BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF008L16

Length=752
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_007023396.1|  Golgi organization, COG2 isoform 1                 160   3e-41   
gb|EYU23123.1|  hypothetical protein MIMGU_mgv1a001829mg                159   5e-41   Erythranthe guttata [common monkey flower]
ref|XP_011083848.1|  PREDICTED: conserved oligomeric Golgi comple...    158   1e-40   Sesamum indicum [beniseed]
gb|KHG07418.1|  Conserved oligomeric Golgi complex subunit 2            154   3e-39   Gossypium arboreum [tree cotton]
ref|XP_002279916.1|  PREDICTED: conserved oligomeric Golgi comple...    154   4e-39   Vitis vinifera
emb|CDP04651.1|  unnamed protein product                                154   7e-39   Coffea canephora [robusta coffee]
ref|XP_009602477.1|  PREDICTED: conserved oligomeric Golgi comple...    153   8e-39   Nicotiana tomentosiformis
gb|KJB43167.1|  hypothetical protein B456_007G187600                    152   3e-38   Gossypium raimondii
gb|KJB43171.1|  hypothetical protein B456_007G187600                    152   3e-38   Gossypium raimondii
ref|XP_006477014.1|  PREDICTED: conserved oligomeric Golgi comple...    151   5e-38   Citrus sinensis [apfelsine]
gb|KDO52633.1|  hypothetical protein CISIN_1g004390mg                   148   6e-38   Citrus sinensis [apfelsine]
ref|XP_010536632.1|  PREDICTED: conserved oligomeric Golgi comple...    151   6e-38   Tarenaya hassleriana [spider flower]
gb|EYU23122.1|  hypothetical protein MIMGU_mgv1a024704mg                150   7e-38   Erythranthe guttata [common monkey flower]
ref|XP_004170101.1|  PREDICTED: conserved oligomeric Golgi comple...    143   8e-38   
ref|XP_007155537.1|  hypothetical protein PHAVU_003G210200g             150   1e-37   Phaseolus vulgaris [French bean]
ref|XP_008239451.1|  PREDICTED: conserved oligomeric Golgi comple...    124   1e-37   Prunus mume [ume]
gb|KHN34411.1|  Conserved oligomeric Golgi complex subunit 2            150   1e-37   Glycine soja [wild soybean]
ref|XP_004244508.1|  PREDICTED: conserved oligomeric Golgi comple...    149   2e-37   Solanum lycopersicum
ref|XP_003525701.1|  PREDICTED: conserved oligomeric Golgi comple...    149   2e-37   Glycine max [soybeans]
gb|KDO52632.1|  hypothetical protein CISIN_1g004390mg                   148   2e-37   Citrus sinensis [apfelsine]
gb|KDO52631.1|  hypothetical protein CISIN_1g004390mg                   148   2e-37   Citrus sinensis [apfelsine]
ref|XP_009769044.1|  PREDICTED: conserved oligomeric Golgi comple...    149   3e-37   Nicotiana sylvestris
ref|XP_010250762.1|  PREDICTED: conserved oligomeric Golgi comple...    148   6e-37   Nelumbo nucifera [Indian lotus]
ref|XP_006440092.1|  hypothetical protein CICLE_v10018979mg             148   7e-37   Citrus clementina [clementine]
gb|KDO52630.1|  hypothetical protein CISIN_1g004390mg                   148   8e-37   Citrus sinensis [apfelsine]
ref|XP_006357074.1|  PREDICTED: conserved oligomeric Golgi comple...    147   8e-37   Solanum tuberosum [potatoes]
gb|KHN14099.1|  Conserved oligomeric Golgi complex subunit 2            146   2e-36   Glycine soja [wild soybean]
emb|CAN71854.1|  hypothetical protein VITISV_007347                     146   4e-36   Vitis vinifera
ref|XP_003549849.1|  PREDICTED: conserved oligomeric Golgi comple...    146   4e-36   Glycine max [soybeans]
ref|XP_004515820.1|  PREDICTED: conserved oligomeric Golgi comple...    145   4e-36   Cicer arietinum [garbanzo]
ref|XP_010105239.1|  Conserved oligomeric Golgi complex subunit 2       136   5e-36   
ref|XP_010026586.1|  PREDICTED: conserved oligomeric Golgi comple...    144   1e-35   Eucalyptus grandis [rose gum]
ref|XP_010026579.1|  PREDICTED: conserved oligomeric Golgi comple...    144   2e-35   Eucalyptus grandis [rose gum]
ref|XP_008463108.1|  PREDICTED: conserved oligomeric Golgi comple...    143   4e-35   
ref|XP_004138387.1|  PREDICTED: conserved oligomeric Golgi comple...    143   4e-35   Cucumis sativus [cucumbers]
gb|EPS73270.1|  hypothetical protein M569_01480                         127   7e-35   Genlisea aurea
gb|KDO52629.1|  hypothetical protein CISIN_1g004390mg                   141   2e-34   Citrus sinensis [apfelsine]
ref|XP_006848427.1|  hypothetical protein AMTR_s00013p00234340          139   9e-34   
ref|XP_009359449.1|  PREDICTED: conserved oligomeric Golgi comple...    139   1e-33   Pyrus x bretschneideri [bai li]
ref|XP_002511204.1|  Conserved oligomeric Golgi complex component...    139   2e-33   Ricinus communis
ref|XP_009346519.1|  PREDICTED: conserved oligomeric Golgi comple...    136   3e-33   Pyrus x bretschneideri [bai li]
ref|XP_009375225.1|  PREDICTED: conserved oligomeric Golgi comple...    136   1e-32   Pyrus x bretschneideri [bai li]
ref|XP_008374256.1|  PREDICTED: conserved oligomeric Golgi comple...    136   1e-32   Malus domestica [apple tree]
ref|XP_010927713.1|  PREDICTED: conserved oligomeric Golgi comple...    136   1e-32   Elaeis guineensis
ref|XP_010448510.1|  PREDICTED: conserved oligomeric Golgi comple...    135   2e-32   Camelina sativa [gold-of-pleasure]
ref|XP_010926719.1|  PREDICTED: conserved oligomeric Golgi comple...    135   3e-32   Elaeis guineensis
ref|XP_004297537.1|  PREDICTED: conserved oligomeric Golgi comple...    134   7e-32   Fragaria vesca subsp. vesca
ref|XP_010433717.1|  PREDICTED: conserved oligomeric Golgi comple...    134   7e-32   Camelina sativa [gold-of-pleasure]
ref|XP_010438959.1|  PREDICTED: conserved oligomeric Golgi comple...    134   9e-32   Camelina sativa [gold-of-pleasure]
ref|XP_006283181.1|  hypothetical protein CARUB_v10004211mg             132   2e-31   Capsella rubella
emb|CAB41124.1|  brefeldin A-sensitive Golgi protein-like               132   3e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003603203.1|  Conserved oligomeric Golgi complex subunit         102   4e-31   
gb|KDP30933.1|  hypothetical protein JCGZ_11309                         131   8e-31   Jatropha curcas
ref|XP_008351743.1|  PREDICTED: conserved oligomeric Golgi comple...    131   8e-31   
ref|XP_008392829.1|  PREDICTED: conserved oligomeric Golgi comple...    131   8e-31   
ref|XP_002867640.1|  hypothetical protein ARALYDRAFT_492352             130   1e-30   
ref|NP_567710.1|  uncharacterized protein                               130   2e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010677897.1|  PREDICTED: conserved oligomeric Golgi comple...    129   3e-30   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003608844.1|  Conserved oligomeric Golgi complex subunit         129   4e-30   Medicago truncatula
gb|AAK32887.1|AF367300_1  AT4g24840/F6I7_50                             129   5e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009385489.1|  PREDICTED: conserved oligomeric Golgi comple...    127   2e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008794572.1|  PREDICTED: conserved oligomeric Golgi comple...    126   3e-29   Phoenix dactylifera
gb|KFK29022.1|  hypothetical protein AALP_AA7G078500                    125   9e-29   Arabis alpina [alpine rockcress]
ref|XP_007210583.1|  hypothetical protein PRUPE_ppa015080mg             124   2e-28   
ref|XP_011024042.1|  PREDICTED: conserved oligomeric Golgi comple...    122   1e-27   Populus euphratica
ref|XP_006296685.1|  hypothetical protein CARUB_v10013037mg             121   2e-27   Capsella rubella
ref|XP_006413377.1|  hypothetical protein EUTSA_v10024490mg             119   7e-27   Eutrema salsugineum [saltwater cress]
ref|XP_002322242.1|  hypothetical protein POPTR_0015s10610g             119   7e-27   Populus trichocarpa [western balsam poplar]
ref|XP_010485902.1|  PREDICTED: conserved oligomeric Golgi comple...    118   2e-26   Camelina sativa [gold-of-pleasure]
ref|XP_009385490.1|  PREDICTED: conserved oligomeric Golgi comple...    117   3e-26   
ref|XP_011044173.1|  PREDICTED: conserved oligomeric Golgi comple...    116   8e-26   Populus euphratica
ref|XP_004981048.1|  PREDICTED: conserved oligomeric Golgi comple...    116   1e-25   Setaria italica
ref|XP_010464008.1|  PREDICTED: conserved oligomeric Golgi comple...    116   1e-25   Camelina sativa [gold-of-pleasure]
tpg|DAA52497.1|  TPA: hypothetical protein ZEAMMB73_788308              115   2e-25   
ref|XP_008645319.1|  PREDICTED: uncharacterized protein LOC100383...    115   2e-25   
emb|CDY11039.1|  BnaA03g46980D                                          114   4e-25   Brassica napus [oilseed rape]
ref|XP_009137478.1|  PREDICTED: conserved oligomeric Golgi comple...    114   4e-25   Brassica rapa
emb|CDX92658.1|  BnaC07g39160D                                          114   4e-25   
ref|XP_002463519.1|  hypothetical protein SORBIDRAFT_01g001270          114   5e-25   Sorghum bicolor [broomcorn]
ref|XP_008644331.1|  PREDICTED: conserved oligomeric Golgi comple...    113   1e-24   
ref|XP_006652018.1|  PREDICTED: conserved oligomeric Golgi comple...    112   1e-24   Oryza brachyantha
ref|XP_003562360.1|  PREDICTED: conserved oligomeric Golgi comple...    112   2e-24   Brachypodium distachyon [annual false brome]
ref|XP_009138596.1|  PREDICTED: conserved oligomeric Golgi comple...    111   4e-24   Brassica rapa
emb|CDY34317.1|  BnaA01g14200D                                          111   4e-24   Brassica napus [oilseed rape]
ref|NP_001051898.1|  Os03g0849600                                       111   5e-24   
gb|EEC76534.1|  hypothetical protein OsI_14326                          111   5e-24   Oryza sativa Indica Group [Indian rice]
emb|CDY51233.1|  BnaA03g07050D                                          110   9e-24   Brassica napus [oilseed rape]
gb|EMS58136.1|  Oligomeric Golgi complex subunit 2                      110   9e-24   Triticum urartu
ref|XP_009131654.1|  PREDICTED: conserved oligomeric Golgi comple...    110   1e-23   Brassica rapa
dbj|BAK01513.1|  predicted protein                                      110   1e-23   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY03412.1|  BnaC01g16700D                                          109   2e-23   
emb|CDX70811.1|  BnaC03g08950D                                          107   8e-23   
gb|EMT13194.1|  Putative oligomeric Golgi complex subunit 2           99.4    4e-20   
ref|XP_002318717.1|  hypothetical protein POPTR_0012s09800g           97.8    2e-19   Populus trichocarpa [western balsam poplar]
ref|XP_002966110.1|  hypothetical protein SELMODRAFT_86129            76.3    1e-17   Selaginella moellendorffii
ref|XP_002982190.1|  hypothetical protein SELMODRAFT_115746           75.9    1e-17   Selaginella moellendorffii
ref|XP_001764075.1|  predicted protein                                83.6    1e-14   
ref|XP_005644140.1|  hypothetical protein COCSUDRAFT_48790            60.8    1e-13   Coccomyxa subellipsoidea C-169
ref|XP_007023397.1|  Golgi organization, COG2 isoform 2               73.9    1e-11   
ref|XP_005848758.1|  hypothetical protein CHLNCDRAFT_57543            50.8    2e-11   Chlorella variabilis
gb|AES73454.2|  oligomeric subunit-like protein                       72.8    2e-11   Medicago truncatula
ref|XP_010233328.1|  PREDICTED: protein FAR1-RELATED SEQUENCE 5-like  71.6    3e-11   Brachypodium distachyon [annual false brome]
ref|XP_001416921.1|  predicted protein                                64.3    6e-09   Ostreococcus lucimarinus CCE9901
ref|XP_003078128.1|  Low density lipoprotein receptor (ISS)           58.5    7e-08   Ostreococcus tauri
gb|AFW66982.1|  hypothetical protein ZEAMMB73_946461                  57.0    1e-07   
ref|XP_007510910.1|  predicted protein                                53.1    3e-07   Bathycoccus prasinos
ref|XP_006817460.1|  PREDICTED: conserved oligomeric Golgi comple...  53.1    4e-07   Saccoglossus kowalevskii
ref|XP_002132051.1|  PREDICTED: conserved oligomeric Golgi comple...  56.2    9e-06   Ciona intestinalis [sea vase]
ref|XP_002501700.1|  predicted protein                                43.9    5e-05   Micromonas commoda
gb|KIZ07920.1|  Conserved oligomeric Golgi complex subunit 2          52.0    3e-04   Monoraphidium neglectum
ref|XP_007127671.1|  PREDICTED: conserved oligomeric Golgi comple...  50.4    9e-04   
ref|XP_005020290.1|  PREDICTED: conserved oligomeric Golgi comple...  50.4    9e-04   
gb|EOB00851.1|  Conserved oligomeric Golgi complex subunit 2          50.4    9e-04   Anas platyrhynchos [duck]
ref|XP_004310291.1|  PREDICTED: conserved oligomeric Golgi comple...  50.1    0.001   



>ref|XP_007023396.1| Golgi organization, COG2 isoform 1 [Theobroma cacao]
 gb|EOY26018.1| Golgi organization, COG2 isoform 1 [Theobroma cacao]
Length=754

 Score =   160 bits (405),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 79/92 (86%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            LRPLKTFLDGERATTYLT   R +LL GAA +IT RYYELAADLV+VARKTESSLQ+IR 
Sbjct  626  LRPLKTFLDGERATTYLTNAARNDLLLGAATEITGRYYELAADLVSVARKTESSLQRIRQ  685

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
            GAQRRAGASSDVSDHN+SDTDKICMQLFLDIQ
Sbjct  686  GAQRRAGASSDVSDHNVSDTDKICMQLFLDIQ  717


 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 38/48 (79%), Gaps = 2/48 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNIIS  260
            IC+  F   D QEY RNL++LG+DAA I +YRSLWQCVAP +RQ++I+
Sbjct  708  ICMQLFL--DIQEYGRNLATLGVDAANITAYRSLWQCVAPADRQSVIN  753



>gb|EYU23123.1| hypothetical protein MIMGU_mgv1a001829mg [Erythranthe guttata]
Length=753

 Score =   159 bits (403),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 77/92 (84%), Positives = 85/92 (92%), Gaps = 0/92 (0%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            LRPLK FL+ E+A TYLTK+LR EL+ GAAF+IT RYYELA+DLV+VARKTESSLQKIRL
Sbjct  625  LRPLKAFLEAEQAATYLTKDLRKELVHGAAFEITRRYYELASDLVSVARKTESSLQKIRL  684

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
            GAQRRAGASSDVSDHN+SDTDKICMQL LDIQ
Sbjct  685  GAQRRAGASSDVSDHNVSDTDKICMQLLLDIQ  716


 Score = 72.0 bits (175),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 38/48 (79%), Gaps = 2/48 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNIIS  260
            IC+      D QEY RNL+SLG+DAA IP+YRSLWQCVAP+++QN IS
Sbjct  707  ICMQLL--LDIQEYGRNLASLGVDAADIPTYRSLWQCVAPSDKQNTIS  752



>ref|XP_011083848.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Sesamum 
indicum]
Length=757

 Score =   158 bits (400),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/92 (85%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            LRPLK FLDGERA TYLT ELR EL+Q AA +IT RYYELAADLV+VARKTESSLQKIRL
Sbjct  629  LRPLKAFLDGERAATYLTSELRKELVQSAANEITRRYYELAADLVSVARKTESSLQKIRL  688

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
            GAQRRAGA+SDVSD N+SDTDK+CMQLFLDIQ
Sbjct  689  GAQRRAGATSDVSDQNVSDTDKMCMQLFLDIQ  720


 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 39/48 (81%), Gaps = 2/48 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNIIS  260
            +C+  F   D QEY RNL+SLG+DAA IP+YRSLWQCVAP++RQN IS
Sbjct  711  MCMQLFL--DIQEYGRNLASLGVDAADIPAYRSLWQCVAPSDRQNSIS  756



>gb|KHG07418.1| Conserved oligomeric Golgi complex subunit 2 [Gossypium arboreum]
Length=754

 Score =   154 bits (390),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 77/92 (84%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            LRPLKTFLDGE+AT YLT + R  LL GAA  IT RYYELAADLV+VARKTESSLQ+IR 
Sbjct  626  LRPLKTFLDGEQATKYLTNDARNNLLLGAATDITIRYYELAADLVSVARKTESSLQRIRQ  685

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
            GAQRRAGASSDVSDHN+SDTDKICMQLFLDIQ
Sbjct  686  GAQRRAGASSDVSDHNVSDTDKICMQLFLDIQ  717


 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 35/47 (74%), Gaps = 2/47 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNII  263
            IC+  F   D QEY RNL+ LG++AA I +YRSLWQCVAP +RQ+ I
Sbjct  708  ICMQLF--LDIQEYGRNLAVLGVEAADIDAYRSLWQCVAPADRQDEI  752



>ref|XP_002279916.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Vitis 
vinifera]
 emb|CBI15649.3| unnamed protein product [Vitis vinifera]
Length=751

 Score =   154 bits (389),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 75/92 (82%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            LRP++ FL GERA TYLT E+R ELL+GAAF IT  YYELAADLVNVARKTESSLQ+IR 
Sbjct  623  LRPVQAFLYGERAATYLTGEIRNELLRGAAFAITGHYYELAADLVNVARKTESSLQRIRQ  682

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
            GAQRRAGASSDV D+N+SDTDKICMQLFLDIQ
Sbjct  683  GAQRRAGASSDVMDNNVSDTDKICMQLFLDIQ  714


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 36/49 (73%), Gaps = 2/49 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNIISL  257
            IC+  F   D QEY RNLS+LG+ A  IP+Y SLW+CVAP ++QN I++
Sbjct  705  ICMQLFL--DIQEYGRNLSALGVKAVEIPAYCSLWRCVAPPDQQNAINV  751



>emb|CDP04651.1| unnamed protein product [Coffea canephora]
Length=763

 Score =   154 bits (388),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 74/92 (80%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            LRP+KTFL+GERAT YLT+ ++ +LLQ  AF+IT  Y ELA DLV VARKTESSLQKIRL
Sbjct  635  LRPIKTFLEGERATAYLTEHIKNDLLQRTAFEITGHYNELATDLVTVARKTESSLQKIRL  694

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
            GAQRRAGASSDVSDHN+SDTDKICMQLFLDIQ
Sbjct  695  GAQRRAGASSDVSDHNVSDTDKICMQLFLDIQ  726


 Score = 72.0 bits (175),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 38/48 (79%), Gaps = 2/48 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNIIS  260
            IC+  F   D QEY RNL+SLG++AA IP+YRSLWQCVAP +RQN IS
Sbjct  717  ICMQLFL--DIQEYGRNLASLGVEAANIPAYRSLWQCVAPPDRQNSIS  762



>ref|XP_009602477.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Nicotiana 
tomentosiformis]
Length=751

 Score =   153 bits (387),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 75/92 (82%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            LRPLK FLDGERA T LT E+R ELLQGAA +IT RY ELA DLVN++R+TESSLQK+RL
Sbjct  623  LRPLKEFLDGERAATCLTNEIRNELLQGAALEITGRYNELATDLVNMSRRTESSLQKLRL  682

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
            GAQRRAGASSDVSD N+SDTDKICMQLFLDIQ
Sbjct  683  GAQRRAGASSDVSDQNLSDTDKICMQLFLDIQ  714


 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 39/48 (81%), Gaps = 2/48 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNIIS  260
            IC+  F   D QEYAR+LSSLG+DAA+IP YRSLWQCVAP ERQN ++
Sbjct  705  ICMQLFL--DIQEYARSLSSLGVDAASIPPYRSLWQCVAPAERQNSLT  750



>gb|KJB43167.1| hypothetical protein B456_007G187600 [Gossypium raimondii]
 gb|KJB43168.1| hypothetical protein B456_007G187600 [Gossypium raimondii]
 gb|KJB43169.1| hypothetical protein B456_007G187600 [Gossypium raimondii]
 gb|KJB43170.1| hypothetical protein B456_007G187600 [Gossypium raimondii]
Length=754

 Score =   152 bits (383),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 76/92 (83%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            LRPLKTFLDGE+AT YLT + R  LL GAA  IT RYYELAADLV+VARKTESSLQ+IR 
Sbjct  626  LRPLKTFLDGEQATKYLTNDARNSLLLGAATDITIRYYELAADLVSVARKTESSLQRIRQ  685

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
            GAQRRAGASSDV DHN+SDTDKICMQLFLDIQ
Sbjct  686  GAQRRAGASSDVLDHNVSDTDKICMQLFLDIQ  717


 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 35/47 (74%), Gaps = 2/47 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNII  263
            IC+  F   D QEY RNL+ LG++AA I +YRSLWQCVAP +RQ+ I
Sbjct  708  ICMQLFL--DIQEYGRNLAVLGVEAADIDAYRSLWQCVAPADRQDEI  752



>gb|KJB43171.1| hypothetical protein B456_007G187600 [Gossypium raimondii]
Length=748

 Score =   152 bits (383),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 76/92 (83%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            LRPLKTFLDGE+AT YLT + R  LL GAA  IT RYYELAADLV+VARKTESSLQ+IR 
Sbjct  620  LRPLKTFLDGEQATKYLTNDARNSLLLGAATDITIRYYELAADLVSVARKTESSLQRIRQ  679

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
            GAQRRAGASSDV DHN+SDTDKICMQLFLDIQ
Sbjct  680  GAQRRAGASSDVLDHNVSDTDKICMQLFLDIQ  711


 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 35/47 (74%), Gaps = 2/47 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNII  263
            IC+  F   D QEY RNL+ LG++AA I +YRSLWQCVAP +RQ+ I
Sbjct  702  ICMQLF--LDIQEYGRNLAVLGVEAADIDAYRSLWQCVAPADRQDEI  746



>ref|XP_006477014.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Citrus sinensis]
Length=757

 Score =   151 bits (382),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 74/92 (80%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            LRPLKT L+GERA TYLT E + ELL GAA +IT RY+ELAA+L++VARKTESSL KIR 
Sbjct  629  LRPLKTLLEGERAMTYLTPEAKNELLLGAATQITSRYHELAAELISVARKTESSLLKIRQ  688

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
            GAQRRAGASSDVSDHN+SDTDKICMQLFLDIQ
Sbjct  689  GAQRRAGASSDVSDHNVSDTDKICMQLFLDIQ  720


 Score = 68.2 bits (165),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 37/47 (79%), Gaps = 2/47 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNII  263
            IC+  F   D QEY RNL++LG+ AA IP YRSLWQCVAP++RQ++I
Sbjct  711  ICMQLFL--DIQEYGRNLAALGVQAADIPPYRSLWQCVAPSDRQSLI  755



>gb|KDO52633.1| hypothetical protein CISIN_1g004390mg [Citrus sinensis]
 gb|KDO52634.1| hypothetical protein CISIN_1g004390mg [Citrus sinensis]
Length=432

 Score =   148 bits (374),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 73/92 (79%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            LRPLKT L+GERA TYLT E + ELL  AA +IT RY+ELAA+L++VARKTESSL KIR 
Sbjct  304  LRPLKTLLEGERAMTYLTPEAKNELLLDAATQITSRYHELAAELISVARKTESSLLKIRQ  363

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
            GAQRRAGASSDVSDHN+SDTDKICMQLFLDIQ
Sbjct  364  GAQRRAGASSDVSDHNVSDTDKICMQLFLDIQ  395


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 37/47 (79%), Gaps = 2/47 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNII  263
            IC+  F   D QEY R+L++LG+ AA IP YRSLWQCVAP++RQ++I
Sbjct  386  ICMQLFL--DIQEYGRSLAALGVQAADIPPYRSLWQCVAPSDRQSLI  430



>ref|XP_010536632.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Tarenaya 
hassleriana]
 ref|XP_010536633.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Tarenaya 
hassleriana]
Length=757

 Score =   151 bits (381),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 73/92 (79%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            LRPLK FLDG++A+ YLT E R ELL G   +IT RYYEL +DLVNVARKTESSLQ+IR 
Sbjct  628  LRPLKAFLDGDKASNYLTPETRQELLLGTVTEITRRYYELTSDLVNVARKTESSLQRIRQ  687

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
            GAQRRAGASSDVSDHNISDTDK+CMQLFLDIQ
Sbjct  688  GAQRRAGASSDVSDHNISDTDKMCMQLFLDIQ  719


 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 35/45 (78%), Gaps = 2/45 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQN  269
            +C+  F   D QEY RNL+++G+ AA IP+YRSLWQCVAP +++N
Sbjct  710  MCMQLFL--DIQEYGRNLAAVGVKAADIPAYRSLWQCVAPADKRN  752



>gb|EYU23122.1| hypothetical protein MIMGU_mgv1a024704mg [Erythranthe guttata]
Length=739

 Score =   150 bits (380),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 71/92 (77%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            LRPLK FL+ E+A TYLTKELR EL+ GAAF+IT RYYELA+D+V+ ARK ESSLQK+RL
Sbjct  611  LRPLKAFLEAEQAATYLTKELRKELVHGAAFEITRRYYELASDIVSAARKMESSLQKMRL  670

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
            GAQRR GASSDV+DHN+S+TDKICMQL LDIQ
Sbjct  671  GAQRRGGASSDVTDHNVSETDKICMQLLLDIQ  702


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 37/48 (77%), Gaps = 2/48 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNIIS  260
            IC+      D QEY RNL+SLG+DAA IP+YRSLWQCVAP ++QN IS
Sbjct  693  ICMQLL--LDIQEYGRNLASLGVDAADIPTYRSLWQCVAPPDKQNTIS  738



>ref|XP_004170101.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Cucumis sativus]
Length=231

 Score =   143 bits (361),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 71/92 (77%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            LRPLK  LDG+RA+T+LT E R  LL  A  +IT RYYE AADLV++ARKT+SSLQKIR 
Sbjct  103  LRPLKAILDGDRASTFLTTETRTALLTDAVTEITSRYYEQAADLVSLARKTDSSLQKIRQ  162

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
            G QRRAGASSDVSDHNISDTDKICMQLFLDIQ
Sbjct  163  GVQRRAGASSDVSDHNISDTDKICMQLFLDIQ  194


 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 2/48 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNIIS  260
            IC+  F   D QEY RNLS+LG++AA+IP+YRS W  VAP+++Q+ IS
Sbjct  185  ICMQLFL--DIQEYGRNLSALGVEAASIPTYRSFWHLVAPSDKQSSIS  230



>ref|XP_007155537.1| hypothetical protein PHAVU_003G210200g [Phaseolus vulgaris]
 gb|ESW27531.1| hypothetical protein PHAVU_003G210200g [Phaseolus vulgaris]
Length=755

 Score =   150 bits (379),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/92 (80%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            LRPLK FLDGERAT YL  + R E+L  AA +ITDRYYELAADLV+VARKTESSLQKIR 
Sbjct  627  LRPLKAFLDGERATRYLASDTRNEILLSAATEITDRYYELAADLVSVARKTESSLQKIRQ  686

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
             AQRRAGASSD+SD+N+SDTDKICMQLFLDIQ
Sbjct  687  SAQRRAGASSDISDNNVSDTDKICMQLFLDIQ  718


 Score = 72.0 bits (175),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 39/49 (80%), Gaps = 2/49 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNIISL  257
            IC+  F   D QEYARNLS+LG++AA I SYRSLWQCVAP +RQN I+L
Sbjct  709  ICMQLFL--DIQEYARNLSALGVEAANIASYRSLWQCVAPADRQNTINL  755



>ref|XP_008239451.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Prunus 
mume]
Length=755

 Score =   124 bits (311),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            +RPLK F +GERAT YLT + + E+L  AA +IT  YYE A +++++AR+T SSLQ+IR 
Sbjct  627  VRPLKAFWEGERATKYLTSDTKHEVLISAATEITGHYYETADNVISMARRTASSLQRIRQ  686

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
            GAQRR GASSDVSD N+SDTDKI MQ+FLDIQ
Sbjct  687  GAQRRGGASSDVSDQNVSDTDKISMQIFLDIQ  718


 Score = 60.1 bits (144),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -2

Query  382  FSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNIIS  260
            F D QEY RNL++LG+D A I ++RSLWQ VAP ERQ+ IS
Sbjct  714  FLDIQEYGRNLAALGVDVANIETFRSLWQSVAPAERQSEIS  754



>gb|KHN34411.1| Conserved oligomeric Golgi complex subunit 2 [Glycine soja]
Length=735

 Score =   150 bits (378),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/92 (79%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            LRPLK FLDGERAT YL  E+R ++L  AA +ITDRYYELA+DLV+VARKTESSLQKIR 
Sbjct  607  LRPLKAFLDGERATRYLASEIRNKILLCAATEITDRYYELASDLVSVARKTESSLQKIRQ  666

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
             AQRRAGASSD+SD+N+SDTDKICMQLFLDIQ
Sbjct  667  SAQRRAGASSDISDNNVSDTDKICMQLFLDIQ  698


 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 38/49 (78%), Gaps = 2/49 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNIISL  257
            IC+  F   D QEYARNLS+LG++A  I SYRSLWQCVAP +RQN I+L
Sbjct  689  ICMQLFL--DIQEYARNLSALGVEAVNIASYRSLWQCVAPADRQNTINL  735



>ref|XP_004244508.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Solanum 
lycopersicum]
Length=742

 Score =   149 bits (377),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/92 (77%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            LRPLK FL+GERA T L  E R ELLQGAA +IT RYY+L ++LVN++R+TESSLQK+RL
Sbjct  614  LRPLKEFLEGERAATCLNNETRNELLQGAALEITQRYYDLTSELVNMSRRTESSLQKLRL  673

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
            GAQRRAGASSDVSDHN+S+TDKICMQLFLDIQ
Sbjct  674  GAQRRAGASSDVSDHNLSETDKICMQLFLDIQ  705


 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 38/48 (79%), Gaps = 2/48 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNIIS  260
            IC+  F   D QEYAR+LS LG+DAA+IP Y+SLWQCVAP ER+N IS
Sbjct  696  ICMQLFL--DIQEYARSLSLLGVDAASIPPYQSLWQCVAPAERKNTIS  741



>ref|XP_003525701.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Glycine max]
Length=755

 Score =   149 bits (377),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/92 (79%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            LRPLK FLDGERAT YL  E+R ++L  AA +ITDRYYELA+DLV+VARKTESSLQKIR 
Sbjct  627  LRPLKAFLDGERATRYLASEIRNKILLCAATEITDRYYELASDLVSVARKTESSLQKIRQ  686

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
             AQRRAGASSD+SD+N+SDTDKICMQLFLDIQ
Sbjct  687  SAQRRAGASSDISDNNVSDTDKICMQLFLDIQ  718


 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 38/49 (78%), Gaps = 2/49 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNIISL  257
            IC+  F   D QEYARNLS+LG++A  I SYRSLWQCVAP +RQN I+L
Sbjct  709  ICMQLFL--DIQEYARNLSALGVEAVNIASYRSLWQCVAPADRQNTINL  755



>gb|KDO52632.1| hypothetical protein CISIN_1g004390mg [Citrus sinensis]
Length=527

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/92 (79%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            LRPLKT L+GERA TYLT E + ELL  AA +IT RY+ELAA+L++VARKTESSL KIR 
Sbjct  399  LRPLKTLLEGERAMTYLTPEAKNELLLDAATQITSRYHELAAELISVARKTESSLLKIRQ  458

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
            GAQRRAGASSDVSDHN+SDTDKICMQLFLDIQ
Sbjct  459  GAQRRAGASSDVSDHNVSDTDKICMQLFLDIQ  490


 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 37/47 (79%), Gaps = 2/47 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNII  263
            IC+  F   D QEY R+L++LG+ AA IP YRSLWQCVAP++RQ++I
Sbjct  481  ICMQLFL--DIQEYGRSLAALGVQAADIPPYRSLWQCVAPSDRQSLI  525



>gb|KDO52631.1| hypothetical protein CISIN_1g004390mg [Citrus sinensis]
Length=558

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/92 (79%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            LRPLKT L+GERA TYLT E + ELL  AA +IT RY+ELAA+L++VARKTESSL KIR 
Sbjct  430  LRPLKTLLEGERAMTYLTPEAKNELLLDAATQITSRYHELAAELISVARKTESSLLKIRQ  489

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
            GAQRRAGASSDVSDHN+SDTDKICMQLFLDIQ
Sbjct  490  GAQRRAGASSDVSDHNVSDTDKICMQLFLDIQ  521


 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 37/47 (79%), Gaps = 2/47 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNII  263
            IC+  F   D QEY R+L++LG+ AA IP YRSLWQCVAP++RQ++I
Sbjct  512  ICMQLFL--DIQEYGRSLAALGVQAADIPPYRSLWQCVAPSDRQSLI  556



>ref|XP_009769044.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Nicotiana 
sylvestris]
Length=751

 Score =   149 bits (375),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 73/92 (79%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            LRPLK FLDGERATT LT E+R ELLQ AA +IT  Y ELA D+VN++R+TESSLQK+RL
Sbjct  623  LRPLKEFLDGERATTCLTNEIRNELLQAAALEITGCYNELATDIVNMSRRTESSLQKLRL  682

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
            GAQRRAGASSDVSD N+SDTDKICMQLFLDIQ
Sbjct  683  GAQRRAGASSDVSDQNLSDTDKICMQLFLDIQ  714


 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 39/48 (81%), Gaps = 2/48 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNIIS  260
            IC+  F   D QEYAR+LSSLG++AA+IP YRSLWQCVAP ERQN ++
Sbjct  705  ICMQLFL--DIQEYARSLSSLGVNAASIPPYRSLWQCVAPAERQNSLT  750



>ref|XP_010250762.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Nelumbo 
nucifera]
Length=747

 Score =   148 bits (374),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 72/92 (78%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            L PLKTFLDGERATTYLT E + +LL GAA +IT RYYEL +++VNVARKTESSLQ+IR 
Sbjct  619  LYPLKTFLDGERATTYLTMEAKNKLLLGAAEEITGRYYELTSEVVNVARKTESSLQRIRQ  678

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
            GAQRRAGASSDVS+ N+SDTDKICMQLFLD+Q
Sbjct  679  GAQRRAGASSDVSEQNVSDTDKICMQLFLDVQ  710


 Score = 68.9 bits (167),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 36/47 (77%), Gaps = 2/47 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNII  263
            IC+  F   D QEY RNLS+LG+ A  IP+YRSLWQCVAP++RQN I
Sbjct  701  ICMQLFL--DVQEYGRNLSALGVVATNIPTYRSLWQCVAPSDRQNTI  745



>ref|XP_006440092.1| hypothetical protein CICLE_v10018979mg [Citrus clementina]
 gb|ESR53332.1| hypothetical protein CICLE_v10018979mg [Citrus clementina]
Length=757

 Score =   148 bits (373),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 73/92 (79%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            LRPLKT L+GERA TYLT E + ELL  AA +IT RY+ELAA+L++VARKTESSL KIR 
Sbjct  629  LRPLKTLLEGERAMTYLTPEAKNELLLDAATQITSRYHELAAELISVARKTESSLLKIRQ  688

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
            GAQRRAGASSDVSDHN+SDTDKICMQLFLDIQ
Sbjct  689  GAQRRAGASSDVSDHNVSDTDKICMQLFLDIQ  720


 Score = 66.2 bits (160),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 37/47 (79%), Gaps = 2/47 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNII  263
            IC+  F   D QEY R+L++LG+ AA IP YRSLWQCVAP++RQ++I
Sbjct  711  ICMQLFL--DIQEYGRSLAALGVQAADIPPYRSLWQCVAPSDRQSLI  755



>gb|KDO52630.1| hypothetical protein CISIN_1g004390mg [Citrus sinensis]
Length=757

 Score =   148 bits (373),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 73/92 (79%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            LRPLKT L+GERA TYLT E + ELL  AA +IT RY+ELAA+L++VARKTESSL KIR 
Sbjct  629  LRPLKTLLEGERAMTYLTPEAKNELLLDAATQITSRYHELAAELISVARKTESSLLKIRQ  688

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
            GAQRRAGASSDVSDHN+SDTDKICMQLFLDIQ
Sbjct  689  GAQRRAGASSDVSDHNVSDTDKICMQLFLDIQ  720


 Score = 66.2 bits (160),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 37/47 (79%), Gaps = 2/47 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNII  263
            IC+  F   D QEY R+L++LG+ AA IP YRSLWQCVAP++RQ++I
Sbjct  711  ICMQLFL--DIQEYGRSLAALGVQAADIPPYRSLWQCVAPSDRQSLI  755



>ref|XP_006357074.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Solanum tuberosum]
Length=742

 Score =   147 bits (372),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 71/92 (77%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            LRPLK FL+GERA T LT E R ELLQGAA +IT RY +L ++LVN++R+TESSLQK+RL
Sbjct  614  LRPLKEFLEGERAATCLTNETRNELLQGAALEITHRYNDLTSELVNMSRRTESSLQKLRL  673

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
            GAQRRAGASSDVSDHN+S+TDKICMQLFLDIQ
Sbjct  674  GAQRRAGASSDVSDHNLSETDKICMQLFLDIQ  705


 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 38/48 (79%), Gaps = 2/48 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNIIS  260
            IC+  F   D QEYAR+LS LG+DAA+IP Y+SLWQCVAP ER+N IS
Sbjct  696  ICMQLFL--DIQEYARSLSLLGVDAASIPPYQSLWQCVAPAERKNTIS  741



>gb|KHN14099.1| Conserved oligomeric Golgi complex subunit 2 [Glycine soja]
Length=658

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/92 (79%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            LRPLK FL GERAT YL  E R E+L  AA +ITDRYYELAADLV+VARKTESSLQKIR 
Sbjct  530  LRPLKAFLGGERATRYLVSETRNEILLCAATEITDRYYELAADLVSVARKTESSLQKIRQ  589

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
             AQRRAGASSD+ D+N+SDTDKICMQLFLDIQ
Sbjct  590  SAQRRAGASSDILDNNVSDTDKICMQLFLDIQ  621


 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 39/49 (80%), Gaps = 2/49 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNIISL  257
            IC+  F   D QEYARNLS+LG++AA I SYRSLWQCVAP +RQN I+L
Sbjct  612  ICMQLFL--DIQEYARNLSALGVEAANIASYRSLWQCVAPADRQNTINL  658



>emb|CAN71854.1| hypothetical protein VITISV_007347 [Vitis vinifera]
Length=777

 Score =   146 bits (368),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 72/86 (84%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = -1

Query  734  FLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRLGAQRRA  555
            FL GERA TYLT E+R ELL+GAAF IT  YYELAADLVNVARKTESSLQ+IR GAQRRA
Sbjct  655  FLYGERAATYLTGEIRNELLRGAAFAITGHYYELAADLVNVARKTESSLQRIRQGAQRRA  714

Query  554  GASSDVSDHNISDTDKICMQLFLDIQ  477
            GASSDV D+N+SDTDKICMQLFLDIQ
Sbjct  715  GASSDVMDNNVSDTDKICMQLFLDIQ  740


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 36/49 (73%), Gaps = 2/49 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNIISL  257
            IC+  F   D QEY RNLS+LG+ A  IP+Y SLW+CVAP ++QN I++
Sbjct  731  ICMQLFL--DIQEYGRNLSALGVKAVEIPAYCSLWRCVAPPDQQNAINV  777



>ref|XP_003549849.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Glycine max]
Length=755

 Score =   146 bits (368),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 73/92 (79%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            LRPLK FL GERAT YL  E R E+L  AA +ITDRYYELAADLV+VARKTESSLQKIR 
Sbjct  627  LRPLKAFLGGERATRYLVSETRNEILLCAATEITDRYYELAADLVSVARKTESSLQKIRQ  686

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
             AQRRAGASSD+ D+N+SDTDKICMQLFLDIQ
Sbjct  687  SAQRRAGASSDILDNNVSDTDKICMQLFLDIQ  718


 Score = 72.0 bits (175),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 39/49 (80%), Gaps = 2/49 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNIISL  257
            IC+  F   D QEYARNLS+LG++AA I SYRSLWQCVAP +RQN I+L
Sbjct  709  ICMQLFL--DIQEYARNLSALGVEAANIASYRSLWQCVAPADRQNTINL  755



>ref|XP_004515820.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Cicer arietinum]
Length=755

 Score =   145 bits (367),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 71/92 (77%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            LRPLK FLDGER + YL  E + E+L  AA +ITDRYYELAADLV+VARKTESSLQKIR 
Sbjct  627  LRPLKAFLDGERTSRYLASETKNEILLCAATEITDRYYELAADLVSVARKTESSLQKIRQ  686

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
             AQRRAGASSD+SD+N+SDTDK+CMQLFLDIQ
Sbjct  687  SAQRRAGASSDISDNNVSDTDKMCMQLFLDIQ  718


 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 38/49 (78%), Gaps = 2/49 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNIISL  257
            +C+  F   D QEYARNLS+LG++A  I SYRSLWQCVAP ++QN I+L
Sbjct  709  MCMQLF--LDIQEYARNLSALGVEAVNIASYRSLWQCVAPADKQNKINL  755



>ref|XP_010105239.1| Conserved oligomeric Golgi complex subunit 2 [Morus notabilis]
 gb|EXC04126.1| Conserved oligomeric Golgi complex subunit 2 [Morus notabilis]
Length=708

 Score =   136 bits (343),  Expect(2) = 5e-36, Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            LRPL+ FL G+RA TYLT E++ ELL  AA +IT RYYELAADLV+VARKTESSLQ+IR 
Sbjct  586  LRPLEAFLRGDRAATYLTSEVKKELLDSAAKEITSRYYELAADLVSVARKTESSLQRIRQ  645

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
            GAQRRAGASSD+SD+N+SDT KIC QL LDIQ
Sbjct  646  GAQRRAGASSDISDNNVSDTYKICQQLKLDIQ  677


 Score = 42.4 bits (98),  Expect(2) = 5e-36, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = -2

Query  376  DYQEYARNLSSLGIDAATIPSYRSLWQCVAPTE  278
            D QEY RNL  LGID   I +YRSL +CV+ ++
Sbjct  675  DIQEYGRNLKELGIDPEDISAYRSLLECVSQSK  707



>ref|XP_010026586.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Eucalyptus grandis]
 gb|KCW83168.1| hypothetical protein EUGRSUZ_B00121 [Eucalyptus grandis]
Length=760

 Score =   144 bits (364),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 71/92 (77%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            LRPLKTFL+GERA  YLT ++R  LL  AA ++T RY ELA+DLVNVARKTESSLQ+IR 
Sbjct  632  LRPLKTFLEGERANAYLTTDVRNALLLSAATEVTGRYNELASDLVNVARKTESSLQRIRQ  691

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
            GAQRRAGASSDVS+ N+SDTDKICMQLFLDIQ
Sbjct  692  GAQRRAGASSDVSEQNVSDTDKICMQLFLDIQ  723


 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 38/48 (79%), Gaps = 2/48 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNIIS  260
            IC+  F   D QEY RNLS LG++AA IP+YRSLWQCVAP +RQN+IS
Sbjct  714  ICMQLFL--DIQEYGRNLSVLGVEAADIPAYRSLWQCVAPPDRQNVIS  759



>ref|XP_010026579.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Eucalyptus grandis]
Length=776

 Score =   144 bits (364),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/92 (77%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            LRPLKTFL+GERA  YLT ++R  LL  AA ++T RY ELA+DLVNVARKTESSLQ+IR 
Sbjct  648  LRPLKTFLEGERANAYLTTDVRNALLLSAATEVTGRYNELASDLVNVARKTESSLQRIRQ  707

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
            GAQRRAGASSDVS+ N+SDTDKICMQLFLDIQ
Sbjct  708  GAQRRAGASSDVSEQNVSDTDKICMQLFLDIQ  739


 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 38/48 (79%), Gaps = 2/48 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNIIS  260
            IC+  F   D QEY RNLS LG++AA IP+YRSLWQCVAP +RQN+IS
Sbjct  730  ICMQLFL--DIQEYGRNLSVLGVEAADIPAYRSLWQCVAPPDRQNVIS  775



>ref|XP_008463108.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Cucumis 
melo]
 ref|XP_008463109.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Cucumis 
melo]
Length=754

 Score =   143 bits (361),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 71/92 (77%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            LRPLK  LDG+RA+T+LT E R  LL  A  +IT RYYE AADLV++ARKT+SSLQKIR 
Sbjct  626  LRPLKVLLDGDRASTFLTMETRTALLTDAVTEITSRYYEQAADLVSLARKTDSSLQKIRQ  685

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
            G QRRAGASSDVSDHNISDTDKICMQLFLDIQ
Sbjct  686  GVQRRAGASSDVSDHNISDTDKICMQLFLDIQ  717


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 36/48 (75%), Gaps = 2/48 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNIIS  260
            IC+  F   D QEY RNLSSLG++AA+IP+Y S W  VAP+++Q+ IS
Sbjct  708  ICMQLF--LDIQEYGRNLSSLGVEAASIPTYLSFWHLVAPSDKQSSIS  753



>ref|XP_004138387.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Cucumis sativus]
 gb|KGN45847.1| hypothetical protein Csa_6G014670 [Cucumis sativus]
Length=754

 Score =   143 bits (360),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 71/92 (77%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            LRPLK  LDG+RA+T+LT E R  LL  A  +IT RYYE AADLV++ARKT+SSLQKIR 
Sbjct  626  LRPLKAILDGDRASTFLTTETRTALLTDAVTEITSRYYEQAADLVSLARKTDSSLQKIRQ  685

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
            G QRRAGASSDVSDHNISDTDKICMQLFLDIQ
Sbjct  686  GVQRRAGASSDVSDHNISDTDKICMQLFLDIQ  717


 Score = 62.8 bits (151),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 2/48 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNIIS  260
            IC+  F   D QEY RNLS+LG++AA+IP+YRS W  VAP+++Q+ IS
Sbjct  708  ICMQLF--LDIQEYGRNLSALGVEAASIPTYRSFWHLVAPSDKQSSIS  753



>gb|EPS73270.1| hypothetical protein M569_01480, partial [Genlisea aurea]
Length=757

 Score =   127 bits (319),  Expect(2) = 7e-35, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 78/93 (84%), Gaps = 1/93 (1%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            LRPLK FL+GERA+ YL++E+R E+L+GA  +IT RYY+L ++LV++ARKTESSLQKIRL
Sbjct  628  LRPLKVFLEGERASKYLSREVRREVLKGACLEITRRYYDLGSELVSMARKTESSLQKIRL  687

Query  572  GA-QRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
            GA QRR G SS+VSD  +S+ DK+C QL LDIQ
Sbjct  688  GAQQRRGGGSSEVSDSGVSEIDKLCTQLLLDIQ  720


 Score = 47.8 bits (112),  Expect(2) = 7e-35, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = -2

Query  367  EYARNLSSLGIDAATIPSYRSLWQCVAPTERQNII  263
            EY RNL S+GI+A +IP+Y S W CVAP +    I
Sbjct  723  EYGRNLGSVGIEARSIPAYVSFWHCVAPPDTHQTI  757



>gb|KDO52629.1| hypothetical protein CISIN_1g004390mg [Citrus sinensis]
Length=756

 Score =   141 bits (356),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/92 (78%), Positives = 80/92 (87%), Gaps = 1/92 (1%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            LRPLKT L+GERA TYLT E + ELL  AA +IT RY+ELAA+L++ ARKTESSL KIR 
Sbjct  629  LRPLKTLLEGERAMTYLTPEAKNELLLDAATQITSRYHELAAELIS-ARKTESSLLKIRQ  687

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
            GAQRRAGASSDVSDHN+SDTDKICMQLFLDIQ
Sbjct  688  GAQRRAGASSDVSDHNVSDTDKICMQLFLDIQ  719


 Score = 66.2 bits (160),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 37/47 (79%), Gaps = 2/47 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNII  263
            IC+  F   D QEY R+L++LG+ AA IP YRSLWQCVAP++RQ++I
Sbjct  710  ICMQLFL--DIQEYGRSLAALGVQAADIPPYRSLWQCVAPSDRQSLI  754



>ref|XP_006848427.1| hypothetical protein AMTR_s00013p00234340 [Amborella trichopoda]
 gb|ERN10008.1| hypothetical protein AMTR_s00013p00234340 [Amborella trichopoda]
Length=805

 Score =   139 bits (351),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 67/94 (71%), Positives = 78/94 (83%), Gaps = 1/94 (1%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            LRPLK FL+GERA  YL  E + +L+ GAA +IT  YYE+A D+VNV R+TESSLQ++R 
Sbjct  643  LRPLKAFLEGERAA-YLASETKSKLIHGAAERITGHYYEIAWDVVNVQRRTESSLQRLRQ  701

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQVT  471
            GAQRR GASSD SDHNISDTDKICMQLFLDIQV+
Sbjct  702  GAQRRGGASSDASDHNISDTDKICMQLFLDIQVS  735



>ref|XP_009359449.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Pyrus x bretschneideri]
Length=755

 Score =   139 bits (349),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            LRPL+ FL+GERAT YLT++   E+L  AA +IT RYYE A+++V+VARKTE+SLQ+IR 
Sbjct  627  LRPLRAFLEGERATKYLTRDAINEVLLNAATEITGRYYEQASNVVSVARKTETSLQRIRQ  686

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
            GAQRR GASSDVSDHN+SDTDKICMQ+FLDIQ
Sbjct  687  GAQRRGGASSDVSDHNVSDTDKICMQIFLDIQ  718


 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 37/49 (76%), Gaps = 2/49 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNIISL  257
            IC+  F   D QEY RNL++LG+D + I +YRSLW+CVAP ER+++I L
Sbjct  709  ICMQIFL--DIQEYGRNLAALGVDVSNIETYRSLWECVAPPERKSVIDL  755



>ref|XP_002511204.1| Conserved oligomeric Golgi complex component, putative [Ricinus 
communis]
 gb|EEF51806.1| Conserved oligomeric Golgi complex component, putative [Ricinus 
communis]
Length=756

 Score =   139 bits (349),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            L PLK FLDGERA TYLTKE R ELL GAA ++T RYYELAA+ V+VARKTE SL +IR 
Sbjct  628  LHPLKAFLDGERAITYLTKETRKELLVGAATELTSRYYELAAETVSVARKTEVSLLRIRQ  687

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
            GAQRR GASSDVSD +++++DKICMQLFLDIQ
Sbjct  688  GAQRRGGASSDVSDQSVTNSDKICMQLFLDIQ  719


 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 38/48 (79%), Gaps = 2/48 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNIIS  260
            IC+  F   D QEY R+L++LG++AA IP+Y SLWQCVAP +RQN+IS
Sbjct  710  ICMQLFL--DIQEYGRSLAALGVEAADIPAYYSLWQCVAPPDRQNVIS  755



>ref|XP_009346519.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like, 
partial [Pyrus x bretschneideri]
Length=599

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            LRPL+ FL+GERAT YLT++   E+L  AA +IT RY E AA++V+VARKTE+SLQ+IR 
Sbjct  471  LRPLRAFLEGERATQYLTRDTINEVLLNAATEITGRYNEQAANVVSVARKTETSLQRIRQ  530

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
            GAQRR GASSDVSDHN+SDTDKICMQ+FLDIQ
Sbjct  531  GAQRRGGASSDVSDHNVSDTDKICMQIFLDIQ  562


 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 35/47 (74%), Gaps = 2/47 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNII  263
            IC+  F   D QEY RNL++LG+D + I +YRSLW CVAP +R+++I
Sbjct  553  ICMQIFL--DIQEYGRNLAALGVDVSNIEAYRSLWDCVAPPDRKSVI  597



>ref|XP_009375225.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Pyrus x bretschneideri]
 ref|XP_009375233.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Pyrus x bretschneideri]
Length=755

 Score =   136 bits (343),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            LRPL+ FL+GERAT YLT++   E+L  AA +IT RY E AA++V+VARKTE+SLQ+IR 
Sbjct  627  LRPLRAFLEGERATQYLTRDTINEVLLNAATEITGRYNEQAANVVSVARKTETSLQRIRQ  686

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
            GAQRR GASSDVSDHN+SDTDKICMQ+FLDIQ
Sbjct  687  GAQRRGGASSDVSDHNVSDTDKICMQIFLDIQ  718


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 34/47 (72%), Gaps = 2/47 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNII  263
            IC+  F   D QEY RNL++LG+D + I +YRSLW CVAP +R+ +I
Sbjct  709  ICMQIF--LDIQEYGRNLAALGVDVSNIEAYRSLWDCVAPPDRKTVI  753



>ref|XP_008374256.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Malus domestica]
Length=755

 Score =   136 bits (342),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            LRPL+ FL+GERAT YLT++   E+L  AA +IT RY E AA++V+VARKTE+SLQ+IR 
Sbjct  627  LRPLRAFLEGERATQYLTRDAINEVLLNAATEITGRYNEQAANVVSVARKTETSLQRIRQ  686

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
            GAQRR GASSDVSDHN+SDTDKICMQ+FLDIQ
Sbjct  687  GAQRRGGASSDVSDHNVSDTDKICMQIFLDIQ  718


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 36/47 (77%), Gaps = 2/47 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNII  263
            IC+  F   D QEY RNL++LG+D + I +YRSLW+CVAP +R+++I
Sbjct  709  ICMQIF--LDIQEYGRNLAALGVDVSNIEAYRSLWECVAPPDRKSVI  753



>ref|XP_010927713.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Elaeis guineensis]
Length=751

 Score =   136 bits (342),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 74/92 (80%), Gaps = 1/92 (1%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            LRPLK FLDGE    YLT   R ELL GA  +IT RYYELA+DLVNVARKTESSL ++R 
Sbjct  624  LRPLKAFLDGEH-VAYLTHNARNELLHGATIRITSRYYELASDLVNVARKTESSLLRLRQ  682

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
            GAQRR GASSD  D+NISDT+KICMQLFLDIQ
Sbjct  683  GAQRRVGASSDALDNNISDTEKICMQLFLDIQ  714


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 35/47 (74%), Gaps = 2/47 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNII  263
            IC+  F   D QEY RNL+++GI AA IP+YRSLWQCVAP ++Q  I
Sbjct  705  ICMQLF--LDIQEYGRNLAAIGIKAADIPAYRSLWQCVAPEDKQTQI  749



>ref|XP_010448510.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Camelina sativa]
Length=756

 Score =   135 bits (340),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            LRP+K FL+G++A  YLTK++R ELL G   +IT RYYELAA+LV+VARKTESSLQK+R 
Sbjct  628  LRPVKAFLEGDKARQYLTKKIREELLHGTVTEITRRYYELAAELVSVARKTESSLQKLRQ  687

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
             AQRRAGA+S VSD N+S+TDK+CMQLFLDIQ
Sbjct  688  NAQRRAGAASGVSDQNVSETDKMCMQLFLDIQ  719


 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 34/49 (69%), Gaps = 2/49 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNIISL  257
            +C+  F   D QEY RN+S+LG+    IP+Y S WQCVAP +RQN IS+
Sbjct  710  MCMQLFL--DIQEYGRNISALGLKPTDIPAYCSFWQCVAPADRQNTISV  756



>ref|XP_010926719.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
isoform X1 [Elaeis guineensis]
 ref|XP_010926720.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
isoform X1 [Elaeis guineensis]
Length=753

 Score =   135 bits (340),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 78/92 (85%), Gaps = 1/92 (1%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            LRPLK FLDGER  +YLT + R ELL GA  +IT+RYYELA+DLV+VARKTESSL ++R 
Sbjct  626  LRPLKAFLDGER-VSYLTVDARNELLHGATERITNRYYELASDLVSVARKTESSLLRLRQ  684

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
            GAQRR GASSD  D+NISDT+KICMQLFLDIQ
Sbjct  685  GAQRRVGASSDALDNNISDTEKICMQLFLDIQ  716


 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 34/47 (72%), Gaps = 2/47 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNII  263
            IC+  F   D QEY RNL+++GI A  IP+YRSLWQCVAP ++Q  I
Sbjct  707  ICMQLF--LDIQEYGRNLAAIGIKAVDIPAYRSLWQCVAPEDKQTQI  751



>ref|XP_004297537.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Fragaria 
vesca subsp. vesca]
Length=768

 Score =   134 bits (337),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 78/92 (85%), Gaps = 1/92 (1%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            LRPLK FLDGERA+ YL ++ + EL+  AA +IT RYYE AA+LV+VAR+TESSLQKIRL
Sbjct  641  LRPLKVFLDGERASRYLKEDAKNELVLSAATEITGRYYESAAELVSVARRTESSLQKIRL  700

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
            GAQRR GA  DVSD N+SDTDKICMQLFLDIQ
Sbjct  701  GAQRRGGA-VDVSDSNVSDTDKICMQLFLDIQ  731


 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 35/48 (73%), Gaps = 2/48 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNIIS  260
            IC+  F   D QEY RNL +LG+DAA I SYRSLWQCVAP + Q +I+
Sbjct  722  ICMQLF--LDIQEYGRNLRALGVDAANIESYRSLWQCVAPADNQGVIN  767



>ref|XP_010433717.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Camelina sativa]
Length=757

 Score =   134 bits (336),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            LRP+K FL+G++A  YLT+++R ELL G   +IT RYYELAA+LV+VARKTESSLQK+R 
Sbjct  629  LRPVKVFLEGDKARQYLTEKIREELLHGTVTEITRRYYELAAELVSVARKTESSLQKLRQ  688

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
             AQRRAGA+S VSD N+S+TDK+CMQLFLDIQ
Sbjct  689  NAQRRAGAASGVSDQNVSETDKMCMQLFLDIQ  720


 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 35/49 (71%), Gaps = 2/49 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNIISL  257
            +C+  F   D QEY RN+S+LG+  A IP+Y S WQCVAP +RQN IS+
Sbjct  711  MCMQLFL--DIQEYGRNISALGLKPADIPAYCSFWQCVAPADRQNTISV  757



>ref|XP_010438959.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Camelina sativa]
Length=756

 Score =   134 bits (336),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            LRP+K FL+G++A  YLT+++R ELL G   +IT RYYELAA+LV+VARKTESSLQK+R 
Sbjct  628  LRPVKAFLEGDKARHYLTEKIREELLHGTVTEITRRYYELAAELVSVARKTESSLQKLRQ  687

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
             AQRRAGA+S VSD N+S+TDK+CMQLFLDIQ
Sbjct  688  NAQRRAGAASGVSDQNVSETDKMCMQLFLDIQ  719


 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 35/49 (71%), Gaps = 2/49 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNIISL  257
            +C+  F   D QEY RN+S+LG+  A IP+Y S WQCVAP ++QN IS+
Sbjct  710  MCMQLFL--DIQEYGRNISALGLKPADIPAYCSFWQCVAPADKQNTISV  756



>ref|XP_006283181.1| hypothetical protein CARUB_v10004211mg [Capsella rubella]
 gb|EOA16079.1| hypothetical protein CARUB_v10004211mg [Capsella rubella]
Length=754

 Score =   132 bits (333),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            LRP+K FL+G++A  YLT++ R ELL G   +IT RYYELAA+LV+VARKTESSLQK+R 
Sbjct  626  LRPVKAFLEGDKARHYLTEKTREELLHGTVTEITRRYYELAAELVSVARKTESSLQKLRQ  685

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
             AQRRAGA+S VSD N+S+TDK+CMQLFLDIQ
Sbjct  686  NAQRRAGAASGVSDQNVSETDKMCMQLFLDIQ  717


 Score = 59.7 bits (143),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 35/49 (71%), Gaps = 2/49 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNIISL  257
            +C+  F   D QEY RN+++LG+  A IP+Y S WQCVAP +RQN IS+
Sbjct  708  MCMQLF--LDIQEYGRNVTALGLIPADIPAYCSFWQCVAPADRQNTISV  754



>emb|CAB41124.1| brefeldin A-sensitive Golgi protein-like [Arabidopsis thaliana]
 emb|CAB79394.1| brefeldin A-sensitive Golgi protein-like [Arabidopsis thaliana]
Length=724

 Score =   132 bits (331),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            LRP+K FL+G++A  YLT++ + ELL G+  +IT RYYELAAD+V+VARKT+SSLQK+R 
Sbjct  628  LRPVKAFLEGDKARNYLTQKTKEELLHGSVSEITRRYYELAADVVSVARKTQSSLQKLRQ  687

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQV  474
             AQRR GA+S VSD N+S+TDK+CMQLFLDIQV
Sbjct  688  NAQRRGGAASGVSDQNVSETDKMCMQLFLDIQV  720



>ref|XP_003603203.1| Conserved oligomeric Golgi complex subunit [Medicago truncatula]
Length=798

 Score =   102 bits (255),  Expect(2) = 4e-31, Method: Composition-based stats.
 Identities = 57/102 (56%), Positives = 71/102 (70%), Gaps = 12/102 (12%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            LRPLK FL GE+  +YL  E + E+L  AA +ITDRYYELAADLV V R  +++L K + 
Sbjct  662  LRPLKAFLGGEK-ISYLASETKNEILLYAATEITDRYYELAADLVIVVR-IQTTLMKFQE  719

Query  572  G----------AQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
            G           QRRAGASS + D+N+SDTD++CMQLFLDIQ
Sbjct  720  GKNIHFRKLDRVQRRAGASSGIYDNNVSDTDRMCMQLFLDIQ  761


 Score = 60.1 bits (144),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 26/42 (62%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -2

Query  382  FSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNIISL  257
            F D QEYARNLS+LG++A  I S+ SLWQ VAP ++QN I L
Sbjct  757  FLDIQEYARNLSALGVEAVNIASFSSLWQSVAPADKQNTIKL  798



>gb|KDP30933.1| hypothetical protein JCGZ_11309 [Jatropha curcas]
Length=756

 Score =   131 bits (329),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 75/92 (82%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            LRPLK FLDG+RA TYLTKE R +LL GAA +IT RYYELAA+LV+VARKTESSLQ+IR 
Sbjct  628  LRPLKVFLDGDRAVTYLTKETRNDLLLGAATEITGRYYELAAELVSVARKTESSLQRIRQ  687

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
            GAQRRAGASSDVSD ++SDTDKICMQLFLDIQ
Sbjct  688  GAQRRAGASSDVSDQSVSDTDKICMQLFLDIQ  719


 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 39/49 (80%), Gaps = 2/49 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNIISL  257
            IC+  F   D QEY RNLS+LG++AA IP+YRSLWQCVAP +RQ +ISL
Sbjct  710  ICMQLFL--DIQEYGRNLSALGVEAANIPAYRSLWQCVAPPDRQTVISL  756



>ref|XP_008351743.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Malus domestica]
Length=755

 Score =   131 bits (329),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            LRPL+ FL+GERAT YLT++   E+L  AA +IT RYYE A+++V+V RK E+SLQ+IR 
Sbjct  627  LRPLRAFLEGERATKYLTRDAINEVLLNAATEITGRYYEQASNVVSVTRKMETSLQRIRQ  686

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
            GAQRR GASSDVSD N+SDTDKICMQ+FLDIQ
Sbjct  687  GAQRRGGASSDVSDXNVSDTDKICMQIFLDIQ  718


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 37/49 (76%), Gaps = 2/49 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNIISL  257
            IC+  F   D QEY RNL++LG+D + I +YRSLW+CVAP ER+++I L
Sbjct  709  ICMQIF--LDIQEYGRNLAALGVDVSNIEAYRSLWECVAPPERKSVIDL  755



>ref|XP_008392829.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Malus domestica]
Length=755

 Score =   131 bits (329),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            LRPL+ FL+GERAT YLT++   E+L  AA +IT RYYE A+++V+V RK E+SLQ+IR 
Sbjct  627  LRPLRAFLEGERATKYLTRDAINEVLLNAATEITGRYYEQASNVVSVTRKMETSLQRIRQ  686

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
            GAQRR GASSDVSD N+SDTDKICMQ+FLDIQ
Sbjct  687  GAQRRGGASSDVSDXNVSDTDKICMQIFLDIQ  718


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 37/49 (76%), Gaps = 2/49 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNIISL  257
            IC+  F   D QEY RNL++LG+D + I +YRSLW+CVAP ER+++I L
Sbjct  709  ICMQIF--LDIQEYGRNLAALGVDVSNIEAYRSLWECVAPPERKSVIDL  755



>ref|XP_002867640.1| hypothetical protein ARALYDRAFT_492352 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43899.1| hypothetical protein ARALYDRAFT_492352 [Arabidopsis lyrata subsp. 
lyrata]
Length=756

 Score =   130 bits (327),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            LRP+K FL+G++A  YLT E R  LL G   +IT RYYELAA+LV+VARKTESSLQK+R 
Sbjct  628  LRPIKAFLEGDKARHYLTHETREALLLGTVTEITRRYYELAAELVSVARKTESSLQKLRQ  687

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
             AQRRAGA+S VSD N+S+TDK+CMQLFLDIQ
Sbjct  688  NAQRRAGAASGVSDQNVSETDKMCMQLFLDIQ  719


 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 35/49 (71%), Gaps = 2/49 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNIISL  257
            +C+  F   D QEY RN+S+LG+  A IP+Y S WQCVAP +RQN IS+
Sbjct  710  MCMQLFL--DIQEYGRNISALGLKPADIPAYCSFWQCVAPADRQNTISV  756



>ref|NP_567710.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE84970.1| uncharacterized protein AT4G24840 [Arabidopsis thaliana]
Length=756

 Score =   130 bits (327),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            LRP+K FL+G++A  YLT++ + ELL G+  +IT RYYELAAD+V+VARKT+SSLQK+R 
Sbjct  628  LRPVKAFLEGDKARNYLTQKTKEELLHGSVSEITRRYYELAADVVSVARKTQSSLQKLRQ  687

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
             AQRR GA+S VSD N+S+TDK+CMQLFLDIQ
Sbjct  688  NAQRRGGAASGVSDQNVSETDKMCMQLFLDIQ  719


 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 34/49 (69%), Gaps = 2/49 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNIISL  257
            +C+  F   D QEY RN+S+LG+  A IP Y S WQCVAP +RQN IS+
Sbjct  710  MCMQLFL--DIQEYGRNVSALGLKPADIPEYCSFWQCVAPADRQNSISV  756



>ref|XP_010677897.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Beta 
vulgaris subsp. vulgaris]
Length=759

 Score =   129 bits (324),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 75/92 (82%), Gaps = 1/92 (1%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            L PLK FL+GE A  YL    + ELL+G A +IT  Y  +A++LVNVARKTESSLQ+IR 
Sbjct  632  LHPLKAFLEGETAI-YLDDATKKELLRGTALEITKSYNAMASELVNVARKTESSLQRIRQ  690

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
            GAQRRAGASSDVSDHN+S+TDKICMQLFLDIQ
Sbjct  691  GAQRRAGASSDVSDHNVSNTDKICMQLFLDIQ  722


 Score = 62.8 bits (151),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 34/47 (72%), Gaps = 2/47 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNII  263
            IC+  F   D QEY RNL++LG+DAA    YRSLWQCVAP ++Q+ I
Sbjct  713  ICMQLF--LDIQEYGRNLAALGVDAAEFEDYRSLWQCVAPADKQSTI  757



>ref|XP_003608844.1| Conserved oligomeric Golgi complex subunit [Medicago truncatula]
 gb|AES91041.1| oligomeric subunit-like protein [Medicago truncatula]
Length=754

 Score =   129 bits (324),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 74/92 (80%), Gaps = 1/92 (1%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            LRPLK FLDGER  +YL  E + E+L  AA  ITDRYYELAADLV  +R+TESSLQKIR 
Sbjct  627  LRPLKMFLDGER-ISYLASETKNEILLCAATDITDRYYELAADLVTTSRRTESSLQKIRQ  685

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
             AQRRAG SS +SD+N+SDTD++CMQ FLDIQ
Sbjct  686  SAQRRAGTSSGISDNNVSDTDRMCMQFFLDIQ  717


 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 39/48 (81%), Gaps = 2/48 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNIIS  260
            +C+ FF   D QEYARNLS+LGI+A+ I SYRSLWQCVAP +RQN I+
Sbjct  708  MCMQFFL--DIQEYARNLSALGIEASNIASYRSLWQCVAPADRQNNIN  753



>gb|AAK32887.1|AF367300_1 AT4g24840/F6I7_50 [Arabidopsis thaliana]
 gb|AAM10288.1| AT4g24840/F6I7_50 [Arabidopsis thaliana]
Length=756

 Score =   129 bits (323),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            LRP+K FL+G++A  YLT++ + ELL G+  +IT RYYELAAD+V+VARKT+SS QK+R 
Sbjct  628  LRPVKAFLEGDKARNYLTQKTKEELLHGSVSEITRRYYELAADVVSVARKTQSSFQKLRQ  687

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
             AQRR GA+S VSD N+S+TDK+CMQLFLDIQ
Sbjct  688  NAQRRGGAASGVSDQNVSETDKMCMQLFLDIQ  719


 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 34/49 (69%), Gaps = 2/49 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNIISL  257
            +C+  F   D QEY RN+S+LG+  A IP Y S WQCVAP +RQN IS+
Sbjct  710  MCMQLFL--DIQEYGRNVSALGLKPADIPEYCSFWQCVAPADRQNSISV  756



>ref|XP_009385489.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=750

 Score =   127 bits (318),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 72/92 (78%), Gaps = 1/92 (1%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            LRPLK FLDGE     L K+ R ELL G   KIT RYYELAAD VNVARKTESSL ++R 
Sbjct  623  LRPLKAFLDGEH-IKLLMKDARNELLHGVTEKITTRYYELAADTVNVARKTESSLLRLRQ  681

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
            GAQRR GA+SD  D+NISDT+KICMQLFLD+Q
Sbjct  682  GAQRRVGATSDSVDNNISDTEKICMQLFLDVQ  713


 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 38/49 (78%), Gaps = 2/49 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNIISL  257
            IC+  F   D QEY RNLS++GI+A+ I +YRSLWQCVAP +RQ+ I+L
Sbjct  704  ICMQLFL--DVQEYGRNLSAMGIEASEISAYRSLWQCVAPEDRQSQITL  750



>ref|XP_008794572.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Phoenix 
dactylifera]
 ref|XP_008794573.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Phoenix 
dactylifera]
Length=751

 Score =   126 bits (317),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 73/92 (79%), Gaps = 1/92 (1%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            LRPLK FLDGE     LT + R ELL G   +IT RYYELA+DLV+VARKTESSL ++R 
Sbjct  624  LRPLKAFLDGEHVAC-LTHDARNELLYGTTKRITSRYYELASDLVSVARKTESSLLRLRQ  682

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
            GAQRR GASSD  D+NISDT+KICMQLFLDIQ
Sbjct  683  GAQRRVGASSDALDNNISDTEKICMQLFLDIQ  714


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 34/44 (77%), Gaps = 2/44 (5%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQ  272
            IC+  F   D QEY RNL+++GI AA IP+YRSLWQCVAP ++Q
Sbjct  705  ICMQLF--LDIQEYGRNLAAIGIKAADIPAYRSLWQCVAPEDKQ  746



>gb|KFK29022.1| hypothetical protein AALP_AA7G078500 [Arabis alpina]
Length=756

 Score =   125 bits (313),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 76/94 (81%), Gaps = 2/94 (2%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            LRPLK FL+G++A  YLT + R ELL G A +IT RYYEL A+LV+ ARKTESSLQK+R 
Sbjct  626  LRPLKAFLEGDKARHYLTDKTREELLLGTATEITRRYYELVAELVSAARKTESSLQKLRQ  685

Query  572  G--AQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
               AQ+R GA+S VSDHN+S+TDK+CMQLFLDIQ
Sbjct  686  SARAQKRGGAASGVSDHNVSETDKMCMQLFLDIQ  719


 Score = 65.1 bits (157),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 37/49 (76%), Gaps = 2/49 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNIISL  257
            +C+  F   D QEY RN+S+LG+  A IP+Y SLWQCVAP +RQN+IS+
Sbjct  710  MCMQLF--LDIQEYGRNISALGLKPADIPAYCSLWQCVAPADRQNVISV  756



>ref|XP_007210583.1| hypothetical protein PRUPE_ppa015080mg, partial [Prunus persica]
 gb|EMJ11782.1| hypothetical protein PRUPE_ppa015080mg, partial [Prunus persica]
Length=718

 Score =   124 bits (311),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            +RPLK F +GERAT YLT + + E+L  AA +IT  YYE A +++++AR+T SSLQ+IR 
Sbjct  627  VRPLKAFWEGERATKYLTSDTKHEVLLSAATEITGHYYETADNVISMARRTASSLQRIRQ  686

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
            GAQRR GASSDVSD N+SDTDKI MQ+FLDIQ
Sbjct  687  GAQRRGGASSDVSDQNVSDTDKISMQIFLDIQ  718



>ref|XP_011024042.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Populus euphratica]
Length=757

 Score =   122 bits (305),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 72/93 (77%), Gaps = 1/93 (1%)
 Frame = -1

Query  752  LRPLKT-FLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIR  576
            L PLK  FLD E+ + YLTKE   EL  GAA  IT RYY++ A++VNVARKTESSLQ+++
Sbjct  628  LTPLKKDFLDTEKHSPYLTKETMNELRHGAATAITGRYYDMVAEIVNVARKTESSLQRLK  687

Query  575  LGAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
             GAQRR G SSDVSD  +SDTDK+CMQ FLDIQ
Sbjct  688  KGAQRRTGVSSDVSDPTVSDTDKLCMQYFLDIQ  720


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 40/49 (82%), Gaps = 2/49 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNIISL  257
            +C+ +F   D QEY RNLS+LG+DA  IP+++SLWQCVAP +RQN+I+L
Sbjct  711  LCMQYFL--DIQEYGRNLSTLGVDAKEIPAFQSLWQCVAPLDRQNVINL  757



>ref|XP_006296685.1| hypothetical protein CARUB_v10013037mg [Capsella rubella]
 gb|EOA29583.1| hypothetical protein CARUB_v10013037mg [Capsella rubella]
Length=760

 Score =   121 bits (303),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            LRPLK FL+GE+A  YLT+E R ELL G   +I+ RYYELAA+LV+ ARK E+ LQK R 
Sbjct  632  LRPLKAFLEGEKARHYLTQETREELLLGTVTEISRRYYELAAELVSEARKRETVLQKHRQ  691

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
             AQRRAGA+S VSD N+S+T+K+CMQLFLD+Q
Sbjct  692  NAQRRAGAASGVSDQNVSETEKMCMQLFLDLQ  723


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 37/49 (76%), Gaps = 2/49 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNIISL  257
            +C+  F   D QEY RN+S+LG++ A IP YRSLWQCVAP +RQN IS+
Sbjct  714  MCMQLF--LDLQEYGRNISALGLNPADIPPYRSLWQCVAPADRQNTISV  760



>ref|XP_006413377.1| hypothetical protein EUTSA_v10024490mg [Eutrema salsugineum]
 gb|ESQ54830.1| hypothetical protein EUTSA_v10024490mg [Eutrema salsugineum]
Length=759

 Score =   119 bits (299),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            LRP+K FL+G++AT YLT+E R ELL G   +IT RYYELA ++V+VARKTESSLQ+ R 
Sbjct  631  LRPVKAFLEGDKATHYLTEETREELLLGTVTEITRRYYELADEVVSVARKTESSLQQFRK  690

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
             AQ+R GA+S VSD  +S+TDK+CMQLFLD Q
Sbjct  691  KAQKRVGAASGVSDDYVSETDKMCMQLFLDTQ  722


 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 35/49 (71%), Gaps = 2/49 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNIISL  257
            +C+  F   D QEY RN+S+LG+  A IP Y SLW+CVAP +RQN IS+
Sbjct  713  MCMQLF--LDTQEYGRNISALGLKPADIPVYCSLWRCVAPADRQNTISV  759



>ref|XP_002322242.1| hypothetical protein POPTR_0015s10610g [Populus trichocarpa]
 gb|EEF06369.1| hypothetical protein POPTR_0015s10610g [Populus trichocarpa]
Length=757

 Score =   119 bits (299),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 72/93 (77%), Gaps = 1/93 (1%)
 Frame = -1

Query  752  LRPLKT-FLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIR  576
            L PLK  FLD E+ + YLTKE   EL  GAA  IT RYY++ A++V+VARKTESSLQ+++
Sbjct  628  LTPLKKDFLDTEKHSPYLTKETMNELRHGAATAITGRYYDMVAEIVSVARKTESSLQRLK  687

Query  575  LGAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
             GAQRR G SSDVSD  +SDTDK+CMQ FLDIQ
Sbjct  688  KGAQRRTGVSSDVSDPTVSDTDKLCMQYFLDIQ  720


 Score = 72.4 bits (176),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 40/49 (82%), Gaps = 2/49 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNIISL  257
            +C+ +F   D QEY RNLS+LG+DA  IP+Y+SLWQCVAP +RQN+I+L
Sbjct  711  LCMQYFL--DIQEYGRNLSTLGVDAKEIPAYQSLWQCVAPLDRQNVINL  757



>ref|XP_010485902.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Camelina sativa]
Length=760

 Score =   118 bits (296),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 72/92 (78%), Gaps = 0/92 (0%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            LRPLK FL+G++A  YLT E R ELL G   +I+ RYYELAA+LV+ ARK E+ LQK R 
Sbjct  632  LRPLKAFLEGDKAKHYLTHETREELLLGTVTEISRRYYELAAELVSEARKRETVLQKHRQ  691

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
             AQ+RAGA+S V D N+S+TDK+CMQLFLD+Q
Sbjct  692  NAQKRAGAASGVPDQNVSETDKMCMQLFLDLQ  723


 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 36/49 (73%), Gaps = 2/49 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNIISL  257
            +C+  F   D QEY RN+S+LG++ A IP Y SLWQCVAP +RQN IS+
Sbjct  714  MCMQLF--LDLQEYGRNISALGLNPADIPPYCSLWQCVAPADRQNTISV  760



>ref|XP_009385490.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=716

 Score =   117 bits (294),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 70/91 (77%), Gaps = 1/91 (1%)
 Frame = -1

Query  749  RPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRLG  570
            + ++ FLDGE     L K+ R ELL G   KIT RYYELAAD VNVARKTESSL ++R G
Sbjct  590  KSVEAFLDGEH-IKLLMKDARNELLHGVTEKITTRYYELAADTVNVARKTESSLLRLRQG  648

Query  569  AQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
            AQRR GA+SD  D+NISDT+KICMQLFLD+Q
Sbjct  649  AQRRVGATSDSVDNNISDTEKICMQLFLDVQ  679


 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 38/49 (78%), Gaps = 2/49 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNIISL  257
            IC+  F   D QEY RNLS++GI+A+ I +YRSLWQCVAP +RQ+ I+L
Sbjct  670  ICMQLFL--DVQEYGRNLSAMGIEASEISAYRSLWQCVAPEDRQSQITL  716



>ref|XP_011044173.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Populus euphratica]
Length=755

 Score =   116 bits (291),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 73/93 (78%), Gaps = 1/93 (1%)
 Frame = -1

Query  752  LRPLKT-FLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIR  576
            L PLK  FLD E+   YLT+E   EL  GAA +IT RYY++  ++V+VARKTESSLQ+++
Sbjct  626  LSPLKKDFLDMEKHNPYLTRETIKELRHGAATEITGRYYDMVVEIVSVARKTESSLQRLK  685

Query  575  LGAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
             GAQRRAG +SDVSD ++SDTDK+CMQ FLDIQ
Sbjct  686  KGAQRRAGVNSDVSDPSVSDTDKLCMQYFLDIQ  718


 Score = 74.3 bits (181),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 39/49 (80%), Gaps = 2/49 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNIISL  257
            +C+ +F   D QEY RNLSSLG+DA  IP+YRSLWQCVAP +RQN+I L
Sbjct  709  LCMQYFL--DIQEYGRNLSSLGVDAKGIPAYRSLWQCVAPPDRQNVIDL  755



>ref|XP_004981048.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Setaria italica]
Length=751

 Score =   116 bits (291),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 75/92 (82%), Gaps = 1/92 (1%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            L PLK FL+GER  +YL+++ + +L +G+  KIT  YY+L +++V VARKTESSLQ++R 
Sbjct  624  LHPLKVFLEGER-VSYLSEDDKTKLCRGSTDKITAIYYDLVSEVVTVARKTESSLQRLRQ  682

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
            GAQRR GAS+D SD+ ISDTDKICMQLFLDIQ
Sbjct  683  GAQRRVGASTDASDNIISDTDKICMQLFLDIQ  714


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 28/49 (57%), Positives = 34/49 (69%), Gaps = 2/49 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNIISL  257
            IC+  F   D QEYARNL ++GIDA  I SYR+LWQCVAP ++Q  I  
Sbjct  705  ICMQLF--LDIQEYARNLRTIGIDAREIDSYRALWQCVAPKDKQENIQF  751



>ref|XP_010464008.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Camelina sativa]
Length=764

 Score =   116 bits (290),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 73/92 (79%), Gaps = 0/92 (0%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            LRPLK FL+G++A  YLT E + ELL G   +I+ RYYELAA+LV+ ARK E+ LQK R 
Sbjct  636  LRPLKDFLEGDKARHYLTHETKEELLLGTVTEISRRYYELAAELVSEARKRETVLQKHRQ  695

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
             AQ+RAGA+S +SD N+S+TDK+CMQLFLD+Q
Sbjct  696  NAQKRAGAASSLSDQNVSETDKMCMQLFLDLQ  727


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 34/49 (69%), Gaps = 2/49 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNIISL  257
            +C+  F   D QEY RN+S LG++ A IP Y SLWQCVAP +RQN  S+
Sbjct  718  MCMQLF--LDLQEYGRNISELGLNPADIPPYCSLWQCVAPADRQNTTSV  764



>tpg|DAA52497.1| TPA: hypothetical protein ZEAMMB73_788308 [Zea mays]
Length=691

 Score =   115 bits (288),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 74/92 (80%), Gaps = 1/92 (1%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            L PLK FL+G+R   YL+++ + +L +G+A KIT  YY+L +++V VARKTESSLQ++R 
Sbjct  564  LHPLKVFLEGDR-MHYLSEDDKTKLCRGSANKITATYYDLVSEVVTVARKTESSLQRLRQ  622

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
            GAQRR GAS+D SD  ISDTDKICMQLFLDIQ
Sbjct  623  GAQRRVGASTDASDSIISDTDKICMQLFLDIQ  654


 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 33/47 (70%), Gaps = 2/47 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNII  263
            IC+  F   D QEYARNL ++GIDA  I SYR+LWQCVAP +R   I
Sbjct  645  ICMQLF--LDIQEYARNLRAIGIDAREIDSYRALWQCVAPKDRHENI  689



>ref|XP_008645319.1| PREDICTED: uncharacterized protein LOC100383630 isoform X1 [Zea 
mays]
 tpg|DAA52498.1| TPA: hypothetical protein ZEAMMB73_788308 [Zea mays]
Length=745

 Score =   115 bits (288),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 74/92 (80%), Gaps = 1/92 (1%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            L PLK FL+G+R   YL+++ + +L +G+A KIT  YY+L +++V VARKTESSLQ++R 
Sbjct  618  LHPLKVFLEGDR-MHYLSEDDKTKLCRGSANKITATYYDLVSEVVTVARKTESSLQRLRQ  676

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
            GAQRR GAS+D SD  ISDTDKICMQLFLDIQ
Sbjct  677  GAQRRVGASTDASDSIISDTDKICMQLFLDIQ  708


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 33/47 (70%), Gaps = 2/47 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNII  263
            IC+  F   D QEYARNL ++GIDA  I SYR+LWQCVAP +R   I
Sbjct  699  ICMQLF--LDIQEYARNLRAIGIDAREIDSYRALWQCVAPKDRHENI  743



>emb|CDY11039.1| BnaA03g46980D [Brassica napus]
Length=757

 Score =   114 bits (286),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 73/92 (79%), Gaps = 0/92 (0%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            LR +K FL+GE+AT YLT+  R ELL     +IT RYYELA ++V+VAR+TESSLQ+ R 
Sbjct  629  LRHVKAFLEGEKATRYLTQATREELLLRTVTEITRRYYELADEVVSVARRTESSLQQFRR  688

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
             AQ+RAGA+S VSD N+S+TDK+CMQLFLD Q
Sbjct  689  KAQKRAGAASGVSDDNVSETDKMCMQLFLDTQ  720


 Score = 62.4 bits (150),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 35/49 (71%), Gaps = 2/49 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNIISL  257
            +C+  F   D QEY RN+S+LG+  A IP Y SLWQCVAP +RQN IS+
Sbjct  711  MCMQLF--LDTQEYGRNISALGLKPAEIPVYCSLWQCVAPADRQNTISV  757



>ref|XP_009137478.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Brassica rapa]
Length=757

 Score =   114 bits (286),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 73/92 (79%), Gaps = 0/92 (0%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            LR +K FL+GE+AT YLT+  R ELL     +IT RYYELA ++V+VAR+TESSLQ+ R 
Sbjct  629  LRHVKAFLEGEKATRYLTQATREELLLRTVTEITRRYYELADEVVSVARRTESSLQQFRR  688

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
             AQ+RAGA+S VSD N+S+TDK+CMQLFLD Q
Sbjct  689  KAQKRAGAASGVSDDNVSETDKMCMQLFLDTQ  720


 Score = 62.8 bits (151),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 35/49 (71%), Gaps = 2/49 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNIISL  257
            +C+  F   D QEY RN+S+LG+  A IP Y SLWQCVAP +RQN IS+
Sbjct  711  MCMQLFL--DTQEYGRNISALGLKPAEIPVYCSLWQCVAPADRQNTISV  757



>emb|CDX92658.1| BnaC07g39160D [Brassica napus]
Length=757

 Score =   114 bits (286),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 73/92 (79%), Gaps = 0/92 (0%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            LR +K FL+GE+AT YLT+  R ELL     +IT RYYELA ++V+VAR+TESSLQ+ R 
Sbjct  629  LRHVKAFLEGEKATRYLTQATREELLLRTVTEITRRYYELADEVVSVARRTESSLQQFRR  688

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
             AQ+RAGA+S VSD N+S+TDK+CMQLFLD Q
Sbjct  689  KAQKRAGAASGVSDDNVSETDKMCMQLFLDTQ  720


 Score = 62.8 bits (151),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 35/49 (71%), Gaps = 2/49 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNIISL  257
            +C+  F   D QEY RN+S+LG+  A IP Y SLWQCVAP +RQN IS+
Sbjct  711  MCMQLFL--DTQEYGRNISALGLKPAEIPVYCSLWQCVAPADRQNTISV  757



>ref|XP_002463519.1| hypothetical protein SORBIDRAFT_01g001270 [Sorghum bicolor]
 gb|EER90517.1| hypothetical protein SORBIDRAFT_01g001270 [Sorghum bicolor]
Length=748

 Score =   114 bits (285),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 73/92 (79%), Gaps = 1/92 (1%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            L PLK FL+GER   YL+++ +  L +G+  KIT  YY+L +++V VARKTESSLQ++R 
Sbjct  621  LHPLKVFLEGER-IHYLSEDDKTRLCRGSTDKITAIYYDLVSEVVTVARKTESSLQRLRQ  679

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
            GAQRR GAS+D SD+ ISDTDKICMQLFLDIQ
Sbjct  680  GAQRRVGASTDASDNIISDTDKICMQLFLDIQ  711


 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 34/47 (72%), Gaps = 2/47 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNII  263
            IC+  F   D QEYARNL ++GIDA  I SYR+LWQCVAP ++Q  I
Sbjct  702  ICMQLFL--DIQEYARNLRAIGIDAREIDSYRALWQCVAPKDKQENI  746



>ref|XP_008644331.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Zea mays]
 gb|AFW66981.1| hypothetical protein ZEAMMB73_946461 [Zea mays]
Length=739

 Score =   113 bits (282),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 74/92 (80%), Gaps = 1/92 (1%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            L PLK FL+G+R   YL+++ + +L +G+  KIT  YY+L +++V VARKTESSLQ++R 
Sbjct  612  LHPLKVFLEGDR-IRYLSEDDKTKLCRGSTDKITAIYYDLVSEVVTVARKTESSLQRLRQ  670

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
            GAQRR GAS+D SD+ ISDTDKICMQLFLDIQ
Sbjct  671  GAQRRVGASTDASDNIISDTDKICMQLFLDIQ  702


 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 34/47 (72%), Gaps = 2/47 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNII  263
            IC+  F   D QEYARNL ++GIDA  I SYR+LWQCVAP +RQ  I
Sbjct  693  ICMQLFL--DIQEYARNLRAIGIDAREIDSYRALWQCVAPKDRQENI  737



>ref|XP_006652018.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Oryza brachyantha]
Length=693

 Score =   112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 74/92 (80%), Gaps = 1/92 (1%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            L PLK FL+G+R   YL+++ + +L +G+  KIT  YY++ +++V VARKTESSLQ++R 
Sbjct  566  LHPLKVFLEGDR-IHYLSEDDKTKLRRGSTDKITSIYYDMVSEVVTVARKTESSLQRLRQ  624

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
            GAQRR GAS+D SD+ ISDTDKICMQLFLDIQ
Sbjct  625  GAQRRVGASTDASDNIISDTDKICMQLFLDIQ  656


 Score = 62.4 bits (150),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 35/47 (74%), Gaps = 2/47 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNII  263
            IC+  F   D QEYARNL ++GIDA  I S+R+LWQCVAP E+Q+ I
Sbjct  647  ICMQLF--LDIQEYARNLRAIGIDAREIESFRALWQCVAPREKQDNI  691



>ref|XP_003562360.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Brachypodium 
distachyon]
Length=759

 Score =   112 bits (280),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 74/92 (80%), Gaps = 1/92 (1%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            L PLK FL+G+R   YL+++ + +L  G+  KIT  Y+++ +++VNVARKTESSLQ++R 
Sbjct  632  LHPLKVFLEGDR-VHYLSEDDKTKLRCGSTDKITAIYFDMVSEVVNVARKTESSLQRLRQ  690

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
            GAQRR GAS+D SD+ ISDTDKICMQLFLDIQ
Sbjct  691  GAQRRVGASTDASDNVISDTDKICMQLFLDIQ  722


 Score = 63.9 bits (154),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 29/49 (59%), Positives = 35/49 (71%), Gaps = 2/49 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNIISL  257
            IC+  F   D QEYARNL  LGIDA  I SYR+LWQCVAP ++Q++I  
Sbjct  713  ICMQLF--LDIQEYARNLRLLGIDAREIESYRALWQCVAPKDKQDLIQF  759



>ref|XP_009138596.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Brassica 
rapa]
Length=758

 Score =   111 bits (278),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 72/92 (78%), Gaps = 0/92 (0%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            LR +K FL+G++AT YLT+E R E+L G    IT RYYE A ++V++AR+TESSLQ+ R 
Sbjct  630  LRHVKAFLEGDKATHYLTQETREEILLGTVTDITRRYYESADEVVSLARRTESSLQQFRR  689

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
             AQ+RAGA+S  SD N+S+TDK+CMQLFLD Q
Sbjct  690  KAQKRAGAASGASDDNVSETDKMCMQLFLDAQ  721


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 35/49 (71%), Gaps = 2/49 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNIISL  257
            +C+  F   D QEY RN+++LG+  A IP Y SLWQCVAP +RQN IS+
Sbjct  712  MCMQLFL--DAQEYGRNIAALGLKPADIPVYCSLWQCVAPADRQNTISV  758



>emb|CDY34317.1| BnaA01g14200D [Brassica napus]
Length=758

 Score =   111 bits (278),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 72/92 (78%), Gaps = 0/92 (0%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            LR +K FL+G++AT YLT+E R E+L G    IT RYYE A ++V++AR+TESSLQ+ R 
Sbjct  630  LRHVKAFLEGDKATHYLTQETREEILLGTVTDITRRYYESADEVVSLARRTESSLQQFRR  689

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
             AQ+RAGA+S  SD N+S+TDK+CMQLFLD Q
Sbjct  690  KAQKRAGAASGASDDNVSETDKMCMQLFLDAQ  721


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 35/49 (71%), Gaps = 2/49 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNIISL  257
            +C+  F   D QEY RN+++LG+  A IP Y SLWQCVAP +RQN IS+
Sbjct  712  MCMQLFL--DAQEYGRNIAALGLKPADIPVYCSLWQCVAPADRQNTISV  758



>ref|NP_001051898.1| Os03g0849600 [Oryza sativa Japonica Group]
 gb|AAO37946.1| putative conserved oligomeric Golgi complex component [Oryza 
sativa Japonica Group]
 gb|ABF99909.1| brefeldin A-sensitive Golgi protein, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF13812.1| Os03g0849600 [Oryza sativa Japonica Group]
 gb|EAZ29309.1| hypothetical protein OsJ_13370 [Oryza sativa Japonica Group]
Length=754

 Score =   111 bits (278),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 74/92 (80%), Gaps = 1/92 (1%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            L PLK FL+G+R   YL+++ + +L +G+  KIT  YY++ +++V VARKTESSLQ++R 
Sbjct  627  LHPLKVFLEGDR-IHYLSEDDKAKLRRGSTDKITSIYYDMVSEVVTVARKTESSLQRLRQ  685

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
            GAQRR GA++D SD+ ISDTDKICMQLFLDIQ
Sbjct  686  GAQRRVGANTDTSDNIISDTDKICMQLFLDIQ  717


 Score = 60.1 bits (144),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 26/49 (53%), Positives = 35/49 (71%), Gaps = 2/49 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNIISL  257
            IC+  F   D QEYARNL ++GIDA  I ++R+LWQCVAP ++Q+ I  
Sbjct  708  ICMQLF--LDIQEYARNLRAIGIDAREIETFRALWQCVAPRDKQDNIQF  754



>gb|EEC76534.1| hypothetical protein OsI_14326 [Oryza sativa Indica Group]
Length=754

 Score =   111 bits (278),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 74/92 (80%), Gaps = 1/92 (1%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            L PLK FL+G+R   YL+++ + +L +G+  KIT  YY++ +++V VARKTESSLQ++R 
Sbjct  627  LHPLKVFLEGDR-IHYLSEDDKAKLRRGSTDKITSIYYDMVSEVVTVARKTESSLQRLRQ  685

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
            GAQRR GA++D SD+ ISDTDKICMQLFLDIQ
Sbjct  686  GAQRRVGANTDTSDNIISDTDKICMQLFLDIQ  717


 Score = 60.1 bits (144),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 26/49 (53%), Positives = 35/49 (71%), Gaps = 2/49 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNIISL  257
            IC+  F   D QEYARNL ++GIDA  I ++R+LWQCVAP ++Q+ I  
Sbjct  708  ICMQLF--LDIQEYARNLRAIGIDAREIETFRALWQCVAPRDKQDNIQF  754



>emb|CDY51233.1| BnaA03g07050D [Brassica napus]
Length=724

 Score =   110 bits (276),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 72/93 (77%), Gaps = 1/93 (1%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            LRPLK FL+G++A  YLT E R ELL G   ++T RYYELAA  ++ ARKTE+ LQK R 
Sbjct  595  LRPLKAFLEGDKARHYLTHETREELLLGTLTEMTRRYYELAAGRLSDARKTETYLQKSRQ  654

Query  572  GAQRRAG-ASSDVSDHNISDTDKICMQLFLDIQ  477
             AQ+RAG A+S V+DHN+S T+K+CMQLFLD+Q
Sbjct  655  NAQKRAGAAASGVTDHNVSGTEKMCMQLFLDLQ  687


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 35/49 (71%), Gaps = 2/49 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNIISL  257
            +C+  F   D QEY RN+S+LG++ A I  Y SLW+CVAP +RQN IS+
Sbjct  678  MCMQLF--LDLQEYGRNISALGLNPADIEPYCSLWKCVAPPDRQNTISV  724



>gb|EMS58136.1| Oligomeric Golgi complex subunit 2 [Triticum urartu]
Length=656

 Score =   110 bits (275),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 73/92 (79%), Gaps = 1/92 (1%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            L PLK FL+G+R   YL+++ + +L +G+  KIT  YY++ +++VNVARKTESSLQ++R 
Sbjct  529  LHPLKVFLEGDR-VHYLSEDDKTKLRRGSTDKITATYYDMVSEVVNVARKTESSLQRLRQ  587

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
            G Q+R G S+D SD+ ISDTDKICMQLFLDIQ
Sbjct  588  GQQKRIGGSTDASDNIISDTDKICMQLFLDIQ  619


 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 35/47 (74%), Gaps = 2/47 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNII  263
            IC+  F   D QEYARNL +LGIDA  I SYRSLWQCVAP ++Q+ I
Sbjct  610  ICMQLFL--DIQEYARNLRTLGIDAREIESYRSLWQCVAPKDKQDSI  654



>ref|XP_009131654.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Brassica rapa]
Length=724

 Score =   110 bits (275),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 72/93 (77%), Gaps = 1/93 (1%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            LRPLK FL+G++A  YLT E R ELL G   ++T RYYELAA  ++ ARKTE+ LQK R 
Sbjct  595  LRPLKAFLEGDKARHYLTHETREELLLGTLTEMTRRYYELAAGRLSDARKTETYLQKSRQ  654

Query  572  GAQRRAG-ASSDVSDHNISDTDKICMQLFLDIQ  477
             AQ+RAG A+S V+DHN+S T+K+CMQLFLD+Q
Sbjct  655  NAQKRAGAAASGVTDHNVSGTEKMCMQLFLDLQ  687


 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 35/49 (71%), Gaps = 2/49 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNIISL  257
            +C+  F   D QEY RN+S+LG++ A I  Y SLW+CVAP +RQN IS+
Sbjct  678  MCMQLF--LDLQEYGRNISALGLNPADIEPYCSLWKCVAPPDRQNTISV  724



>dbj|BAK01513.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=767

 Score =   110 bits (275),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/92 (59%), Positives = 73/92 (79%), Gaps = 1/92 (1%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            L PLK FL+G+R   YL+++ + +L +G+  KIT  YY++ +++VNVARKTESSLQ++R 
Sbjct  640  LHPLKVFLEGDR-VHYLSEDDKTKLRRGSTDKITATYYDMVSEVVNVARKTESSLQRLRQ  698

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
            G Q+R G S+D SD+ ISDTDKICMQLFLDIQ
Sbjct  699  GQQKRIGGSTDASDNIISDTDKICMQLFLDIQ  730


 Score = 68.2 bits (165),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 31/49 (63%), Positives = 36/49 (73%), Gaps = 2/49 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNIISL  257
            IC+  F   D QEYARNL +LGIDA  I SYRSLWQCVAP ++Q+II  
Sbjct  721  ICMQLF--LDIQEYARNLRTLGIDAKEIESYRSLWQCVAPKDKQDIIQF  767



>emb|CDY03412.1| BnaC01g16700D [Brassica napus]
Length=760

 Score =   109 bits (273),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 72/92 (78%), Gaps = 0/92 (0%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            LR +K FL+G++AT YLT+E R E+L      IT RYYE A ++V++AR+TESSLQ+ R 
Sbjct  632  LRHVKAFLEGDKATHYLTQETREEILLRTVTDITRRYYESADEVVSLARRTESSLQQFRR  691

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
             AQ+RAGA+S VSD N+S+TDK+CMQLFLD Q
Sbjct  692  KAQKRAGAASGVSDDNVSETDKMCMQLFLDAQ  723


 Score = 62.4 bits (150),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 35/49 (71%), Gaps = 2/49 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNIISL  257
            +C+  F   D QEY RN+S+LG+  A IP Y SLWQCVAP +RQN IS+
Sbjct  714  MCMQLF--LDAQEYGRNISALGLKPADIPVYCSLWQCVAPADRQNTISV  760



>emb|CDX70811.1| BnaC03g08950D [Brassica napus]
Length=725

 Score =   107 bits (268),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 71/93 (76%), Gaps = 1/93 (1%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            LRPLK FL+G++A  YLT E R ELL G   ++T RYYELAA  ++ ARKTE+ LQK R 
Sbjct  596  LRPLKAFLEGDKARHYLTHETREELLLGTLTEMTRRYYELAAGRLSDARKTETYLQKSRQ  655

Query  572  GAQRRAG-ASSDVSDHNISDTDKICMQLFLDIQ  477
             AQ+RAG A+S V+DHN S T+K+CMQLFLD+Q
Sbjct  656  NAQKRAGAAASGVTDHNESGTEKMCMQLFLDLQ  688


 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 36/55 (65%), Gaps = 2/55 (4%)
 Frame = -2

Query  421  ESTPWYICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNIISL  257
            ES    +C+  F   D QEY RN+ +LG++ A I  Y SLW+CVAP +RQN IS+
Sbjct  673  ESGTEKMCMQLF--LDLQEYGRNICALGLNPADIEPYCSLWKCVAPPDRQNTISV  725



>gb|EMT13194.1| Putative oligomeric Golgi complex subunit 2 [Aegilops tauschii]
Length=621

 Score = 99.4 bits (246),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 73/109 (67%), Gaps = 18/109 (17%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNV-------------  612
            L PLK FL+G+R   YL+++ + +L +G+  KIT  YY++ +++VNV             
Sbjct  477  LHPLKVFLEGDRVH-YLSEDDKTKLRRGSTDKITATYYDMVSEVVNVFYLSTYELLRLYL  535

Query  611  ----ARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
                ARKTESSLQ++R G Q+R G S+D SD+ ISDTDKICMQLFLDIQ
Sbjct  536  FNMKARKTESSLQRLRQGQQKRIGGSTDASDNIISDTDKICMQLFLDIQ  584


 Score = 65.5 bits (158),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 35/47 (74%), Gaps = 2/47 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNII  263
            IC+  F   D QEYARNL +LGIDA  I SYRSLWQCVAP ++Q+ I
Sbjct  575  ICMQLFL--DIQEYARNLRTLGIDAREIESYRSLWQCVAPKDKQDSI  619



>ref|XP_002318717.1| hypothetical protein POPTR_0012s09800g [Populus trichocarpa]
 gb|EEE96937.1| hypothetical protein POPTR_0012s09800g [Populus trichocarpa]
Length=755

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 73/93 (78%), Gaps = 1/93 (1%)
 Frame = -1

Query  752  LRPLKT-FLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIR  576
            L PLK  FLD E+   YLT+E   EL  GAA +IT RYY++  ++V+VARKTESSLQ+++
Sbjct  626  LSPLKKDFLDMEKHNPYLTRETVKELRHGAATEITGRYYDMVVEIVSVARKTESSLQRLK  685

Query  575  LGAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
             GAQRRAG SSDVSD ++SDTDK+CMQ FLDIQ
Sbjct  686  KGAQRRAGVSSDVSDPSVSDTDKLCMQYFLDIQ  718


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 39/49 (80%), Gaps = 2/49 (4%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNIISL  257
            +C+ +F   D QEY RNLS+LG+DA  IP+YRSLWQCVAP +RQN+I L
Sbjct  709  LCMQYF--LDIQEYGRNLSTLGVDAKEIPAYRSLWQCVAPPDRQNVIDL  755



>ref|XP_002966110.1| hypothetical protein SELMODRAFT_86129 [Selaginella moellendorffii]
 gb|EFJ32137.1| hypothetical protein SELMODRAFT_86129 [Selaginella moellendorffii]
Length=714

 Score = 76.3 bits (186),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 57/92 (62%), Gaps = 2/92 (2%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            L+ L+ FL G+    Y++   R E+L   A K+T  Y +   DLV   RKTESSL + R 
Sbjct  591  LQALRAFLQGDH-NAYMSDACRLEILNSVAKKVTKNYDQQIRDLVEGLRKTESSLLRFR-  648

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
             A++R GA  D +D NIS+TDK+C QL LD+Q
Sbjct  649  QARQRTGAGPDANDANISNTDKVCAQLLLDVQ  680


 Score = 41.2 bits (95),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -2

Query  376  DYQEYARNLSSLGIDAATIPSYRSLWQCVAPTER  275
            D QE+ R L  LG+D++ +P ++SLW+ V+  E+
Sbjct  678  DVQEHGRKLDELGVDSSKLPEFQSLWEFVSLQEK  711



>ref|XP_002982190.1| hypothetical protein SELMODRAFT_115746 [Selaginella moellendorffii]
 gb|EFJ16858.1| hypothetical protein SELMODRAFT_115746 [Selaginella moellendorffii]
Length=714

 Score = 75.9 bits (185),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 57/92 (62%), Gaps = 2/92 (2%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            L+ L+ FL G+    Y++   R E+L   A K+T  Y +   DLV   RKTESSL + R 
Sbjct  591  LQALRAFLQGDH-NAYMSDACRLEILNSVAKKVTKNYDQQIRDLVEGLRKTESSLLRFR-  648

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
             A++R GA  D +D NIS+TDK+C QL LD+Q
Sbjct  649  QARQRTGAGPDANDANISNTDKVCAQLLLDVQ  680


 Score = 41.2 bits (95),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -2

Query  376  DYQEYARNLSSLGIDAATIPSYRSLWQCVAPTER  275
            D QE+ R L  LG+D++ +P ++SLW+ V+  E+
Sbjct  678  DVQEHGRKLDELGVDSSKLPEFQSLWEFVSLQEK  711



>ref|XP_001764075.1| predicted protein [Physcomitrella patens]
 gb|EDQ71214.1| predicted protein [Physcomitrella patens]
Length=761

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 68/94 (72%), Gaps = 4/94 (4%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            L+PLKTFL+ +R   ++T E+  EL+   + KIT +Y  LA D+V++AR+TE+SL  +R 
Sbjct  635  LQPLKTFLEDDR-YAHVTNEMHAELIASVSEKITSQYDVLARDMVSMARQTEASLLLLRR  693

Query  572  GAQRRAGASSDVSDHNISD--TDKICMQLFLDIQ  477
            GA++R   S+D +D N+SD  +DKIC QLFLD+Q
Sbjct  694  GARQRGAGSADTTD-NVSDNLSDKICAQLFLDVQ  726


 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 28/40 (70%), Gaps = 2/40 (5%)
 Frame = -2

Query  403  ICLSFFHFSDYQEYARNLSSLGIDAATIPSYRSLWQCVAP  284
            IC   F   D QEY R L++LGI AA +P+Y SLWQCVAP
Sbjct  717  ICAQLFL--DVQEYGRRLAALGITAADLPAYTSLWQCVAP  754



>ref|XP_005644140.1| hypothetical protein COCSUDRAFT_48790 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE19596.1| hypothetical protein COCSUDRAFT_48790 [Coccomyxa subellipsoidea 
C-169]
Length=752

 Score = 60.8 bits (146),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 56/92 (61%), Gaps = 4/92 (4%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            L  L++FLDG+ A   L+ + R E+ QG    +T R+   A +L+   RKTESSL++++ 
Sbjct  629  LSGLRSFLDGQ-AAGRLSPDARAEIAQGVIAGVTQRFANQAGELLENLRKTESSLKRLK-  686

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
              + RAG ++      +SD DK+ +QLFLD Q
Sbjct  687  --KSRAGDAAADGPGALSDADKVNVQLFLDAQ  716


 Score = 42.7 bits (99),  Expect(2) = 1e-13, Method: Composition-based stats.
 Identities = 16/40 (40%), Positives = 24/40 (60%), Gaps = 0/40 (0%)
 Frame = -2

Query  382  FSDYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNII  263
            F D QEY  ++   G+D   +P+Y  LW  VAP ER++ +
Sbjct  712  FLDAQEYGTHVKKFGVDPTGLPAYLELWNAVAPPERRDAV  751



>ref|XP_007023397.1| Golgi organization, COG2 isoform 2 [Theobroma cacao]
 gb|EOY26019.1| Golgi organization, COG2 isoform 2 [Theobroma cacao]
Length=674

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVA  609
            LRPLKTFLDGERATTYLT   R +LL GAA +IT RYYELAADLV+V 
Sbjct  626  LRPLKTFLDGERATTYLTNAARNDLLLGAATEITGRYYELAADLVSVV  673



>ref|XP_005848758.1| hypothetical protein CHLNCDRAFT_57543 [Chlorella variabilis]
 gb|EFN56656.1| hypothetical protein CHLNCDRAFT_57543 [Chlorella variabilis]
Length=767

 Score = 50.8 bits (120),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 50/93 (54%), Gaps = 9/93 (10%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            L PL  FL  + A+  L+ E R +L       ++ RY  LAAD ++  RKTESSL++++ 
Sbjct  647  LAPLHQFLQADVASK-LSPEARQQLAVAVVTGVSGRYLHLAADTLSTVRKTESSLKRLKA  705

Query  572  GAQRRAGASSDVSDHNISDTDK-ICMQLFLDIQ  477
              Q   G ++        DTDK I  QL LD+Q
Sbjct  706  RQQGGEGGAAP-------DTDKMIGQQLLLDVQ  731


 Score = 45.8 bits (107),  Expect(2) = 2e-11, Method: Composition-based stats.
 Identities = 18/36 (50%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = -2

Query  376  DYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQN  269
            D QE+ R  +  G+DAA + SYR LWQ VAP E+++
Sbjct  729  DVQEFGRQATQAGVDAAQLDSYRQLWQMVAPEEQKD  764



>gb|AES73454.2| oligomeric subunit-like protein [Medicago truncatula]
Length=468

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 48/67 (72%), Gaps = 1/67 (1%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            LRPLK FL GE+  +YL  E + E+L  AA +ITDRYYELAADLV V+R+ E SLQKIR 
Sbjct  398  LRPLKAFLGGEK-ISYLASETKNEILLYAATEITDRYYELAADLVIVSRRKEYSLQKIRQ  456

Query  572  GAQRRAG  552
             A+   G
Sbjct  457  SAETSRG  463



>ref|XP_010233328.1| PREDICTED: protein FAR1-RELATED SEQUENCE 5-like [Brachypodium 
distachyon]
Length=308

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -1

Query  611  ARKTESSLQKIRLGAQRRAGASSDVSDHNISDTDKICMQLFLDI  480
            ARKTESSLQ++R GAQR+ GAS+D S + ISDTDKICMQLFLDI
Sbjct  265  ARKTESSLQRLRQGAQRQVGASTDASGNVISDTDKICMQLFLDI  308



>ref|XP_001416921.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO95214.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=766

 Score = 64.3 bits (155),  Expect(2) = 6e-09, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 54/90 (60%), Gaps = 8/90 (9%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            L PL+ FLD ER T   +K  R E++      +++RY E+A+DLV   +KTE+SL +++ 
Sbjct  650  LAPLQAFLDNER-TKMFSKTSRQEIVDKVVDSVSERYAEMASDLVATVKKTEASLNRLK-  707

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLD  483
                R G +S      + DTDKIC QL+LD
Sbjct  708  ---DRQGKTSST---GVGDTDKICRQLYLD  731


 Score = 23.5 bits (49),  Expect(2) = 6e-09, Method: Composition-based stats.
 Identities = 9/32 (28%), Positives = 16/32 (50%), Gaps = 0/32 (0%)
 Frame = -2

Query  382  FSDYQEYARNLSSLGIDAATIPSYRSLWQCVA  287
            + D +EYA  +   G+ +    ++  LW  VA
Sbjct  729  YLDAKEYAVQMEKFGVVSTNSDAFNELWSNVA  760



>ref|XP_003078128.1| Low density lipoprotein receptor (ISS) [Ostreococcus tauri]
 emb|CAL52868.1| Conserved oligomeric Golgi complex, subunit 2,N-terminal [Ostreococcus 
tauri]
Length=799

 Score = 58.5 bits (140),  Expect(2) = 7e-08, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 53/90 (59%), Gaps = 8/90 (9%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            L PL+TF+D ER T  L+K    E++      + ++Y ELA DL+   +KTE+SL +++ 
Sbjct  681  LAPLQTFVDNER-TKALSKTSTHEIVTQVVETVCEKYGELARDLLETVKKTEASLNRLK-  738

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLD  483
                R G +S+       D+DKIC QL+LD
Sbjct  739  ---DRQGKASNA---GTGDSDKICRQLYLD  762


 Score = 25.4 bits (54),  Expect(2) = 7e-08, Method: Composition-based stats.
 Identities = 8/31 (26%), Positives = 17/31 (55%), Gaps = 0/31 (0%)
 Frame = -2

Query  382  FSDYQEYARNLSSLGIDAATIPSYRSLWQCV  290
            + D +E+   +   G+D     ++R+LW+ V
Sbjct  760  YLDAKEFETQMKKFGVDPRDSNAFRALWEAV  790



>gb|AFW66982.1| hypothetical protein ZEAMMB73_946461, partial [Zea mays]
Length=46

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  370  QEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNIISL  257
            QEYARNL ++GIDA  I SYR+LWQCVAP +RQ  I  
Sbjct  9    QEYARNLRAIGIDAREIDSYRALWQCVAPKDRQENIQF  46



>ref|XP_007510910.1| predicted protein [Bathycoccus prasinos]
 emb|CCO66470.1| predicted protein [Bathycoccus prasinos]
Length=955

 Score = 53.1 bits (126),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 54/97 (56%), Gaps = 10/97 (10%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLT----KELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQ  585
            L+PL  F +  + T  L+    KEL  E+ +G    +T +Y E+A+DLV    KTE+SL 
Sbjct  827  LQPLSKFCEESQRTRRLSPIAAKELTREVCEG----VTKKYAEMASDLVATVLKTEASLN  882

Query  584  KI--RLGAQRRAGASSDVSDHNISDTDKICMQLFLDI  480
            ++  R G    A A +  +   +SDTDKI  QL LD+
Sbjct  883  RLKDRQGKGTAASADATKTGGKLSDTDKILKQLHLDV  919


 Score = 28.9 bits (63),  Expect(2) = 3e-07, Method: Composition-based stats.
 Identities = 10/33 (30%), Positives = 21/33 (64%), Gaps = 0/33 (0%)
 Frame = -2

Query  376  DYQEYARNLSSLGIDAATIPSYRSLWQCVAPTE  278
            D  EYA  L S+ +  +++ ++ +LW+ +AP +
Sbjct  918  DVAEYASRLISVNVQPSSLEAFPALWKALAPED  950



>ref|XP_006817460.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Saccoglossus kowalevskii]
Length=672

 Score = 53.1 bits (126),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 58/94 (62%), Gaps = 9/94 (10%)
 Frame = -1

Query  752  LRPLKTFL--DGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKI  579
            ++PL+ FL  +GE+  T    + R ELL G    +T  Y+ + +D+++  RK E SL+K+
Sbjct  553  IKPLQLFLEENGEKIKT----DRRGELLSGILTLLTQEYFGVTSDVLDSVRKMEESLKKL  608

Query  578  RLGAQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
            ++   R+  + S+ S + +SD DKI +QL LD++
Sbjct  609  KM---RKVTSVSNFSANGMSDDDKIRLQLALDVR  639


 Score = 28.5 bits (62),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 11/29 (38%), Positives = 19/29 (66%), Gaps = 0/29 (0%)
 Frame = -2

Query  376  DYQEYARNLSSLGIDAATIPSYRSLWQCV  290
            D +++A  + +LGI ++ IP Y SL + V
Sbjct  637  DVRQFAEEMDNLGIKSSDIPKYDSLSELV  665



>ref|XP_002132051.1| PREDICTED: conserved oligomeric Golgi complex subunit 2-like 
[Ciona intestinalis]
Length=705

 Score = 56.2 bits (134),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 30/94 (32%), Positives = 55/94 (59%), Gaps = 5/94 (5%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESS---LQK  582
            ++P+  F  G+  T+Y+  EL    L   A  I+DR++ + ++++   RK E S   LQK
Sbjct  579  MKPIVAFHGGQ--TSYINDELLSHWLTQVAIPISDRFHSVVSEVLTSVRKMEESLLRLQK  636

Query  581  IRLGAQRRAGASSDVSDHNISDTDKICMQLFLDI  480
            +R G +  +   + ++  ++SD DKI +QLF+D+
Sbjct  637  MRSGGKSSSSNLAALAGSSLSDDDKIRLQLFIDV  670



>ref|XP_002501700.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO62958.1| predicted protein [Micromonas sp. RCC299]
Length=779

 Score = 43.9 bits (102),  Expect(2) = 5e-05, Method: Composition-based stats.
 Identities = 29/93 (31%), Positives = 46/93 (49%), Gaps = 4/93 (4%)
 Frame = -1

Query  746  PLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIR---  576
            PLK F++       L+ E   ++       +  +Y E+A++LV   +KTE+SL +++   
Sbjct  646  PLKLFVEQTARKKILSAESATQVAMAVGEYVAGKYAEMASELVAGVKKTEASLNRLKDRR  705

Query  575  -LGAQRRAGASSDVSDHNISDTDKICMQLFLDI  480
                   A    D  +   SDTDKIC QL LD+
Sbjct  706  AAKDGGSAAGGGDDGEKGPSDTDKICKQLLLDV  738


 Score = 30.4 bits (67),  Expect(2) = 5e-05, Method: Composition-based stats.
 Identities = 13/43 (30%), Positives = 20/43 (47%), Gaps = 0/43 (0%)
 Frame = -2

Query  376  DYQEYARNLSSLGIDAATIPSYRSLWQCVAPTERQNIISLYSA  248
            D  E+   L+ LG D A    ++ LW  VAP   + +    +A
Sbjct  737  DVVEFGTQLTKLGTDPARSEKFKELWSLVAPEGEKQVPVFLTA  779



>gb|KIZ07920.1| Conserved oligomeric Golgi complex subunit 2 [Monoraphidium neglectum]
Length=787

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 33/94 (35%), Positives = 50/94 (53%), Gaps = 2/94 (2%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            L PL+  LD   A   L   ++  L       +  RY +LA +L+   RKTESSL++++ 
Sbjct  582  LAPLRQALDAPGAPQRLPPGVKLALAAAVFDSVNRRYAQLAEELLGSVRKTESSLKRLKK  641

Query  572  G--AQRRAGASSDVSDHNISDTDKICMQLFLDIQ  477
            G       GA +      ++D+DKIC+QL+LD Q
Sbjct  642  GRAPDGGGGADAGGGAAEMNDSDKICLQLYLDAQ  675



>ref|XP_007127671.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Physeter 
catodon]
Length=717

 Score = 50.4 bits (119),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 29/91 (32%), Positives = 50/91 (55%), Gaps = 2/91 (2%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            L+PL    +G +    L + +  + L+GA  + T +YYE  +D++N  RK E SL++++ 
Sbjct  590  LKPLYQLQNGHKDK--LKQAIIQQWLEGALSESTHKYYETVSDVLNSVRKMEESLKRLKQ  647

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDI  480
              +      +  S   +SD DKI +QL LD+
Sbjct  648  ARRTAPATPAGPSGGGMSDDDKIRLQLALDV  678



>ref|XP_005020290.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Anas 
platyrhynchos]
Length=735

 Score = 50.4 bits (119),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 48/77 (62%), Gaps = 3/77 (4%)
 Frame = -1

Query  704  LTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRLGAQRRAGASSDV-SDH  528
            L + +  + L+GA  + T +YYE  +D++N  +K E SL+  RL   R+  AS+ V ++ 
Sbjct  623  LKQPMIHQWLEGALSESTQKYYETVSDVLNSVKKMEESLK--RLKQARKTAASNPVGTNG  680

Query  527  NISDTDKICMQLFLDIQ  477
             +SD DKI +QL LD++
Sbjct  681  GMSDDDKIRLQLALDVE  697



>gb|EOB00851.1| Conserved oligomeric Golgi complex subunit 2, partial [Anas platyrhynchos]
Length=717

 Score = 50.4 bits (119),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 48/77 (62%), Gaps = 3/77 (4%)
 Frame = -1

Query  704  LTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRLGAQRRAGASSDV-SDH  528
            L + +  + L+GA  + T +YYE  +D++N  +K E SL+  RL   R+  AS+ V ++ 
Sbjct  605  LKQPMIHQWLEGALSESTQKYYETVSDVLNSVKKMEESLK--RLKQARKTAASNPVGTNG  662

Query  527  NISDTDKICMQLFLDIQ  477
             +SD DKI +QL LD++
Sbjct  663  GMSDDDKIRLQLALDVE  679



>ref|XP_004310291.1| PREDICTED: conserved oligomeric Golgi complex subunit 2 [Tursiops 
truncatus]
Length=739

 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 29/91 (32%), Positives = 49/91 (54%), Gaps = 2/91 (2%)
 Frame = -1

Query  752  LRPLKTFLDGERATTYLTKELRFELLQGAAFKITDRYYELAADLVNVARKTESSLQKIRL  573
            L+PL     G +    L + +  + L+GA  + T +YYE  +D++N  RK E SL++++ 
Sbjct  612  LKPLHQLQSGHKDK--LKQAIIQQWLEGALSESTHKYYETVSDVLNSVRKMEESLKRLKQ  669

Query  572  GAQRRAGASSDVSDHNISDTDKICMQLFLDI  480
              +      +  S   +SD DKI +QL LD+
Sbjct  670  ARRTAPATPAGPSGGGMSDDDKIRLQLALDV  700



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1387667965840