (88%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG+TAEDVNAAFR
Sbjct  270  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVDKKGMTAEDVNAAFR  329

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA+DGPLKG+L VCD PLVSVDFRCSDVSST+D+SLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  330  KAADGPLKGILAVCDIPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVVAWYDNEWGYSQR  389

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  105
            VVDLAHLVA KWPG A A SGDPL+++CKTNP   ECKV++A
Sbjct  390  VVDLAHLVAEKWPGGAPAPSGDPLDEFCKTNPDTDECKVYDA  431



>ref|XP_003558903.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Brachypodium distachyon]
Length=446

 Score =   258 bits (660),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 139/161 (86%), Positives = 149/161 (93%), Gaps = 0/161 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVSVVDLV+N  K G+TA+DVNAAFR
Sbjct  286  NIVPTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVINTAKTGITADDVNAAFR  345

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA+ GPL G+LDVCD PLVSVDFRCSDVSSTID+SLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  346  KAAAGPLNGILDVCDEPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQR  405

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  108
            VVDLAHLVASKWPG  V G+GDPLEDYCKTNP   ECKV++
Sbjct  406  VVDLAHLVASKWPGSEVKGTGDPLEDYCKTNPETDECKVYD  446



>ref|XP_002982608.1| hypothetical protein SELMODRAFT_179517 [Selaginella moellendorffii]
 gb|EFJ16361.1| hypothetical protein SELMODRAFT_179517 [Selaginella moellendorffii]
Length=431

 Score =   258 bits (659),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 141/162 (87%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG+TAEDVNAAFR
Sbjct  270  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVDKKGMTAEDVNAAFR  329

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA+DGPLKG+L VCD PLVSVDFRCSDVSST+D+SLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  330  KAADGPLKGILAVCDIPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVVAWYDNEWGYSQR  389

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  105
            VVDLAHLVA KWPG A A SGDPL+++CKTNP   EC+V++A
Sbjct  390  VVDLAHLVADKWPGGAAAPSGDPLDEFCKTNPDTDECRVYDA  431



>ref|XP_010094540.1| Glyceraldehyde-3-phosphate dehydrogenase B [Morus notabilis]
 gb|EXB56294.1| Glyceraldehyde-3-phosphate dehydrogenase B [Morus notabilis]
Length=1333

 Score =   270 bits (691),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 146/168 (87%), Positives = 155/168 (92%), Gaps = 0/168 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKG+TAEDVNAAFR
Sbjct  294  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGITAEDVNAAFR  353

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            K ++GPLKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  354  KEAEGPLKGILDVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  413

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA*FTTNF  87
            VVDLAHLVASKWPG    GSGDPLED+CKTNP D+ECK+  A F   F
Sbjct  414  VVDLAHLVASKWPGSGTGGSGDPLEDFCKTNPADEECKIVIASFIGCF  461



>ref|XP_010686856.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=451

 Score =   255 bits (652),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 141/162 (87%), Positives = 152/162 (94%), Gaps = 1/162 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVN++KKG+TAEDVN AFR
Sbjct  290  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKKGITAEDVNNAFR  349

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA+ GP KGVL+VCD PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  350  KAAAGPSKGVLEVCDIPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  409

Query  230  VVDLAHLVASKWPGVAVA-GSGDPLEDYCKTNPGDKECKVFE  108
            VVDLAHLVA+KWPG+  A  SGDPLED+CK NP D+ECKV+E
Sbjct  410  VVDLAHLVANKWPGMEGAISSGDPLEDFCKDNPADEECKVYE  451



>ref|XP_006855683.1| hypothetical protein AMTR_s00044p00131190 [Amborella trichopoda]
 gb|ERN17150.1| hypothetical protein AMTR_s00044p00131190 [Amborella trichopoda]
Length=413

 Score =   254 bits (649),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 141/162 (87%), Positives = 153/162 (94%), Gaps = 1/162 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLP+LKGKLNGIALRVPTPNVSVVDLVVNV+KKGLTAEDVNAAFR
Sbjct  253  NIVPTSTGAAKAVSLVLPKLKGKLNGIALRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFR  312

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            K+++GPLKG+L VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  313  KSAEGPLKGILAVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  372

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  105
            VVDLAHLVASKW G A +G GDPLE++C+T+P   ECKV+EA
Sbjct  373  VVDLAHLVASKWSGAAKSG-GDPLEEFCQTSPETVECKVYEA  413



>gb|ABS72003.1| putative chloroplast glyceradehyde-3-phosphate dehydrogenase 
subunit B [Olea europaea]
Length=149

 Score =   244 bits (622),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 132/149 (89%), Positives = 142/149 (95%), Gaps = 0/149 (0%)
 Frame = -2

Query  551  SLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFRKASDGPLKGVLDV  372
            SLVLPQLKGKLNGIALRVPTPNVSVVDLVVN++KKG+TAEDVNAAFRKA+DGPLKGVL V
Sbjct  1    SLVLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKKGITAEDVNAAFRKAADGPLKGVLAV  60

Query  371  CDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWP  192
            CD PLVSVDFRC+DVS+TIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVA KWP
Sbjct  61   CDVPLVSVDFRCTDVSATIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAYKWP  120

Query  191  GVAVAGSGDPLEDYCKTNPGDKECKVFEA  105
            G+A   SGDPLED+CKTNP D+ECKV+EA
Sbjct  121  GMAAQESGDPLEDFCKTNPADEECKVYEA  149



>pdb|2PKQ|O Chain O, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
 pdb|2PKQ|Q Chain Q, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
 pdb|2PKQ|T Chain T, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
Length=368

 Score =   246 bits (627),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 138/162 (85%), Positives = 148/162 (91%), Gaps = 1/162 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVN++K G+TAEDVN AFR
Sbjct  207  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKVGVTAEDVNNAFR  266

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA+ GPLKGVLDVCD PLVSVDFRCSD SSTIDSSLTMVMG DMVKVVAWYDNEWGYSQR
Sbjct  267  KAAAGPLKGVLDVCDIPLVSVDFRCSDFSSTIDSSLTMVMGGDMVKVVAWYDNEWGYSQR  326

Query  230  VVDLAHLVASKWPGV-AVAGSGDPLEDYCKTNPGDKECKVFE  108
            VVDLA LVA+KWPG+     SGDPLED+CK NP D+ECK++E
Sbjct  327  VVDLADLVANKWPGLEGSVASGDPLEDFCKDNPADEECKLYE  368



>sp|P12860.1|G3PB_SPIOL RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit B; Flags: Precursor [Spinacia oleracea]
 emb|CAA33263.1| unnamed protein product [Spinacia oleracea]
 gb|AAD10218.1| NADP-dependent glyceraldehydephosphate dehydrogenase subunit 
B [Spinacia oleracea]
Length=451

 Score =   247 bits (631),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 138/162 (85%), Positives = 148/162 (91%), Gaps = 1/162 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVN++K G+TAEDVN AFR
Sbjct  290  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKVGVTAEDVNNAFR  349

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA+ GPLKGVLDVCD PLVSVDFRCSD SSTIDSSLTMVMG DMVKVVAWYDNEWGYSQR
Sbjct  350  KAAAGPLKGVLDVCDIPLVSVDFRCSDFSSTIDSSLTMVMGGDMVKVVAWYDNEWGYSQR  409

Query  230  VVDLAHLVASKWPGV-AVAGSGDPLEDYCKTNPGDKECKVFE  108
            VVDLA LVA+KWPG+     SGDPLED+CK NP D+ECK++E
Sbjct  410  VVDLADLVANKWPGLEGSVASGDPLEDFCKDNPADEECKLYE  451



>ref|XP_003603850.1| Glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
Length=490

 Score =   246 bits (629),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 143/200 (72%), Positives = 153/200 (77%), Gaps = 39/200 (20%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG++AEDVNAAFR
Sbjct  291  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGISAEDVNAAFR  350

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWG----  243
            KA++GPLKGVLDVCD PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWG    
Sbjct  351  KAAEGPLKGVLDVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGAHFV  410

Query  242  -----------------------------------YSQRVVDLAHLVASKWPGVAVAGSG  168
                                               ++QRVVDLAHLVA+KWPG   AGSG
Sbjct  411  WAFSLMFLFSGRGYWQELIESIVWAHNKLKYKVCFHNQRVVDLAHLVANKWPGTPQAGSG  470

Query  167  DPLEDYCKTNPGDKECKVFE  108
            DPLED+C+TNP   ECKVFE
Sbjct  471  DPLEDFCETNPSTDECKVFE  490



>emb|CAC80378.2| glyceraldehyde-3-phosphate dehydrogenase [Chara vulgaris]
Length=480

 Score =   240 bits (613),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 135/164 (82%), Positives = 147/164 (90%), Gaps = 3/164 (2%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPT+TGAAKAV+LVLP+LKGKLNGIALRVPTPNVSVVDLVVNV+ KG TAEDVN AFR
Sbjct  317  NIVPTTTGAAKAVALVLPKLKGKLNGIALRVPTPNVSVVDLVVNVENKGCTAEDVNDAFR  376

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA++GPLKGVL VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  377  KAANGPLKGVLAVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQR  436

Query  230  VVDLAHLVASKWPGVAVAGSG---DPLEDYCKTNPGDKECKVFE  108
            VVDLAHLVA+KWPG   A  G   DPL  YC++NP D EC+VFE
Sbjct  437  VVDLAHLVAAKWPGAKPAPDGKDADPLGTYCESNPDDAECRVFE  480



>gb|EMT30317.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Aegilops 
tauschii]
Length=442

 Score =   238 bits (607),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 135/161 (84%), Positives = 146/161 (91%), Gaps = 2/161 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+N  K G+TA+DVNAAFR
Sbjct  283  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINTVKTGITADDVNAAFR  342

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA+DGPLKG+LDVCD PLVSVDFRCSDVS++ID+SLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  343  KAADGPLKGILDVCDEPLVSVDFRCSDVSTSIDASLTMVMGDDMVKVVAWYDNEWGYSQR  402

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  108
            VVDLAHLVA+KWPG    G G   EDYCKT+P   ECKVF+
Sbjct  403  VVDLAHLVAAKWPGAGTGGGG--GEDYCKTDPNAVECKVFD  441



>gb|ACN40006.1| unknown [Picea sitchensis]
Length=460

 Score =   238 bits (606),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 138/162 (85%), Positives = 151/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPT+TGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG++AEDVNAAFR
Sbjct  299  NIVPTTTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGISAEDVNAAFR  358

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
             A+DGPLKG+L VCD PLVSVDFRCSDVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  359  SAADGPLKGILAVCDVPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQR  418

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  105
            VVDLAHLVA+KWPG    GS DPL+++CKTNP   EC+V+EA
Sbjct  419  VVDLAHLVAAKWPGAGKGGSDDPLDEFCKTNPATDECRVYEA  460



>gb|ABK24645.1| unknown [Picea sitchensis]
Length=460

 Score =   238 bits (606),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 138/162 (85%), Positives = 151/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPT+TGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG++AEDVNAAFR
Sbjct  299  NIVPTTTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGISAEDVNAAFR  358

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
             A+DGPLKG+L VCD PLVSVDFRCSDVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  359  SAADGPLKGILAVCDVPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQR  418

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  105
            VVDLAHLVA+KWPG    GS DPL+++CKTNP   EC+V+EA
Sbjct  419  VVDLAHLVAAKWPGAGKGGSDDPLDEFCKTNPATDECRVYEA  460



>gb|ACN40526.1| unknown [Picea sitchensis]
Length=460

 Score =   237 bits (605),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 138/162 (85%), Positives = 151/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPT+TGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG++AEDVNAAFR
Sbjct  299  NIVPTTTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGISAEDVNAAFR  358

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
             A+DGPLKG+L VCD PLVSVDFRCSDVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  359  SAADGPLKGILAVCDVPLVSVDFRCSDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQR  418

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  105
            VVDLAHLVA+KWPG    GS DPL+++CKTNP   EC+V+EA
Sbjct  419  VVDLAHLVAAKWPGAGKGGSDDPLDEFCKTNPATDECRVYEA  460



>ref|XP_008650588.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Zea mays]
 gb|ACF78460.1| unknown [Zea mays]
 gb|ACF87738.1| unknown [Zea mays]
 gb|ACG28147.1| glyceraldehyde-3-phosphate dehydrogenase B [Zea mays]
 gb|ACG29047.1| glyceraldehyde-3-phosphate dehydrogenase B [Zea mays]
 gb|ACR36877.1| unknown [Zea mays]
 tpg|DAA43140.1| TPA: glyceraldehyde-3-phosphate dehydrogenase B [Zea mays]
Length=449

 Score =   237 bits (604),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 137/162 (85%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVSVVDLV+N  K G+TA+DVNAAFR
Sbjct  288  NIVPTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVINTVKTGITADDVNAAFR  347

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA+ GPL+G+L+VCD PLVSVDFRCSDVS TID+SL+MVMGDDMVKVVAWYDNEWGYSQR
Sbjct  348  KAAAGPLQGILEVCDVPLVSVDFRCSDVSCTIDASLSMVMGDDMVKVVAWYDNEWGYSQR  407

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  105
            VVDLAHLVA+KWPG A AGSGDPLED+CK NP   ECKV+EA
Sbjct  408  VVDLAHLVAAKWPGAAAAGSGDPLEDFCKDNPETDECKVYEA  449



>gb|ABD37964.1| glyceraldehyde-3-phosphate dehydrogenase subunit B [Chlorokybus 
atmophyticus]
Length=458

 Score =   233 bits (595),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 128/164 (78%), Positives = 144/164 (88%), Gaps = 3/164 (2%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPT+TGAAKAV+LVLPQLKGKLNGIALRVPTPNVSVVDLV+N +KKG+TA+ VNAAFR
Sbjct  294  NIVPTTTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVINTEKKGITADQVNAAFR  353

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA++GPL GVL V D PLVS+DFRCSDVSSTIDSSLTMVMGDDM+KVVAWYDNEWGYSQR
Sbjct  354  KAAEGPLNGVLAVSDLPLVSIDFRCSDVSSTIDSSLTMVMGDDMLKVVAWYDNEWGYSQR  413

Query  230  VVDLAHLVASKWPGVAV---AGSGDPLEDYCKTNPGDKECKVFE  108
            VVDLAH+VA+ WPG        SGDPL+ YC TNP   EC+V++
Sbjct  414  VVDLAHIVANNWPGQKADSEEESGDPLDKYCATNPEADECRVYD  457



>gb|ABD37965.1| glyceraldehyde-3-phosphate dehydrogenase subunit B [Mesostigma 
viride]
Length=415

 Score =   229 bits (583),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 139/161 (86%), Gaps = 0/161 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLP+LKGKLNGIALRVPTPNVSVVDLV+N  KKG+TAE+VNAAFR
Sbjct  254  NIVPTSTGAAKAVSLVLPKLKGKLNGIALRVPTPNVSVVDLVINTTKKGMTAEEVNAAFR  313

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            K ++G +KG+L V D PLVS+DFRCSDVS TIDSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  314  KEANGAMKGILAVSDLPLVSIDFRCSDVSCTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  373

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  108
            VVDLA +VA+ WPG+      DPLE +C TNP   EC+V+ 
Sbjct  374  VVDLADIVANNWPGMVQETGSDPLETFCNTNPDADECRVYN  414



>pdb|2PKR|O Chain O, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|R Chain R, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|P Chain P, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|Q Chain Q, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|A Chain A, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|B Chain B, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|C Chain C, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|D Chain D, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|H Chain H, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|I Chain I, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|L Chain L, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|M Chain M, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
Length=365

 Score =   226 bits (577),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 127/162 (78%), Positives = 143/162 (88%), Gaps = 2/162 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  205  NIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  263

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            +++D  LKG+L VCD PLVS+DFRC+DVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  264  ESADNELKGILSVCDEPLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQR  323

Query  230  VVDLAHLVASKWPGV-AVAGSGDPLEDYCKTNPGDKECKVFE  108
            VVDLA +VA+KW G+     SGDPLED+CK NP D+ECK++E
Sbjct  324  VVDLADIVANKWQGLEGSVASGDPLEDFCKDNPADEECKLYE  365



>emb|CAC80389.2| glyceraldehyde-3-phosphate dehydrogenase [Marchantia polymorpha]
Length=457

 Score =   229 bits (583),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 134/161 (83%), Positives = 149/161 (93%), Gaps = 1/161 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+N +KKGLTAEDVN AFR
Sbjct  297  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINTEKKGLTAEDVNNAFR  356

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            +A++GPLKG+L VCD PLVS+DFRCSDVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  357  EAANGPLKGILAVCDIPLVSIDFRCSDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQR  416

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  108
            VVDLAHLVA++WPGVA   SGDPLE++C TNP   EC++ +
Sbjct  417  VVDLAHLVAAQWPGVA-KPSGDPLEEFCVTNPDTDECRLHD  456



>gb|ABK00057.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase [Mesostigma 
viride]
Length=384

 Score =   224 bits (570),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 137/159 (86%), Gaps = 0/159 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLP+LKGKLNGIALRVPTPNVSVVDLV+N  KKG+TAE+VNAAFR
Sbjct  226  NIVPTSTGAAKAVSLVLPKLKGKLNGIALRVPTPNVSVVDLVINTTKKGMTAEEVNAAFR  285

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            K ++G +KG+L V D PLVS+DFRCSDVS TIDSSLTMVMGDDMVKVVAWY NEWGYSQR
Sbjct  286  KEANGAMKGILAVSDLPLVSIDFRCSDVSCTIDSSLTMVMGDDMVKVVAWYGNEWGYSQR  345

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKV  114
            VVDLA +VA+ WPG+      DPLE +C TNP   EC+V
Sbjct  346  VVDLADIVANNWPGMVQETGSDPLETFCNTNPDADECRV  384



>sp|P09044.1|G3PB_TOBAC RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit B; Flags: Precursor, partial [Nicotiana 
tabacum]
 gb|AAA34076.1| glyceraldehyde-3-phosphate dehydrogenase B-subunit precursor, 
partial [Nicotiana tabacum]
Length=438

 Score =   224 bits (571),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 127/134 (95%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG+TAEDVNAAFR
Sbjct  260  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGITAEDVNAAFR  319

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA+DGPLKGVL VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  320  KAADGPLKGVLAVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  379

Query  230  VVDLAHLVASKWPG  189
            VVDLAHLVA+ WPG
Sbjct  380  VVDLAHLVANNWPG  393



>ref|XP_003056194.1| hypothetical protein MICPUCDRAFT_25339 [Micromonas pusilla CCMP1545]
 gb|EEH59570.1| hypothetical protein MICPUCDRAFT_25339 [Micromonas pusilla CCMP1545]
Length=406

 Score =   216 bits (549),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVS+VDLVVNV+KKG+TAE+VNAAF+
Sbjct  246  NIVPTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSIVDLVVNVEKKGVTAEEVNAAFK  305

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            +AS+GP+KG+L + + PLVSVDFRCSDVS+TID++LTMVMGDDMVKVVAWYDNEWGY+QR
Sbjct  306  EASEGPMKGILAITETPLVSVDFRCSDVSTTIDAALTMVMGDDMVKVVAWYDNEWGYTQR  365

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  108
            VVDL H+VA+          GDP++ +C  +P  +ECKVF+
Sbjct  366  VVDLTHIVAAGLIEGGEVTVGDPMDAFCADDPSAEECKVFD  406



>ref|XP_007515295.1| glyceraldehyde-3-phosphate dehydrogenase [Bathycoccus prasinos]
 emb|CCO14174.1| glyceraldehyde-3-phosphate dehydrogenase [Bathycoccus prasinos]
Length=405

 Score =   214 bits (545),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 141/161 (88%), Gaps = 1/161 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVS+VDLVVNV+KKG+TAE+VNAAFR
Sbjct  246  NIVPTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSIVDLVVNVEKKGITAEEVNAAFR  305

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            +A +GP+KGVL + D PLVSVDFRC+DVS+TID++LTMVMGDDMVKVVAWYDNEWGY+QR
Sbjct  306  EAQNGPMKGVLAITDTPLVSVDFRCTDVSTTIDAALTMVMGDDMVKVVAWYDNEWGYTQR  365

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  108
            VVDL  L+ +K     V    DP++  C ++PG +ECKVF+
Sbjct  366  VVDLT-LIVAKALVTGVENFSDPMDALCASDPGAEECKVFD  405



>ref|XP_004985859.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Setaria italica]
Length=445

 Score =   214 bits (545),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 137/163 (84%), Positives = 146/163 (90%), Gaps = 1/163 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVSVVDLV+N +KKG+TA+DVNAAFR
Sbjct  283  NIVPTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVINTEKKGMTADDVNAAFR  342

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            KA+ GPLKGVL VCD PLVSVDFRCSDVSS+IDSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  343  KAAAGPLKGVLQVCDEPLVSVDFRCSDVSSSIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  402

Query  230  VVDLAHLV-ASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  105
            VVDLAHLV A      A  GSGDPLED+CK NP   ECKV+EA
Sbjct  403  VVDLAHLVAAKWPGAAAAGGSGDPLEDFCKDNPETDECKVYEA  445



>ref|XP_002507103.1| glyceraldehyde-3-phosphate dehydrogenase B [Micromonas sp. RCC299]
 gb|ACO68361.1| glyceraldehyde-3-phosphate dehydrogenase B [Micromonas sp. RCC299]
Length=405

 Score =   213 bits (541),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 142/163 (87%), Gaps = 5/163 (3%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVS+VDLV NV+KKG+TAE+VNAAF+
Sbjct  246  NIVPTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSIVDLVCNVEKKGVTAEEVNAAFK  305

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            +A+DGP+KGVL + + PLVSVDFRCSDVS+TID++LTMVMGDDMVKVVAWYDNEWGY+QR
Sbjct  306  EAADGPMKGVLAITETPLVSVDFRCSDVSTTIDAALTMVMGDDMVKVVAWYDNEWGYTQR  365

Query  230  VVDLAHLVASKWPGVAVAG--SGDPLEDYCKTNPGDKECKVFE  108
            VVDL H+VA    G+   G  S DP++  C  +P  +ECKVF+
Sbjct  366  VVDLTHIVAK---GLIEGGDVSADPMDALCADDPSAEECKVFD  405



>ref|XP_001415434.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABG85192.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase subunit 
B [Ostreococcus 'lucimarinus']
 gb|ABO93726.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=406

 Score =   211 bits (538),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 141/161 (88%), Gaps = 1/161 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAE+VNAAF+
Sbjct  247  NIVPTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGVTAEEVNAAFK  306

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            +A DGP+KGVL + D PLVSVDFRC+DVS+TID++LTMVMGDDMVKVVAWYDNEWGY+QR
Sbjct  307  EAQDGPMKGVLAITDVPLVSVDFRCTDVSTTIDAALTMVMGDDMVKVVAWYDNEWGYTQR  366

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFE  108
            VVDL+ +VA+      VA S DP++  C  +P   ECKVF+
Sbjct  367  VVDLSLIVANGLINEGVA-SADPMDQLCADDPSADECKVFD  406



>emb|CEF96577.1| Glyceraldehyde 3-phosphate dehydrogenase, NAD(P) binding domain 
[Ostreococcus tauri]
Length=407

 Score =   206 bits (524),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 117/162 (72%), Positives = 140/162 (86%), Gaps = 1/162 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVS+VDLVVNV+KKG+TAE+VNAAF+
Sbjct  247  NIVPTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSIVDLVVNVEKKGVTAEEVNAAFK  306

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            + +DGP+KGVL + D PLVSVDFRC+DVS+TID++LTMVMGDDMVKVVAWYDNEWGY+QR
Sbjct  307  EYADGPMKGVLAITDTPLVSVDFRCTDVSTTIDAALTMVMGDDMVKVVAWYDNEWGYTQR  366

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  105
            VVDL  +VA+       + + DPL+  C  +P   ECKVF++
Sbjct  367  VVDLTLIVANSLINEG-SVTLDPLDQLCSDDPSADECKVFDS  407



>gb|ABG85191.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase subunit 
B [Ostreococcus tauri]
Length=439

 Score =   205 bits (521),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 140/162 (86%), Gaps = 1/162 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVS+VDLVVNV+KKG+TAE+VNAAF+
Sbjct  279  NIVPTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSIVDLVVNVEKKGVTAEEVNAAFK  338

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            + +DGP+KGVL + D PLVSVDFRC+DVS+TID++LTMV+GDDMVKVVAWYDNEWGY+QR
Sbjct  339  EYADGPMKGVLAITDTPLVSVDFRCTDVSTTIDAALTMVIGDDMVKVVAWYDNEWGYTQR  398

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  105
            VVDL  +VA+       + + DPL+  C  +P   ECKVF++
Sbjct  399  VVDLTLIVANSLINEG-SVTLDPLDQLCSDDPSADECKVFDS  439



>ref|XP_003074208.1| NADP-glyceraldehyde-3-phosphate dehydrogenase (IC) [Ostreococcus 
tauri]
Length=434

 Score =   204 bits (520),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 140/162 (86%), Gaps = 1/162 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVS+VDLVVNV+KKG+TAE+VNAAF+
Sbjct  274  NIVPTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSIVDLVVNVEKKGVTAEEVNAAFK  333

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            + +DGP+KGVL + D PLVSVDFRC+DVS+TID++LTMV+GDDMVKVVAWYDNEWGY+QR
Sbjct  334  EYADGPMKGVLAITDTPLVSVDFRCTDVSTTIDAALTMVIGDDMVKVVAWYDNEWGYTQR  393

Query  230  VVDLAHLVASKWPGVAVAGSGDPLEDYCKTNPGDKECKVFEA  105
            VVDL  +VA+       + + DPL+  C  +P   ECKVF++
Sbjct  394  VVDLTLIVANSLINEG-SVTLDPLDQLCSDDPSADECKVFDS  434



>gb|ABK00067.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase, partial 
[Chlorokybus atmophyticus]
Length=325

 Score =   200 bits (509),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 123/132 (93%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVS+VDLV+  +KK   AE+VNAAFR
Sbjct  182  NIVPTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSIVDLVIQTEKKTF-AEEVNAAFR  240

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            +A++GPLKG+L VCD PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  241  EAANGPLKGILAVCDEPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  300

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+ W
Sbjct  301  VVDLADIVANNW  312



>gb|ABD37959.1| glyceraldehyde-3-phosphate dehydrogenase subunit A, partial [Chlorokybus 
atmophyticus]
Length=347

 Score =   199 bits (506),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 123/132 (93%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVS+VDLV+  +KK   AE+VNAAFR
Sbjct  204  NIVPTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSIVDLVIQTEKKTF-AEEVNAAFR  262

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            +A++GPLKG+L VCD PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  263  EAANGPLKGILAVCDEPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  322

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+ W
Sbjct  323  VVDLADIVANNW  334



>sp|P09672.1|G3PA_SINAL RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A, partial [Sinapis alba]
 emb|CAA27845.1| chloroplast GAPDH (233aa) [Sinapis alba]
Length=233

 Score =   193 bits (491),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 112/132 (85%), Positives = 120/132 (91%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  102  NIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  160

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
             A++  LKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  161  DAAEKELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQR  220

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+ W
Sbjct  221  VVDLADIVANNW  232



>gb|ABK00052.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase, partial 
[Marchantia polymorpha]
Length=359

 Score =   197 bits (500),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 113/134 (84%), Positives = 124/134 (93%), Gaps = 1/134 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VNAAFR
Sbjct  226  NIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNAAFR  284

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            +A++G +KG+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  285  EAANGDMKGILAVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQR  344

Query  230  VVDLAHLVASKWPG  189
            VVDLA+LVA KW G
Sbjct  345  VVDLANLVAEKWTG  358



>gb|ABY20971.1| glyceraldehyde-3-phosphate dehydrogenase A subunit [Hypericum 
perforatum]
Length=141

 Score =   189 bits (481),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 120/132 (91%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  10   NIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFR  68

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            +++D  LKG+L VCD PLVSVDFRCSDVSST+D+SLT VMGDDMVKV+AWYDNEWGYSQR
Sbjct  69   ESADKELKGILAVCDEPLVSVDFRCSDVSSTVDASLTTVMGDDMVKVIAWYDNEWGYSQR  128

Query  230  VVDLAHLVASKW  195
            VVDLA LVA+KW
Sbjct  129  VVDLADLVANKW  140



>ref|XP_009148557.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Brassica rapa]
Length=317

 Score =   195 bits (496),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 112/132 (85%), Positives = 120/132 (91%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  186  NIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  244

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
             A++  LKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  245  DAAEKELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQR  304

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+ W
Sbjct  305  VVDLADIVANNW  316



>emb|CAC80388.1| glyceraldehyde-3-phosphate dehydrogenase [Marchantia polymorpha]
Length=400

 Score =   197 bits (501),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 113/134 (84%), Positives = 124/134 (93%), Gaps = 1/134 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VNAAFR
Sbjct  267  NIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNAAFR  325

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            +A++G +KG+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  326  EAANGDMKGILAVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQR  385

Query  230  VVDLAHLVASKWPG  189
            VVDLA+LVA KW G
Sbjct  386  VVDLANLVAEKWTG  399



>gb|ADU04755.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Mesostigma 
viride]
 gb|ADU04760.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Mesostigma 
viride]
 gb|ADU04761.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Mesostigma 
viride]
 gb|ADU04762.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Mesostigma 
viride]
Length=284

 Score =   194 bits (492),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 109/131 (83%), Positives = 124/131 (95%), Gaps = 1/131 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP+LKGKLNGIALRVPTPNVSVVDLV+ V+KK   AE+VNAA R
Sbjct  155  NIVPTSTGAAKAVALVLPKLKGKLNGIALRVPTPNVSVVDLVIQVEKKTF-AEEVNAALR  213

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            +A++GP+KGVL VCD PLVSVDF+CSDVSSTID+SLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  214  EAANGPMKGVLAVCDEPLVSVDFKCSDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQR  273

Query  230  VVDLAHLVASK  198
            VVDLAH++A++
Sbjct  274  VVDLAHIMANQ  284



>dbj|BAD93961.1| glyceraldehyde 3-phosphate dehydrogenase A subunit [Arabidopsis 
thaliana]
Length=161

 Score =   189 bits (481),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 119/132 (90%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  30   NIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  88

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
             +++  LKG+LDVCD PLVSVDFRCSD S+TIDSSLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  89   DSAEKELKGILDVCDEPLVSVDFRCSDFSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQR  148

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+ W
Sbjct  149  VVDLADIVANNW  160



>ref|NP_001077529.1| glyceraldehyde 3-phosphate dehydrogenase GAPA2 [Arabidopsis thaliana]
 gb|AEE28945.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
Length=317

 Score =   194 bits (494),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 112/132 (85%), Positives = 120/132 (91%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  186  NIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  244

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
             A++  LKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  245  DAAEKELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQR  304

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+ W
Sbjct  305  VVDLADIVANNW  316



>gb|KIY93372.1| NADP-dependent glyceraldehydephosphatedehydrogenase subunit A 
[Monoraphidium neglectum]
Length=176

 Score =   190 bits (482),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 120/132 (91%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPT+TGAAKAV+LVLP+LKGKLNGIALRVPTPNVSVVDLV+ V+KK   AE+VNAAFR
Sbjct  45   NIVPTTTGAAKAVALVLPKLKGKLNGIALRVPTPNVSVVDLVIQVEKKTF-AEEVNAAFR  103

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            +A+ GP+ GVL V D PLVSVDFRC+DVS++IDSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  104  EAAAGPMAGVLAVADEPLVSVDFRCTDVSTSIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  163

Query  230  VVDLAHLVASKW  195
            VVDLA L A KW
Sbjct  164  VVDLAELTAQKW  175



>ref|XP_010476270.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Camelina sativa]
Length=317

 Score =   194 bits (494),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 112/132 (85%), Positives = 120/132 (91%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  186  NIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  244

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
             A++  LKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  245  DAAEKELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQR  304

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+ W
Sbjct  305  VVDLADIVANNW  316



>ref|XP_010494750.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Camelina sativa]
Length=317

 Score =   194 bits (493),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 112/132 (85%), Positives = 120/132 (91%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  186  NIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  244

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
             A++  LKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  245  DAAEKELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQR  304

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+ W
Sbjct  305  VVDLADIVANNW  316



>gb|ADU04754.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Mesostigma 
viride]
Length=284

 Score =   193 bits (490),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 109/131 (83%), Positives = 123/131 (94%), Gaps = 1/131 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP+LKGKLNGIALRVPTPNVSVVDLV+ V+KK   AE+VNAA R
Sbjct  155  NIVPTSTGAAKAVALVLPKLKGKLNGIALRVPTPNVSVVDLVIQVEKKTF-AEEVNAALR  213

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            +A++GP+KGVL VCD PLVSVDF+CSDVSSTID+SLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  214  EAANGPMKGVLAVCDEPLVSVDFKCSDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQR  273

Query  230  VVDLAHLVASK  198
            VVDLAH++A +
Sbjct  274  VVDLAHIMAKE  284



>ref|XP_002503470.1| glyceraldehyde-3-phosphate dehydrogenase a chloroplast precursor 
[Micromonas sp. RCC299]
 gb|ACO64728.1| glyceraldehyde-3-phosphate dehydrogenase a chloroplast precursor 
[Micromonas sp. RCC299]
Length=377

 Score =   195 bits (496),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 104/132 (79%), Positives = 122/132 (92%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVSVVD+ +  +KK  TAE++NAAFR
Sbjct  245  NIVPTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDMCIQTEKK-CTAEEINAAFR  303

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            +A++GP+KG+L V D PLVS+DFRCSDVS+TID++LTMVMGDD++KVVAWYDNEWGYSQR
Sbjct  304  EAAEGPMKGILAVADEPLVSIDFRCSDVSTTIDAALTMVMGDDLIKVVAWYDNEWGYSQR  363

Query  230  VVDLAHLVASKW  195
            VVDLA L A+KW
Sbjct  364  VVDLAELTATKW  375



>gb|ABK00056.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase, partial 
[Mesostigma viride]
Length=310

 Score =   193 bits (491),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 109/131 (83%), Positives = 123/131 (94%), Gaps = 1/131 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP+LKGKLNGIALRVPTPNVSVVDLV+ V+KK   AE+VNAA R
Sbjct  181  NIVPTSTGAAKAVALVLPKLKGKLNGIALRVPTPNVSVVDLVIQVEKKTF-AEEVNAALR  239

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            +A++GP+KGVL VCD PLVSVDF+CSDVSSTID+SLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  240  EAANGPMKGVLAVCDEPLVSVDFKCSDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQR  299

Query  230  VVDLAHLVASK  198
            VVDLAH++A +
Sbjct  300  VVDLAHIMAKE  310



>pir||DESPGA glyceraldehyde-3-phosphate dehydrogenase (NADP)  (phosphorylating) 
(EC 1.2.1.13) A, chloroplast - spinach
Length=337

 Score =   194 bits (492),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 122/132 (92%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  205  NIVPTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  263

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            +++D  LKG+L VCD PLVS+DFRC+DVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  264  ESADNELKGILSVCDEPLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQR  323

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+KW
Sbjct  324  VVDLADIVANKW  335



>dbj|BAK05515.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=147

 Score =   187 bits (475),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 105/117 (90%), Positives = 113/117 (97%), Gaps = 0/117 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+N  K G+TA+DVNAAFR
Sbjct  30   NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINTVKTGITADDVNAAFR  89

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGY  240
            KA+DGPLKG+LDVCD PLVSVDFRCSDVS++ID+SLTMVMGDDMVKVVAWYDNEWGY
Sbjct  90   KAADGPLKGILDVCDEPLVSVDFRCSDVSTSIDASLTMVMGDDMVKVVAWYDNEWGY  146



>pdb|1JN0|O Chain O, Crystal Structure Of The Non-regulatory A4 Isoform Of 
Spinach Chloroplast Glyceraldehyde-3-phosphate Dehydrogenase 
Complexed With Nadp
 pdb|1JN0|A Chain A, Crystal Structure Of The Non-regulatory A4 Isoform Of 
Spinach Chloroplast Glyceraldehyde-3-phosphate Dehydrogenase 
Complexed With Nadp
 pdb|1JN0|B Chain B, Crystal Structure Of The Non-regulatory A4 Isoform Of 
Spinach Chloroplast Glyceraldehyde-3-phosphate Dehydrogenase 
Complexed With Nadp
Length=335

 Score =   193 bits (490),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 122/132 (92%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  203  NIVPTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  261

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            +++D  LKG+L VCD PLVS+DFRC+DVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  262  ESADQELKGILSVCDEPLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQR  321

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+KW
Sbjct  322  VVDLADIVANKW  333



>ref|XP_010425376.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Camelina sativa]
Length=317

 Score =   192 bits (489),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 120/132 (91%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  186  NIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  244

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
             +++  LKG+LDVCD PLVSVDFRCSD S+TIDSSLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  245  DSAEKELKGILDVCDEPLVSVDFRCSDYSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQR  304

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+KW
Sbjct  305  VVDLADIVANKW  316



>ref|XP_003055659.1| hypothetical protein MICPUCDRAFT_49403 [Micromonas pusilla CCMP1545]
 gb|EEH60911.1| hypothetical protein MICPUCDRAFT_49403 [Micromonas pusilla CCMP1545]
Length=380

 Score =   194 bits (493),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 107/132 (81%), Positives = 123/132 (93%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVSVVD+V+ V+KK  TAEDVNAAFR
Sbjct  247  NIVPTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDMVIQVEKK-CTAEDVNAAFR  305

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            +A+ GP+KG+L V D PLVS+DFRC+DVS++IDS+LTMVMG+D+VK+VAWYDNEWGYSQR
Sbjct  306  EAAAGPMKGILQVVDEPLVSIDFRCTDVSTSIDSALTMVMGEDLVKIVAWYDNEWGYSQR  365

Query  230  VVDLAHLVASKW  195
            VVDLA L ASKW
Sbjct  366  VVDLAELTASKW  377



>ref|XP_009118049.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Brassica rapa]
Length=317

 Score =   192 bits (489),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 119/132 (90%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  186  NIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  244

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
             A+   LKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  245  DAAANELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQR  304

Query  230  VVDLAHLVASKW  195
            VVDL+ +VA+ W
Sbjct  305  VVDLSDIVANNW  316



>gb|EPS59235.1| hypothetical protein M569_15573, partial [Genlisea aurea]
Length=395

 Score =   194 bits (494),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 123/132 (93%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VNAAFR
Sbjct  264  NIVPTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNAAFR  322

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            +++D  LKG+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  323  ESADKELKGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQR  382

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+KW
Sbjct  383  VVDLADIVANKW  394



>ref|XP_010502598.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=317

 Score =   192 bits (488),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 120/132 (91%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  186  NIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  244

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
             +++  LKG+LDVCD PLVSVDFRCSD S+TIDSSLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  245  DSAEKELKGILDVCDEPLVSVDFRCSDYSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQR  304

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+KW
Sbjct  305  VVDLADIVANKW  316



>gb|ABD37961.1| glyceraldehyde-3-phosphate dehydrogenase subunit A, partial [Mesostigma 
viride]
Length=333

 Score =   192 bits (488),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 109/131 (83%), Positives = 123/131 (94%), Gaps = 1/131 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP+LKGKLNGIALRVPTPNVSVVDLV+ V+KK   AE+VNAA R
Sbjct  202  NIVPTSTGAAKAVALVLPKLKGKLNGIALRVPTPNVSVVDLVIQVEKKTF-AEEVNAALR  260

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            +A++GP+KGVL VCD PLVSVDF+CSDVSSTID+SLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  261  EAANGPMKGVLAVCDEPLVSVDFKCSDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQR  320

Query  230  VVDLAHLVASK  198
            VVDLAH++A +
Sbjct  321  VVDLAHIMAKE  331



>ref|XP_002985183.1| hypothetical protein SELMODRAFT_181561 [Selaginella moellendorffii]
 gb|EFJ13677.1| hypothetical protein SELMODRAFT_181561 [Selaginella moellendorffii]
Length=402

 Score =   194 bits (492),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 112/132 (85%), Positives = 122/132 (92%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP+LKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VNAAFR
Sbjct  271  NIVPTSTGAAKAVALVLPKLKGKLNGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNAAFR  329

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            +A+D  L G+L VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  330  EAADKALNGILAVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  389

Query  230  VVDLAHLVASKW  195
            VVDLA++VA +W
Sbjct  390  VVDLANIVAEQW  401



>pdb|1RM5|O Chain O, Crystal Structure Of Mutant S188a Of Photosynthetic 
Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM5|A Chain A, Crystal Structure Of Mutant S188a Of Photosynthetic 
Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM5|B Chain B, Crystal Structure Of Mutant S188a Of Photosynthetic 
Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
Length=337

 Score =   191 bits (486),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 121/132 (92%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  205  NIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  263

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            +++D  LKG+L VCD PLVS+DFRC+DVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  264  ESADNELKGILSVCDEPLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQR  323

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+KW
Sbjct  324  VVDLADIVANKW  335



>pdb|1RM3|O Chain O, Crystal Structure Of Mutant T33a Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM3|A Chain A, Crystal Structure Of Mutant T33a Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM3|B Chain B, Crystal Structure Of Mutant T33a Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
Length=337

 Score =   191 bits (486),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 121/132 (92%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  205  NIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  263

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            +++D  LKG+L VCD PLVS+DFRC+DVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  264  ESADNELKGILSVCDEPLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQR  323

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+KW
Sbjct  324  VVDLADIVANKW  335



>pdb|1NBO|O Chain O, The Dual Coenzyme Specificity Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase Interpreted By The Crystal 
Structure Of A4 Isoform Complexed With Nad
 pdb|1NBO|A Chain A, The Dual Coenzyme Specificity Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase Interpreted By The Crystal 
Structure Of A4 Isoform Complexed With Nad
 pdb|1NBO|B Chain B, The Dual Coenzyme Specificity Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase Interpreted By The Crystal 
Structure Of A4 Isoform Complexed With Nad
 pdb|1RM4|O Chain O, Crystal Structure Of Recombinant Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM4|A Chain A, Crystal Structure Of Recombinant Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM4|B Chain B, Crystal Structure Of Recombinant Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|2HKI|A Chain A, Crystal Structure Of Photosynthetic Glyceraldehyde-3-Phosphate 
Dehydrogenase A4 Isoform
 pdb|2PKQ|P Chain P, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
 pdb|2PKQ|R Chain R, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
 pdb|2PKQ|S Chain S, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
Length=337

 Score =   191 bits (486),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 121/132 (92%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  205  NIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  263

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            +++D  LKG+L VCD PLVS+DFRC+DVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  264  ESADNELKGILSVCDEPLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQR  323

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+KW
Sbjct  324  VVDLADIVANKW  335



>ref|NP_001117276.1| glyceraldehyde 3-phosphate dehydrogenase GAPA2 [Arabidopsis thaliana]
 ref|NP_001184977.1| glyceraldehyde 3-phosphate dehydrogenase GAPA2 [Arabidopsis thaliana]
 gb|AEE28946.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
 gb|AEE28947.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
Length=350

 Score =   192 bits (487),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 112/132 (85%), Positives = 120/132 (91%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  219  NIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  277

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
             A++  LKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  278  DAAEKELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQR  337

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+ W
Sbjct  338  VVDLADIVANNW  349



>dbj|BAP91041.1| glyceraldehyde 3-phosphate dehydrogenase-A [Nicotiana benthamiana]
Length=401

 Score =   193 bits (490),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 122/132 (92%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  270  NIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  328

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            +A+D  LKG+LDVCD PLVSVDFRCSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  329  EAADKELKGILDVCDEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQR  388

Query  230  VVDLAHLVASKW  195
            VVDLA +VA++W
Sbjct  389  VVDLADIVANQW  400



>ref|XP_010494747.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Camelina sativa]
Length=399

 Score =   193 bits (490),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 112/132 (85%), Positives = 120/132 (91%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  268  NIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  326

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
             A++  LKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  327  DAAEKELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQR  386

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+ W
Sbjct  387  VVDLADIVANNW  398



>ref|XP_009800449.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Nicotiana sylvestris]
Length=401

 Score =   193 bits (490),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 122/132 (92%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  270  NIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  328

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            +A+D  LKG+LDVCD PLVSVDFRCSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  329  EAADKELKGILDVCDEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQR  388

Query  230  VVDLAHLVASKW  195
            VVDLA +VA++W
Sbjct  389  VVDLADIVANQW  400



>ref|XP_006417176.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
 ref|XP_006417178.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
 gb|ESQ35529.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
 gb|ESQ35531.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
Length=350

 Score =   192 bits (487),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 112/132 (85%), Positives = 120/132 (91%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  219  NIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  277

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
             A++  LKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  278  DAAEKELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQR  337

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+ W
Sbjct  338  VVDLADIVANNW  349



>ref|XP_009148556.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Brassica rapa]
Length=399

 Score =   193 bits (490),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 112/132 (85%), Positives = 120/132 (91%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  268  NIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  326

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
             A++  LKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  327  DAAEKELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQR  386

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+ W
Sbjct  387  VVDLADIVANNW  398



>ref|XP_009631078.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Nicotiana tomentosiformis]
Length=401

 Score =   193 bits (490),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 122/132 (92%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  270  NIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFR  328

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            +A+D  LKG+LDVCD PLVSVDFRCSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  329  EAADKELKGILDVCDEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQR  388

Query  230  VVDLAHLVASKW  195
            VVDLA +VA++W
Sbjct  389  VVDLADIVANQW  400



>ref|XP_006304985.1| hypothetical protein CARUB_v10009349mg [Capsella rubella]
 gb|EOA37883.1| hypothetical protein CARUB_v10009349mg [Capsella rubella]
Length=399

 Score =   193 bits (490),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 112/132 (85%), Positives = 120/132 (91%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  268  NIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  326

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
             A++  LKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  327  DAAEKELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQR  386

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+ W
Sbjct  387  VVDLADIVANNW  398



>ref|XP_010476269.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Camelina sativa]
Length=399

 Score =   193 bits (490),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 112/132 (85%), Positives = 120/132 (91%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  268  NIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  326

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
             A++  LKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  327  DAAEKELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQR  386

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+ W
Sbjct  387  VVDLADIVANNW  398



>ref|NP_172750.1| glyceraldehyde 3-phosphate dehydrogenase GAPA2 [Arabidopsis thaliana]
 sp|Q9LPW0.1|G3PA2_ARATH RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase GAPA2, 
chloroplastic; AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase A subunit 2; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF78494.1|AC012187_14 Strong similarity to GAPDH subunit A from Pisum sativum gb|X15190 
and contains a GAPDH PF|00044 domain. ESTs gb|T42920, gb|T43410, 
gb|T46101, gb|T04006, gb|T20630, gb|Z34677, gb|T46805, 
gb|N37754, gb|N37754, gb|Z26072, gb|H37169, gb|H76419, 
gb|T20834, gb|T21557, gb|AA713258, gb|T04005, gb|AI099909, gb|Z34793 
come from this gene [Arabidopsis thaliana]
 gb|AAP40454.1| putative calcium-binding protein, calreticulin [Arabidopsis thaliana]
 gb|AAU94430.1| At1g12900 [Arabidopsis thaliana]
 gb|AEE28944.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
Length=399

 Score =   193 bits (490),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 112/132 (85%), Positives = 120/132 (91%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  268  NIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  326

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
             A++  LKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  327  DAAEKELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQR  386

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+ W
Sbjct  387  VVDLADIVANNW  398



>emb|CDY19412.1| BnaC05g09210D [Brassica napus]
 emb|CDX98028.1| BnaA06g07790D [Brassica napus]
Length=399

 Score =   193 bits (490),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 112/132 (85%), Positives = 120/132 (91%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  268  NIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  326

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
             A++  LKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  327  DAAEKELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQR  386

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+ W
Sbjct  387  VVDLADIVANNW  398



>ref|XP_006417177.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
 gb|ESQ35530.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
Length=399

 Score =   192 bits (489),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 112/132 (85%), Positives = 120/132 (91%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  268  NIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  326

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
             A++  LKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  327  DAAEKELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQR  386

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+ W
Sbjct  387  VVDLADIVANNW  398



>ref|XP_002892719.1| GAPA-2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68978.1| GAPA-2 [Arabidopsis lyrata subsp. lyrata]
Length=399

 Score =   192 bits (489),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 112/132 (85%), Positives = 120/132 (91%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  268  NIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  326

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
             A++  LKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  327  DAAEKELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQR  386

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+ W
Sbjct  387  VVDLADIVANNW  398



>gb|AES74103.2| glyceraldehyde-3-phosphate dehydrogenase B [Medicago truncatula]
Length=415

 Score =   193 bits (490),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 110/117 (94%), Positives = 115/117 (98%), Gaps = 0/117 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNV KKG++AEDVNAAFR
Sbjct  291  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGISAEDVNAAFR  350

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGY  240
            KA++GPLKGVLDVCD PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGY
Sbjct  351  KAAEGPLKGVLDVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGY  407



>sp|P19866.2|G3PA_SPIOL RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor [Spinacia oleracea]
 gb|AAD10217.1| NADP-dependent glyceraldehydephosphate dehydrogenase subunit 
A [Spinacia oleracea]
Length=401

 Score =   192 bits (489),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 121/132 (92%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  270  NIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  328

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            +++D  LKG+L VCD PLVS+DFRC+DVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  329  ESADNELKGILSVCDEPLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQR  388

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+KW
Sbjct  389  VVDLADIVANKW  400



>ref|XP_002970103.1| hypothetical protein SELMODRAFT_270825 [Selaginella moellendorffii]
 gb|EFJ29227.1| hypothetical protein SELMODRAFT_270825 [Selaginella moellendorffii]
Length=402

 Score =   192 bits (489),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 122/132 (92%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP+LKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VNAAFR
Sbjct  271  NIVPTSTGAAKAVALVLPKLKGKLNGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNAAFR  329

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            +++D  L G+L VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  330  ESADKALNGILAVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  389

Query  230  VVDLAHLVASKW  195
            VVDLA++VA +W
Sbjct  390  VVDLANIVAEQW  401



>dbj|BAK02737.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=306

 Score =   190 bits (482),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 120/132 (91%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK L AE+VN AFR
Sbjct  175  NIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL-AEEVNQAFR  233

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
             A+   LKG+LDVCD PLVSVDFRCSDVSSTID+SL+MVMGDDMVKV+AWYDNEWGYSQR
Sbjct  234  DAAANELKGILDVCDEPLVSVDFRCSDVSSTIDASLSMVMGDDMVKVIAWYDNEWGYSQR  293

Query  230  VVDLAHLVASKW  195
            VVDLA +VA++W
Sbjct  294  VVDLADIVANQW  305



>gb|AIU56856.1| glyceraldehyde-3-phosphate dehydrogenase A, partial [Brassica 
rapa subsp. chinensis]
Length=336

 Score =   191 bits (484),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 112/132 (85%), Positives = 119/132 (90%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  205  NIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  263

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
             A+   LKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  264  DAAANELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQR  323

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+ W
Sbjct  324  VVDLADIVANNW  335



>gb|KHN46369.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Glycine 
soja]
Length=403

 Score =   192 bits (488),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 121/132 (92%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  272  NIVPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  330

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            +++D  LKG+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  331  ESADNELKGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQR  390

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+KW
Sbjct  391  VVDLADIVANKW  402



>ref|NP_001238484.1| glyceraldehyde-3-phosphate dehydrogenase A subunit [Glycine max]
 gb|ABA86963.1| glyceraldehyde-3-phosphate dehydrogenase A subunit [Glycine max]
Length=403

 Score =   192 bits (488),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 121/132 (92%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  272  NIVPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  330

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            +++D  LKG+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  331  ESADNELKGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQR  390

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+KW
Sbjct  391  VVDLADIVANKW  402



>gb|KJB11770.1| hypothetical protein B456_001G276400 [Gossypium raimondii]
Length=305

 Score =   189 bits (481),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 120/132 (91%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  174  NIVPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  232

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            ++++  LKG+L VCD PLVSVDFRCSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  233  ESAEKELKGILSVCDEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQR  292

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+ W
Sbjct  293  VVDLADIVANNW  304



>gb|KHN46819.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Glycine 
soja]
Length=403

 Score =   192 bits (488),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 121/132 (92%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  272  NIVPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  330

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            +++D  LKG+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  331  ESADNELKGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQR  390

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+KW
Sbjct  391  VVDLADIVANKW  402



>emb|CDX83635.1| BnaC07g23750D [Brassica napus]
Length=380

 Score =   191 bits (486),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 121/132 (92%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  249  NIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFR  307

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            ++++  LKG+L+VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  308  ESAEKELKGILEVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQR  367

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+ W
Sbjct  368  VVDLADIVANNW  379



>gb|KDO85174.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=409

 Score =   192 bits (488),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 109/117 (93%), Positives = 115/117 (98%), Gaps = 0/117 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLV+PQLKGKLNGIALRVPTPNVSVVDLVVNV+KKG+TAEDVNAAFR
Sbjct  292  NIVPTSTGAAKAVSLVMPQLKGKLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFR  351

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGY  240
            KA++GPLKG+L VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGY
Sbjct  352  KAAEGPLKGILAVCDVPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGY  408



>emb|CDY26599.1| BnaA09g46780D [Brassica napus]
Length=399

 Score =   192 bits (487),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 112/132 (85%), Positives = 119/132 (90%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  268  NIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  326

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
             A+   LKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  327  DAAANELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQR  386

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+ W
Sbjct  387  VVDLADIVANNW  398



>emb|CDY16038.1| BnaC08g40850D [Brassica napus]
Length=399

 Score =   191 bits (486),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 112/132 (85%), Positives = 119/132 (90%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  268  NIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  326

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
             A+   LKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  327  DAAANELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQR  386

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+ W
Sbjct  387  VVDLADIVANNW  398



>gb|KFK33590.1| hypothetical protein AALP_AA5G033500 [Arabis alpina]
Length=400

 Score =   191 bits (486),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 121/132 (92%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  269  NIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  327

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            ++++  LKG+L+VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  328  ESAEKELKGILEVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQR  387

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+ W
Sbjct  388  VVDLADIVANNW  399



>ref|XP_006395535.1| hypothetical protein EUTSA_v10004349mg [Eutrema salsugineum]
 gb|ESQ32821.1| hypothetical protein EUTSA_v10004349mg [Eutrema salsugineum]
Length=400

 Score =   191 bits (486),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 120/132 (91%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  269  NIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  327

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
             A++  LKG+L+VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  328  DAAEKELKGILEVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQR  387

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+ W
Sbjct  388  VVDLADIVANNW  399



>ref|XP_010028899.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Eucalyptus grandis]
 gb|KCW55732.1| hypothetical protein EUGRSUZ_I01564 [Eucalyptus grandis]
Length=402

 Score =   192 bits (487),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 119/132 (90%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNA FR
Sbjct  271  NIVPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAGFR  329

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            +++D  LKG+L VCD PLVSVDFRCSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  330  ESADNELKGILSVCDEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQR  389

Query  230  VVDLAHLVASKW  195
            VVDLAH+VA  W
Sbjct  390  VVDLAHIVADNW  401



>dbj|BAJ34149.1| unnamed protein product [Thellungiella halophila]
Length=400

 Score =   191 bits (486),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 120/132 (91%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  269  NIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  327

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
             A++  LKG+L+VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  328  DAAEKELKGILEVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQR  387

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+ W
Sbjct  388  VVDLADIVANNW  399



>ref|XP_010694632.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=401

 Score =   191 bits (486),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 120/132 (91%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  270  NIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFR  328

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            +++D  LKG+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  329  ESADNELKGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQR  388

Query  230  VVDLAHLVASKW  195
            VVDLA +VA KW
Sbjct  389  VVDLADIVADKW  400



>gb|KFK43560.1| hypothetical protein AALP_AA1G142100 [Arabis alpina]
Length=399

 Score =   191 bits (486),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 119/132 (90%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  268  NIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  326

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
             A+   +KG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  327  DAAANEMKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQR  386

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+ W
Sbjct  387  VVDLADIVANNW  398



>ref|XP_009152035.1| PREDICTED: LOW QUALITY PROTEIN: glyceraldehyde-3-phosphate dehydrogenase 
GAPA1, chloroplastic [Brassica rapa]
Length=400

 Score =   191 bits (485),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 121/132 (92%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  269  NIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFR  327

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            ++++  LKG+L+VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  328  ESAEKELKGILEVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQR  387

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+ W
Sbjct  388  VVDLADIVANNW  399



>ref|XP_010425375.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic 
isoform X1 [Camelina sativa]
Length=400

 Score =   191 bits (485),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 120/132 (91%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  269  NIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  327

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
             +++  LKG+LDVCD PLVSVDFRCSD S+TIDSSLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  328  DSAEKELKGILDVCDEPLVSVDFRCSDYSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQR  387

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+KW
Sbjct  388  VVDLADIVANKW  399



>gb|ABD37956.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Spermatozopsis 
similis]
Length=263

 Score =   187 bits (475),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 106/132 (80%), Positives = 118/132 (89%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPT+TGAAKAV+LVLP LKGKLNG ALRVPTPNVS+VDLV+ V+KK   AE+VN AFR
Sbjct  132  NIVPTTTGAAKAVALVLPNLKGKLNGFALRVPTPNVSIVDLVIQVEKKTF-AEEVNNAFR  190

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            +A+ G +KGVL VCD PLVSVDFRC+DVS +IDSSLTMVMGDDMVK+VAWYDNEWGYSQR
Sbjct  191  EAAAGEMKGVLAVCDEPLVSVDFRCTDVSVSIDSSLTMVMGDDMVKIVAWYDNEWGYSQR  250

Query  230  VVDLAHLVASKW  195
            VVDLA L ASKW
Sbjct  251  VVDLAELAASKW  262



>ref|XP_010502597.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=400

 Score =   191 bits (485),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 120/132 (91%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  269  NIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  327

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
             +++  LKG+LDVCD PLVSVDFRCSD S+TIDSSLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  328  DSAEKELKGILDVCDEPLVSVDFRCSDYSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQR  387

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+KW
Sbjct  388  VVDLADIVANKW  399



>ref|XP_003579898.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Brachypodium distachyon]
Length=403

 Score =   191 bits (484),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 121/132 (92%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK L AE+VNAAFR
Sbjct  272  NIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL-AEEVNAAFR  330

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
             A+   LKG+LDVCD PLVSVDFRCSDVSSTID+SL+MVMGDDMVKV+AWYDNEWGYSQR
Sbjct  331  DAAANELKGILDVCDEPLVSVDFRCSDVSSTIDASLSMVMGDDMVKVIAWYDNEWGYSQR  390

Query  230  VVDLAHLVASKW  195
            VVDLA +VA++W
Sbjct  391  VVDLADIVANQW  402



>ref|XP_003548805.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Glycine max]
Length=403

 Score =   191 bits (484),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 121/132 (92%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  272  NIVPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  330

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            +++D  L+G+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  331  ESADNELQGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQR  390

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+KW
Sbjct  391  VVDLADIVANKW  402



>ref|XP_009118048.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Brassica rapa]
Length=399

 Score =   191 bits (484),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 119/132 (90%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  268  NIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  326

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
             A+   LKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  327  DAAANELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQR  386

Query  230  VVDLAHLVASKW  195
            VVDL+ +VA+ W
Sbjct  387  VVDLSDIVANNW  398



>ref|XP_006359279.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Solanum tuberosum]
Length=399

 Score =   191 bits (484),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 120/132 (91%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  268  NIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFR  326

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            +A+D  L G+L VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  327  EAADKELNGILAVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQR  386

Query  230  VVDLAHLVASKW  195
            VVDLA +VA++W
Sbjct  387  VVDLADIVANQW  398



>ref|XP_002512790.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
 gb|EEF49293.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
Length=404

 Score =   191 bits (484),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 121/132 (92%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V+KK   AE+VNAAFR
Sbjct  273  NIVPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNAAFR  331

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            +++D  LKG+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  332  ESADKELKGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQR  391

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+ W
Sbjct  392  VVDLADIVANNW  403



>emb|CDY13649.1| BnaA06g32740D [Brassica napus]
Length=380

 Score =   190 bits (482),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 120/132 (91%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  249  NIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFR  307

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
             +++  LKG+L+VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  308  DSAEKELKGILEVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQR  367

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+ W
Sbjct  368  VVDLADIVANNW  379



>ref|XP_007161788.1| hypothetical protein PHAVU_001G098100g [Phaseolus vulgaris]
 gb|ESW33782.1| hypothetical protein PHAVU_001G098100g [Phaseolus vulgaris]
Length=403

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 121/132 (92%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  272  NIVPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  330

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            ++++  LKG+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  331  ESAEKELKGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQR  390

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+KW
Sbjct  391  VVDLADIVANKW  402



>emb|CDY28536.1| BnaC02g36240D [Brassica napus]
Length=380

 Score =   190 bits (482),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 120/132 (91%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE++NAAFR
Sbjct  249  NIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEINAAFR  307

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
             +++  LKG+L+VCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  308  DSAEKELKGILEVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQR  367

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+ W
Sbjct  368  VVDLADIVANNW  379



>gb|ACU21011.1| unknown [Glycine max]
Length=403

 Score =   190 bits (483),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 120/132 (91%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  272  NIVPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  330

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            +++D  LKG+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  331  ESADNELKGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQR  390

Query  230  VVDLAHLVASKW  195
             VDLA +VA+KW
Sbjct  391  AVDLADIVANKW  402



>pdb|3K2B|A Chain A, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|B Chain B, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|C Chain C, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|D Chain D, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|E Chain E, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|F Chain F, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|G Chain G, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|H Chain H, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|O Chain O, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|Q Chain Q, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3QV1|A Chain A, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|B Chain B, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|C Chain C, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|D Chain D, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|E Chain E, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|F Chain F, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|A Chain A, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|B Chain B, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|C Chain C, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|D Chain D, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|E Chain E, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|F Chain F, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|G Chain G, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|H Chain H, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|O Chain O, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|Q Chain Q, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
Length=337

 Score =   188 bits (478),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 119/132 (90%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  206  NIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  264

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
             +++  LKG+LDVCD PLVSVDFRCSD S+TIDSSLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  265  DSAEKELKGILDVCDEPLVSVDFRCSDFSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQR  324

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+ W
Sbjct  325  VVDLADIVANNW  336



>dbj|BAH57068.1| AT1G12900 [Arabidopsis thaliana]
Length=350

 Score =   189 bits (479),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 119/132 (90%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  219  NIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  277

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
             A++  LKG+LDVCD PLVSVDFRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  278  DAAEKELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQR  337

Query  230  VVDLAHLVASKW  195
             VDLA +VA+ W
Sbjct  338  DVDLADIVANNW  349



>ref|XP_007510189.1| glyceraldehyde-3-phosphate dehydrogenase [Bathycoccus prasinos]
 emb|CCO18534.1| glyceraldehyde-3-phosphate dehydrogenase [Bathycoccus prasinos]
Length=379

 Score =   189 bits (481),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 105/132 (80%), Positives = 120/132 (91%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP+LKGKLNGIALRVPTPNVSVVDLV+   KK +TAE+VN AFR
Sbjct  248  NIVPTSTGAAKAVALVLPELKGKLNGIALRVPTPNVSVVDLVIQTSKK-VTAEEVNNAFR  306

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            +++ GPLKG+L VCD PLVSVDFRC+D S+TIDS+LTMV+GDDM+KVVAWYDNEWGYSQR
Sbjct  307  ESAAGPLKGILSVCDEPLVSVDFRCTDQSTTIDSALTMVIGDDMLKVVAWYDNEWGYSQR  366

Query  230  VVDLAHLVASKW  195
            VVDLA L A+ W
Sbjct  367  VVDLAELTAANW  378



>gb|AAD10209.1| glyceraldehyde 3-phosphate dehydrogenase A subunit [Arabidopsis 
thaliana]
Length=350

 Score =   189 bits (479),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 119/132 (90%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  219  NIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  277

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
             +++  LKG+LDVCD PLVSVDFRCSD S+TIDSSLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  278  DSAEKELKGILDVCDEPLVSVDFRCSDFSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQR  337

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+ W
Sbjct  338  VVDLADIVANNW  349



>ref|XP_009362873.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
isoform X3 [Pyrus x bretschneideri]
Length=408

 Score =   190 bits (483),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 108/117 (92%), Positives = 114/117 (97%), Gaps = 0/117 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV KKG++AEDVNAAFR
Sbjct  291  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVAKKGISAEDVNAAFR  350

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGY  240
            KA+DGPLKG+L VCD PLVSVDFRC+DVSSTIDSSLTMVMGDDMVKVVAWYDNEWGY
Sbjct  351  KAADGPLKGILAVCDVPLVSVDFRCTDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGY  407



>ref|XP_010514317.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X1 [Camelina sativa]
 ref|XP_010514318.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X2 [Camelina sativa]
 ref|XP_010514319.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X3 [Camelina sativa]
Length=400

 Score =   190 bits (482),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 120/132 (91%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  269  NIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  327

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
             +++  LKG+L+VCD PLVSVDFRCSD S+TIDSSLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  328  DSAEKELKGILEVCDEPLVSVDFRCSDYSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQR  387

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+KW
Sbjct  388  VVDLADIVANKW  399



>ref|NP_566796.2| glyceraldehyde-3-phosphate dehydrogenase A subunit [Arabidopsis 
thaliana]
 sp|P25856.3|G3PA1_ARATH RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase GAPA1, 
chloroplastic; AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase A subunit 1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAL16200.1|AF428431_1 AT3g26650/MLJ15_5 [Arabidopsis thaliana]
 dbj|BAB01730.1| glyceralehyde-3-phosphate dehydrogenase subunit [Arabidopsis 
thaliana]
 gb|AAL24215.1| AT3g26650/MLJ15_5 [Arabidopsis thaliana]
 gb|AAL25556.1| AT3g26650/MLJ15_5 [Arabidopsis thaliana]
 gb|AAL91645.1| AT3g26650/MLJ15_5 [Arabidopsis thaliana]
 gb|AAM98317.1| At3g26650/MLJ15_5 [Arabidopsis thaliana]
 gb|AEE77191.1| glyceraldehyde-3-phosphate dehydrogenase A subunit [Arabidopsis 
thaliana]
Length=396

 Score =   189 bits (481),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 119/132 (90%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  265  NIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  323

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
             +++  LKG+LDVCD PLVSVDFRCSD S+TIDSSLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  324  DSAEKELKGILDVCDEPLVSVDFRCSDFSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQR  383

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+ W
Sbjct  384  VVDLADIVANNW  395



>ref|XP_002955293.1| hypothetical protein VOLCADRAFT_76662 [Volvox carteri f. nagariensis]
 gb|EFJ43593.1| hypothetical protein VOLCADRAFT_76662 [Volvox carteri f. nagariensis]
Length=374

 Score =   189 bits (480),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 107/132 (81%), Positives = 120/132 (91%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPT+TGAAKAV+LVLPQLKGKLNGIALRVPTP VSVVDLVV V+KK   AE+VNAAFR
Sbjct  242  NIVPTTTGAAKAVALVLPQLKGKLNGIALRVPTPTVSVVDLVVQVEKKTF-AEEVNAAFR  300

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            +A+ GP+KGVL V DAPLVS+DF+C+D S++IDSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  301  EAAAGPMKGVLHVEDAPLVSIDFKCTDQSTSIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  360

Query  230  VVDLAHLVASKW  195
            VVDLA + A KW
Sbjct  361  VVDLAEVTAQKW  372



>dbj|BAG68209.1| glyceraldehyde-3-phosphate dehydrogenase [Brassica rapa subsp. 
chinensis]
Length=328

 Score =   187 bits (476),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 118/132 (89%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  197  NIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  255

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
             A+   LKG+LDVCD PLVSV FRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  256  GAAANELKGILDVCDEPLVSVGFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQR  315

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+ W
Sbjct  316  VVDLADIVANNW  327



>gb|AAA32793.1| glyceraldehyde 3-phosphate dehydrogenase [Arabidopsis thaliana]
 emb|CAA66816.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
Length=396

 Score =   189 bits (481),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 119/132 (90%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  265  NIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  323

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
             +++  LKG+LDVCD PLVSVDFRCSD S+TIDSSLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  324  DSAEKELKGILDVCDEPLVSVDFRCSDFSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQR  383

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+ W
Sbjct  384  VVDLADIVANNW  395



>ref|XP_010250427.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Nelumbo nucifera]
Length=402

 Score =   189 bits (481),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 120/132 (91%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  271  NIVPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  329

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            +++D  LKG+L VCD PLVSVDFRCSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  330  ESADKELKGILSVCDEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQR  389

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+ W
Sbjct  390  VVDLADIVANNW  401



>gb|KDP41897.1| hypothetical protein JCGZ_26915 [Jatropha curcas]
Length=411

 Score =   189 bits (481),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 120/132 (91%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  280  NIVPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  338

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            +++D  LKG+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  339  ESADKELKGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQR  398

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+ W
Sbjct  399  VVDLADIVANNW  410



>gb|KHG29734.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Gossypium 
arboreum]
Length=360

 Score =   188 bits (478),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 120/132 (91%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  229  NIVPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  287

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            ++++  LKG+L VCD PLVSVDFRCSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  288  ESAEKELKGILSVCDEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQR  347

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+ W
Sbjct  348  VVDLADIVANNW  359



>ref|XP_002875330.1| gapa [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51589.1| gapa [Arabidopsis lyrata subsp. lyrata]
Length=396

 Score =   189 bits (480),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 119/132 (90%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  265  NIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  323

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
             +++  LKG+LDVCD PLVSVDFRCSD S+TIDSSLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  324  DSAEKELKGILDVCDEPLVSVDFRCSDYSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQR  383

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+ W
Sbjct  384  VVDLADIVANNW  395



>gb|AHZ58488.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Syntrichia 
caninervis]
Length=377

 Score =   189 bits (479),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 111/133 (83%), Positives = 121/133 (91%), Gaps = 2/133 (2%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP+LKGK+NGIALRVPTPNVSVVDLVV V+KK   AE+VN AFR
Sbjct  245  NIVPTSTGAAKAVALVLPRLKGKINGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNQAFR  303

Query  410  KASDGP-LKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQ  234
             A + P LKG+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQ
Sbjct  304  DACETPQLKGILAVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQ  363

Query  233  RVVDLAHLVASKW  195
            RVVDLA+LVA KW
Sbjct  364  RVVDLANLVAEKW  376



>gb|AHA84230.1| glyceraldehyde-3-phosphate dehydrogenase A [Phaseolus vulgaris]
Length=402

 Score =   189 bits (480),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 120/132 (91%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  271  NIVPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  329

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            ++++  LKG+L VCD P VSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  330  ESAEKELKGILSVCDEPFVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQR  389

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+KW
Sbjct  390  VVDLADIVANKW  401



>ref|XP_004231523.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Solanum lycopersicum]
Length=409

 Score =   189 bits (481),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 121/132 (92%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  278  NIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  336

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            +++D  L G+L VCD PLVSVDFRCSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  337  ESADNELAGILSVCDEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQR  396

Query  230  VVDLAHLVASKW  195
            VVDLA++VA++W
Sbjct  397  VVDLANIVANQW  408



>dbj|BAJ10475.1| glyceraldehyde-3-phosphate dehydrogenase [Brassica rapa subsp. 
chinensis]
Length=399

 Score =   189 bits (479),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 118/132 (89%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  268  NIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  326

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
             A+   LKG+LDVCD PLVSV FRCSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  327  GAAANELKGILDVCDEPLVSVGFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQR  386

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+ W
Sbjct  387  VVDLADIVANNW  398



>ref|XP_001689871.1| glyceraldehyde-3-phosphate dehydrogenase [Chlamydomonas reinhardtii]
 sp|P50362.1|G3PA_CHLRE RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor [Chlamydomonas 
reinhardtii]
 gb|AAA86855.1| glyceraldehyde-3-phosphate dehydrogenase [Chlamydomonas reinhardtii]
 gb|EDP09609.1| glyceraldehyde-3-phosphate dehydrogenase [Chlamydomonas reinhardtii]
Length=374

 Score =   188 bits (478),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 106/132 (80%), Positives = 120/132 (91%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPT+TGAAKAVSLVLP LKGKLNGIALRVPTP VSVVDLVV V+KK   AE+VNAAFR
Sbjct  242  NIVPTTTGAAKAVSLVLPSLKGKLNGIALRVPTPTVSVVDLVVQVEKKTF-AEEVNAAFR  300

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            +A++GP+KGVL V DAPLVS+DF+C+D S++ID+SLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  301  EAANGPMKGVLHVEDAPLVSIDFKCTDQSTSIDASLTMVMGDDMVKVVAWYDNEWGYSQR  360

Query  230  VVDLAHLVASKW  195
            VVDLA + A KW
Sbjct  361  VVDLAEVTAKKW  372



>dbj|BAA94304.1| NADP-glyceraldehyde-3-phosphate dehydrogenase [Chlamydomonas 
sp. W80]
Length=369

 Score =   188 bits (477),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 119/132 (90%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP +KGKLNGIALRVPTPNVS+VDLVV V+KK   AE+VNAAFR
Sbjct  238  NIVPTSTGAAKAVALVLPSMKGKLNGIALRVPTPNVSIVDLVVQVEKKTF-AEEVNAAFR  296

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            +A++G  KGVL V D PLVSVDFRCSDVSSTID+SLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  297  EAANGAQKGVLAVSDEPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVVAWYDNEWGYSQR  356

Query  230  VVDLAHLVASKW  195
            VVDLA + A KW
Sbjct  357  VVDLAEITAQKW  368



>dbj|BAJ90885.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK08149.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=401

 Score =   189 bits (479),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 120/132 (91%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK L AE+VN AFR
Sbjct  270  NIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL-AEEVNQAFR  328

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
             A+   LKG+LDVCD PLVSVDFRCSDVSSTID+SL+MVMGDDMVKV+AWYDNEWGYSQR
Sbjct  329  DAAANELKGILDVCDEPLVSVDFRCSDVSSTIDASLSMVMGDDMVKVIAWYDNEWGYSQR  388

Query  230  VVDLAHLVASKW  195
            VVDLA +VA++W
Sbjct  389  VVDLADIVANQW  400



>dbj|BAJ90530.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=401

 Score =   189 bits (479),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 120/132 (91%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK L AE+VN AFR
Sbjct  270  NIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL-AEEVNQAFR  328

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
             A+   LKG+LDVCD PLVSVDFRCSDVSSTID+SL+MVMGDDMVKV+AWYDNEWGYSQR
Sbjct  329  DAAANELKGILDVCDEPLVSVDFRCSDVSSTIDASLSMVMGDDMVKVIAWYDNEWGYSQR  388

Query  230  VVDLAHLVASKW  195
            VVDLA +VA++W
Sbjct  389  VVDLADIVANQW  400



>gb|AAG23800.1| chloroplast NADP-dependent glyceraldehyde 3-phosphate dehydrogenase 
B subunit [Cucurbita pepo]
Length=171

 Score =   182 bits (461),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 104/116 (90%), Positives = 114/116 (98%), Gaps = 0/116 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVN++KKG++A+DVNAAFR
Sbjct  56   NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKKGISADDVNAAFR  115

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWG  243
            KA+DGPLKGVL VCD PLVSVDF+C+DVSSTIDSSLTMVMGDDM+KVVAWYDN+WG
Sbjct  116  KAADGPLKGVLAVCDIPLVSVDFKCTDVSSTIDSSLTMVMGDDMLKVVAWYDNDWG  171



>gb|EMT31124.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Aegilops 
tauschii]
Length=402

 Score =   189 bits (479),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 120/132 (91%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK L AE+VN AFR
Sbjct  271  NIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL-AEEVNQAFR  329

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
             A+   LKG+LDVCD PLVSVDFRCSDVSSTID+SL+MVMGDDMVKV+AWYDNEWGYSQR
Sbjct  330  DAAANELKGILDVCDEPLVSVDFRCSDVSSTIDASLSMVMGDDMVKVIAWYDNEWGYSQR  389

Query  230  VVDLAHLVASKW  195
            VVDLA +VA++W
Sbjct  390  VVDLADIVANQW  401



>ref|XP_006291258.1| hypothetical protein CARUB_v10017390mg [Capsella rubella]
 gb|EOA24156.1| hypothetical protein CARUB_v10017390mg [Capsella rubella]
Length=400

 Score =   188 bits (478),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 119/132 (90%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  269  NIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  327

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
             +++  LKG+L+VCD PLVSVDFRCSD S+TIDSSLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  328  DSAEKELKGILEVCDEPLVSVDFRCSDFSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQR  387

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+ W
Sbjct  388  VVDLADIVANNW  399



>ref|XP_006652373.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
isoform X2 [Oryza brachyantha]
Length=401

 Score =   188 bits (477),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 121/132 (92%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK L AE+VNAAFR
Sbjct  270  NIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL-AEEVNAAFR  328

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
             ++   L+G+L+VCD PLVSVDFRCSDVSSTID+SLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  329  DSAANELQGILEVCDVPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVIAWYDNEWGYSQR  388

Query  230  VVDLAHLVASKW  195
            VVDLA +VA++W
Sbjct  389  VVDLADIVANQW  400



>ref|XP_006652372.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
isoform X1 [Oryza brachyantha]
Length=403

 Score =   188 bits (477),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 121/132 (92%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK L AE+VNAAFR
Sbjct  272  NIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL-AEEVNAAFR  330

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
             ++   L+G+L+VCD PLVSVDFRCSDVSSTID+SLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  331  DSAANELQGILEVCDVPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVIAWYDNEWGYSQR  390

Query  230  VVDLAHLVASKW  195
            VVDLA +VA++W
Sbjct  391  VVDLADIVANQW  402



>gb|ABA01125.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase, partial 
[Chlamydomonas incerta]
Length=369

 Score =   187 bits (475),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 105/132 (80%), Positives = 120/132 (91%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPT+TGAAKAV+LVLP LKGKLNGIALRVPTP VSVVDLVV V+KK   AE+VNAAFR
Sbjct  237  NIVPTTTGAAKAVALVLPSLKGKLNGIALRVPTPTVSVVDLVVQVEKKTF-AEEVNAAFR  295

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            +A++GP+KGVL V DAPLVS+DF+C+D S++ID+SLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  296  EAANGPMKGVLHVEDAPLVSIDFKCTDQSTSIDASLTMVMGDDMVKVVAWYDNEWGYSQR  355

Query  230  VVDLAHLVASKW  195
            VVDLA + A KW
Sbjct  356  VVDLAEITAKKW  367



>gb|KJB11771.1| hypothetical protein B456_001G276400 [Gossypium raimondii]
Length=403

 Score =   188 bits (477),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 120/132 (91%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  272  NIVPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  330

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            ++++  LKG+L VCD PLVSVDFRCSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  331  ESAEKELKGILSVCDEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQR  390

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+ W
Sbjct  391  VVDLADIVANNW  402



>ref|XP_001771209.1| predicted protein [Physcomitrella patens]
 gb|EDQ63920.1| predicted protein [Physcomitrella patens]
Length=399

 Score =   187 bits (476),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 111/133 (83%), Positives = 119/133 (89%), Gaps = 2/133 (2%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGK+NGIALRVPTPNVSVVDLVV V+KK   AE+VN AFR
Sbjct  267  NIVPTSTGAAKAVALVLPNLKGKINGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNQAFR  325

Query  410  KA-SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQ  234
             A +   LKGVL VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQ
Sbjct  326  DACATEELKGVLAVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQ  385

Query  233  RVVDLAHLVASKW  195
            RVVDLAH+VA KW
Sbjct  386  RVVDLAHIVAEKW  398



>gb|KJB70724.1| hypothetical protein B456_011G088800 [Gossypium raimondii]
Length=303

 Score =   185 bits (469),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 105/132 (80%), Positives = 120/132 (91%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAF+
Sbjct  172  NIVPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFK  230

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            ++++  L+G+L VC+ PLVSVDFRCSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  231  ESAEKELQGILSVCEEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQR  290

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+ W
Sbjct  291  VVDLADIVANSW  302



>gb|ABG85189.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase subunit 
A [Ostreococcus tauri]
 emb|CEF99493.1| Glyceraldehyde 3-phosphate dehydrogenase, NAD(P) binding domain 
[Ostreococcus tauri]
Length=380

 Score =   187 bits (474),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 106/132 (80%), Positives = 119/132 (90%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVSVVDLVV   KK  TA++VNAAFR
Sbjct  249  NIVPTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVVQTSKK-CTADEVNAAFR  307

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            +A++GPLKG+L V D PLVS DFRC+DVS TID++LTMVMGDDM+KVV+WYDNEWGYSQR
Sbjct  308  EAANGPLKGILAVADEPLVSCDFRCTDVSCTIDAALTMVMGDDMLKVVSWYDNEWGYSQR  367

Query  230  VVDLAHLVASKW  195
            VVDLA L A+ W
Sbjct  368  VVDLAELCAANW  379



>ref|XP_003081785.1| NADP-glyceraldehyde-3-phosphate dehydrogenase (IC), partial [Ostreococcus 
tauri]
Length=378

 Score =   187 bits (474),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 106/132 (80%), Positives = 119/132 (90%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLPQLKGKLNGIALRVPTPNVSVVDLVV   KK  TA++VNAAFR
Sbjct  247  NIVPTSTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVVQTSKK-CTADEVNAAFR  305

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            +A++GPLKG+L V D PLVS DFRC+DVS TID++LTMVMGDDM+KVV+WYDNEWGYSQR
Sbjct  306  EAANGPLKGILAVADEPLVSCDFRCTDVSCTIDAALTMVMGDDMLKVVSWYDNEWGYSQR  365

Query  230  VVDLAHLVASKW  195
            VVDLA L A+ W
Sbjct  366  VVDLAELCAANW  377



>ref|XP_001771246.1| predicted protein [Physcomitrella patens]
 gb|EDQ63957.1| predicted protein [Physcomitrella patens]
Length=406

 Score =   187 bits (476),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 111/133 (83%), Positives = 119/133 (89%), Gaps = 2/133 (2%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGK+NGIALRVPTPNVSVVDLVV V+KK   AE+VN AFR
Sbjct  274  NIVPTSTGAAKAVALVLPNLKGKINGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNQAFR  332

Query  410  KA-SDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQ  234
             A +   LKGVL VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQ
Sbjct  333  DACATEELKGVLAVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQ  392

Query  233  RVVDLAHLVASKW  195
            RVVDLAH+VA KW
Sbjct  393  RVVDLAHIVAEKW  405



>ref|XP_004304578.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=404

 Score =   187 bits (475),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 119/132 (90%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  273  NIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFR  331

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            +++D  L G+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  332  ESADKELAGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQR  391

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+ W
Sbjct  392  VVDLADIVANNW  403



>emb|CDY48981.1| BnaA02g28150D [Brassica napus]
Length=368

 Score =   186 bits (472),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 118/132 (89%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGK NGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  237  NIVPTSTGAAKAVALVLPNLKGKHNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFR  295

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
             +++  LKG+L VCD PLVSVDF+CSDVSSTIDSSLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  296  NSAEKELKGILKVCDEPLVSVDFKCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQR  355

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+ W
Sbjct  356  VVDLADIVANNW  367



>gb|AEH04452.1| glyceraldehyde-3-phosphate dehydrogenase [Arachis hypogaea]
Length=405

 Score =   186 bits (473),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 107/132 (81%), Positives = 119/132 (90%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  274  NIVPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  332

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            ++++  L G+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  333  ESAEKELNGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQR  392

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+ W
Sbjct  393  VVDLADIVANSW  404



>gb|AFC88822.1| glyceraldehyde-3-phosphate dehydrogenase-like protein, partial 
[Miscanthus sinensis]
Length=316

 Score =   184 bits (467),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 117/132 (89%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLP LKGKLNGIALRVPTPNVSVVDLVV V KK L AE+VN AFR
Sbjct  185  NIVPTSTGAAKAVSLVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL-AEEVNQAFR  243

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
             A+   L G+L+VCD PLVSVDFRCSDVSSTID+SLTMVMGDDMVKV++WYDNEWGYSQR
Sbjct  244  DAAANELIGILEVCDVPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVISWYDNEWGYSQR  303

Query  230  VVDLAHLVASKW  195
            VVDLA + A KW
Sbjct  304  VVDLADICAIKW  315



>ref|XP_008797069.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Phoenix dactylifera]
 ref|XP_008797070.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Phoenix dactylifera]
Length=445

 Score =   187 bits (475),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 118/132 (89%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  314  NIVPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  372

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
              ++  LKG+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  373  DTAEKELKGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQR  432

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+ W
Sbjct  433  VVDLADIVANNW  444



>gb|ACX37507.1| chloroplast glyceraldehyde 3-phosphate dehydrogenase [Botryococcus 
braunii]
Length=411

 Score =   186 bits (473),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 107/132 (81%), Positives = 118/132 (89%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPT+TGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLV+ V+KK   AE+VN AFR
Sbjct  280  NIVPTTTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVIQVEKKTF-AEEVNEAFR  338

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            +A++GP+KG+L V D PLVS DF CSD SSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  339  EAANGPMKGILVVSDEPLVSKDFACSDQSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  398

Query  230  VVDLAHLVASKW  195
            VVDLA +VA KW
Sbjct  399  VVDLAEIVAKKW  410



>ref|XP_001779769.1| predicted protein [Physcomitrella patens]
 gb|EDQ55453.1| predicted protein [Physcomitrella patens]
Length=400

 Score =   186 bits (472),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 111/133 (83%), Positives = 119/133 (89%), Gaps = 2/133 (2%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGK+NGIALRVPTPNVSVVDLVV V+KK   AE+VN AFR
Sbjct  268  NIVPTSTGAAKAVALVLPNLKGKINGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNQAFR  326

Query  410  KASDGP-LKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQ  234
             A +   LKGVL VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQ
Sbjct  327  DACETEQLKGVLAVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQ  386

Query  233  RVVDLAHLVASKW  195
            RVVDLA+LVA KW
Sbjct  387  RVVDLANLVAEKW  399



>ref|XP_001779753.1| predicted protein [Physcomitrella patens]
 gb|EDQ55437.1| predicted protein [Physcomitrella patens]
Length=406

 Score =   186 bits (472),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 111/133 (83%), Positives = 119/133 (89%), Gaps = 2/133 (2%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGK+NGIALRVPTPNVSVVDLVV V+KK   AE+VN AFR
Sbjct  274  NIVPTSTGAAKAVALVLPNLKGKINGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNQAFR  332

Query  410  KASDGP-LKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQ  234
             A +   LKGVL VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQ
Sbjct  333  DACETEQLKGVLAVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQ  392

Query  233  RVVDLAHLVASKW  195
            RVVDLA+LVA KW
Sbjct  393  RVVDLANLVAEKW  405



>emb|CAC80374.1| glyceraldehyde-3-phosphate dehydrogenase [Capsicum annuum]
Length=317

 Score =   184 bits (466),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 104/115 (90%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLV+NV+KKG+TAEDVNAAFR
Sbjct  202  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGITAEDVNAAFR  261

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEW  246
            K++DGPL G+L VCD PLVSVDFRCSDVS+TIDSSLTMVMGDDMVK+VAWYDNEW
Sbjct  262  KSADGPLNGILAVCDVPLVSVDFRCSDVSTTIDSSLTMVMGDDMVKIVAWYDNEW  316



>ref|XP_004975847.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Setaria italica]
Length=401

 Score =   186 bits (471),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 119/132 (90%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK L AE+VN AFR
Sbjct  270  NIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL-AEEVNQAFR  328

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
             ++   L G+L+VCDAPLVSVDFRCSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  329  DSAANELAGILEVCDAPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQR  388

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+ W
Sbjct  389  VVDLADIVANNW  400



>gb|ABD37966.1| glyceraldehyde-3-phosphate dehydrogenase subunit B [Spirogyra 
sp. SAG 170.80]
Length=321

 Score =   184 bits (466),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 103/117 (88%), Positives = 112/117 (96%), Gaps = 0/117 (0%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLV+N +KKG+TAE+VNAAFR
Sbjct  205  NIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVINTEKKGMTAEEVNAAFR  264

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGY  240
            KA+DGP+KG+L VCD PLVS+DFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNE GY
Sbjct  265  KAADGPMKGILGVCDLPLVSIDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNELGY  321



>gb|ACT21568.1| glyceraldehyde-3-phosphate dehydrogenase [Bruguiera gymnorhiza]
Length=405

 Score =   186 bits (471),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 107/132 (81%), Positives = 117/132 (89%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAK V+LVLP L+GKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  274  NIVPTSTGAAKPVALVLPTLRGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  332

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            +++D  LKG+L VCD PLVSVDFRC DVSST+DSSLTMVMGDDMVKV+AWYDNEWGY QR
Sbjct  333  ESADKELKGILSVCDEPLVSVDFRCRDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYFQR  392

Query  230  VVDLAHLVASKW  195
            VVDLA +VA KW
Sbjct  393  VVDLADVVAEKW  404



>gb|ABD37962.1| glyceraldehyde-3-phosphate dehydrogenase subunit A1, partial 
[Physcomitrella patens]
Length=378

 Score =   185 bits (469),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 111/133 (83%), Positives = 118/133 (89%), Gaps = 2/133 (2%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGK+NGIALRVPTPNVSVVDLVV V+KK   AE+VN AFR
Sbjct  246  NIVPTSTGAAKAVALVLPNLKGKINGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNQAFR  304

Query  410  KASDGP-LKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQ  234
             A     LKGVL VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQ
Sbjct  305  DACQTEQLKGVLAVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQ  364

Query  233  RVVDLAHLVASKW  195
            RVVDLA+LVA KW
Sbjct  365  RVVDLANLVAEKW  377



>ref|XP_010090946.1| Glyceraldehyde-3-phosphate dehydrogenase A [Morus notabilis]
 gb|EXB41431.1| Glyceraldehyde-3-phosphate dehydrogenase A [Morus notabilis]
Length=404

 Score =   185 bits (470),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 106/132 (80%), Positives = 119/132 (90%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  273  NIVPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  331

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            ++++  L G+L VCD PLVSVDFRC+DVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  332  ESAEKELNGILSVCDEPLVSVDFRCTDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQR  391

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+ W
Sbjct  392  VVDLADIVANNW  403



>gb|ABD37957.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Cladophora 
rupestris]
Length=376

 Score =   185 bits (469),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 119/132 (90%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPT+TGAAKAV+LVLPQLKGKLNGIALRVPTPNVSVVDLVV V+KK L AE+VN AFR
Sbjct  245  NIVPTTTGAAKAVALVLPQLKGKLNGIALRVPTPNVSVVDLVVQVEKKTL-AEEVNQAFR  303

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
             A+ GPLKGVL V D PLVS+DF+ SDVS+TIDS+LTMVMGDDMVKVVAWYDNEWGYSQR
Sbjct  304  DAAAGPLKGVLGVADIPLVSMDFKKSDVSTTIDSALTMVMGDDMVKVVAWYDNEWGYSQR  363

Query  230  VVDLAHLVASKW  195
            V+DLA L A KW
Sbjct  364  VLDLAELCAEKW  375



>tpg|DAA37469.1| TPA: glyceraldehyde-3-phosphate dehydrogenase1 [Zea mays]
Length=403

 Score =   185 bits (470),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 118/132 (89%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLP LKGKLNGIALRVPTPNVSVVDLVV V KK L AE+VN AFR
Sbjct  272  NIVPTSTGAAKAVSLVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL-AEEVNQAFR  330

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
             A+   L G+L+VCD PLVSVDFRCSDVSSTID+SLTMVMGDDMVKV++WYDNEWGYSQR
Sbjct  331  DAAANELTGILEVCDVPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVISWYDNEWGYSQR  390

Query  230  VVDLAHLVASKW  195
            VVDLA + A++W
Sbjct  391  VVDLADICANQW  402



>ref|NP_001105414.1| glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic precursor 
[Zea mays]
 sp|P09315.1|G3PA_MAIZE RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor [Zea mays]
 gb|AAA33464.1| glyceraldehyde-3-phosphate dehydrogenase [Zea mays]
 emb|CAA33455.1| glyceraldehyde-3-phosphate dehydrogenase [Zea mays]
Length=403

 Score =   185 bits (470),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 118/132 (89%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLP LKGKLNGIALRVPTPNVSVVDLVV V KK L AE+VN AFR
Sbjct  272  NIVPTSTGAAKAVSLVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL-AEEVNQAFR  330

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
             A+   L G+L+VCD PLVSVDFRCSDVSSTID+SLTMVMGDDMVKV++WYDNEWGYSQR
Sbjct  331  DAAANELTGILEVCDVPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVISWYDNEWGYSQR  390

Query  230  VVDLAHLVASKW  195
            VVDLA + A++W
Sbjct  391  VVDLADICANQW  402



>ref|XP_009378072.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Pyrus x bretschneideri]
Length=355

 Score =   184 bits (466),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 107/132 (81%), Positives = 118/132 (89%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  224  NIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFR  282

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
             +++  L G+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  283  DSAEKELAGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQR  342

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+ W
Sbjct  343  VVDLADIVANNW  354



>ref|XP_001753934.1| predicted protein [Physcomitrella patens]
 gb|EDQ81256.1| predicted protein [Physcomitrella patens]
Length=406

 Score =   185 bits (470),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 111/133 (83%), Positives = 118/133 (89%), Gaps = 2/133 (2%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGK+NGIALRVPTPNVSVVDLVV V+KK   AE+VN AFR
Sbjct  274  NIVPTSTGAAKAVALVLPNLKGKINGIALRVPTPNVSVVDLVVQVEKKTF-AEEVNQAFR  332

Query  410  KASDGP-LKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQ  234
             A     LKGVL VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKVVAWYDNEWGYSQ
Sbjct  333  DACQTEQLKGVLAVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQ  392

Query  233  RVVDLAHLVASKW  195
            RVVDLA+LVA KW
Sbjct  393  RVVDLANLVAEKW  405



>ref|XP_011399143.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Auxenochlorella 
protothecoides]
 gb|KFM26247.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Auxenochlorella 
protothecoides]
Length=412

 Score =   185 bits (470),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 103/132 (78%), Positives = 118/132 (89%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPT+TGAAKAV+LVLPQLKGKLNG+ALRVPTP VSVVDLV+  +KK  T E+VN+AFR
Sbjct  281  NIVPTTTGAAKAVALVLPQLKGKLNGVALRVPTPTVSVVDLVIQTEKKTFT-EEVNSAFR  339

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            +AS+G LKG+L V D PLVS D+R +DVSSTID++LTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  340  EASEGYLKGILAVSDEPLVSCDYRMTDVSSTIDAALTMVMGDDMVKVIAWYDNEWGYSQR  399

Query  230  VVDLAHLVASKW  195
            VVDLA LVA KW
Sbjct  400  VVDLAELVAQKW  411



>emb|CAA30152.1| GADPH (383 AA) [Zea mays]
Length=383

 Score =   184 bits (468),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 118/132 (89%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAVSLVLP LKGKLNGIALRVPTPNVSVVDLVV V KK L AE+VN AFR
Sbjct  252  NIVPTSTGAAKAVSLVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTL-AEEVNQAFR  310

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
             A+   L G+L+VCD PLVSVDFRCSDVSSTID+SLTMVMGDDMVKV++WYDNEWGYSQR
Sbjct  311  DAAANELTGILEVCDVPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVISWYDNEWGYSQR  370

Query  230  VVDLAHLVASKW  195
            VVDLA + A++W
Sbjct  371  VVDLADICANQW  382



>gb|KHG21941.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Gossypium 
arboreum]
Length=363

 Score =   184 bits (466),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 105/132 (80%), Positives = 120/132 (91%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAF+
Sbjct  232  NIVPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFK  290

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
            ++++  L+G+L VC+ PLVSVDFRCSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  291  ESAEKELQGILSVCEEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQR  350

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+ W
Sbjct  351  VVDLADIVANSW  362



>gb|ABD37963.1| glyceraldehyde-3-phosphate dehydrogenase subunit A2 [Physcomitrella 
patens]
Length=323

 Score =   182 bits (463),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 110/133 (83%), Positives = 120/133 (90%), Gaps = 2/133 (2%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGK+NGIALRVPTPNVSVVDLVV V+KK  +AE+VN AFR
Sbjct  191  NIVPTSTGAAKAVALVLPNLKGKINGIALRVPTPNVSVVDLVVQVEKK-TSAEEVNQAFR  249

Query  410  KASDG-PLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQ  234
             A +   LKGVL VCD PLVSVDFRC+DVSST+DSSLTMVMG+DMVKVVAWYDNEWGYSQ
Sbjct  250  DACNTDQLKGVLAVCDEPLVSVDFRCTDVSSTVDSSLTMVMGEDMVKVVAWYDNEWGYSQ  309

Query  233  RVVDLAHLVASKW  195
            RVVDLA+LVA KW
Sbjct  310  RVVDLANLVAEKW  322



>ref|XP_007032095.1| Glyceraldehyde 3-phosphate dehydrogenase A subunit 2 [Theobroma 
cacao]
 gb|EOY03021.1| Glyceraldehyde 3-phosphate dehydrogenase A subunit 2 [Theobroma 
cacao]
Length=404

 Score =   185 bits (469),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 107/132 (81%), Positives = 118/132 (89%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  273  NIVPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTF-AEEVNAAFR  331

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
             +++  L G+L VCD PLVSVDFRCSDVSST+D+SLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  332  DSAEKELNGILSVCDEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQR  391

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+ W
Sbjct  392  VVDLADIVANNW  403



>ref|XP_008362077.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Malus domestica]
Length=403

 Score =   184 bits (468),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 107/132 (81%), Positives = 118/132 (89%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  272  NIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFR  330

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
             +++  L G+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  331  DSAEKELAGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQR  390

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+ W
Sbjct  391  VVDLADIVANNW  402



>ref|XP_009378071.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X1 [Pyrus x bretschneideri]
Length=403

 Score =   184 bits (468),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 107/132 (81%), Positives = 118/132 (89%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  272  NIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFR  330

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
             +++  L G+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  331  DSAEKELAGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQR  390

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+ W
Sbjct  391  VVDLADIVANNW  402



>ref|XP_008379036.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Malus domestica]
Length=403

 Score =   184 bits (468),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 107/132 (81%), Positives = 118/132 (89%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  272  NIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFR  330

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
             +++  L G+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  331  DSAEKELAGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQR  390

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+ W
Sbjct  391  VVDLADIVANNW  402



>ref|XP_008231212.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Prunus mume]
Length=403

 Score =   184 bits (468),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 117/132 (89%), Gaps = 1/132 (1%)
 Frame = -2

Query  590  NIVPTSTGAAKAVSLVLPQLKGKLNGIALRvptpnvsvvdlvvnVQKKGLTAEDVNAAFR  411
            NIVPTSTGAAKAV+LVLP LKGKLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR
Sbjct  272  NIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTF-AEEVNAAFR  330

Query  410  KASDGPLKGVLDVCDAPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQR  231
             +S   L G+L VCD PLVSVDFRC+DVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQR
Sbjct  331  DSSAKELAGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDMVKVIAWYDNEWGYSQR  390

Query  230  VVDLAHLVASKW  195
            VVDLA +VA+ W
Sbjct  391  VVDLADIVANNW  402



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1014965446875