BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF008L05

Length=718
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011089543.1|  PREDICTED: root phototropism protein 2-like        248   1e-74   Sesamum indicum [beniseed]
ref|XP_009777101.1|  PREDICTED: root phototropism protein 2             248   2e-74   Nicotiana sylvestris
ref|XP_009611218.1|  PREDICTED: root phototropism protein 2             247   4e-74   Nicotiana tomentosiformis
gb|KHG08105.1|  Root phototropism 2 -like protein                       242   6e-73   Gossypium arboreum [tree cotton]
gb|KJB26283.1|  hypothetical protein B456_004G235100                    243   6e-73   Gossypium raimondii
emb|CDP04035.1|  unnamed protein product                                243   1e-72   Coffea canephora [robusta coffee]
gb|KJB26282.1|  hypothetical protein B456_004G235100                    242   1e-72   Gossypium raimondii
gb|KJB26284.1|  hypothetical protein B456_004G235100                    243   2e-72   Gossypium raimondii
ref|XP_010244564.1|  PREDICTED: root phototropism protein 2             240   1e-71   Nelumbo nucifera [Indian lotus]
ref|XP_006432049.1|  hypothetical protein CICLE_v10000673mg             231   3e-70   
emb|CBI15802.3|  unnamed protein product                                225   5e-70   Vitis vinifera
ref|XP_007017103.1|  Phototropic-responsive NPH3 family protein         234   2e-69   
gb|EYU36889.1|  hypothetical protein MIMGU_mgv1a003487mg                234   5e-69   Erythranthe guttata [common monkey flower]
ref|XP_006432045.1|  hypothetical protein CICLE_v10000673mg             231   2e-68   
ref|XP_006432046.1|  hypothetical protein CICLE_v10000673mg             231   7e-68   Citrus clementina [clementine]
ref|XP_006353728.1|  PREDICTED: root phototropism protein 2-like        230   8e-68   Solanum tuberosum [potatoes]
ref|XP_004243653.1|  PREDICTED: root phototropism protein 2             229   2e-67   Solanum lycopersicum
gb|KDO54918.1|  hypothetical protein CISIN_1g007944mg                   228   3e-67   Citrus sinensis [apfelsine]
gb|KDO54917.1|  hypothetical protein CISIN_1g007944mg                   228   9e-67   Citrus sinensis [apfelsine]
ref|XP_010650806.1|  PREDICTED: root phototropism protein 2 isofo...    226   1e-66   
ref|XP_002264896.1|  PREDICTED: root phototropism protein 2 isofo...    226   2e-66   Vitis vinifera
gb|KDP45678.1|  hypothetical protein JCGZ_17285                         226   4e-66   Jatropha curcas
ref|XP_004147730.1|  PREDICTED: root phototropism protein 2-like        224   2e-65   Cucumis sativus [cucumbers]
gb|KGN53487.1|  hypothetical protein Csa_4G056750                       223   3e-65   Cucumis sativus [cucumbers]
ref|XP_002533880.1|  Root phototropism protein, putative                223   3e-65   
ref|XP_011041764.1|  PREDICTED: root phototropism protein 2-like        223   3e-65   Populus euphratica
ref|XP_010677799.1|  PREDICTED: root phototropism protein 2             223   3e-65   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002325631.1|  ROOT PHOTOTROPISM 2 family protein                 223   3e-65   Populus trichocarpa [western balsam poplar]
ref|XP_011011776.1|  PREDICTED: root phototropism protein 2-like        223   7e-65   Populus euphratica
ref|XP_002319980.1|  ROOT PHOTOTROPISM 2 family protein                 223   7e-65   
ref|XP_008451888.1|  PREDICTED: root phototropism protein 2 isofo...    223   7e-65   Cucumis melo [Oriental melon]
ref|XP_010094443.1|  Root phototropism protein 2                        221   2e-64   Morus notabilis
ref|XP_011015900.1|  PREDICTED: root phototropism protein 2-like        219   1e-63   Populus euphratica
ref|XP_003544940.2|  PREDICTED: root phototropism protein 2-like        219   2e-63   Glycine max [soybeans]
ref|XP_008451887.1|  PREDICTED: root phototropism protein 2 isofo...    221   2e-63   
ref|XP_004294714.1|  PREDICTED: root phototropism protein 2             218   3e-63   Fragaria vesca subsp. vesca
ref|XP_006293884.1|  hypothetical protein CARUB_v10022870mg             218   6e-63   Capsella rubella
ref|XP_007142019.1|  hypothetical protein PHAVU_008G245700g             218   6e-63   Phaseolus vulgaris [French bean]
ref|XP_006591739.1|  PREDICTED: root phototropism protein 2-like        216   9e-63   Glycine max [soybeans]
gb|ACJ85866.1|  unknown                                                 212   9e-63   Medicago truncatula
ref|XP_006842585.1|  hypothetical protein AMTR_s00077p00161250          216   1e-62   Amborella trichopoda
ref|XP_003553189.1|  PREDICTED: root phototropism protein 2-like        216   1e-62   Glycine max [soybeans]
ref|XP_007206420.1|  hypothetical protein PRUPE_ppa003347mg             216   2e-62   Prunus persica
gb|KEH28209.1|  root phototropism-like protein                          215   2e-62   Medicago truncatula
dbj|BAJ33924.1|  unnamed protein product                                216   2e-62   Eutrema halophilum
ref|XP_010023564.1|  PREDICTED: root phototropism protein 2             215   3e-62   Eucalyptus grandis [rose gum]
ref|XP_007146905.1|  hypothetical protein PHAVU_006G080400g             215   5e-62   Phaseolus vulgaris [French bean]
ref|XP_009374407.1|  PREDICTED: root phototropism protein 2-like        215   5e-62   Pyrus x bretschneideri [bai li]
ref|XP_010469846.1|  PREDICTED: root phototropism protein 2 isofo...    215   5e-62   
gb|AAB63086.1|  unknown protein                                         211   7e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003616056.1|  Root phototropism protein                          214   8e-62   Medicago truncatula
gb|ADL36608.1|  BZIP domain class transcription factor                  214   8e-62   Malus domestica [apple tree]
gb|ACJ85743.1|  unknown                                                 206   8e-62   Medicago truncatula
gb|EPS73802.1|  hypothetical protein M569_00954                         214   8e-62   Genlisea aurea
ref|XP_003519296.1|  PREDICTED: root phototropism protein 2             214   1e-61   
ref|XP_010414259.1|  PREDICTED: root phototropism protein 2-like        214   1e-61   Camelina sativa [gold-of-pleasure]
ref|XP_010522018.1|  PREDICTED: root phototropism protein 2-like        213   2e-61   Tarenaya hassleriana [spider flower]
ref|XP_002881117.1|  hypothetical protein ARALYDRAFT_481966             213   4e-61   
ref|XP_008239637.1|  PREDICTED: root phototropism protein 2 isofo...    213   4e-61   Prunus mume [ume]
ref|XP_008239576.1|  PREDICTED: root phototropism protein 2 isofo...    213   4e-61   Prunus mume [ume]
ref|XP_010557176.1|  PREDICTED: root phototropism protein 2             213   4e-61   Tarenaya hassleriana [spider flower]
ref|NP_001280895.1|  root phototropism protein 2-like                   213   5e-61   Malus domestica [apple tree]
ref|XP_010510344.1|  PREDICTED: root phototropism protein 2-like        213   5e-61   Camelina sativa [gold-of-pleasure]
ref|NP_001031446.1|  Root phototropism protein 2                        211   8e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008366216.1|  PREDICTED: root phototropism protein 2-like        212   9e-61   
dbj|BAF02185.1|  hypothetical protein                                   211   1e-60   Arabidopsis thaliana [mouse-ear cress]
ref|NP_850147.1|  Root phototropism protein 2                           211   1e-60   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF01791.1|  hypothetical protein                                   211   2e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009355145.1|  PREDICTED: root phototropism protein 2-like        211   2e-60   Pyrus x bretschneideri [bai li]
gb|AAF33112.1|AF181683_1  RPT2                                          210   4e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004490729.1|  PREDICTED: root phototropism protein 2-like        209   5e-60   Cicer arietinum [garbanzo]
ref|NP_001280845.1|  root phototropism protein 2-like                   208   1e-59   Malus domestica [apple tree]
ref|XP_003600551.1|  Root phototropism protein                          207   2e-59   
gb|AES70802.2|  root phototropism-like protein                          207   3e-59   Medicago truncatula
ref|XP_008349518.1|  PREDICTED: LOW QUALITY PROTEIN: root phototr...    207   3e-59   
ref|XP_003600550.1|  Root phototropism protein                          207   5e-59   Medicago truncatula
gb|KFK22949.1|  root phototropism protein 2                             207   7e-59   Arabis alpina [alpine rockcress]
gb|KHN24717.1|  Root phototropism protein 2                             194   1e-58   Glycine soja [wild soybean]
ref|XP_004500391.1|  PREDICTED: root phototropism protein 2-like        204   8e-58   Cicer arietinum [garbanzo]
emb|CDX84827.1|  BnaA03g14030D                                          201   5e-57   
ref|XP_009132742.1|  PREDICTED: root phototropism protein 2-like        201   6e-57   Brassica rapa
ref|XP_009402206.1|  PREDICTED: root phototropism protein 2 isofo...    199   3e-56   
emb|CDY10743.1|  BnaA05g11930D                                          199   4e-56   Brassica napus [oilseed rape]
ref|XP_009144295.1|  PREDICTED: root phototropism protein 2             199   4e-56   Brassica rapa
emb|CDY23992.1|  BnaC03g16990D                                          199   5e-56   Brassica napus [oilseed rape]
ref|XP_009402205.1|  PREDICTED: root phototropism protein 2 isofo...    199   6e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010044625.1|  PREDICTED: root phototropism protein 2-like        198   7e-56   Eucalyptus grandis [rose gum]
gb|KCW86718.1|  hypothetical protein EUGRSUZ_B03325                     198   9e-56   Eucalyptus grandis [rose gum]
ref|XP_009384760.1|  PREDICTED: root phototropism protein 2-like ...    195   6e-55   
ref|XP_009384759.1|  PREDICTED: root phototropism protein 2-like ...    195   1e-54   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY02075.1|  BnaC04g14260D                                          192   3e-53   
ref|XP_011080638.1|  PREDICTED: root phototropism protein 2             184   1e-50   Sesamum indicum [beniseed]
gb|KHN18647.1|  Root phototropism protein 2                             175   2e-49   Glycine soja [wild soybean]
ref|XP_010922790.1|  PREDICTED: root phototropism protein 2             177   4e-48   Elaeis guineensis
ref|XP_004978520.1|  PREDICTED: root phototropism protein 2-like        167   4e-44   Setaria italica
ref|XP_009374446.1|  PREDICTED: putative disease resistance prote...    169   9e-44   Pyrus x bretschneideri [bai li]
gb|EMS47631.1|  Root phototropism protein 2                             162   2e-43   Triticum urartu
ref|XP_008669932.1|  PREDICTED: root phototropism protein 2-like        161   3e-42   Zea mays [maize]
ref|XP_004977394.1|  PREDICTED: root phototropism protein 2-like        160   9e-42   Setaria italica
ref|XP_008803009.1|  PREDICTED: root phototropism protein 2             159   3e-41   Phoenix dactylifera
ref|XP_002450159.1|  hypothetical protein SORBIDRAFT_05g001300          156   2e-40   
dbj|BAJ91259.1|  predicted protein                                      155   5e-40   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ92463.1|  predicted protein                                      155   6e-40   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002463481.1|  hypothetical protein SORBIDRAFT_01g000540          149   1e-39   
ref|XP_003577852.1|  PREDICTED: root phototropism protein 2             149   7e-38   Brachypodium distachyon [annual false brome]
ref|XP_006663162.1|  PREDICTED: root phototropism protein 2-like        146   4e-37   
gb|EEC68739.1|  hypothetical protein OsI_37246                          134   1e-32   Oryza sativa Indica Group [Indian rice]
gb|ABG22339.1|  RPT2, putative, expressed                               132   4e-32   Oryza sativa Japonica Group [Japonica rice]
gb|ABA95649.1|  RPT2, putative, expressed                               132   6e-32   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001065596.1|  Os11g0118300                                       132   7e-32   
ref|NP_001066000.1|  Os12g0117400                                       132   7e-32   
gb|EEC67555.1|  hypothetical protein OsI_34888                          132   9e-32   Oryza sativa Indica Group [Indian rice]
gb|AFW55920.1|  putative phototropic-responsive NPH3 family protein     126   2e-29   
ref|NP_001147592.1|  LOC100281201                                       125   2e-29   
ref|XP_008661889.1|  PREDICTED: LOC100281201 isoform X1                 126   2e-29   
gb|AAV50010.1|  phototropic response-like protein                       113   9e-28   Malus domestica [apple tree]
dbj|BAF95168.1|  similar to ROOT PHOTOTROPISM2 protein binding          109   1e-26   Ipomoea nil [qian niu]
ref|XP_002441790.1|  hypothetical protein SORBIDRAFT_08g002330          112   2e-24   
ref|XP_010272171.1|  PREDICTED: BTB/POZ domain-containing protein...  95.9    6e-19   Nelumbo nucifera [Indian lotus]
ref|XP_010277089.1|  PREDICTED: BTB/POZ domain-containing protein...  94.7    2e-18   
ref|XP_010277091.1|  PREDICTED: BTB/POZ domain-containing protein...  94.4    2e-18   
ref|XP_011012052.1|  PREDICTED: BTB/POZ domain-containing protein...  92.8    5e-18   Populus euphratica
ref|XP_011006800.1|  PREDICTED: BTB/POZ domain-containing protein...  92.8    5e-18   Populus euphratica
ref|XP_011012051.1|  PREDICTED: BTB/POZ domain-containing protein...  92.8    6e-18   Populus euphratica
ref|XP_011006799.1|  PREDICTED: BTB/POZ domain-containing protein...  92.8    6e-18   Populus euphratica
ref|XP_008787157.1|  PREDICTED: BTB/POZ domain-containing protein...  92.0    1e-17   Phoenix dactylifera
gb|KHN36285.1|  BTB/POZ domain-containing protein                     91.3    2e-17   Glycine soja [wild soybean]
ref|XP_003517336.1|  PREDICTED: BTB/POZ domain-containing protein...  90.5    4e-17   Glycine max [soybeans]
ref|XP_002533158.1|  Root phototropism protein, putative              90.1    6e-17   Ricinus communis
ref|XP_006579934.1|  PREDICTED: BTB/POZ domain-containing protein...  89.7    7e-17   Glycine max [soybeans]
ref|XP_006380639.1|  hypothetical protein POPTR_0007s10060g           89.7    7e-17   Populus trichocarpa [western balsam poplar]
ref|XP_006590635.1|  PREDICTED: BTB/POZ domain-containing protein...  89.4    9e-17   Glycine max [soybeans]
ref|XP_003538794.2|  PREDICTED: BTB/POZ domain-containing protein...  89.4    9e-17   Glycine max [soybeans]
gb|KHN12984.1|  BTB/POZ domain-containing protein                     89.4    9e-17   Glycine soja [wild soybean]
ref|XP_009411062.1|  PREDICTED: BTB/POZ domain-containing protein...  89.0    1e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006380638.1|  hypothetical protein POPTR_0007s10060g           89.0    1e-16   
ref|XP_002970426.1|  hypothetical protein SELMODRAFT_231529           88.6    2e-16   
gb|EEC74727.1|  hypothetical protein OsI_10455                        88.6    2e-16   Oryza sativa Indica Group [Indian rice]
gb|AAN77296.1|  Hypothetical protein                                  88.6    2e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002978505.1|  hypothetical protein SELMODRAFT_443843           88.2    2e-16   Selaginella moellendorffii
ref|XP_010412681.1|  PREDICTED: putative BTB/POZ domain-containin...  84.0    7e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010559030.1|  PREDICTED: BTB/POZ domain-containing protein...  85.1    3e-15   Tarenaya hassleriana [spider flower]
ref|XP_010559028.1|  PREDICTED: BTB/POZ domain-containing protein...  85.1    3e-15   Tarenaya hassleriana [spider flower]
ref|XP_006600924.1|  PREDICTED: BTB/POZ domain-containing protein...  84.7    3e-15   Glycine max [soybeans]
ref|XP_010905283.1|  PREDICTED: BTB/POZ domain-containing protein...  84.3    3e-15   Elaeis guineensis
ref|XP_010905282.1|  PREDICTED: BTB/POZ domain-containing protein...  84.7    4e-15   Elaeis guineensis
emb|CDP02580.1|  unnamed protein product                              84.3    4e-15   Coffea canephora [robusta coffee]
gb|KJB48679.1|  hypothetical protein B456_008G080700                  82.8    4e-15   Gossypium raimondii
ref|XP_004511862.1|  PREDICTED: BTB/POZ domain-containing protein...  84.3    5e-15   Cicer arietinum [garbanzo]
ref|XP_004511860.1|  PREDICTED: BTB/POZ domain-containing protein...  84.3    5e-15   Cicer arietinum [garbanzo]
ref|XP_010028106.1|  PREDICTED: BTB/POZ domain-containing protein...  84.0    6e-15   Eucalyptus grandis [rose gum]
ref|XP_010028107.1|  PREDICTED: BTB/POZ domain-containing protein...  84.0    6e-15   Eucalyptus grandis [rose gum]
ref|XP_002983725.1|  hypothetical protein SELMODRAFT_228979           84.0    6e-15   Selaginella moellendorffii
ref|XP_004511857.1|  PREDICTED: BTB/POZ domain-containing protein...  84.0    7e-15   
ref|XP_004511859.1|  PREDICTED: BTB/POZ domain-containing protein...  84.0    7e-15   
ref|XP_010412682.1|  PREDICTED: putative BTB/POZ domain-containin...  83.6    8e-15   Camelina sativa [gold-of-pleasure]
ref|XP_008238282.1|  PREDICTED: BTB/POZ domain-containing protein...  83.6    8e-15   
ref|XP_010028108.1|  PREDICTED: BTB/POZ domain-containing protein...  83.2    9e-15   Eucalyptus grandis [rose gum]
ref|XP_009342777.1|  PREDICTED: BTB/POZ domain-containing protein...  83.2    1e-14   Pyrus x bretschneideri [bai li]
ref|XP_008341358.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...  83.2    1e-14   
ref|XP_008354715.1|  PREDICTED: BTB/POZ domain-containing protein...  83.2    1e-14   
ref|XP_007156731.1|  hypothetical protein PHAVU_002G012500g           83.2    1e-14   Phaseolus vulgaris [French bean]
ref|XP_002989054.1|  hypothetical protein SELMODRAFT_272040           82.8    1e-14   Selaginella moellendorffii
ref|XP_007047478.1|  Phototropic-responsive NPH3 family protein       82.8    1e-14   
gb|KHG27515.1|  hypothetical protein F383_13864                       82.4    1e-14   Gossypium arboreum [tree cotton]
ref|XP_009115683.1|  PREDICTED: BTB/POZ domain-containing protein...  82.4    2e-14   Brassica rapa
gb|KJB48678.1|  hypothetical protein B456_008G080700                  82.4    2e-14   Gossypium raimondii
ref|XP_009115684.1|  PREDICTED: BTB/POZ domain-containing protein...  82.4    2e-14   Brassica rapa
ref|XP_009782405.1|  PREDICTED: BTB/POZ domain-containing protein...  82.4    2e-14   Nicotiana sylvestris
ref|XP_002465671.1|  hypothetical protein SORBIDRAFT_01g043470        82.4    2e-14   
ref|XP_006466487.1|  PREDICTED: BTB/POZ domain-containing protein...  82.4    2e-14   Citrus sinensis [apfelsine]
gb|KJB48677.1|  hypothetical protein B456_008G080700                  82.0    2e-14   Gossypium raimondii
gb|KDO78972.1|  hypothetical protein CISIN_1g006971mg                 82.0    2e-14   Citrus sinensis [apfelsine]
ref|XP_004149698.1|  PREDICTED: BTB/POZ domain-containing protein...  82.0    2e-14   
ref|XP_006426057.1|  hypothetical protein CICLE_v10025164mg           82.0    2e-14   Citrus clementina [clementine]
ref|XP_010086959.1|  BTB/POZ domain-containing protein                82.0    3e-14   
emb|CAN71562.1|  hypothetical protein VITISV_007563                   81.6    3e-14   Vitis vinifera
ref|XP_002284242.2|  PREDICTED: BTB/POZ domain-containing protein...  81.6    3e-14   Vitis vinifera
ref|XP_006339816.1|  PREDICTED: BTB/POZ domain-containing protein...  81.6    4e-14   Solanum tuberosum [potatoes]
gb|EPS72379.1|  hypothetical protein M569_02379                       81.3    5e-14   Genlisea aurea
gb|KEH27511.1|  phototropic-responsive NPH3 family protein            80.5    7e-14   Medicago truncatula
ref|XP_003597110.1|  Root phototropism protein                        80.9    7e-14   
ref|XP_004231910.1|  PREDICTED: BTB/POZ domain-containing protein...  80.9    7e-14   Solanum lycopersicum
gb|ACL53070.1|  unknown                                               80.1    8e-14   Zea mays [maize]
gb|KFK28391.1|  hypothetical protein AALP_AA8G509000                  80.5    9e-14   Arabis alpina [alpine rockcress]
ref|XP_010426528.1|  PREDICTED: putative BTB/POZ domain-containin...  79.7    1e-13   Camelina sativa [gold-of-pleasure]
tpg|DAA43883.1|  TPA: putative phototropic-responsive NPH3 family...  80.1    1e-13   
gb|KFK34271.1|  hypothetical protein AALP_AA5G123300                  79.7    1e-13   Arabis alpina [alpine rockcress]
gb|KDP32052.1|  hypothetical protein JCGZ_12513                       79.7    2e-13   Jatropha curcas
ref|XP_007208165.1|  hypothetical protein PRUPE_ppa002888mg           79.3    2e-13   Prunus persica
ref|XP_009780159.1|  PREDICTED: BTB/POZ domain-containing protein...  79.3    2e-13   Nicotiana sylvestris
emb|CDY37857.1|  BnaAnng05180D                                        79.3    2e-13   Brassica napus [oilseed rape]
gb|ACL52494.1|  unknown                                               79.0    2e-13   Zea mays [maize]
ref|XP_004509079.1|  PREDICTED: BTB/POZ domain-containing protein...  79.0    2e-13   Cicer arietinum [garbanzo]
dbj|BAK07863.1|  predicted protein                                    79.0    3e-13   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY30615.1|  BnaAnng03900D                                        78.6    3e-13   Brassica napus [oilseed rape]
ref|XP_007155848.1|  hypothetical protein PHAVU_003G236800g           78.6    3e-13   Phaseolus vulgaris [French bean]
ref|XP_009628088.1|  PREDICTED: BTB/POZ domain-containing protein...  78.6    4e-13   Nicotiana tomentosiformis
gb|AES90666.2|  phototropic-responsive NPH3 family protein            78.2    4e-13   Medicago truncatula
ref|XP_008457766.1|  PREDICTED: BTB/POZ domain-containing protein...  77.8    6e-13   
ref|XP_008457767.1|  PREDICTED: BTB/POZ domain-containing protein...  77.8    6e-13   Cucumis melo [Oriental melon]
ref|XP_006841959.1|  hypothetical protein AMTR_s00144p00020600        77.8    7e-13   Amborella trichopoda
ref|XP_006364419.1|  PREDICTED: BTB/POZ domain-containing protein...  77.4    7e-13   Solanum tuberosum [potatoes]
ref|XP_006393938.1|  hypothetical protein EUTSA_v10003858mg           77.4    7e-13   Eutrema salsugineum [saltwater cress]
dbj|BAJ34215.1|  unnamed protein product                              77.4    7e-13   Eutrema halophilum
ref|XP_009379312.1|  PREDICTED: BTB/POZ domain-containing protein...  77.0    8e-13   
ref|XP_009630229.1|  PREDICTED: BTB/POZ domain-containing protein...  77.4    9e-13   Nicotiana tomentosiformis
ref|NP_001152299.1|  transposon protein Mutator sub-class             77.0    1e-12   Zea mays [maize]
ref|XP_009379310.1|  PREDICTED: BTB/POZ domain-containing protein...  77.0    1e-12   Pyrus x bretschneideri [bai li]
ref|XP_010503666.1|  PREDICTED: putative BTB/POZ domain-containin...  77.0    1e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010939121.1|  PREDICTED: BTB/POZ domain-containing protein...  76.6    1e-12   Elaeis guineensis
ref|NP_680473.2|  phototropic-responsive NPH3-like protein            76.6    1e-12   Arabidopsis thaliana [mouse-ear cress]
gb|AAU05485.1|  At5g67385                                             76.6    1e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009130549.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...  76.6    2e-12   Brassica rapa
ref|XP_010484507.1|  PREDICTED: BTB/POZ domain-containing protein...  76.3    2e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010484509.1|  PREDICTED: BTB/POZ domain-containing protein...  76.3    2e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010464139.1|  PREDICTED: BTB/POZ domain-containing protein...  76.3    2e-12   Camelina sativa [gold-of-pleasure]
ref|XP_006290338.1|  hypothetical protein CARUB_v10016995mg           75.9    2e-12   
ref|XP_004985270.1|  PREDICTED: BTB/POZ domain-containing protein...  75.9    3e-12   Setaria italica
ref|XP_011099322.1|  PREDICTED: BTB/POZ domain-containing protein...  75.5    3e-12   Sesamum indicum [beniseed]
emb|CBI33715.3|  unnamed protein product                              75.5    3e-12   Vitis vinifera
ref|XP_002866705.1|  signal transducer                                75.5    4e-12   Arabidopsis lyrata subsp. lyrata
gb|EYU44474.1|  hypothetical protein MIMGU_mgv1a027075mg              74.7    5e-12   Erythranthe guttata [common monkey flower]
emb|CDY57361.1|  BnaC08g48680D                                        74.7    5e-12   Brassica napus [oilseed rape]
ref|XP_011089989.1|  PREDICTED: BTB/POZ domain-containing protein...  74.7    6e-12   Sesamum indicum [beniseed]
ref|XP_003520918.1|  PREDICTED: BTB/POZ domain-containing protein...  74.3    7e-12   Glycine max [soybeans]
ref|XP_008368005.1|  PREDICTED: BTB/POZ domain-containing protein...  71.6    1e-11   
ref|XP_003558544.1|  PREDICTED: BTB/POZ domain-containing protein...  73.6    1e-11   Brachypodium distachyon [annual false brome]
gb|KJB43883.1|  hypothetical protein B456_007G221600                  72.4    2e-11   Gossypium raimondii
ref|XP_007133999.1|  hypothetical protein PHAVU_010G010500g           73.2    2e-11   Phaseolus vulgaris [French bean]
gb|KJB43882.1|  hypothetical protein B456_007G221600                  72.8    2e-11   Gossypium raimondii
gb|KJB43880.1|  hypothetical protein B456_007G221600                  72.8    2e-11   Gossypium raimondii
ref|XP_011089103.1|  PREDICTED: BTB/POZ domain-containing protein...  72.8    3e-11   Sesamum indicum [beniseed]
ref|XP_006280202.1|  hypothetical protein CARUB_v10026107mg           72.8    3e-11   Capsella rubella
ref|XP_004233453.1|  PREDICTED: BTB/POZ domain-containing protein...  72.0    4e-11   
ref|XP_010317168.1|  PREDICTED: BTB/POZ domain-containing protein...  72.0    4e-11   
ref|XP_010685004.1|  PREDICTED: BTB/POZ domain-containing protein...  71.6    6e-11   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007201187.1|  hypothetical protein PRUPE_ppa002993mg           71.6    7e-11   Prunus persica
ref|XP_006650337.1|  PREDICTED: BTB/POZ domain-containing protein...  71.2    8e-11   Oryza brachyantha
gb|AFK45576.1|  unknown                                               70.9    8e-11   Medicago truncatula
ref|XP_009103425.1|  PREDICTED: BTB/POZ domain-containing protein...  70.9    1e-10   Brassica rapa
ref|XP_004982336.1|  PREDICTED: uncharacterized protein LOC101754459  70.9    1e-10   
ref|XP_008235484.1|  PREDICTED: BTB/POZ domain-containing protein...  70.5    1e-10   Prunus mume [ume]
ref|XP_003561994.1|  PREDICTED: BTB/POZ domain-containing protein...  70.5    2e-10   Brachypodium distachyon [annual false brome]
emb|CDY12841.1|  BnaC07g15920D                                        70.1    2e-10   Brassica napus [oilseed rape]
ref|XP_006349069.1|  PREDICTED: BTB/POZ domain-containing protein...  70.1    2e-10   Solanum tuberosum [potatoes]
ref|XP_006349068.1|  PREDICTED: BTB/POZ domain-containing protein...  70.1    2e-10   Solanum tuberosum [potatoes]
ref|XP_004251006.1|  PREDICTED: BTB/POZ domain-containing protein...  70.1    2e-10   
gb|KDP26391.1|  hypothetical protein JCGZ_17549                       70.1    2e-10   Jatropha curcas
ref|XP_002521098.1|  protein binding protein, putative                70.1    2e-10   Ricinus communis
ref|XP_006845260.1|  hypothetical protein AMTR_s00005p00262560        69.7    2e-10   
gb|EEE59569.1|  hypothetical protein OsJ_11863                        69.3    3e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010687037.1|  PREDICTED: BTB/POZ domain-containing protein...  69.7    3e-10   Beta vulgaris subsp. vulgaris [field beet]
gb|ABF97835.1|  transposon protein, putative, Mutator sub-class, ...  69.7    3e-10   Oryza sativa Japonica Group [Japonica rice]
gb|AAT85278.1|  NPH3 family protein                                   69.3    3e-10   Oryza sativa Japonica Group [Japonica rice]
gb|ABF97836.1|  transposon protein, putative, Mutator sub-class, ...  69.3    3e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008383422.1|  PREDICTED: BTB/POZ domain-containing protein...  69.3    4e-10   Malus domestica [apple tree]
ref|XP_001769248.1|  predicted protein                                69.3    4e-10   
ref|XP_004294000.1|  PREDICTED: BTB/POZ domain-containing protein...  69.3    4e-10   Fragaria vesca subsp. vesca
ref|XP_008228112.1|  PREDICTED: BTB/POZ domain-containing protein...  68.9    4e-10   
ref|XP_007204975.1|  hypothetical protein PRUPE_ppa002796mg           68.9    5e-10   Prunus persica
ref|XP_006404081.1|  hypothetical protein EUTSA_v10010248mg           68.9    5e-10   Eutrema salsugineum [saltwater cress]
ref|XP_004166154.1|  PREDICTED: BTB/POZ domain-containing protein...  68.9    6e-10   
ref|XP_002464177.1|  hypothetical protein SORBIDRAFT_01g013680        68.6    6e-10   Sorghum bicolor [broomcorn]
emb|CDY57436.1|  BnaAnng14510D                                        68.6    6e-10   Brassica napus [oilseed rape]
ref|XP_006386870.1|  hypothetical protein POPTR_0002s24380g           68.2    7e-10   
ref|XP_009792130.1|  PREDICTED: BTB/POZ domain-containing protein...  68.2    8e-10   Nicotiana sylvestris
emb|CDP03873.1|  unnamed protein product                              68.2    8e-10   Coffea canephora [robusta coffee]
ref|XP_002301784.2|  hypothetical protein POPTR_0002s24380g           68.2    8e-10   Populus trichocarpa [western balsam poplar]
ref|XP_011024680.1|  PREDICTED: BTB/POZ domain-containing protein...  68.2    8e-10   Populus euphratica
ref|XP_010036820.1|  PREDICTED: BTB/POZ domain-containing protein...  68.2    9e-10   Eucalyptus grandis [rose gum]
ref|XP_003551322.2|  PREDICTED: BTB/POZ domain-containing protein...  68.2    9e-10   Glycine max [soybeans]
ref|XP_008385468.1|  PREDICTED: BTB/POZ domain-containing protein...  68.2    9e-10   
ref|XP_009337389.1|  PREDICTED: BTB/POZ domain-containing protein...  68.2    9e-10   Pyrus x bretschneideri [bai li]
ref|XP_011096666.1|  PREDICTED: BTB/POZ domain-containing protein...  68.2    1e-09   Sesamum indicum [beniseed]
ref|XP_009337391.1|  PREDICTED: BTB/POZ domain-containing protein...  67.8    1e-09   
gb|KHN13450.1|  BTB/POZ domain-containing protein                     67.8    1e-09   Glycine soja [wild soybean]
ref|NP_001168297.1|  putative phototropic-resoponsive NPH3 family...  67.8    1e-09   Zea mays [maize]
ref|XP_009344395.1|  PREDICTED: BTB/POZ domain-containing protein...  67.8    1e-09   Pyrus x bretschneideri [bai li]
ref|XP_007049780.1|  Phototropic-responsive NPH3 family protein       67.8    1e-09   
ref|XP_009757420.1|  PREDICTED: BTB/POZ domain-containing protein...  67.8    1e-09   
gb|KJB26098.1|  hypothetical protein B456_004G225600                  67.4    2e-09   
ref|XP_008813119.1|  PREDICTED: BTB/POZ domain-containing protein...  67.4    2e-09   
dbj|BAK04900.1|  predicted protein                                    67.0    2e-09   
ref|XP_008813120.1|  PREDICTED: BTB/POZ domain-containing protein...  67.0    2e-09   
ref|XP_010100164.1|  BTB/POZ domain-containing protein                67.0    2e-09   
ref|XP_009364840.1|  PREDICTED: BTB/POZ domain-containing protein...  67.0    2e-09   
gb|ADV56692.1|  NPH3 family protein                                   67.0    2e-09   
ref|XP_010278266.1|  PREDICTED: BTB/POZ domain-containing protein...  67.0    2e-09   
ref|NP_001280859.1|  BTB/POZ domain-containing protein At1g30440-...  67.0    2e-09   
ref|XP_007163074.1|  hypothetical protein PHAVU_001G203800g           66.6    2e-09   
ref|XP_010486408.1|  PREDICTED: putative BTB/POZ domain-containin...  66.6    2e-09   
gb|EMT10715.1|  BTB/POZ domain-containing protein                     67.0    2e-09   
ref|XP_009406358.1|  PREDICTED: BTB/POZ domain-containing protein...  66.6    2e-09   
ref|XP_003546563.1|  PREDICTED: BTB/POZ domain-containing protein...  66.6    3e-09   
ref|XP_010679605.1|  PREDICTED: BTB/POZ domain-containing protein...  66.6    3e-09   
ref|XP_010679597.1|  PREDICTED: BTB/POZ domain-containing protein...  66.6    3e-09   
ref|XP_010923665.1|  PREDICTED: BTB/POZ domain-containing protein...  66.6    3e-09   
ref|XP_010679598.1|  PREDICTED: BTB/POZ domain-containing protein...  66.6    3e-09   
gb|KDP34960.1|  hypothetical protein JCGZ_09248                       66.6    3e-09   
ref|XP_003533834.1|  PREDICTED: BTB/POZ domain-containing protein...  66.2    3e-09   
ref|XP_009611132.1|  PREDICTED: BTB/POZ domain-containing protein...  66.2    3e-09   
ref|XP_002527435.1|  protein binding protein, putative                66.2    3e-09   
gb|KHG00255.1|  hypothetical protein F383_19997                       65.9    4e-09   
ref|XP_007138529.1|  hypothetical protein PHAVU_009G216900g           65.9    4e-09   
gb|KJB42465.1|  hypothetical protein B456_007G154300                  65.9    4e-09   
ref|XP_004134651.1|  PREDICTED: BTB/POZ domain-containing protein...  65.9    4e-09   
ref|XP_010234279.1|  PREDICTED: BTB/POZ domain-containing protein...  65.9    4e-09   
ref|XP_003573346.1|  PREDICTED: BTB/POZ domain-containing protein...  65.9    5e-09   
ref|XP_011089687.1|  PREDICTED: BTB/POZ domain-containing protein...  65.9    5e-09   
ref|XP_009399039.1|  PREDICTED: BTB/POZ domain-containing protein...  65.9    5e-09   
gb|ABR25380.1|  transposon protein                                    64.7    5e-09   
ref|XP_011089689.1|  PREDICTED: BTB/POZ domain-containing protein...  65.9    5e-09   
ref|XP_008439559.1|  PREDICTED: BTB/POZ domain-containing protein...  65.9    5e-09   
ref|XP_011089686.1|  PREDICTED: BTB/POZ domain-containing protein...  65.5    6e-09   
ref|XP_011459733.1|  PREDICTED: BTB/POZ domain-containing protein...  65.5    6e-09   
gb|AAS79592.1|  putative non-phototropic hypocotyl 3-like protein     65.5    6e-09   
ref|XP_010109730.1|  BTB/POZ domain-containing protein                65.5    6e-09   
ref|XP_009622877.1|  PREDICTED: BTB/POZ domain-containing protein...  65.5    7e-09   
ref|XP_008382632.1|  PREDICTED: BTB/POZ domain-containing protein...  65.5    7e-09   
ref|XP_011015340.1|  PREDICTED: BTB/POZ domain-containing protein...  65.5    7e-09   
gb|EMT33625.1|  BTB/POZ domain-containing protein                     65.5    7e-09   
ref|XP_008784787.1|  PREDICTED: BTB/POZ domain-containing protein...  65.1    8e-09   
emb|CBI17097.3|  unnamed protein product                              65.1    8e-09   
ref|XP_003577427.1|  PREDICTED: BTB/POZ domain-containing protein...  65.1    8e-09   
gb|KJB35735.1|  hypothetical protein B456_006G125900                  65.1    8e-09   
ref|XP_003632267.1|  PREDICTED: BTB/POZ domain-containing protein...  65.1    8e-09   
gb|KHG15697.1|  hypothetical protein F383_22812                       65.1    8e-09   
ref|XP_004488271.1|  PREDICTED: BTB/POZ domain-containing protein...  65.1    8e-09   
ref|XP_006356774.1|  PREDICTED: BTB/POZ domain-containing protein...  65.1    9e-09   
ref|XP_007015158.1|  BZIP domain class transcription factor           65.1    9e-09   
ref|XP_010241172.1|  PREDICTED: BTB/POZ domain-containing protein...  65.1    9e-09   
ref|XP_003595495.1|  BTB/POZ domain-containing protein                65.1    9e-09   
ref|XP_007144554.1|  hypothetical protein PHAVU_007G165600g           65.1    9e-09   
gb|KHN41442.1|  BTB/POZ domain-containing protein                     65.1    1e-08   
gb|ADZ04641.1|  hypothetical protein                                  65.1    1e-08   
gb|EEC82855.1|  hypothetical protein OsI_27703                        65.1    1e-08   
ref|XP_010524688.1|  PREDICTED: BTB/POZ domain-containing protein...  65.1    1e-08   
gb|KEH43247.1|  phototropic-responsive NPH3 family protein            64.7    1e-08   
ref|NP_001060924.1|  Os08g0130600                                     64.7    1e-08   
ref|XP_007144555.1|  hypothetical protein PHAVU_007G165600g           64.7    1e-08   
ref|XP_010241171.1|  PREDICTED: BTB/POZ domain-containing protein...  64.7    1e-08   
ref|XP_008235006.1|  PREDICTED: BTB/POZ domain-containing protein...  64.7    1e-08   
ref|NP_187478.1|  phototropic-responsive NPH3 family protein          64.7    1e-08   
ref|XP_007199752.1|  hypothetical protein PRUPE_ppa002803mg           64.7    1e-08   
ref|XP_010051973.1|  PREDICTED: BTB/POZ domain-containing protein...  64.7    1e-08   
ref|XP_001763717.1|  predicted protein                                64.7    1e-08   
ref|XP_008389180.1|  PREDICTED: BTB/POZ domain-containing protein...  64.7    1e-08   
ref|XP_002526612.1|  Root phototropism protein, putative              64.7    1e-08   
ref|XP_009378916.1|  PREDICTED: BTB/POZ domain-containing protein...  64.7    1e-08   
gb|KFK38267.1|  hypothetical protein AALP_AA3G091600                  64.7    1e-08   
gb|KDP34354.1|  hypothetical protein JCGZ_11237                       64.7    1e-08   
dbj|BAJ33928.1|  unnamed protein product                              64.7    1e-08   
ref|XP_008803011.1|  PREDICTED: BTB/POZ domain-containing protein...  64.7    1e-08   
ref|XP_006443605.1|  hypothetical protein CICLE_v10019330mg           64.7    1e-08   
ref|XP_006577128.1|  PREDICTED: BTB/POZ domain-containing protein...  64.3    1e-08   
gb|KHG21232.1|  hypothetical protein F383_08117                       64.3    1e-08   
ref|XP_009362255.1|  PREDICTED: BTB/POZ domain-containing protein...  64.3    1e-08   
ref|XP_010683440.1|  PREDICTED: BTB/POZ domain-containing protein...  64.3    2e-08   
ref|XP_003521542.1|  PREDICTED: BTB/POZ domain-containing protein...  64.3    2e-08   
ref|XP_006395119.1|  hypothetical protein EUTSA_v10003813mg           64.3    2e-08   
ref|XP_006389692.1|  hypothetical protein POPTR_0020s00510g           64.3    2e-08   
gb|KHN28223.1|  BTB/POZ domain-containing protein                     64.3    2e-08   
ref|XP_011460693.1|  PREDICTED: BTB/POZ domain-containing protein...  64.3    2e-08   
ref|XP_004294043.1|  PREDICTED: BTB/POZ domain-containing protein...  64.3    2e-08   
ref|XP_004144382.1|  PREDICTED: BTB/POZ domain-containing protein...  64.3    2e-08   
ref|XP_004247004.1|  PREDICTED: BTB/POZ domain-containing protein...  64.3    2e-08   
ref|XP_009410501.1|  PREDICTED: BTB/POZ domain-containing protein...  63.9    2e-08   
ref|XP_004247086.1|  PREDICTED: BTB/POZ domain-containing protein...  63.9    2e-08   
gb|KGN58361.1|  hypothetical protein Csa_3G627720                     63.9    2e-08   
ref|XP_003604967.1|  BTB/POZ domain-containing protein                63.9    2e-08   
ref|XP_010535644.1|  PREDICTED: BTB/POZ domain-containing protein...  63.9    2e-08   
ref|XP_009397396.1|  PREDICTED: BTB/POZ domain-containing protein...  63.9    2e-08   
ref|XP_002312886.2|  hypothetical protein POPTR_0009s15270g           63.9    2e-08   
ref|XP_009410500.1|  PREDICTED: BTB/POZ domain-containing protein...  63.9    2e-08   
ref|XP_009397397.1|  PREDICTED: BTB/POZ domain-containing protein...  63.9    2e-08   
ref|XP_010245988.1|  PREDICTED: BTB/POZ domain-containing protein...  63.9    2e-08   
ref|XP_010110255.1|  BTB/POZ domain-containing protein                63.9    2e-08   
ref|XP_006836308.1|  hypothetical protein AMTR_s00092p00041800        63.5    2e-08   
emb|CDY09586.1|  BnaC05g23330D                                        63.5    2e-08   
ref|XP_006604703.1|  PREDICTED: BTB/POZ domain-containing protein...  63.5    2e-08   
ref|XP_002281182.1|  PREDICTED: BTB/POZ domain-containing protein...  63.5    3e-08   
emb|CDP05630.1|  unnamed protein product                              63.5    3e-08   
ref|XP_010245990.1|  PREDICTED: BTB/POZ domain-containing protein...  63.5    3e-08   
ref|XP_010245989.1|  PREDICTED: BTB/POZ domain-containing protein...  63.5    3e-08   
gb|KHN43539.1|  BTB/POZ domain-containing protein                     63.5    3e-08   
emb|CAN72130.1|  hypothetical protein VITISV_002335                   63.5    3e-08   
ref|XP_009371616.1|  PREDICTED: BTB/POZ domain-containing protein...  63.5    3e-08   
gb|EYU40606.1|  hypothetical protein MIMGU_mgv1a003057mg              63.5    3e-08   
ref|XP_009334929.1|  PREDICTED: BTB/POZ domain-containing protein...  63.5    3e-08   
ref|XP_006659093.1|  PREDICTED: BTB/POZ domain-containing protein...  63.5    3e-08   
ref|XP_010922793.1|  PREDICTED: BTB/POZ domain-containing protein...  63.5    3e-08   
ref|XP_006855474.1|  hypothetical protein AMTR_s00057p00189750        63.5    3e-08   
gb|EPS73600.1|  hypothetical protein M569_01153                       63.2    3e-08   
gb|EYU42051.1|  hypothetical protein MIMGU_mgv1a003173mg              63.2    3e-08   
ref|XP_010031443.1|  PREDICTED: BTB/POZ domain-containing protein...  63.2    4e-08   
gb|KEH38919.1|  phototropic-responsive NPH3 family protein            63.2    4e-08   
ref|XP_006856184.1|  hypothetical protein AMTR_s00059p00182270        63.2    4e-08   
ref|XP_011033589.1|  PREDICTED: BTB/POZ domain-containing protein...  63.2    4e-08   
ref|XP_002317350.2|  hypothetical protein POPTR_0011s09340g           63.2    4e-08   
emb|CAN78287.1|  hypothetical protein VITISV_008137                   63.2    4e-08   
dbj|BAB10932.1|  photoreceptor-interacting protein-like               63.2    4e-08   
ref|XP_010027852.1|  PREDICTED: putative BTB/POZ domain-containin...  63.2    4e-08   
gb|AAO16690.1|  hypothetical protein-like protein                     63.2    4e-08   
emb|CAN82247.1|  hypothetical protein VITISV_036489                   63.2    4e-08   
ref|XP_008344909.1|  PREDICTED: BTB/POZ domain-containing protein...  62.8    5e-08   
gb|KJB09015.1|  hypothetical protein B456_001G119000                  62.8    5e-08   
ref|XP_010275928.1|  PREDICTED: BTB/POZ domain-containing protein...  62.8    5e-08   
ref|XP_011033590.1|  PREDICTED: BTB/POZ domain-containing protein...  62.8    5e-08   
ref|XP_011033592.1|  PREDICTED: BTB/POZ domain-containing protein...  62.8    5e-08   
ref|XP_010275927.1|  PREDICTED: BTB/POZ domain-containing protein...  62.8    5e-08   
ref|XP_010905600.1|  PREDICTED: BTB/POZ domain-containing protein...  62.8    5e-08   
emb|CDX73781.1|  BnaC08g22220D                                        62.8    5e-08   
ref|XP_010275929.1|  PREDICTED: BTB/POZ domain-containing protein...  62.8    5e-08   
gb|KJB09013.1|  hypothetical protein B456_001G119000                  62.8    5e-08   
ref|XP_002265786.1|  PREDICTED: BTB/POZ domain-containing protein...  62.8    5e-08   
emb|CDX90249.1|  BnaA08g17350D                                        62.8    5e-08   
ref|XP_010941534.1|  PREDICTED: BTB/POZ domain-containing protein...  62.8    5e-08   
ref|XP_008465052.1|  PREDICTED: BTB/POZ domain-containing protein...  62.8    5e-08   
ref|XP_002285522.2|  PREDICTED: BTB/POZ domain-containing protein...  62.8    6e-08   
gb|ADN33739.1|  phototropic-responsive NPH3 family protein            62.4    6e-08   
ref|XP_007214533.1|  hypothetical protein PRUPE_ppa002754mg           62.8    6e-08   
emb|CDY43566.1|  BnaC02g16630D                                        62.0    6e-08   
emb|CBI37309.3|  unnamed protein product                              62.4    6e-08   
ref|XP_010652501.1|  PREDICTED: BTB/POZ domain-containing protein...  62.4    6e-08   
ref|XP_008225559.1|  PREDICTED: BTB/POZ domain-containing protein...  62.4    6e-08   
ref|XP_002320358.1|  hypothetical protein POPTR_0014s12800g           62.4    6e-08   
ref|XP_003544563.1|  PREDICTED: BTB/POZ domain-containing protein...  62.4    6e-08   
ref|XP_009115761.1|  PREDICTED: BTB/POZ domain-containing protein...  62.4    6e-08   
ref|XP_010941535.1|  PREDICTED: BTB/POZ domain-containing protein...  62.4    6e-08   
ref|XP_010912198.1|  PREDICTED: BTB/POZ domain-containing protein...  62.4    6e-08   
ref|XP_009593550.1|  PREDICTED: BTB/POZ domain-containing protein...  62.4    6e-08   
ref|XP_008794466.1|  PREDICTED: BTB/POZ domain-containing protein...  62.4    6e-08   
ref|XP_009763589.1|  PREDICTED: BTB/POZ domain-containing protein...  62.4    7e-08   
ref|XP_001770455.1|  predicted protein                                62.4    7e-08   
ref|XP_010652500.1|  PREDICTED: BTB/POZ domain-containing protein...  62.4    7e-08   
ref|XP_009757792.1|  PREDICTED: BTB/POZ domain-containing protein...  62.4    7e-08   
ref|XP_008794467.1|  PREDICTED: BTB/POZ domain-containing protein...  62.4    7e-08   
gb|ABR17518.1|  unknown                                               62.4    7e-08   
ref|XP_010652068.1|  PREDICTED: BTB/POZ domain-containing protein...  62.0    7e-08   
emb|CBI21142.3|  unnamed protein product                              62.4    7e-08   
gb|KHG12311.1|  hypothetical protein F383_18973                       62.4    7e-08   
ref|XP_010912199.1|  PREDICTED: BTB/POZ domain-containing protein...  62.4    7e-08   
emb|CDY27653.1|  BnaUnng00030D                                        62.4    7e-08   
ref|XP_011468062.1|  PREDICTED: BTB/POZ domain-containing protein...  62.4    7e-08   
ref|XP_009757790.1|  PREDICTED: BTB/POZ domain-containing protein...  62.4    8e-08   
gb|KDO64171.1|  hypothetical protein CISIN_1g035818mg                 62.0    8e-08   
gb|KJB35284.1|  hypothetical protein B456_006G108300                  62.4    8e-08   
ref|XP_011044267.1|  PREDICTED: BTB/POZ domain-containing protein...  62.0    8e-08   
ref|XP_009379765.1|  PREDICTED: BTB/POZ domain-containing protein...  62.0    8e-08   
gb|EMT33147.1|  BTB/POZ domain-containing protein                     62.0    8e-08   
ref|XP_004288469.1|  PREDICTED: BTB/POZ domain-containing protein...  62.0    8e-08   
ref|XP_011088823.1|  PREDICTED: BTB/POZ domain-containing protein...  62.0    8e-08   
ref|XP_002961348.1|  hypothetical protein SELMODRAFT_74933            62.0    8e-08   
ref|XP_011015142.1|  PREDICTED: BTB/POZ domain-containing protein...  62.0    9e-08   
ref|XP_010652067.1|  PREDICTED: BTB/POZ domain-containing protein...  62.0    9e-08   
gb|AHH91634.1|  SOD3 protein                                          61.6    9e-08   
ref|XP_006481239.1|  PREDICTED: BTB/POZ domain-containing protein...  62.0    9e-08   
emb|CDX77951.1|  BnaA09g31460D                                        62.0    9e-08   
ref|XP_011470995.1|  PREDICTED: BTB/POZ domain-containing protein...  62.0    9e-08   
ref|XP_004309683.1|  PREDICTED: BTB/POZ domain-containing protein...  62.0    9e-08   
ref|XP_002267241.2|  PREDICTED: BTB/POZ domain-containing protein...  62.0    9e-08   
ref|XP_010652066.1|  PREDICTED: BTB/POZ domain-containing protein...  62.0    9e-08   
ref|XP_010243298.1|  PREDICTED: BTB/POZ domain-containing protein...  62.0    9e-08   
ref|XP_006429637.1|  hypothetical protein CICLE_v10011315mg           62.0    9e-08   
ref|XP_011015143.1|  PREDICTED: BTB/POZ domain-containing protein...  62.0    1e-07   
dbj|BAJ87289.1|  predicted protein                                    61.6    1e-07   
ref|XP_009140160.1|  PREDICTED: BTB/POZ domain-containing protein...  62.0    1e-07   
ref|XP_004506596.1|  PREDICTED: BTB/POZ domain-containing protein...  62.0    1e-07   
ref|XP_010543146.1|  PREDICTED: BTB/POZ domain-containing protein...  62.0    1e-07   
ref|XP_009140161.1|  PREDICTED: BTB/POZ domain-containing protein...  62.0    1e-07   
ref|XP_011468065.1|  PREDICTED: BTB/POZ domain-containing protein...  61.6    1e-07   
gb|KDO75322.1|  hypothetical protein CISIN_1g006764mg                 61.6    1e-07   
ref|XP_006468280.1|  PREDICTED: BTB/POZ domain-containing protein...  61.6    1e-07   
ref|XP_010503131.1|  PREDICTED: BTB/POZ domain-containing protein...  61.6    1e-07   
gb|AFO63285.1|  bZIP6                                                 61.6    1e-07   
ref|XP_006448940.1|  hypothetical protein CICLE_v10014591mg           61.6    1e-07   
gb|KJB41979.1|  hypothetical protein B456_007G130600                  61.6    1e-07   
ref|XP_003555437.1|  PREDICTED: BTB/POZ domain-containing protein...  61.6    1e-07   
gb|EYU39234.1|  hypothetical protein MIMGU_mgv1a003527mg              61.6    1e-07   
gb|KHG22134.1|  hypothetical protein F383_09600                       61.6    1e-07   
ref|XP_002963864.1|  hypothetical protein SELMODRAFT_141980           61.6    1e-07   
ref|XP_011036689.1|  PREDICTED: BTB/POZ domain-containing protein...  61.6    1e-07   
gb|KJB41980.1|  hypothetical protein B456_007G130600                  61.6    1e-07   
ref|XP_007150120.1|  hypothetical protein PHAVU_005G128400g           61.6    1e-07   
gb|KFK44855.1|  hypothetical protein AALP_AA1G311200                  61.6    1e-07   
gb|KHN00846.1|  BTB/POZ domain-containing protein                     61.6    1e-07   
ref|XP_010905431.1|  PREDICTED: BTB/POZ domain-containing protein...  61.6    1e-07   
ref|XP_008360252.1|  PREDICTED: BTB/POZ domain-containing protein...  61.6    1e-07   
ref|XP_010112756.1|  BTB/POZ domain-containing protein                61.2    1e-07   
ref|XP_010244572.1|  PREDICTED: BTB/POZ domain-containing protein...  61.2    1e-07   
ref|XP_010244571.1|  PREDICTED: BTB/POZ domain-containing protein...  61.2    1e-07   
gb|KHN21468.1|  BTB/POZ domain-containing protein                     61.2    2e-07   
ref|XP_003551085.1|  PREDICTED: BTB/POZ domain-containing protein...  61.2    2e-07   
gb|KHG06351.1|  hypothetical protein F383_31936                       61.2    2e-07   
ref|XP_004156559.1|  PREDICTED: putative BTB/POZ domain-containin...  61.2    2e-07   
ref|XP_006280179.1|  hypothetical protein CARUB_v10026083mg           61.2    2e-07   
ref|XP_007050812.1|  Phototropic-responsive NPH3 family protein i...  61.2    2e-07   
ref|XP_004137290.1|  PREDICTED: putative BTB/POZ domain-containin...  61.2    2e-07   
ref|XP_009783326.1|  PREDICTED: BTB/POZ domain-containing protein...  61.2    2e-07   



>ref|XP_011089543.1| PREDICTED: root phototropism protein 2-like [Sesamum indicum]
Length=563

 Score =   248 bits (633),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 139/160 (87%), Gaps = 8/160 (5%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNA  538
            DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSGA+D K TP+A
Sbjct  412  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGADDHK-TPDA  470

Query  537  IATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasaVRKPTFFS  358
            + TRNQLQAD +LVKENEALRTELL+MKM+I D+Q        S   +S  + +KPTFFS
Sbjct  471  LTTRNQLQADTSLVKENEALRTELLKMKMYIQDIQK-------SQGTTSKGSAKKPTFFS  523

Query  357  SMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  238
            S+SK LGKLNPFKHGSKDTSN+DDG VD+TKPRRRRFSIS
Sbjct  524  SVSKTLGKLNPFKHGSKDTSNIDDGMVDLTKPRRRRFSIS  563



>ref|XP_009777101.1| PREDICTED: root phototropism protein 2 [Nicotiana sylvestris]
Length=574

 Score =   248 bits (632),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 136/160 (85%), Gaps = 4/160 (3%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNA  538
            DEIEREKVCSVMD LKLSYEARVHASQNKRLPVQIVLHALY+DQLKIRSG +D  + P+A
Sbjct  419  DEIEREKVCSVMDTLKLSYEARVHASQNKRLPVQIVLHALYFDQLKIRSGGDDTSNLPDA  478

Query  537  IATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasaVRKPTFFS  358
            +ATRNQLQADV+LVKENEALRTELL+MKM+I+D+Q            +  S  RKPTFFS
Sbjct  479  MATRNQLQADVSLVKENEALRTELLKMKMYISDIQK----TSQGTTSAKPSLSRKPTFFS  534

Query  357  SMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  238
            S+SKKLGKLNPFKHGSKDTS +DD  VDITKPRRRRFSIS
Sbjct  535  SVSKKLGKLNPFKHGSKDTSMIDDATVDITKPRRRRFSIS  574



>ref|XP_009611218.1| PREDICTED: root phototropism protein 2 [Nicotiana tomentosiformis]
Length=575

 Score =   247 bits (630),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 135/160 (84%), Gaps = 4/160 (3%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNA  538
            DEIEREKVCSVMD LKLSYEARVHASQNKRLPVQIVLHALY+DQLKIRSG +D  + P A
Sbjct  420  DEIEREKVCSVMDTLKLSYEARVHASQNKRLPVQIVLHALYFDQLKIRSGGDDTSNLPEA  479

Query  537  IATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasaVRKPTFFS  358
            +ATRNQLQADV+LVKENEALRTELL+MKM+I+D+Q            +  S  RKPTFFS
Sbjct  480  MATRNQLQADVSLVKENEALRTELLKMKMYISDIQK----TSQGTTSAKPSLSRKPTFFS  535

Query  357  SMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  238
            S+SKKLGKLNPFKHGSKDTS +DD  VDITKPRRRRFSIS
Sbjct  536  SVSKKLGKLNPFKHGSKDTSMIDDATVDITKPRRRRFSIS  575



>gb|KHG08105.1| Root phototropism 2 -like protein [Gossypium arboreum]
Length=507

 Score =   242 bits (618),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 136/161 (84%), Gaps = 5/161 (3%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNA  538
            DEIEREKVCS MDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG  D ++ P+A
Sbjct  351  DEIEREKVCSSMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGGADDRNQPDA  410

Query  537  IATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasaVRKPTFFS  358
            + TRNQLQADV+LVKENEALRTELL+MKM+I+DMQ        +   S +   RKPTFFS
Sbjct  411  VTTRNQLQADVSLVKENEALRTELLKMKMYISDMQK----NNQTGTSSKSIGTRKPTFFS  466

Query  357  SMSKKLGKLNPFKHGSKDTSNLDDG-EVDITKPRRRRFSIS  238
            SMSK LGKLNPF+HGSKDTS++DD   VD+TKPRRRRFSIS
Sbjct  467  SMSKTLGKLNPFRHGSKDTSHIDDNLGVDVTKPRRRRFSIS  507



>gb|KJB26283.1| hypothetical protein B456_004G235100 [Gossypium raimondii]
Length=532

 Score =   243 bits (619),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 136/161 (84%), Gaps = 5/161 (3%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNA  538
            DEIEREKVCS MDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG  D ++ P+A
Sbjct  376  DEIEREKVCSSMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGGADDRNQPDA  435

Query  537  IATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasaVRKPTFFS  358
            + TRNQLQADV+LVKENEALRTELL+MKM+I+DMQ        +   S +   RKPTFFS
Sbjct  436  VTTRNQLQADVSLVKENEALRTELLKMKMYISDMQK----NNQTGTSSKSVGTRKPTFFS  491

Query  357  SMSKKLGKLNPFKHGSKDTSNLDDG-EVDITKPRRRRFSIS  238
            SMSK LGKLNPF+HGSKDTS++DD   VD+TKPRRRRFSIS
Sbjct  492  SMSKTLGKLNPFRHGSKDTSHIDDNLGVDVTKPRRRRFSIS  532



>emb|CDP04035.1| unnamed protein product [Coffea canephora]
Length=573

 Score =   243 bits (620),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 135/160 (84%), Gaps = 5/160 (3%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNA  538
            DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG ED K  PNA
Sbjct  419  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGTEDQK-MPNA  477

Query  537  IATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasaVRKPTFFS  358
            I TR QLQAD +L +ENE LRTELL+MKM+IAD+Q            ++A++ ++PTFFS
Sbjct  478  ITTRRQLQADTSLARENEELRTELLKMKMYIADLQK----TQGPSTKATAASSKRPTFFS  533

Query  357  SMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  238
            SMSK LGKLNPFKHGSKDTSNLDD  VDI+KPRRRRFSIS
Sbjct  534  SMSKTLGKLNPFKHGSKDTSNLDDALVDISKPRRRRFSIS  573



>gb|KJB26282.1| hypothetical protein B456_004G235100 [Gossypium raimondii]
Length=558

 Score =   242 bits (618),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 136/161 (84%), Gaps = 5/161 (3%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNA  538
            DEIEREKVCS MDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG  D ++ P+A
Sbjct  402  DEIEREKVCSSMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGGADDRNQPDA  461

Query  537  IATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasaVRKPTFFS  358
            + TRNQLQADV+LVKENEALRTELL+MKM+I+DMQ        +   S +   RKPTFFS
Sbjct  462  VTTRNQLQADVSLVKENEALRTELLKMKMYISDMQK----NNQTGTSSKSVGTRKPTFFS  517

Query  357  SMSKKLGKLNPFKHGSKDTSNLDDG-EVDITKPRRRRFSIS  238
            SMSK LGKLNPF+HGSKDTS++DD   VD+TKPRRRRFSIS
Sbjct  518  SMSKTLGKLNPFRHGSKDTSHIDDNLGVDVTKPRRRRFSIS  558



>gb|KJB26284.1| hypothetical protein B456_004G235100 [Gossypium raimondii]
Length=574

 Score =   243 bits (619),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 136/161 (84%), Gaps = 5/161 (3%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNA  538
            DEIEREKVCS MDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG  D ++ P+A
Sbjct  418  DEIEREKVCSSMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGGADDRNQPDA  477

Query  537  IATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasaVRKPTFFS  358
            + TRNQLQADV+LVKENEALRTELL+MKM+I+DMQ        +   S +   RKPTFFS
Sbjct  478  VTTRNQLQADVSLVKENEALRTELLKMKMYISDMQK----NNQTGTSSKSVGTRKPTFFS  533

Query  357  SMSKKLGKLNPFKHGSKDTSNLDDG-EVDITKPRRRRFSIS  238
            SMSK LGKLNPF+HGSKDTS++DD   VD+TKPRRRRFSIS
Sbjct  534  SMSKTLGKLNPFRHGSKDTSHIDDNLGVDVTKPRRRRFSIS  574



>ref|XP_010244564.1| PREDICTED: root phototropism protein 2 [Nelumbo nucifera]
Length=571

 Score =   240 bits (612),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 116/160 (73%), Positives = 135/160 (84%), Gaps = 6/160 (4%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNA  538
            DEIEREKVCSVMDP KLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG  D + T +A
Sbjct  418  DEIEREKVCSVMDPHKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGVIDDRKTQDA  477

Query  537  IATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasaVRKPTFFS  358
            + TRNQ+QADV+L+KENEALRTELL+MKM+I+D+Q       +    S +   RKPTFFS
Sbjct  478  LMTRNQIQADVSLIKENEALRTELLKMKMYISDLQK------NQGTSSKSGGSRKPTFFS  531

Query  357  SMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  238
            S+SK LGKLNPF+HGSKDTSN+DD  +D+TKPRRRRFS+S
Sbjct  532  SVSKTLGKLNPFRHGSKDTSNIDDSAIDLTKPRRRRFSVS  571



>ref|XP_006432049.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
 gb|ESR45289.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
Length=382

 Score =   231 bits (590),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 135/163 (83%), Gaps = 3/163 (2%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNA  538
            DEIEREK+CS MDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG ++ +STP+A
Sbjct  220  DEIEREKICSSMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGLDNDRSTPDA  279

Query  537  IATRNQLQADVTLVKENEALRTELLQMKMFIADMQ-NkggsqgssvkgssasaVRKPTFF  361
             ATRNQLQADV+L+KENEALR+EL +MK++I+DMQ     +   S   S  S  +K TFF
Sbjct  280  AATRNQLQADVSLIKENEALRSELTRMKLYISDMQKGNNQAGTGSSSKSGTSGHKKHTFF  339

Query  360  SSMSKKLGKLNPFKHGSKDTSNLDD--GEVDITKPRRRRFSIS  238
            SSMSK  GKLNPFKHGSKDTSN+DD    +D TKPRRRRFSIS
Sbjct  340  SSMSKTFGKLNPFKHGSKDTSNIDDDVAAMDGTKPRRRRFSIS  382



>emb|CBI15802.3| unnamed protein product [Vitis vinifera]
Length=213

 Score =   225 bits (574),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 136/161 (84%), Gaps = 7/161 (4%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNA  538
            DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSGA+D     +A
Sbjct  59   DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGADDAH---DA  115

Query  537  IATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasaVRKPTFFS  358
            ++TR+ LQADV+LV+ENEALR+EL++MKM+I+D+Q    + G    G  +    KPTFFS
Sbjct  116  MSTRSHLQADVSLVRENEALRSELMKMKMYISDIQKNSSAGGGKGLGGGSK---KPTFFS  172

Query  357  SMSKKLGKLNPFKHGSKDTSNLDD-GEVDITKPRRRRFSIS  238
            SMSK LGKLNPF+HGSKDTSN+DD   VD+TKPRRRRFSIS
Sbjct  173  SMSKTLGKLNPFRHGSKDTSNIDDETAVDVTKPRRRRFSIS  213



>ref|XP_007017103.1| Phototropic-responsive NPH3 family protein [Theobroma cacao]
 gb|EOY34722.1| Phototropic-responsive NPH3 family protein [Theobroma cacao]
Length=576

 Score =   234 bits (598),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 121/163 (74%), Positives = 136/163 (83%), Gaps = 7/163 (4%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAED--PKSTP  544
            DEIEREKVCS MDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSGA D   ++  
Sbjct  418  DEIEREKVCSSMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGAVDDRERNAA  477

Query  543  NAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasaVRKPTF  364
            +A+ATRNQLQADV+LVKENEALR+EL +MKM+I+D+Q             SA+  RKPTF
Sbjct  478  DAVATRNQLQADVSLVKENEALRSELKKMKMYISDLQK----NNQGTCSKSAAGNRKPTF  533

Query  363  FSSMSKKLGKLNPFKHGSKDTSNLDDG-EVDITKPRRRRFSIS  238
            FSSMSK LGKLNPF+HGSKDTSN+DD   VD+TKPRRRRFSIS
Sbjct  534  FSSMSKTLGKLNPFRHGSKDTSNIDDSLGVDVTKPRRRRFSIS  576



>gb|EYU36889.1| hypothetical protein MIMGU_mgv1a003487mg [Erythranthe guttata]
Length=582

 Score =   234 bits (596),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 137/168 (82%), Gaps = 8/168 (5%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGA-EDPKSTPN  541
            DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQL +RSGA ED   TP+
Sbjct  415  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLMLRSGADEDDHKTPD  474

Query  540  AIATRNQLQADVTLVKENEALRTELLQMKMFIADMQ-------Nkggsqgssvkgssasa  382
            A +TRNQLQADV+L KENEALRTELL+MKM+I D+Q           +  S+   +SAS 
Sbjct  475  AGSTRNQLQADVSLAKENEALRTELLKMKMYIQDIQRPQGTTSKAVSTSTSTSASASAST  534

Query  381  VRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  238
             RKP FFSSMSK LGKLNPFKHGSKDT NLD+G  D+TKPRRRRFSIS
Sbjct  535  SRKPKFFSSMSKTLGKLNPFKHGSKDTLNLDEGMPDLTKPRRRRFSIS  582



>ref|XP_006432045.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
 ref|XP_006432047.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
 gb|ESR45285.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
 gb|ESR45287.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
Length=541

 Score =   231 bits (589),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 135/163 (83%), Gaps = 3/163 (2%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNA  538
            DEIEREK+CS MDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG ++ +STP+A
Sbjct  379  DEIEREKICSSMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGLDNDRSTPDA  438

Query  537  IATRNQLQADVTLVKENEALRTELLQMKMFIADMQ-NkggsqgssvkgssasaVRKPTFF  361
             ATRNQLQADV+L+KENEALR+EL +MK++I+DMQ     +   S   S  S  +K TFF
Sbjct  439  AATRNQLQADVSLIKENEALRSELTRMKLYISDMQKGNNQAGTGSSSKSGTSGHKKHTFF  498

Query  360  SSMSKKLGKLNPFKHGSKDTSNLDD--GEVDITKPRRRRFSIS  238
            SSMSK  GKLNPFKHGSKDTSN+DD    +D TKPRRRRFSIS
Sbjct  499  SSMSKTFGKLNPFKHGSKDTSNIDDDVAAMDGTKPRRRRFSIS  541



>ref|XP_006432046.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
 ref|XP_006432048.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
 ref|XP_006464960.1| PREDICTED: root phototropism protein 2-like isoform X1 [Citrus 
sinensis]
 gb|ESR45286.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
 gb|ESR45288.1| hypothetical protein CICLE_v10000673mg [Citrus clementina]
Length=584

 Score =   231 bits (588),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 135/163 (83%), Gaps = 3/163 (2%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNA  538
            DEIEREK+CS MDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG ++ +STP+A
Sbjct  422  DEIEREKICSSMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGLDNDRSTPDA  481

Query  537  IATRNQLQADVTLVKENEALRTELLQMKMFIADMQ-NkggsqgssvkgssasaVRKPTFF  361
             ATRNQLQADV+L+KENEALR+EL +MK++I+DMQ     +   S   S  S  +K TFF
Sbjct  482  AATRNQLQADVSLIKENEALRSELTRMKLYISDMQKGNNQAGTGSSSKSGTSGHKKHTFF  541

Query  360  SSMSKKLGKLNPFKHGSKDTSNLDD--GEVDITKPRRRRFSIS  238
            SSMSK  GKLNPFKHGSKDTSN+DD    +D TKPRRRRFSIS
Sbjct  542  SSMSKTFGKLNPFKHGSKDTSNIDDDVAAMDGTKPRRRRFSIS  584



>ref|XP_006353728.1| PREDICTED: root phototropism protein 2-like [Solanum tuberosum]
Length=576

 Score =   230 bits (587),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 138/163 (85%), Gaps = 7/163 (4%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKST--P  544
            DEIEREKVCSVMDPLKLS+EARVHASQNKRLPVQIVLHALY+DQLK+RSGA D  +   P
Sbjct  418  DEIEREKVCSVMDPLKLSHEARVHASQNKRLPVQIVLHALYFDQLKLRSGAADDTNNNMP  477

Query  543  NAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasaVRKPTF  364
             A+ATRNQLQADV+LVKENE LRTELL+MKM+IAD+Q       +S +G+S   ++K TF
Sbjct  478  EAMATRNQLQADVSLVKENEVLRTELLKMKMYIADIQK----TTTSTQGTSKGGLKKTTF  533

Query  363  FSSMSKKLGKLNPFKHGSKDTSNL-DDGEVDITKPRRRRFSIS  238
            FSS+SK LGK NPFKHGSKDTSN+ DD  +D+TKPRRRRFSIS
Sbjct  534  FSSVSKTLGKFNPFKHGSKDTSNIVDDAALDLTKPRRRRFSIS  576



>ref|XP_004243653.1| PREDICTED: root phototropism protein 2 [Solanum lycopersicum]
Length=576

 Score =   229 bits (584),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 139/163 (85%), Gaps = 7/163 (4%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKST--P  544
            DEIEREKVCSVMDPLKLS+EARVHASQNKRLPVQIVLHALY+DQLKIRSGA D  +   P
Sbjct  418  DEIEREKVCSVMDPLKLSHEARVHASQNKRLPVQIVLHALYFDQLKIRSGAADDSNNNMP  477

Query  543  NAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasaVRKPTF  364
             A+ATRNQLQADV+LVKENE LRTELL+MKM+IAD+Q       +S +G+S  +++K TF
Sbjct  478  EAMATRNQLQADVSLVKENEVLRTELLKMKMYIADIQK----TTNSSQGTSKGSLKKTTF  533

Query  363  FSSMSKKLGKLNPFKHGSKDTSNL-DDGEVDITKPRRRRFSIS  238
            FSS+SK LGK NPFKHGSKDTS++ DD  +D+TKPRRRRFSIS
Sbjct  534  FSSVSKTLGKFNPFKHGSKDTSSIVDDAALDLTKPRRRRFSIS  576



>gb|KDO54918.1| hypothetical protein CISIN_1g007944mg [Citrus sinensis]
Length=541

 Score =   228 bits (581),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 117/163 (72%), Positives = 134/163 (82%), Gaps = 3/163 (2%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNA  538
            DEIEREK+CS MDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG ++ +STP+A
Sbjct  379  DEIEREKICSSMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGLDNDRSTPDA  438

Query  537  IATRNQLQADVTLVKENEALRTELLQMKMFIADMQ-NkggsqgssvkgssasaVRKPTFF  361
             ATRNQLQADV L+KENEALR+EL +MK++I+D+Q     +   S   S  S  +K TFF
Sbjct  439  AATRNQLQADVLLIKENEALRSELTRMKLYISDVQKGNNQAGTGSSSKSGTSGHKKHTFF  498

Query  360  SSMSKKLGKLNPFKHGSKDTSNLDD--GEVDITKPRRRRFSIS  238
            SSMSK  GKLNPFKHGSKDTSN+DD    +D TKPRRRRFSIS
Sbjct  499  SSMSKTFGKLNPFKHGSKDTSNIDDDVAAMDGTKPRRRRFSIS  541



>gb|KDO54917.1| hypothetical protein CISIN_1g007944mg [Citrus sinensis]
Length=584

 Score =   228 bits (580),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 117/163 (72%), Positives = 134/163 (82%), Gaps = 3/163 (2%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNA  538
            DEIEREK+CS MDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG ++ +STP+A
Sbjct  422  DEIEREKICSSMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGLDNDRSTPDA  481

Query  537  IATRNQLQADVTLVKENEALRTELLQMKMFIADMQ-NkggsqgssvkgssasaVRKPTFF  361
             ATRNQLQADV L+KENEALR+EL +MK++I+D+Q     +   S   S  S  +K TFF
Sbjct  482  AATRNQLQADVLLIKENEALRSELTRMKLYISDVQKGNNQAGTGSSSKSGTSGHKKHTFF  541

Query  360  SSMSKKLGKLNPFKHGSKDTSNLDD--GEVDITKPRRRRFSIS  238
            SSMSK  GKLNPFKHGSKDTSN+DD    +D TKPRRRRFSIS
Sbjct  542  SSMSKTFGKLNPFKHGSKDTSNIDDDVAAMDGTKPRRRRFSIS  584



>ref|XP_010650806.1| PREDICTED: root phototropism protein 2 isoform X2 [Vitis vinifera]
Length=527

 Score =   226 bits (576),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 115/161 (71%), Positives = 135/161 (84%), Gaps = 7/161 (4%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNA  538
            DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSGA+D     +A
Sbjct  373  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGADDAH---DA  429

Query  537  IATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasaVRKPTFFS  358
            ++TR+ LQADV+LV+ENEALR+EL++MKM+I+D+Q    +  +          +KPTFFS
Sbjct  430  MSTRSHLQADVSLVRENEALRSELMKMKMYISDIQK---NSSAGGGKGLGGGSKKPTFFS  486

Query  357  SMSKKLGKLNPFKHGSKDTSNLDD-GEVDITKPRRRRFSIS  238
            SMSK LGKLNPF+HGSKDTSN+DD   VD+TKPRRRRFSIS
Sbjct  487  SMSKTLGKLNPFRHGSKDTSNIDDETAVDVTKPRRRRFSIS  527



>ref|XP_002264896.1| PREDICTED: root phototropism protein 2 isoform X1 [Vitis vinifera]
Length=572

 Score =   226 bits (577),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 115/161 (71%), Positives = 135/161 (84%), Gaps = 7/161 (4%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNA  538
            DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSGA+D     +A
Sbjct  418  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGADDAH---DA  474

Query  537  IATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasaVRKPTFFS  358
            ++TR+ LQADV+LV+ENEALR+EL++MKM+I+D+Q    +  +          +KPTFFS
Sbjct  475  MSTRSHLQADVSLVRENEALRSELMKMKMYISDIQK---NSSAGGGKGLGGGSKKPTFFS  531

Query  357  SMSKKLGKLNPFKHGSKDTSNLDD-GEVDITKPRRRRFSIS  238
            SMSK LGKLNPF+HGSKDTSN+DD   VD+TKPRRRRFSIS
Sbjct  532  SMSKTLGKLNPFRHGSKDTSNIDDETAVDVTKPRRRRFSIS  572



>gb|KDP45678.1| hypothetical protein JCGZ_17285 [Jatropha curcas]
Length=575

 Score =   226 bits (575),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 135/162 (83%), Gaps = 7/162 (4%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNA  538
            DEIEREKVCSVMDPLKLSYEAR+HASQNKRLPVQIVLHALYYDQLK+RSG  +  +    
Sbjct  419  DEIEREKVCSVMDPLKLSYEARLHASQNKRLPVQIVLHALYYDQLKLRSGVVESSTPETP  478

Query  537  IA-TRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasaVRKPTFF  361
            ++ T+NQLQ DV+L++ENEALR+EL +MK++I+DMQ       S+   S+ S  RKPTFF
Sbjct  479  VSNTKNQLQTDVSLIRENEALRSELTKMKLYISDMQK-----NSNQGSSTKSGSRKPTFF  533

Query  360  SSMSKKLGKLNPFKHGSKDTSNLDDGE-VDITKPRRRRFSIS  238
            SSMSK LGKLNPFKHGSKDTS+LDDG  +DITKPRRRRFSIS
Sbjct  534  SSMSKTLGKLNPFKHGSKDTSHLDDGAGIDITKPRRRRFSIS  575



>ref|XP_004147730.1| PREDICTED: root phototropism protein 2-like [Cucumis sativus]
 ref|XP_004164428.1| PREDICTED: root phototropism protein 2-like [Cucumis sativus]
Length=582

 Score =   224 bits (570),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 134/163 (82%), Gaps = 7/163 (4%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGA-EDPKSTPN  541
            DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG  +D KST  
Sbjct  424  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGTPDDRKSTQE  483

Query  540  AIAT--RNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasaVRKPT  367
              AT  R Q QADV+LVKENEALR+EL++MK++I+DMQ       S    +S S   K T
Sbjct  484  DAATMARTQAQADVSLVKENEALRSELMKMKLYISDMQKSSQGTSSIKVPTSRS---KGT  540

Query  366  FFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  238
            FFSS+SK LGKLNPF+HGSKDTSN+DDG +DITKPRRRRFSIS
Sbjct  541  FFSSVSKTLGKLNPFRHGSKDTSNIDDG-IDITKPRRRRFSIS  582



>gb|KGN53487.1| hypothetical protein Csa_4G056750 [Cucumis sativus]
Length=572

 Score =   223 bits (569),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 134/163 (82%), Gaps = 7/163 (4%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGA-EDPKSTPN  541
            DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG  +D KST  
Sbjct  414  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGTPDDRKSTQE  473

Query  540  AIAT--RNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasaVRKPT  367
              AT  R Q QADV+LVKENEALR+EL++MK++I+DMQ       S    +S S   K T
Sbjct  474  DAATMARTQAQADVSLVKENEALRSELMKMKLYISDMQKSSQGTSSIKVPTSRS---KGT  530

Query  366  FFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  238
            FFSS+SK LGKLNPF+HGSKDTSN+DDG +DITKPRRRRFSIS
Sbjct  531  FFSSVSKTLGKLNPFRHGSKDTSNIDDG-IDITKPRRRRFSIS  572



>ref|XP_002533880.1| Root phototropism protein, putative [Ricinus communis]
 gb|EEF28503.1| Root phototropism protein, putative [Ricinus communis]
Length=549

 Score =   223 bits (568),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 116/163 (71%), Positives = 134/163 (82%), Gaps = 9/163 (6%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNA  538
            DEIEREKVCSVMDPLKLSYEAR+HASQNKRLPVQIVLH LY+DQLK+RSG  D +STP A
Sbjct  393  DEIEREKVCSVMDPLKLSYEARLHASQNKRLPVQIVLHCLYFDQLKLRSGVAD-RSTPEA  451

Query  537  IA--TRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasaVRKPTF  364
            +A  T++QLQ DV+L++ENEALR+EL++MK++I DMQ       S    S+    RK TF
Sbjct  452  MAPNTKSQLQTDVSLIRENEALRSELMKMKLYITDMQK-----SSQGTTSARGGPRKTTF  506

Query  363  FSSMSKKLGKLNPFKHGSKDTSNLDD-GEVDITKPRRRRFSIS  238
            FSSMSK LGKLNPFKHGSKDTS++DD   VDITKPRRRRFSIS
Sbjct  507  FSSMSKTLGKLNPFKHGSKDTSHIDDSAGVDITKPRRRRFSIS  549



>ref|XP_011041764.1| PREDICTED: root phototropism protein 2-like [Populus euphratica]
Length=574

 Score =   223 bits (569),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 138/162 (85%), Gaps = 5/162 (3%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNA  538
            DEIEREKVCSVMDPLKLSYEAR+HASQNKRLP+QIVLH LYYDQLK+RSGA+D    P+A
Sbjct  416  DEIEREKVCSVMDPLKLSYEARIHASQNKRLPLQIVLHTLYYDQLKLRSGADD---QPDA  472

Query  537  IATRNQLQADVTLVKENEALRTELLQMKMFIADMQ-NkggsqgssvkgssasaVRKPTFF  361
             ATR+QLQ+DV+LV ENEALR+EL +MK++I++MQ NKG S  S    ++ S  RK TFF
Sbjct  473  AATRSQLQSDVSLVSENEALRSELKKMKLYISEMQKNKGSSAKSISAAAATSGPRKHTFF  532

Query  360  SSMSKKLGKLNPFKHGSKDTSNLDDG-EVDITKPRRRRFSIS  238
            SSMSK LGKLNPFKHGSKDTS++DD   VDITKPRRRRFS+S
Sbjct  533  SSMSKTLGKLNPFKHGSKDTSHIDDNLAVDITKPRRRRFSVS  574



>ref|XP_010677799.1| PREDICTED: root phototropism protein 2 [Beta vulgaris subsp. 
vulgaris]
Length=581

 Score =   223 bits (569),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 132/160 (83%), Gaps = 5/160 (3%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNA  538
            DEIEREKVCS MDPLKLSYEARVHASQNKRLPVQ+VLHALYYDQLK+RSGA D    P+A
Sbjct  427  DEIEREKVCSSMDPLKLSYEARVHASQNKRLPVQMVLHALYYDQLKLRSGAND-GPLPDA  485

Query  537  IATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasaVRKPTFFS  358
            IATR Q++AD +L KENEAL++EL++MKM+I+DMQ    +   +   +      K TFFS
Sbjct  486  IATRGQVKADASLAKENEALKSELMKMKMYISDMQKNKATTSRTSTATGMP---KRTFFS  542

Query  357  SMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  238
            SMSK LGKLNPFKHGSKDTS+LDD EVD+TKPRRRRFSIS
Sbjct  543  SMSKTLGKLNPFKHGSKDTSHLDD-EVDLTKPRRRRFSIS  581



>ref|XP_002325631.1| ROOT PHOTOTROPISM 2 family protein [Populus trichocarpa]
 gb|EEF00013.1| ROOT PHOTOTROPISM 2 family protein [Populus trichocarpa]
Length=575

 Score =   223 bits (569),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 138/163 (85%), Gaps = 6/163 (4%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNA  538
            DE+EREKVCSVMDPLKLSYEAR+HASQNKRLPVQIVLH LYYDQLK+RSGA+D    P+A
Sbjct  416  DEMEREKVCSVMDPLKLSYEARLHASQNKRLPVQIVLHTLYYDQLKLRSGADD---QPDA  472

Query  537  IATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasaV--RKPTF  364
             ATR+QLQ+DV+LV ENEALR+EL +MK++I+DMQ   GS   S+  ++A+    RK TF
Sbjct  473  AATRSQLQSDVSLVSENEALRSELTKMKLYISDMQKDKGSSAKSISAAAATTSGPRKHTF  532

Query  363  FSSMSKKLGKLNPFKHGSKDTSNLDDG-EVDITKPRRRRFSIS  238
            FSSMSK LGKLNPFKHGSKDTS++DD   VDITKPRRRRFS+S
Sbjct  533  FSSMSKTLGKLNPFKHGSKDTSHIDDNIAVDITKPRRRRFSVS  575



>ref|XP_011011776.1| PREDICTED: root phototropism protein 2-like [Populus euphratica]
Length=595

 Score =   223 bits (568),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 136/164 (83%), Gaps = 7/164 (4%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNA  538
            DEIEREKVCSVMDPLKLSYEAR+HASQNKRLPVQIVLHALYYDQLK+RSG +D    P+A
Sbjct  435  DEIEREKVCSVMDPLKLSYEARLHASQNKRLPVQIVLHALYYDQLKLRSGVDD---QPDA  491

Query  537  IATRNQLQADVTLVKENEALRTELLQMKMFIADM---QNkggsqgssvkgssasaVRKPT  367
            +ATR+QLQ+DV+LV+ENEALR+EL++MK++I+DM   Q       ++    + +  RK +
Sbjct  492  VATRSQLQSDVSLVRENEALRSELMKMKLYISDMQKNQGSSTKGIAAAAAPTTTGSRKHS  551

Query  366  FFSSMSKKLGKLNPFKHGSKDTSNLDDG-EVDITKPRRRRFSIS  238
            FFSSMSK LGKLNPFKHGSKDT +++D   VDITKPRRRRFSIS
Sbjct  552  FFSSMSKTLGKLNPFKHGSKDTLHINDNIGVDITKPRRRRFSIS  595



>ref|XP_002319980.1| ROOT PHOTOTROPISM 2 family protein [Populus trichocarpa]
 gb|EEE95903.1| ROOT PHOTOTROPISM 2 family protein [Populus trichocarpa]
Length=578

 Score =   223 bits (567),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 135/164 (82%), Gaps = 7/164 (4%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNA  538
            DEIEREKVCSVMDPLKLSYEAR+HASQNKRLPVQIVLHALYYDQLK+RSG  D    P+A
Sbjct  418  DEIEREKVCSVMDPLKLSYEARLHASQNKRLPVQIVLHALYYDQLKLRSGVND---QPDA  474

Query  537  IATRNQLQADVTLVKENEALRTELLQMKMFIADM---QNkggsqgssvkgssasaVRKPT  367
            +ATR+QLQ+DV+LV+ENEALR+EL++MK++I+DM   Q       ++    + +  RK +
Sbjct  475  VATRSQLQSDVSLVRENEALRSELMKMKLYISDMQKNQGSSTKGIAATAAPTTTGSRKHS  534

Query  366  FFSSMSKKLGKLNPFKHGSKDTSNLDDG-EVDITKPRRRRFSIS  238
            FFSSMSK LGKLNPFKHGSKDT +++D   VDITKPRRRRFSIS
Sbjct  535  FFSSMSKTLGKLNPFKHGSKDTFHINDNIGVDITKPRRRRFSIS  578



>ref|XP_008451888.1| PREDICTED: root phototropism protein 2 isoform X2 [Cucumis melo]
Length=582

 Score =   223 bits (567),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 119/163 (73%), Positives = 134/163 (82%), Gaps = 7/163 (4%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGA-EDPKSTPN  541
            DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG  +D KST  
Sbjct  424  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGTPDDRKSTQE  483

Query  540  AIAT--RNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasaVRKPT  367
              A+  R Q QADV+LVKENEALR+EL++MK++I+DMQ       S    +S S   K T
Sbjct  484  DAASMARTQAQADVSLVKENEALRSELMKMKLYISDMQRSSQGTSSIKVPTSRS---KGT  540

Query  366  FFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  238
            FFSS+SK LGKLNPF+HGSKDTSN+DDG +DITKPRRRRFSIS
Sbjct  541  FFSSVSKTLGKLNPFRHGSKDTSNIDDG-IDITKPRRRRFSIS  582



>ref|XP_010094443.1| Root phototropism protein 2 [Morus notabilis]
 gb|EXB56024.1| Root phototropism protein 2 [Morus notabilis]
Length=574

 Score =   221 bits (563),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 111/160 (69%), Positives = 130/160 (81%), Gaps = 3/160 (2%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNA  538
            DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG  D      A
Sbjct  418  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGVADDHDAKEA  477

Query  537  IATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasaVRKPTFFS  358
               R+QLQADV+LV+ENEALR EL +MK++I D+Q     Q ++    +  + ++PTFFS
Sbjct  478  ATARSQLQADVSLVRENEALRAELTKMKLYITDIQK--NGQTTATSSRAVGSTKRPTFFS  535

Query  357  SMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  238
            S+SK LGKLNPFKHGSKDTS+++D  VDI+KPRRRRFSIS
Sbjct  536  SVSKTLGKLNPFKHGSKDTSHIED-VVDISKPRRRRFSIS  574



>ref|XP_011015900.1| PREDICTED: root phototropism protein 2-like [Populus euphratica]
Length=579

 Score =   219 bits (558),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 139/167 (83%), Gaps = 10/167 (6%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNA  538
            DEIEREKVCSVMDPLKLSYEAR+HASQNKRLP+QIVLH LYYDQLK+RSGA+D    P+A
Sbjct  416  DEIEREKVCSVMDPLKLSYEARIHASQNKRLPLQIVLHTLYYDQLKLRSGADD---QPDA  472

Query  537  IATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasaV------R  376
             ATR+QLQ+DV+LV ENEALR+EL +MK++I++MQ   GS   S+  ++A+A       R
Sbjct  473  AATRSQLQSDVSLVSENEALRSELKKMKLYISEMQKNKGSSAKSISAAAAAAAAATSGPR  532

Query  375  KPTFFSSMSKKLGKLNPFKHGSKDTSNLDDG-EVDITKPRRRRFSIS  238
            K TFFSSMSK LGKLNPFKHGSKDTS++DD   VDITKPRRRRFS+S
Sbjct  533  KHTFFSSMSKTLGKLNPFKHGSKDTSHIDDNLAVDITKPRRRRFSVS  579



>ref|XP_003544940.2| PREDICTED: root phototropism protein 2-like [Glycine max]
Length=579

 Score =   219 bits (557),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 132/160 (83%), Gaps = 2/160 (1%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNA  538
            DEIE+EKVCSV+DPLKLSYEARVHAS+NKRLP+QIVLHALYYDQL IRSG  + K    A
Sbjct  422  DEIEKEKVCSVLDPLKLSYEARVHASKNKRLPLQIVLHALYYDQLHIRSGTAEEK-VALA  480

Query  537  IATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasaVRKPTFFS  358
            +A + QLQADV+LV+ENE LR+EL++MKMFI+DMQ   G   SS    +    +KPTFFS
Sbjct  481  VAEKKQLQADVSLVRENEELRSELMKMKMFISDMQK-HGHGTSSSGRENIGLAKKPTFFS  539

Query  357  SMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  238
            SMSKKL KLNPFK+GSKDTS++DD  VD+TKPRRRRFSIS
Sbjct  540  SMSKKLSKLNPFKNGSKDTSHIDDAPVDLTKPRRRRFSIS  579



>ref|XP_008451887.1| PREDICTED: root phototropism protein 2 isoform X1 [Cucumis melo]
Length=666

 Score =   221 bits (562),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 119/163 (73%), Positives = 134/163 (82%), Gaps = 7/163 (4%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGA-EDPKSTPN  541
            DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG  +D KST  
Sbjct  508  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGTPDDRKSTQE  567

Query  540  AIAT--RNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasaVRKPT  367
              A+  R Q QADV+LVKENEALR+EL++MK++I+DMQ       S    +S S   K T
Sbjct  568  DAASMARTQAQADVSLVKENEALRSELMKMKLYISDMQRSSQGTSSIKVPTSRS---KGT  624

Query  366  FFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  238
            FFSS+SK LGKLNPF+HGSKDTSN+DDG +DITKPRRRRFSIS
Sbjct  625  FFSSVSKTLGKLNPFRHGSKDTSNIDDG-IDITKPRRRRFSIS  666



>ref|XP_004294714.1| PREDICTED: root phototropism protein 2 [Fragaria vesca subsp. 
vesca]
Length=581

 Score =   218 bits (556),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 137/164 (84%), Gaps = 5/164 (3%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNA  538
            DEIEREKVCSVMD LKLSYEAR+HASQNKRLPVQIVLHALYYDQLK+RSG E+ ++  +A
Sbjct  419  DEIEREKVCSVMDALKLSYEARLHASQNKRLPVQIVLHALYYDQLKLRSGEEENETQIDA  478

Query  537  IATRNQLQADVTLVKENEALRTELLQMKMFIADMQN----kggsqgssvkgssasaVRKP  370
             +TRNQ+QADV+L KENE LRTELL+MKM+I+D++      G S  ++  G      RKP
Sbjct  479  ASTRNQVQADVSLAKENEVLRTELLKMKMYISDIKKSGGGAGASAATTSSGKGGGGPRKP  538

Query  369  TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  238
            TFFSS+SKKLGKLNPFK+GSKDTSN+DD  VD+TKPRRRRFSIS
Sbjct  539  TFFSSVSKKLGKLNPFKNGSKDTSNIDDC-VDVTKPRRRRFSIS  581



>ref|XP_006293884.1| hypothetical protein CARUB_v10022870mg [Capsella rubella]
 gb|EOA26782.1| hypothetical protein CARUB_v10022870mg [Capsella rubella]
Length=593

 Score =   218 bits (555),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 117/170 (69%), Positives = 134/170 (79%), Gaps = 10/170 (6%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS----  550
            DEIEREKVCS MDPLKLSY+AR+HASQNKRLPV IVLHALYYDQLK+RSG ED +     
Sbjct  424  DEIEREKVCSSMDPLKLSYDARLHASQNKRLPVNIVLHALYYDQLKLRSGVEDQEERAVV  483

Query  549  -TPNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasaVRK  373
              P A+ TR+QLQAD TL KENEALR+EL++MKM+++DMQ      G+S   SS+    K
Sbjct  484  VLPEALKTRSQLQADTTLAKENEALRSELMKMKMYVSDMQKNKNGAGASSSNSSSLVSNK  543

Query  372  P---TFFSSMSKKLGKLNPFKHGSKDTSNLDD--GEVDITKPRRRRFSIS  238
                TFFSS+SKKLGKLNPFKHGSKDTSN+D+    VDITKPRRRRFSIS
Sbjct  544  KSKNTFFSSVSKKLGKLNPFKHGSKDTSNIDEDLAGVDITKPRRRRFSIS  593



>ref|XP_007142019.1| hypothetical protein PHAVU_008G245700g [Phaseolus vulgaris]
 gb|ESW14013.1| hypothetical protein PHAVU_008G245700g [Phaseolus vulgaris]
Length=580

 Score =   218 bits (554),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 132/160 (83%), Gaps = 1/160 (1%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNA  538
            DEIE+EKVCSVMDPLKLSYEARVHAS+NKRLP+QIVLHALYYDQL +RSGA + K    A
Sbjct  422  DEIEKEKVCSVMDPLKLSYEARVHASKNKRLPLQIVLHALYYDQLHLRSGAAEDKEAGAA  481

Query  537  IATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasaVRKPTFFS  358
               + QLQADV+LV+ENE LR+EL++MKM+I DMQ  G    SS K +SA A R PTF S
Sbjct  482  AVEKKQLQADVSLVRENEELRSELMKMKMYITDMQKNGNGTSSSGKETSAPAKR-PTFLS  540

Query  357  SMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  238
            SMSKKL KLNPFK+GSKDTS++DD  VD+TKPRRRRFSIS
Sbjct  541  SMSKKLSKLNPFKNGSKDTSHIDDAPVDLTKPRRRRFSIS  580



>ref|XP_006591739.1| PREDICTED: root phototropism protein 2-like [Glycine max]
Length=516

 Score =   216 bits (549),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 110/168 (65%), Positives = 135/168 (80%), Gaps = 13/168 (8%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNA  538
            DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQL++RSGAE+ +     
Sbjct  354  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLRLRSGAEERE-----  408

Query  537  IAT-RNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqg-------ssvkgssasa  382
            +AT +NQLQ DVTLV+ENE LRTEL++MKM+I+D+Q    +          +   ++   
Sbjct  409  VATEKNQLQMDVTLVRENEELRTELMKMKMYISDLQQNKNTNNGANPQGHGTTSSAANPN  468

Query  381  VRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  238
             +K TFFSS+SK LGKLNPF++GSKDT++L+DG VD+TKPRRRRFS+S
Sbjct  469  PKKATFFSSVSKTLGKLNPFRNGSKDTTHLEDGNVDLTKPRRRRFSVS  516



>gb|ACJ85866.1| unknown [Medicago truncatula]
Length=376

 Score =   212 bits (539),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 130/160 (81%), Gaps = 5/160 (3%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNA  538
            DE+E+EKVCSVMD LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGA   +   + 
Sbjct  222  DELEKEKVCSVMDALKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGATAERDAED-  280

Query  537  IATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasaVRKPTFFS  358
               RNQLQ DVTLV+ENE LRTEL++MKM+++D+Q   G  G++        V+  TFFS
Sbjct  281  ---RNQLQTDVTLVRENEELRTELIRMKMYVSDLQK-NGHGGTTSSSEVGKEVKNSTFFS  336

Query  357  SMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  238
            S+SKKLGKLNPFK+GSKDTS+++D  VD+TKPRRRRFSIS
Sbjct  337  SVSKKLGKLNPFKNGSKDTSHIEDVGVDLTKPRRRRFSIS  376



>ref|XP_006842585.1| hypothetical protein AMTR_s00077p00161250 [Amborella trichopoda]
 gb|ERN04260.1| hypothetical protein AMTR_s00077p00161250 [Amborella trichopoda]
Length=564

 Score =   216 bits (551),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 112/161 (70%), Positives = 130/161 (81%), Gaps = 11/161 (7%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNA  538
            DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSG ED K+  +A
Sbjct  414  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGKEDAKNF-DA  472

Query  537  IATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasaVRKPTFFS  358
              TRNQ+QAD++L+KENE+L++EL +MK ++  +Q   G    S          K TFFS
Sbjct  473  SFTRNQVQADISLIKENESLKSELAKMKSYVDGLQKGKGIATKSS---------KKTFFS  523

Query  357  SMSKKLGKLNPFKHGSKDTSNLDDGE-VDITKPRRRRFSIS  238
            SMSKKLG+LNPF+HGSKDT N++DG  VDITKPR+RRFSIS
Sbjct  524  SMSKKLGRLNPFRHGSKDTLNVEDGNAVDITKPRKRRFSIS  564



>ref|XP_003553189.1| PREDICTED: root phototropism protein 2-like [Glycine max]
Length=573

 Score =   216 bits (551),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 110/163 (67%), Positives = 135/163 (83%), Gaps = 7/163 (4%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNA  538
            DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQL++RSGAE+    P  
Sbjct  415  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLRLRSGAEERDVEPE-  473

Query  537  IATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgs---svkgssasaVRKPT  367
               +NQLQ DV+LV+ENE LRTEL++MKM+I+D+QNK  +  +       +S++  +K T
Sbjct  474  ---KNQLQMDVSLVRENEELRTELMKMKMYISDLQNKNTNNDANPQVHGTTSSATPKKAT  530

Query  366  FFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  238
            FFSS+SK LGKLNPF++GSKDT++L+D  VD+TKPRRRRFS+S
Sbjct  531  FFSSVSKTLGKLNPFRNGSKDTTHLEDASVDLTKPRRRRFSMS  573



>ref|XP_007206420.1| hypothetical protein PRUPE_ppa003347mg [Prunus persica]
 gb|EMJ07619.1| hypothetical protein PRUPE_ppa003347mg [Prunus persica]
Length=583

 Score =   216 bits (550),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 129/166 (78%), Gaps = 6/166 (4%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNA  538
            DEIEREKVCSVMD LKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG ++     +A
Sbjct  418  DEIEREKVCSVMDALKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGVDENDMMQDA  477

Query  537  IATRNQLQADVTLVKENEALRTELLQMKMFIADMQNk------ggsqgssvkgssasaVR  376
            + TR+Q+Q DV+L +ENE+LRTELL+MKM+I D+Q             ++  G      R
Sbjct  478  VTTRSQVQQDVSLARENESLRTELLRMKMYITDLQKSGPAAKGSLGSATTSSGKGGGGPR  537

Query  375  KPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  238
            K TFFSS+SKKLGKLNPFK GSKDTSN+ D  VDITKPRRRRFSIS
Sbjct  538  KGTFFSSVSKKLGKLNPFKQGSKDTSNIMDEGVDITKPRRRRFSIS  583



>gb|KEH28209.1| root phototropism-like protein [Medicago truncatula]
Length=536

 Score =   215 bits (548),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 111/160 (69%), Positives = 131/160 (82%), Gaps = 5/160 (3%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNA  538
            DE+E+EKVCSVMD LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGA   +   + 
Sbjct  382  DELEKEKVCSVMDALKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGATAERDAED-  440

Query  537  IATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasaVRKPTFFS  358
               RNQLQ DVTLV+ENE LRTEL++MKM+++D+Q   G  G++        V+K TFFS
Sbjct  441  ---RNQLQTDVTLVRENEELRTELIRMKMYVSDLQK-NGHGGTTSSSEVGKEVKKSTFFS  496

Query  357  SMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  238
            S+SKKLGKLNPFK+GSKDTS+++D  VD+TKPRRRRFSIS
Sbjct  497  SVSKKLGKLNPFKNGSKDTSHIEDVGVDLTKPRRRRFSIS  536



>dbj|BAJ33924.1| unnamed protein product [Thellungiella halophila]
Length=597

 Score =   216 bits (550),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 112/174 (64%), Positives = 133/174 (76%), Gaps = 14/174 (8%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS----  550
            DEIEREKVCS MDPLKLSY+AR+HASQNKRLPV IVLHALYYDQLK+RSG ED +     
Sbjct  424  DEIEREKVCSSMDPLKLSYDARLHASQNKRLPVNIVLHALYYDQLKLRSGVEDKEGAVVM  483

Query  549  TPNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkg--------s  394
             P A+ATR Q++AD +L KENEALR+EL++MKM+++D+Q    S G              
Sbjct  484  VPEALATRGQVKADTSLAKENEALRSELMKMKMYVSDLQKNKQSGGGGAGASSSNSSSLV  543

Query  393  sasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDD--GEVDITKPRRRRFSIS  238
            ++    KPTFFSS+SKKLGKLNPF+HGSKDTSN+D+    VDITKPRRRRFSIS
Sbjct  544  NSKKSNKPTFFSSVSKKLGKLNPFRHGSKDTSNIDEDLAGVDITKPRRRRFSIS  597



>ref|XP_010023564.1| PREDICTED: root phototropism protein 2 [Eucalyptus grandis]
 gb|KCW59867.1| hypothetical protein EUGRSUZ_H02604 [Eucalyptus grandis]
Length=570

 Score =   215 bits (548),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 131/160 (82%), Gaps = 7/160 (4%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNA  538
            DEIEREK CS +DPLKLS EAR+HASQNKRLPVQIVLHALYYDQLK+RSG ED K  P+A
Sbjct  418  DEIEREKACSALDPLKLSPEARLHASQNKRLPVQIVLHALYYDQLKLRSGTEDHKG-PDA  476

Query  537  IATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasaVRKPTFFS  358
            + TR+QLQAD +L+KENE LR+EL++MKM+I+D+Q       +    S+    ++ TFFS
Sbjct  477  VTTRHQLQADSSLIKENEDLRSELMKMKMYISDLQK-----TNHGTTSAKGGPKRHTFFS  531

Query  357  SMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  238
            SMSK LGKLNPF+HGSKDTSN++D  VDITKPR+RRFSIS
Sbjct  532  SMSKTLGKLNPFRHGSKDTSNIEDA-VDITKPRKRRFSIS  570



>ref|XP_007146905.1| hypothetical protein PHAVU_006G080400g [Phaseolus vulgaris]
 gb|ESW18899.1| hypothetical protein PHAVU_006G080400g [Phaseolus vulgaris]
Length=573

 Score =   215 bits (547),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 138/164 (84%), Gaps = 9/164 (5%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNA  538
            DEIEREKVCSVMDPLKLSYEAR+HASQNKRLPVQIVLHALYYDQL++RSGAE+ +     
Sbjct  415  DEIEREKVCSVMDPLKLSYEARLHASQNKRLPVQIVLHALYYDQLRLRSGAEERE-----  469

Query  537  IAT-RNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssv---kgssasaVRKP  370
            +AT +N+L  DV+LV+ENE LRTELL+MKM+I+DMQNK  +   S      +S+ + +K 
Sbjct  470  VATEKNELHMDVSLVRENEELRTELLKMKMYISDMQNKNVNNAESTHGNGTTSSGSTKKA  529

Query  369  TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  238
            TFFSS+SK LG+LNPF++GSKDT++L+DG VD++KPRRRRFS+S
Sbjct  530  TFFSSVSKTLGRLNPFRNGSKDTTHLEDGNVDLSKPRRRRFSMS  573



>ref|XP_009374407.1| PREDICTED: root phototropism protein 2-like [Pyrus x bretschneideri]
Length=577

 Score =   215 bits (547),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 112/161 (70%), Positives = 127/161 (79%), Gaps = 2/161 (1%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNA  538
            DEIEREKVCSVMD LKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG  D     +A
Sbjct  418  DEIEREKVCSVMDALKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGV-DENDVQDA  476

Query  537  IATRNQLQADVTLVKENEALRTELLQMKMFIADMQ-NkggsqgssvkgssasaVRKPTFF  361
            + TR+Q+Q DV+L +ENE LRTELL+MKM+I D+Q        ++  G      +K TFF
Sbjct  477  VTTRSQVQHDVSLARENEELRTELLKMKMYITDLQKTGSAGIATTSSGKGGGGPKKATFF  536

Query  360  SSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  238
            SS+SKKLGKLNPFK GSKDTSN+ D  VDITKPRRRRFSIS
Sbjct  537  SSVSKKLGKLNPFKQGSKDTSNIMDEGVDITKPRRRRFSIS  577



>ref|XP_010469846.1| PREDICTED: root phototropism protein 2 isoform X1 [Camelina sativa]
 ref|XP_010469847.1| PREDICTED: root phototropism protein 2 isoform X2 [Camelina sativa]
Length=595

 Score =   215 bits (548),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 116/172 (67%), Positives = 135/172 (78%), Gaps = 12/172 (7%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPK-----  553
            DEIEREKVCS MDPLKLSY+AR+HASQNKRLPV IVLHALYYDQLK+RSG E+ +     
Sbjct  424  DEIEREKVCSSMDPLKLSYDARLHASQNKRLPVNIVLHALYYDQLKLRSGVEEHEERAVV  483

Query  552  -STPNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQ----Nkggsqgssvkgssa  388
             + P A+ TR+QLQAD TL KENEALR+EL++MKM+++DMQ      G S  +S    S 
Sbjct  484  VNLPEALKTRSQLQADTTLAKENEALRSELMKMKMYVSDMQKNKNGAGASSSNSTSLVSN  543

Query  387  saVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDD--GEVDITKPRRRRFSIS  238
            +   K TFFSS+SKKLGKLNPF+HGSKDTSNLD+    VDITKPRRRRFSIS
Sbjct  544  NKKSKHTFFSSVSKKLGKLNPFRHGSKDTSNLDEDLAGVDITKPRRRRFSIS  595



>gb|AAB63086.1| unknown protein [Arabidopsis thaliana]
Length=415

 Score =   211 bits (536),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 114/170 (67%), Positives = 135/170 (79%), Gaps = 10/170 (6%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS----  550
            DEIEREKVCS MDPLKLSY+AR+HASQNKRLPV IVLHALYYDQLK+RSG  + +     
Sbjct  246  DEIEREKVCSSMDPLKLSYDARLHASQNKRLPVNIVLHALYYDQLKLRSGVAEQEERAVV  305

Query  549  -TPNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQ---Nkggsqgssvkgssasa  382
              P A+ TR+QLQAD TL KENEALR+EL++MKM+++DMQ   N  G+  S+     +S 
Sbjct  306  VLPEALKTRSQLQADTTLAKENEALRSELMKMKMYVSDMQKNKNGAGASSSNSSSLVSSK  365

Query  381  VRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDD--GEVDITKPRRRRFSIS  238
              K TFFSS+SKKLGKLNPFK+GSKDTS++D+  G VDITKPRRRRFSIS
Sbjct  366  KSKHTFFSSVSKKLGKLNPFKNGSKDTSHIDEDLGGVDITKPRRRRFSIS  415



>ref|XP_003616056.1| Root phototropism protein [Medicago truncatula]
 gb|AES99014.1| root phototropism-like protein [Medicago truncatula]
Length=579

 Score =   214 bits (546),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 111/160 (69%), Positives = 131/160 (82%), Gaps = 5/160 (3%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNA  538
            DE+E+EKVCSVMD LKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGA   +   + 
Sbjct  425  DELEKEKVCSVMDALKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGATAERDAED-  483

Query  537  IATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasaVRKPTFFS  358
               RNQLQ DVTLV+ENE LRTEL++MKM+++D+Q   G  G++        V+K TFFS
Sbjct  484  ---RNQLQTDVTLVRENEELRTELIRMKMYVSDLQK-NGHGGTTSSSEVGKEVKKSTFFS  539

Query  357  SMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  238
            S+SKKLGKLNPFK+GSKDTS+++D  VD+TKPRRRRFSIS
Sbjct  540  SVSKKLGKLNPFKNGSKDTSHIEDVGVDLTKPRRRRFSIS  579



>gb|ADL36608.1| BZIP domain class transcription factor [Malus domestica]
Length=577

 Score =   214 bits (546),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 112/161 (70%), Positives = 127/161 (79%), Gaps = 2/161 (1%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNA  538
            DEIEREKVCSVMD LKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG  D     +A
Sbjct  418  DEIEREKVCSVMDALKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGV-DENDVQDA  476

Query  537  IATRNQLQADVTLVKENEALRTELLQMKMFIADMQ-NkggsqgssvkgssasaVRKPTFF  361
            I TR+++Q DV+L +ENE LRTELL+MKM+I DMQ        ++  G      +K TFF
Sbjct  477  ITTRSRVQHDVSLARENEELRTELLKMKMYITDMQKTGSAGIATTSSGKGGGGPKKATFF  536

Query  360  SSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  238
            SS+SKKLGKLNPFK GSKDTSN+ D  VDI+KPRRRRFSIS
Sbjct  537  SSVSKKLGKLNPFKQGSKDTSNIIDDGVDISKPRRRRFSIS  577



>gb|ACJ85743.1| unknown [Medicago truncatula]
Length=257

 Score =   206 bits (524),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 130/160 (81%), Gaps = 6/160 (4%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNA  538
            DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG++D +    A
Sbjct  104  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGSDDGE-CDGA  162

Query  537  IATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasaVRKPTFFS  358
               RN+L  DV+LV ENE LR+EL +MKM+I DMQ     +  +   +S S+ +K TFFS
Sbjct  163  ATERNRLATDVSLVGENEELRSELTKMKMYITDMQQ---QKNVTPGTTSLSSSKKTTFFS  219

Query  357  SMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  238
            S+SKKLGKL  FK+G+KDT++L+DG VD+TKPRRRRFSIS
Sbjct  220  SVSKKLGKL--FKNGAKDTAHLEDGPVDLTKPRRRRFSIS  257



>gb|EPS73802.1| hypothetical protein M569_00954 [Genlisea aurea]
Length=566

 Score =   214 bits (545),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 108/160 (68%), Positives = 124/160 (78%), Gaps = 5/160 (3%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNA  538
            DEIEREKVC+ MDPLKLSYEARVHASQNKRLPVQIVLHALYYDQL++RSG       PNA
Sbjct  412  DEIEREKVCAAMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLQLRSGGGGDYEKPNA  471

Query  537  IATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasaVRKPTFFS  358
             +TR Q QAD  LVKENE LRTELL+MKM++ ++Q        +   +S+ A +KPTFFS
Sbjct  472  ASTRFQAQADTDLVKENEKLRTELLKMKMYVQEIQE-----SKNQGTTSSKAAKKPTFFS  526

Query  357  SMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  238
            SMSK LGKLNPF+ GSKDT  +DD   D+ KPRRRRFSIS
Sbjct  527  SMSKTLGKLNPFRIGSKDTLQIDDAASDVRKPRRRRFSIS  566



>ref|XP_003519296.1| PREDICTED: root phototropism protein 2 [Glycine max]
Length=580

 Score =   214 bits (545),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 129/160 (81%), Gaps = 1/160 (1%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNA  538
            DEIE+EKVCSV+D LKLSYEARVHAS+NKRLP+QIVLHALYYDQL+IRSG    K    A
Sbjct  422  DEIEKEKVCSVLDTLKLSYEARVHASKNKRLPLQIVLHALYYDQLQIRSGTAADKQAVVA  481

Query  537  IATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasaVRKPTFFS  358
             A + QLQADV+LV+ENE LR+EL++MKMFI+D+Q       SS    +    +KPTFFS
Sbjct  482  AAEKKQLQADVSLVRENEELRSELMKMKMFISDLQK-NVHGTSSSGRENIGPTKKPTFFS  540

Query  357  SMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  238
            SMSKKL KLNPFK+GSKDTS++DD  VD+TKPR+RRFSIS
Sbjct  541  SMSKKLSKLNPFKNGSKDTSHIDDAPVDLTKPRKRRFSIS  580



>ref|XP_010414259.1| PREDICTED: root phototropism protein 2-like [Camelina sativa]
Length=595

 Score =   214 bits (545),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 115/172 (67%), Positives = 135/172 (78%), Gaps = 12/172 (7%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPK-----  553
            DEIEREKVCS MDPLKLSY+AR+HASQNKRLPV IVLHALYYDQLK+RSG E+ +     
Sbjct  424  DEIEREKVCSSMDPLKLSYDARLHASQNKRLPVNIVLHALYYDQLKLRSGVEEQEERAVV  483

Query  552  -STPNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQ----Nkggsqgssvkgssa  388
             + P A+ TR+QLQAD TL KENEALR+EL++MK++++DMQ      G S  +S    S 
Sbjct  484  VNLPEALKTRSQLQADTTLAKENEALRSELMKMKLYVSDMQKNKNGAGTSSSNSTSLVSN  543

Query  387  saVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDD--GEVDITKPRRRRFSIS  238
            +   K TFFSS+SKKLGKLNPF+HGSKDTSNLD+    VDITKPRRRRFSIS
Sbjct  544  NKKSKHTFFSSVSKKLGKLNPFRHGSKDTSNLDEDLAGVDITKPRRRRFSIS  595



>ref|XP_010522018.1| PREDICTED: root phototropism protein 2-like [Tarenaya hassleriana]
Length=572

 Score =   213 bits (543),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 129/161 (80%), Gaps = 6/161 (4%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNA  538
            DEIEREK CS MDPLKLSYEAR+HASQNKRLPV IVLHALYYD LK+RSG ED +  P A
Sbjct  417  DEIEREKACSSMDPLKLSYEARLHASQNKRLPVNIVLHALYYDNLKLRSGKED-RDVPEA  475

Query  537  IATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasaVRKPTFFS  358
            +  R QLQ DV+L KENEALRTEL++MKM+++DMQ   GS G+S     +    K TFFS
Sbjct  476  MEIRGQLQKDVSLEKENEALRTELMKMKMYVSDMQKNQGSVGASSLSKKS----KYTFFS  531

Query  357  SMSKKLGKLNPFKHGSKDTSNL-DDGEVDITKPRRRRFSIS  238
            S+SK LGKLNPF+HG+KDTSN+ DD  VDITKPRRRRFSIS
Sbjct  532  SVSKTLGKLNPFRHGAKDTSNIDDDSGVDITKPRRRRFSIS  572



>ref|XP_002881117.1| hypothetical protein ARALYDRAFT_481966 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57376.1| hypothetical protein ARALYDRAFT_481966 [Arabidopsis lyrata subsp. 
lyrata]
Length=593

 Score =   213 bits (542),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 115/170 (68%), Positives = 135/170 (79%), Gaps = 10/170 (6%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS----  550
            DEIEREKVCS MDPLKLSY+AR+HASQNKRLPV IVLHALYYDQLK+RSG E+ +     
Sbjct  424  DEIEREKVCSSMDPLKLSYDARLHASQNKRLPVNIVLHALYYDQLKLRSGVEEQEERAVV  483

Query  549  -TPNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQ---Nkggsqgssvkgssasa  382
              P A+ TR+QLQAD TL KENEALR+EL++MKM+++DMQ   N  G+  S+     +S 
Sbjct  484  VLPEALKTRSQLQADTTLAKENEALRSELMKMKMYVSDMQKNKNGAGASSSNSSSLVSSK  543

Query  381  VRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDD--GEVDITKPRRRRFSIS  238
              K TFFSS+SKKLGKLNPFK+GSKDTSN+D+    VDITKPRRRRFSIS
Sbjct  544  KNKHTFFSSVSKKLGKLNPFKNGSKDTSNIDEDLAGVDITKPRRRRFSIS  593



>ref|XP_008239637.1| PREDICTED: root phototropism protein 2 isoform X2 [Prunus mume]
Length=584

 Score =   213 bits (542),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 131/167 (78%), Gaps = 7/167 (4%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNA  538
            DEIEREKVCSVMD LKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG ++ +   +A
Sbjct  418  DEIEREKVCSVMDALKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGVDENEMMQDA  477

Query  537  IATRNQLQADVTLVKENEALRTELLQMKMFIADMQNk------ggsqgssvkgssasaVR  376
            + TR+Q+Q DV+L +ENE+LRTELL+MKM+I+D+Q             ++  G      R
Sbjct  478  VTTRSQVQQDVSLARENESLRTELLRMKMYISDLQKSGPAAKGSLGAATTSSGKGGGGPR  537

Query  375  KPTFFSSMSKKLGKLNPFKHGSK-DTSNLDDGEVDITKPRRRRFSIS  238
            K TFFSS+SKKLGKLNPFK GSK DTSN+ D  VDITKPRRRRFSIS
Sbjct  538  KGTFFSSVSKKLGKLNPFKQGSKDDTSNIMDEGVDITKPRRRRFSIS  584



>ref|XP_008239576.1| PREDICTED: root phototropism protein 2 isoform X1 [Prunus mume]
Length=584

 Score =   213 bits (541),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 131/167 (78%), Gaps = 7/167 (4%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNA  538
            DEIEREKVCSVMD LKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG ++ +   +A
Sbjct  418  DEIEREKVCSVMDALKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGVDENEMMQDA  477

Query  537  IATRNQLQADVTLVKENEALRTELLQMKMFIADMQNk------ggsqgssvkgssasaVR  376
            + TR+Q+Q DV+L +ENE+LRTELL+MKM+I+D+Q             ++  G      R
Sbjct  478  VTTRSQVQQDVSLARENESLRTELLRMKMYISDLQKSGPAAKGSLGAATTSSGKGGGGPR  537

Query  375  KPTFFSSMSKKLGKLNPFKHGSK-DTSNLDDGEVDITKPRRRRFSIS  238
            K TFFSS+SKKLGKLNPFK GSK DTSN+ D  VDITKPRRRRFSIS
Sbjct  538  KGTFFSSVSKKLGKLNPFKQGSKDDTSNIMDEGVDITKPRRRRFSIS  584



>ref|XP_010557176.1| PREDICTED: root phototropism protein 2 [Tarenaya hassleriana]
Length=575

 Score =   213 bits (541),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 126/161 (78%), Gaps = 5/161 (3%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNA  538
            DEIEREKVCS +DPLKLSYEAR+HASQNKRLPV IVLHALYYDQLK+RSG E+ +  P  
Sbjct  419  DEIEREKVCSSIDPLKLSYEARLHASQNKRLPVNIVLHALYYDQLKLRSGVEE-RDAPEG  477

Query  537  IATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasaVRKPTFFS  358
            +A R QLQ DV+L KENEALRTEL +MKM+I+DMQ   G    +   S  S     TFFS
Sbjct  478  LAIRGQLQTDVSLAKENEALRTELTKMKMYISDMQKNQGGGVGASSSSKKSKH---TFFS  534

Query  357  SMSKKLGKLNPFKHGSKDTSNLDD-GEVDITKPRRRRFSIS  238
            S+SK LGKLNPF+ GSKDT NLDD G VDITKPRRRRFSIS
Sbjct  535  SVSKTLGKLNPFRQGSKDTLNLDDAGGVDITKPRRRRFSIS  575



>ref|NP_001280895.1| root phototropism protein 2-like [Malus domestica]
 gb|ADL36607.1| BZIP domain class transcription factor [Malus domestica]
Length=577

 Score =   213 bits (541),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 127/161 (79%), Gaps = 2/161 (1%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNA  538
            DEIE+EKVCSVMD LKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG  D     +A
Sbjct  418  DEIEKEKVCSVMDALKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGV-DENDVQDA  476

Query  537  IATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkg-gsqgssvkgssasaVRKPTFF  361
            I TR+Q+Q DV+L +ENE LRTELL+MKM+I D+   G  +  ++         +K  FF
Sbjct  477  ITTRSQVQHDVSLARENEELRTELLKMKMYITDLHKTGPAAVATTSSCKGGGGPKKAKFF  536

Query  360  SSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  238
            SSMSKKLG+LNPFK GSKDTSN+ D +VDITKPRRRRFSIS
Sbjct  537  SSMSKKLGRLNPFKQGSKDTSNIMDEDVDITKPRRRRFSIS  577



>ref|XP_010510344.1| PREDICTED: root phototropism protein 2-like [Camelina sativa]
Length=596

 Score =   213 bits (541),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 114/173 (66%), Positives = 136/173 (79%), Gaps = 13/173 (8%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPK-----  553
            DEIEREKVCS MDPLKLSY+AR+HASQNKRLPV IVLHALYYDQLK+RSG E+ +     
Sbjct  424  DEIEREKVCSSMDPLKLSYDARLHASQNKRLPVNIVLHALYYDQLKLRSGVEEQEERAVV  483

Query  552  -STPNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQ---Nkggsqgssvkgssas  385
             + P A+ TR+QLQAD TL KENEALR+EL++MKM+++DMQ   N  G+  S+     ++
Sbjct  484  VNLPEALKTRSQLQADTTLAKENEALRSELMKMKMYVSDMQKNKNGAGASSSNSTSLVSN  543

Query  384  aVRKP--TFFSSMSKKLGKLNPFKHGSKDTSNLDD--GEVDITKPRRRRFSIS  238
              +K    FFSS+SKKLGKLNPF+HGSKDTSNLD+    VDITKPRRRRFSIS
Sbjct  544  NNKKSKHNFFSSVSKKLGKLNPFRHGSKDTSNLDEDLAGVDITKPRRRRFSIS  596



>ref|NP_001031446.1| Root phototropism protein 2 [Arabidopsis thaliana]
 ref|NP_001077982.1| Root phototropism protein 2 [Arabidopsis thaliana]
 dbj|BAD43060.1| unknown protein [Arabidopsis thaliana]
 gb|AEC08402.1| Root phototropism protein 2 [Arabidopsis thaliana]
 gb|AEC08403.1| Root phototropism protein 2 [Arabidopsis thaliana]
Length=545

 Score =   211 bits (537),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 114/170 (67%), Positives = 135/170 (79%), Gaps = 10/170 (6%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS----  550
            DEIEREKVCS MDPLKLSY+AR+HASQNKRLPV IVLHALYYDQLK+RSG  + +     
Sbjct  376  DEIEREKVCSSMDPLKLSYDARLHASQNKRLPVNIVLHALYYDQLKLRSGVAEQEERAVV  435

Query  549  -TPNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQ---Nkggsqgssvkgssasa  382
              P A+ TR+QLQAD TL KENEALR+EL++MKM+++DMQ   N  G+  S+     +S 
Sbjct  436  VLPEALKTRSQLQADTTLAKENEALRSELMKMKMYVSDMQKNKNGAGASSSNSSSLVSSK  495

Query  381  VRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDD--GEVDITKPRRRRFSIS  238
              K TFFSS+SKKLGKLNPFK+GSKDTS++D+  G VDITKPRRRRFSIS
Sbjct  496  KSKHTFFSSVSKKLGKLNPFKNGSKDTSHIDEDLGGVDITKPRRRRFSIS  545



>ref|XP_008366216.1| PREDICTED: root phototropism protein 2-like [Malus domestica]
Length=577

 Score =   212 bits (539),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 126/161 (78%), Gaps = 2/161 (1%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNA  538
            DEIEREKVCSVMD LKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG  D     +A
Sbjct  418  DEIEREKVCSVMDALKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGX-DENDVQDA  476

Query  537  IATRNQLQADVTLVKENEALRTELLQMKMFIADMQ-NkggsqgssvkgssasaVRKPTFF  361
            I TR+Q+Q DV+L +ENE LRTELL+MK +I D+Q        ++  G      +K TFF
Sbjct  477  ITTRSQVQHDVSLARENEELRTELLKMKXYITDLQKTGSAGIATTSSGKGGGGPKKATFF  536

Query  360  SSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  238
            SS+SKKLGKLNPFK GSKDTSN+ D  VDI+KPRRRRFSIS
Sbjct  537  SSVSKKLGKLNPFKXGSKDTSNIIDDGVDISKPRRRRFSIS  577



>dbj|BAF02185.1| hypothetical protein [Arabidopsis thaliana]
Length=593

 Score =   211 bits (538),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 114/170 (67%), Positives = 135/170 (79%), Gaps = 10/170 (6%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS----  550
            DEIEREKVCS MDPLKLSY+AR+HASQNKRLPV IVLHALYYDQLK+RSG  + +     
Sbjct  424  DEIEREKVCSSMDPLKLSYDARLHASQNKRLPVNIVLHALYYDQLKLRSGVAEQEERAVV  483

Query  549  -TPNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQ---Nkggsqgssvkgssasa  382
              P A+ TR+QLQAD TL KENEALR+EL++MKM+++DMQ   N  G+  S+     +S 
Sbjct  484  VLPEALKTRSQLQADTTLAKENEALRSELMKMKMYVSDMQKNKNGAGASSSNSSSLVSSK  543

Query  381  VRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDD--GEVDITKPRRRRFSIS  238
              K TFFSS+SKKLGKLNPFK+GSKDTS++D+  G VDITKPRRRRFSIS
Sbjct  544  KSKHTFFSSVSKKLGKLNPFKNGSKDTSHIDEDLGGVDITKPRRRRFSIS  593



>ref|NP_850147.1| Root phototropism protein 2 [Arabidopsis thaliana]
 sp|Q682S0.2|RPT2_ARATH RecName: Full=Root phototropism protein 2; AltName: Full=BTB/POZ 
domain-containing protein RPT2 [Arabidopsis thaliana]
 gb|AAK59568.1| unknown protein [Arabidopsis thaliana]
 gb|AAL07245.1| unknown protein [Arabidopsis thaliana]
 gb|AAN31821.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD94074.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD94572.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD95385.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAF01595.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAF01673.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAF02233.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC08401.1| Root phototropism protein 2 [Arabidopsis thaliana]
Length=593

 Score =   211 bits (538),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 114/170 (67%), Positives = 135/170 (79%), Gaps = 10/170 (6%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS----  550
            DEIEREKVCS MDPLKLSY+AR+HASQNKRLPV IVLHALYYDQLK+RSG  + +     
Sbjct  424  DEIEREKVCSSMDPLKLSYDARLHASQNKRLPVNIVLHALYYDQLKLRSGVAEQEERAVV  483

Query  549  -TPNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQ---Nkggsqgssvkgssasa  382
              P A+ TR+QLQAD TL KENEALR+EL++MKM+++DMQ   N  G+  S+     +S 
Sbjct  484  VLPEALKTRSQLQADTTLAKENEALRSELMKMKMYVSDMQKNKNGAGASSSNSSSLVSSK  543

Query  381  VRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDD--GEVDITKPRRRRFSIS  238
              K TFFSS+SKKLGKLNPFK+GSKDTS++D+  G VDITKPRRRRFSIS
Sbjct  544  KSKHTFFSSVSKKLGKLNPFKNGSKDTSHIDEDLGGVDITKPRRRRFSIS  593



>dbj|BAF01791.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAF01873.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAF01940.1| hypothetical protein [Arabidopsis thaliana]
Length=593

 Score =   211 bits (538),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 114/170 (67%), Positives = 135/170 (79%), Gaps = 10/170 (6%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS----  550
            DEIEREKVCS MDPLKLSY+AR+HASQNKRLPV IVLHALYYDQLK+RSG  + +     
Sbjct  424  DEIEREKVCSSMDPLKLSYDARLHASQNKRLPVNIVLHALYYDQLKLRSGVAEQEERAVV  483

Query  549  -TPNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQ---Nkggsqgssvkgssasa  382
              P A+ TR+QLQAD TL KENEALR+EL++MKM+++DMQ   N  G+  S+     +S 
Sbjct  484  VLPEALKTRSQLQADTTLAKENEALRSELMKMKMYVSDMQKNKNGAGASSSNSSSLVSSK  543

Query  381  VRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDD--GEVDITKPRRRRFSIS  238
              K TFFSS+SKKLGKLNPFK+GSKDTS++D+  G VDITKPRRRRFSIS
Sbjct  544  KSKHTFFSSVSKKLGKLNPFKNGSKDTSHIDEDLGGVDITKPRRRRFSIS  593



>ref|XP_009355145.1| PREDICTED: root phototropism protein 2-like [Pyrus x bretschneideri]
Length=577

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 108/161 (67%), Positives = 126/161 (78%), Gaps = 2/161 (1%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNA  538
            DEIE+EKVCSVMD LKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG E+     +A
Sbjct  418  DEIEKEKVCSVMDALKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGVEE-NDVQDA  476

Query  537  IATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkg-gsqgssvkgssasaVRKPTFF  361
              TR Q+Q DV+L +ENE LRTELL+MKM+I D+Q  G     ++         +K TFF
Sbjct  477  TMTRRQVQHDVSLARENEELRTELLKMKMYITDLQKTGPAGVATTSSCKGGGGPKKATFF  536

Query  360  SSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  238
            SS+SKKLG+LNPFK GSKDT N+ D +VD+TKPRRRRFSIS
Sbjct  537  SSVSKKLGRLNPFKQGSKDTMNIVDEDVDLTKPRRRRFSIS  577



>gb|AAF33112.1|AF181683_1 RPT2 [Arabidopsis thaliana]
Length=593

 Score =   210 bits (535),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 113/170 (66%), Positives = 135/170 (79%), Gaps = 10/170 (6%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS----  550
            DEIEREKVCS MDPLKLSY+AR+HASQNKRLPV IVLHALYYDQLK+RSG  + +     
Sbjct  424  DEIEREKVCSSMDPLKLSYDARLHASQNKRLPVNIVLHALYYDQLKLRSGVAEQEERAVV  483

Query  549  -TPNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQ---Nkggsqgssvkgssasa  382
              P A+ TR+QLQAD TL KENEALR+EL++MKM+++DMQ   N  G+  S+     +S 
Sbjct  484  VLPEALKTRSQLQADTTLAKENEALRSELMKMKMYVSDMQKNKNGAGASSSNSSSLVSSK  543

Query  381  VRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDD--GEVDITKPRRRRFSIS  238
              K TFFSS+S+KLGKLNPFK+GSKDTS++D+  G VDITKPRRRRFSIS
Sbjct  544  KSKHTFFSSVSRKLGKLNPFKNGSKDTSHIDEDLGGVDITKPRRRRFSIS  593



>ref|XP_004490729.1| PREDICTED: root phototropism protein 2-like [Cicer arietinum]
Length=573

 Score =   209 bits (533),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 107/160 (67%), Positives = 129/160 (81%), Gaps = 8/160 (5%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNA  538
            DE+E+EKVCSVMD LKLSYEARVHASQNKRLPVQIVLHALY+DQLK+RSGA   +   + 
Sbjct  422  DELEKEKVCSVMDALKLSYEARVHASQNKRLPVQIVLHALYFDQLKLRSGAVVER---DV  478

Query  537  IATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasaVRKPTFFS  358
             A RNQLQ DVTLV+ENE LR+EL++MKM++ D++            SS+  V+K TFFS
Sbjct  479  TAERNQLQTDVTLVRENEELRSELMRMKMYVTDLKK-----NVDGTTSSSREVKKSTFFS  533

Query  357  SMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  238
            S+SKKLGKLNPFK+G+KDTS ++DG VD+ KPRRRRFSIS
Sbjct  534  SVSKKLGKLNPFKNGAKDTSTIEDGPVDLIKPRRRRFSIS  573



>ref|NP_001280845.1| root phototropism protein 2-like [Malus domestica]
 gb|ADL36603.1| BZIP domain class transcription factor [Malus domestica]
Length=577

 Score =   208 bits (530),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 108/161 (67%), Positives = 126/161 (78%), Gaps = 2/161 (1%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNA  538
            DEIE+EKVCSVMD LKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG  D     +A
Sbjct  418  DEIEKEKVCSVMDALKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGV-DENDVQDA  476

Query  537  IATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkg-gsqgssvkgssasaVRKPTFF  361
            I TR+Q+Q DV+L +ENE LRTELL+MKM+I D+   G  +  ++         +K  FF
Sbjct  477  ITTRSQVQHDVSLARENEELRTELLKMKMYITDLHKTGPAAVATTSSCKGGGGPKKAKFF  536

Query  360  SSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  238
            S +SKKLG+LNPFK GSKDTSN+ D +VDITKPRRRRFSIS
Sbjct  537  SYVSKKLGRLNPFKQGSKDTSNIVDEDVDITKPRRRRFSIS  577



>ref|XP_003600551.1| Root phototropism protein [Medicago truncatula]
Length=513

 Score =   207 bits (526),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 131/160 (82%), Gaps = 6/160 (4%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNA  538
            DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG++D +    A
Sbjct  360  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGSDDGE-CDGA  418

Query  537  IATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasaVRKPTFFS  358
               RN+L  DV+LV+ENE LR+EL +MKM+I DMQ     +  +   +S S+ +K TFFS
Sbjct  419  ATERNRLATDVSLVRENEELRSELTKMKMYITDMQQ---QKNVTPGTTSLSSSKKTTFFS  475

Query  357  SMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  238
            S+SKKLGKL  FK+G+KDT++L+DG VD+TKPRRRRFSIS
Sbjct  476  SVSKKLGKL--FKNGAKDTAHLEDGPVDLTKPRRRRFSIS  513



>gb|AES70802.2| root phototropism-like protein [Medicago truncatula]
Length=526

 Score =   207 bits (526),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 131/160 (82%), Gaps = 6/160 (4%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNA  538
            DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG++D +    A
Sbjct  373  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGSDDGE-CDGA  431

Query  537  IATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasaVRKPTFFS  358
               RN+L  DV+LV+ENE LR+EL +MKM+I DMQ     +  +   +S S+ +K TFFS
Sbjct  432  ATERNRLATDVSLVRENEELRSELTKMKMYITDMQQ---QKNVTPGTTSLSSSKKTTFFS  488

Query  357  SMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  238
            S+SKKLGKL  FK+G+KDT++L+DG VD+TKPRRRRFSIS
Sbjct  489  SVSKKLGKL--FKNGAKDTAHLEDGPVDLTKPRRRRFSIS  526



>ref|XP_008349518.1| PREDICTED: LOW QUALITY PROTEIN: root phototropism protein 2-like 
[Malus domestica]
Length=577

 Score =   207 bits (528),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 109/161 (68%), Positives = 125/161 (78%), Gaps = 2/161 (1%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNA  538
            DEIEREKVCSVMD LKLSYEARVHASQNK  PVQIVLHALYYDQLK+RSG  +     +A
Sbjct  418  DEIEREKVCSVMDALKLSYEARVHASQNKTTPVQIVLHALYYDQLKLRSGXXE-NDVQDA  476

Query  537  IATRNQLQADVTLVKENEALRTELLQMKMFIADMQ-NkggsqgssvkgssasaVRKPTFF  361
            I TR+Q+Q DV+L +ENE LRTELL+MKM+I D+Q        ++  G      +K TFF
Sbjct  477  ITTRSQVQHDVSLARENEELRTELLKMKMYITDLQKTGSAGIATTSSGKGGGGPKKATFF  536

Query  360  SSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  238
            SS+SKKLGKLNPFK GSKDTSN+ D  VDI+KPRRRRFSIS
Sbjct  537  SSVSKKLGKLNPFKXGSKDTSNIIDDGVDISKPRRRRFSIS  577



>ref|XP_003600550.1| Root phototropism protein [Medicago truncatula]
 gb|AES70801.1| root phototropism-like protein [Medicago truncatula]
Length=568

 Score =   207 bits (526),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 131/160 (82%), Gaps = 6/160 (4%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNA  538
            DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLK+RSG++D +    A
Sbjct  415  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKLRSGSDDGE-CDGA  473

Query  537  IATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasaVRKPTFFS  358
               RN+L  DV+LV+ENE LR+EL +MKM+I DMQ     +  +   +S S+ +K TFFS
Sbjct  474  ATERNRLATDVSLVRENEELRSELTKMKMYITDMQQ---QKNVTPGTTSLSSSKKTTFFS  530

Query  357  SMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  238
            S+SKKLGKL  FK+G+KDT++L+DG VD+TKPRRRRFSIS
Sbjct  531  SVSKKLGKL--FKNGAKDTAHLEDGPVDLTKPRRRRFSIS  568



>gb|KFK22949.1| root phototropism protein 2 [Arabis alpina]
Length=596

 Score =   207 bits (527),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 110/173 (64%), Positives = 135/173 (78%), Gaps = 13/173 (8%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKST---  547
            DEIEREKVCS MDPLKLSY+AR+HASQNKRLPV IVLHALYYDQLK+RSG E+ + T   
Sbjct  424  DEIEREKVCSSMDPLKLSYDARLHASQNKRLPVNIVLHALYYDQLKLRSGVEEKQGTVVI  483

Query  546  -PNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasaVR--  376
             P A+ATR Q++AD +L KENEALR+EL++MKM+++D+Q    S G +   +S++ V   
Sbjct  484  VPEALATRGQVKADTSLAKENEALRSELMKMKMYVSDLQKNKQSGGGASSSNSSALVSSS  543

Query  375  -----KPTFFSSMSKKLGKLNPFKHGSKDTSNLDD--GEVDITKPRRRRFSIS  238
                 K  FFSS+SKKLGK NPF+HGSKDTS++D+    VDITKPRRRRFSIS
Sbjct  544  NKKNIKQNFFSSVSKKLGKFNPFRHGSKDTSHIDEDLAGVDITKPRRRRFSIS  596



>gb|KHN24717.1| Root phototropism protein 2 [Glycine soja]
Length=152

 Score =   194 bits (493),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 123/157 (78%), Gaps = 13/157 (8%)
 Frame = -2

Query  684  MDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIAT-RNQLQAD  508
            MDPLKLSYEARVHASQNKRLPVQIVLHALYYDQL++RSGAE+ +     +AT +NQLQ D
Sbjct  1    MDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLRLRSGAEERE-----VATEKNQLQMD  55

Query  507  VTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasaV-------RKPTFFSSMS  349
            VTLV+ENE LRTEL++MKM+I+D+Q    +   +      +         +K TFFSS+S
Sbjct  56   VTLVRENEELRTELMKMKMYISDLQQNKNTNNGANPQGHGTTSSAANPNPKKATFFSSVS  115

Query  348  KKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  238
            K LGKLNPF++GSKDT++L+DG VD+TKPRRRRFS+S
Sbjct  116  KTLGKLNPFRNGSKDTTHLEDGNVDLTKPRRRRFSVS  152



>ref|XP_004500391.1| PREDICTED: root phototropism protein 2-like [Cicer arietinum]
Length=569

 Score =   204 bits (518),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 103/160 (64%), Positives = 127/160 (79%), Gaps = 5/160 (3%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNA  538
            DEIEREKVCSVMD LKLSYEARVHASQ KRLPVQIVLHALYYDQL++RSG++D  +   A
Sbjct  415  DEIEREKVCSVMDTLKLSYEARVHASQKKRLPVQIVLHALYYDQLRLRSGSDDGDT---A  471

Query  537  IATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasaVRKPTFFS  358
               +N+L  DV+LV+ENE LR+EL +MKM+++DMQ    +       +S+ + +K  FFS
Sbjct  472  ATKKNRLNTDVSLVRENEELRSELAKMKMYVSDMQQ--KNVSQVHGTTSSHSTKKTKFFS  529

Query  357  SMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  238
            S+SK LGKLNPFKH +KDT++LDDG VD+ KPRRRRFSIS
Sbjct  530  SVSKTLGKLNPFKHEAKDTTHLDDGPVDLIKPRRRRFSIS  569



>emb|CDX84827.1| BnaA03g14030D [Brassica napus]
Length=565

 Score =   201 bits (512),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 124/162 (77%), Gaps = 5/162 (3%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAI  535
            EIEREKVCS+MDPLKLSY+AR+HASQNKRLPV IVLH LYYDQLK+RS  ED + TP  I
Sbjct  406  EIEREKVCSLMDPLKLSYDARLHASQNKRLPVNIVLHTLYYDQLKLRSEVEDKEGTP-VI  464

Query  534  ATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasaVRKPTFFSS  355
                    D +L KENE LR+EL++MKM+++D+QN   +  SS    S     K TFFSS
Sbjct  465  VPEGLGTRDSSLAKENEDLRSELMKMKMYVSDLQNNVAAGASSSNAPSNKKNSKHTFFSS  524

Query  354  MSKKLGKLNPFKHGSKDTSNLD---DGEVDITKPRRRRFSIS  238
            +SKKLGKLNPF+HGSKDTSN+D   DG VDITKPRRRRFSIS
Sbjct  525  VSKKLGKLNPFRHGSKDTSNIDEDLDG-VDITKPRRRRFSIS  565



>ref|XP_009132742.1| PREDICTED: root phototropism protein 2-like [Brassica rapa]
Length=575

 Score =   201 bits (512),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 124/162 (77%), Gaps = 5/162 (3%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAI  535
            EIEREKVCS+MDPLKLSY+AR+HASQNKRLPV IVLH LYYDQLK+RS  ED + TP  I
Sbjct  416  EIEREKVCSLMDPLKLSYDARLHASQNKRLPVNIVLHTLYYDQLKLRSEVEDKEGTP-VI  474

Query  534  ATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasaVRKPTFFSS  355
                    D +L KENE LR+EL++MKM+++D+QN   +  SS    S     K TFFSS
Sbjct  475  VPEGLGTRDSSLAKENEDLRSELMKMKMYVSDLQNNVAAGASSSNAPSNKKNSKHTFFSS  534

Query  354  MSKKLGKLNPFKHGSKDTSNLD---DGEVDITKPRRRRFSIS  238
            +SKKLGKLNPF+HGSKDTSN+D   DG VDITKPRRRRFSIS
Sbjct  535  VSKKLGKLNPFRHGSKDTSNIDEDLDG-VDITKPRRRRFSIS  575



>ref|XP_009402206.1| PREDICTED: root phototropism protein 2 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=540

 Score =   199 bits (505),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 105/164 (64%), Positives = 130/164 (79%), Gaps = 7/164 (4%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAI  535
            EIEREKVCSVMDPLKLSYEAR+HASQNKRLP+QIVLHALYYDQLK+RSG  D ++   A+
Sbjct  379  EIEREKVCSVMDPLKLSYEARLHASQNKRLPLQIVLHALYYDQLKLRSGI-DGEAAAGAL  437

Query  534  AT---RNQ-LQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasaVRKPT  367
                 R++ L+ADV+L++ENE LR+EL +MKM+++++Q  GG  G           +K +
Sbjct  438  GVTLGRDEGLKADVSLIRENETLRSELAKMKMYVSELQR-GGGGGGGEGSGVKIGSKKTS  496

Query  366  FFSSMSKKLGKLNPFKHGSKDTSNLDDG-EVDITKPRRRRFSIS  238
            FFSS+S+ LGKLNPFK GSKDTSN+DDG  VD+TKPRRRRFSIS
Sbjct  497  FFSSVSRTLGKLNPFKQGSKDTSNIDDGVGVDVTKPRRRRFSIS  540



>emb|CDY10743.1| BnaA05g11930D [Brassica napus]
Length=581

 Score =   199 bits (507),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 136/168 (81%), Gaps = 8/168 (5%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKST---  547
            DEIEREKVCS MDPLKLSYEAR+HASQNKRLPV IVLHALYYDQLK+RSG ED +     
Sbjct  414  DEIEREKVCSSMDPLKLSYEARLHASQNKRLPVNIVLHALYYDQLKLRSGVEDKEGAVVV  473

Query  546  -PNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgs--sasaVR  376
             P A+ATR Q++AD +L KENEALR+EL++MKM+++D+Q  GG+ G+S   +  S     
Sbjct  474  LPEAVATRGQVKADASLAKENEALRSELMKMKMYVSDLQKSGGAAGASSSNAPPSNKKSS  533

Query  375  KPTFFSSMSKKLGKLNPFKHGSKDTSNLDD--GEVDITKPRRRRFSIS  238
            K TFFSS+SKKLGKLNPF+HGSKDTSN+D+    VDITKPRRRRFSIS
Sbjct  534  KSTFFSSVSKKLGKLNPFRHGSKDTSNIDEDLAGVDITKPRRRRFSIS  581



>ref|XP_009144295.1| PREDICTED: root phototropism protein 2 [Brassica rapa]
Length=591

 Score =   199 bits (507),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 136/168 (81%), Gaps = 8/168 (5%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKST---  547
            DEIEREKVCS MDPLKLSYEAR+HASQNKRLPV IVLHALYYDQLK+RSG ED +     
Sbjct  424  DEIEREKVCSSMDPLKLSYEARLHASQNKRLPVNIVLHALYYDQLKLRSGVEDKEGAVVV  483

Query  546  -PNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgs--sasaVR  376
             P A+ATR Q++AD +L KENEALR+EL++MKM+++D+Q  GG+ G+S   +  S     
Sbjct  484  LPEAVATRGQVKADASLAKENEALRSELMKMKMYVSDLQKSGGAAGASSSNAPPSNKKSS  543

Query  375  KPTFFSSMSKKLGKLNPFKHGSKDTSNLDD--GEVDITKPRRRRFSIS  238
            K TFFSS+SKKLGKLNPF+HGSKDTSN+D+    VDITKPRRRRFSIS
Sbjct  544  KSTFFSSVSKKLGKLNPFRHGSKDTSNIDEDLAGVDITKPRRRRFSIS  591



>emb|CDY23992.1| BnaC03g16990D [Brassica napus]
Length=565

 Score =   199 bits (505),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 126/166 (76%), Gaps = 13/166 (8%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKST----  547
            EIEREKVCS+MDPLKLS + R+HASQNKRLPV IVLHALYYDQLK+RS  ED + T    
Sbjct  406  EIEREKVCSLMDPLKLSCDPRLHASQNKRLPVNIVLHALYYDQLKLRSEVEDKEGTPVIV  465

Query  546  PNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasaVRKPT  367
            P A+ TR     D +L KENE LR+EL++MKM+++D+QN   +  SS    S     K T
Sbjct  466  PEALGTR-----DSSLAKENEDLRSELMKMKMYVSDLQNNVAAGASSSNAPSNKKNSKHT  520

Query  366  FFSSMSKKLGKLNPFKHGSKDTSNLD---DGEVDITKPRRRRFSIS  238
            FFSS+SKKLGKLNPF+HGSKDTSN+D   DG VDITKPRRRRFSIS
Sbjct  521  FFSSVSKKLGKLNPFRHGSKDTSNIDEDLDG-VDITKPRRRRFSIS  565



>ref|XP_009402205.1| PREDICTED: root phototropism protein 2 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=581

 Score =   199 bits (505),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 105/164 (64%), Positives = 130/164 (79%), Gaps = 7/164 (4%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAI  535
            EIEREKVCSVMDPLKLSYEAR+HASQNKRLP+QIVLHALYYDQLK+RSG  D ++   A+
Sbjct  420  EIEREKVCSVMDPLKLSYEARLHASQNKRLPLQIVLHALYYDQLKLRSGI-DGEAAAGAL  478

Query  534  AT---RNQ-LQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasaVRKPT  367
                 R++ L+ADV+L++ENE LR+EL +MKM+++++Q  GG  G           +K +
Sbjct  479  GVTLGRDEGLKADVSLIRENETLRSELAKMKMYVSELQR-GGGGGGGEGSGVKIGSKKTS  537

Query  366  FFSSMSKKLGKLNPFKHGSKDTSNLDDG-EVDITKPRRRRFSIS  238
            FFSS+S+ LGKLNPFK GSKDTSN+DDG  VD+TKPRRRRFSIS
Sbjct  538  FFSSVSRTLGKLNPFKQGSKDTSNIDDGVGVDVTKPRRRRFSIS  581



>ref|XP_010044625.1| PREDICTED: root phototropism protein 2-like [Eucalyptus grandis]
 gb|KCW86717.1| hypothetical protein EUGRSUZ_B03325 [Eucalyptus grandis]
Length=570

 Score =   198 bits (504),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 105/160 (66%), Positives = 124/160 (78%), Gaps = 6/160 (4%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNA  538
            DE+EREK CSVMDPLKLS+EAR+HASQNKR P QIVLHALY DQLK+RSG  D +   + 
Sbjct  417  DEVEREKACSVMDPLKLSHEARIHASQNKRFPAQIVLHALYNDQLKLRSGM-DNRDVCDP  475

Query  537  IATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasaVRKPTFFS  358
            +ATR+Q+ ADV+L++ENE LR+EL+ MK  I+DMQN      S    SS    +K TFFS
Sbjct  476  MATRSQVLADVSLIRENETLRSELMMMKKNISDMQN----PKSQGTTSSKGGAKKTTFFS  531

Query  357  SMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  238
            SM+K LGKLNPF+ GSKD SN+DD  VDITKPRRRRFSIS
Sbjct  532  SMTKTLGKLNPFRQGSKDASNIDD-LVDITKPRRRRFSIS  570



>gb|KCW86718.1| hypothetical protein EUGRSUZ_B03325 [Eucalyptus grandis]
Length=577

 Score =   198 bits (504),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 105/160 (66%), Positives = 124/160 (78%), Gaps = 6/160 (4%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNA  538
            DE+EREK CSVMDPLKLS+EAR+HASQNKR P QIVLHALY DQLK+RSG  D +   + 
Sbjct  424  DEVEREKACSVMDPLKLSHEARIHASQNKRFPAQIVLHALYNDQLKLRSGM-DNRDVCDP  482

Query  537  IATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasaVRKPTFFS  358
            +ATR+Q+ ADV+L++ENE LR+EL+ MK  I+DMQN      S    SS    +K TFFS
Sbjct  483  MATRSQVLADVSLIRENETLRSELMMMKKNISDMQN----PKSQGTTSSKGGAKKTTFFS  538

Query  357  SMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  238
            SM+K LGKLNPF+ GSKD SN+DD  VDITKPRRRRFSIS
Sbjct  539  SMTKTLGKLNPFRQGSKDASNIDD-LVDITKPRRRRFSIS  577



>ref|XP_009384760.1| PREDICTED: root phototropism protein 2-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=538

 Score =   195 bits (496),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 104/164 (63%), Positives = 124/164 (76%), Gaps = 6/164 (4%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAED--PKSTP  544
            DEIEREK  SV+DPLKLSYEAR+HASQNKRLP+QIVLHALYYDQLK RSG ED      P
Sbjct  377  DEIEREKASSVIDPLKLSYEARLHASQNKRLPLQIVLHALYYDQLKQRSGMEDEAAAGAP  436

Query  543  NA-IATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasaVRKPT  367
             A +   + L ADV+L++ENEALR+EL +MKM++++M    G  G        +  +K  
Sbjct  437  GATLGPDHGLNADVSLIRENEALRSELARMKMYVSEMHR--GGGGGGQGSGVKARSKKAM  494

Query  366  FFSSMSKKLGKLNPFKHGSKDTSNLDDG-EVDITKPRRRRFSIS  238
            FFSS+S+ LGKLNPFK GSKDTSN+DDG  VD+TKPRRRRFSIS
Sbjct  495  FFSSVSRTLGKLNPFKQGSKDTSNMDDGVVVDVTKPRRRRFSIS  538



>ref|XP_009384759.1| PREDICTED: root phototropism protein 2-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=582

 Score =   195 bits (496),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 104/164 (63%), Positives = 124/164 (76%), Gaps = 6/164 (4%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAED--PKSTP  544
            DEIEREK  SV+DPLKLSYEAR+HASQNKRLP+QIVLHALYYDQLK RSG ED      P
Sbjct  421  DEIEREKASSVIDPLKLSYEARLHASQNKRLPLQIVLHALYYDQLKQRSGMEDEAAAGAP  480

Query  543  NA-IATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasaVRKPT  367
             A +   + L ADV+L++ENEALR+EL +MKM++++M    G  G        +  +K  
Sbjct  481  GATLGPDHGLNADVSLIRENEALRSELARMKMYVSEMHR--GGGGGGQGSGVKARSKKAM  538

Query  366  FFSSMSKKLGKLNPFKHGSKDTSNLDDG-EVDITKPRRRRFSIS  238
            FFSS+S+ LGKLNPFK GSKDTSN+DDG  VD+TKPRRRRFSIS
Sbjct  539  FFSSVSRTLGKLNPFKQGSKDTSNMDDGVVVDVTKPRRRRFSIS  582



>emb|CDY02075.1| BnaC04g14260D [Brassica napus]
Length=580

 Score =   192 bits (487),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 114/167 (68%), Positives = 133/167 (80%), Gaps = 7/167 (4%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS----  550
            DEIEREKVCS MDPLKLSYEAR+HASQNKRLPV IVLHALYYDQLK+RSG ED +     
Sbjct  414  DEIEREKVCSSMDPLKLSYEARLHASQNKRLPVNIVLHALYYDQLKLRSGVEDKEGAVVV  473

Query  549  TPNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkg-ssasaVRK  373
             P A+ATR Q++AD +L KENEALR+EL++MKM+++D+Q  G +  SS     S     K
Sbjct  474  VPEAVATRGQVKADASLAKENEALRSELMKMKMYVSDLQKSGAAGASSSNAPPSNKKSSK  533

Query  372  PTFFSSMSKKLGKLNPFKHGSKDTSNLDD--GEVDITKPRRRRFSIS  238
             TFFSS+SKKLGKLNPF+HGSKDTSN+D+    VDITKPRRRRFSIS
Sbjct  534  STFFSSVSKKLGKLNPFRHGSKDTSNIDEDLAGVDITKPRRRRFSIS  580



>ref|XP_011080638.1| PREDICTED: root phototropism protein 2 [Sesamum indicum]
Length=570

 Score =   184 bits (468),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 101/160 (63%), Positives = 115/160 (72%), Gaps = 7/160 (4%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNA  538
            DEI+R KVCSVMDPL+LS++ARVHASQN RLPVQIVLHAL+YDQLK+  G  D     +A
Sbjct  418  DEIKRLKVCSVMDPLRLSHQARVHASQNNRLPVQIVLHALHYDQLKLTRGIYDDHLLLDA  477

Query  537  IATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasaVRKPTFFS  358
               RN LQ DV+LVKENEALRTELL+M+M + DMQ               S V+K TFFS
Sbjct  478  PRARNYLQIDVSLVKENEALRTELLRMRMCMRDMQR-------IQGTPYRSRVKKHTFFS  530

Query  357  SMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  238
            S+SK LG LNPFKH  KDTSN+DD  VD T  RR RFSIS
Sbjct  531  SLSKTLGILNPFKHARKDTSNVDDEMVDSTTLRRGRFSIS  570



>gb|KHN18647.1| Root phototropism protein 2 [Glycine soja]
Length=312

 Score =   175 bits (444),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 98/163 (60%), Positives = 117/163 (72%), Gaps = 29/163 (18%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNA  538
            DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQL++RSGAE+ +     
Sbjct  176  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLRLRSGAEERE-----  230

Query  537  IAT-RNQLQADVTLVK--ENEALRTELLQMKMFIADMQNkggsqgssvkgssasaVRKPT  367
            +AT +NQLQ DVTL K   N+A                            +S++  +K T
Sbjct  231  VATEKNQLQMDVTLNKNTNNDA---------------------NPQGHGTTSSATPKKAT  269

Query  366  FFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  238
            FFSS+SK LGKLNPF++GSKDT++L+D  VD+TKPRRRRFS+S
Sbjct  270  FFSSVSKTLGKLNPFRNGSKDTTHLEDASVDLTKPRRRRFSMS  312



>ref|XP_010922790.1| PREDICTED: root phototropism protein 2 [Elaeis guineensis]
Length=577

 Score =   177 bits (450),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 124/163 (76%), Gaps = 10/163 (6%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGA--EDPKSTPN  541
            EIEREK+CSVMDPLKL+Y+AR+HASQN RLP+QIVL ALYYDQLK+RSGA  E+  + PN
Sbjct  421  EIEREKLCSVMDPLKLTYDARLHASQNNRLPLQIVLQALYYDQLKLRSGAEPENAVTPPN  480

Query  540  A-IATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasaVRKPTF  364
            +  A R    AD +L++ENEALR+EL +MK+ ++++Q       S       +  ++PTF
Sbjct  481  SAAAARAGAMADASLMRENEALRSELTRMKLCLSELQR------SQGTSGLKAGPKRPTF  534

Query  363  FSSMSKKLGKLNPFKHGSKDTSNLDDG-EVDITKPRRRRFSIS  238
            FSS SK L KLNPF+HGSKDT+++DDG  VD+TKPRRRRFSI 
Sbjct  535  FSSFSKTLEKLNPFRHGSKDTASIDDGVGVDLTKPRRRRFSIG  577



>ref|XP_004978520.1| PREDICTED: root phototropism protein 2-like [Setaria italica]
Length=604

 Score =   167 bits (422),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 118/168 (70%), Gaps = 13/168 (8%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS--GAEDPKSTP  544
            DEIEREKVCSVMDPLKLSY+AR+HASQNKRLP+Q VL ALYYDQLK+RS  GA D  +  
Sbjct  442  DEIEREKVCSVMDPLKLSYQARLHASQNKRLPLQAVLSALYYDQLKLRSAAGAGDDDTQS  501

Query  543  NAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasaVRKPTF  364
             A   R Q +AD +L +ENEALR+EL +M+ +++ MQ            S + A +K +F
Sbjct  502  AAGKARAQARADASLARENEALRSELARMRAYLSGMQP-----SRGSGSSPSPAAKKTSF  556

Query  363  FSSMSKKLGKLNPFKHG-SKDTSNLDDG-----EVDITKPRRRRFSIS  238
              S+S+ L +LNPFK G +KDT+++ DG     E+ + +P+RRRFSIS
Sbjct  557  LGSVSRTLSRLNPFKGGWAKDTASVADGRDGRKEMHVVRPKRRRFSIS  604



>ref|XP_009374446.1| PREDICTED: putative disease resistance protein RGA3 [Pyrus x 
bretschneideri]
Length=1090

 Score =   169 bits (427),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 103/136 (76%), Gaps = 2/136 (1%)
 Frame = -2

Query  717   DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNA  538
             DEIEREKVCSVMD LKLSYEARVHASQNKRLPVQIVLHALYYDQ K+RSG  D     +A
Sbjct  950   DEIEREKVCSVMDALKLSYEARVHASQNKRLPVQIVLHALYYDQPKLRSGV-DENDVQDA  1008

Query  537   IATRNQLQADVTLVKENEALRTELLQMKMFIADMQ-NkggsqgssvkgssasaVRKPTFF  361
             + TR+Q+Q DV+L +ENE LR ELL+MKM+I D+Q        ++  G      +K TFF
Sbjct  1009  VTTRSQVQHDVSLARENEELRMELLKMKMYITDLQKTGSAGIATTSSGKGGGGPKKATFF  1068

Query  360   SSMSKKLGKLNPFKHG  313
             SS+SKKLGKLNPFK G
Sbjct  1069  SSVSKKLGKLNPFKQG  1084



>gb|EMS47631.1| Root phototropism protein 2 [Triticum urartu]
Length=386

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 114/171 (67%), Gaps = 11/171 (6%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGA-----EDPK  553
            DEIEREKVCSVMD LKLSY AR+HASQNKRLP+Q VL ALYYDQLK+RS       ED  
Sbjct  216  DEIEREKVCSVMDTLKLSYTARIHASQNKRLPLQAVLSALYYDQLKLRSAGVGHDDEDSD  275

Query  552  STPNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasaVRK  373
            +   A + R Q +AD  L +ENEALR+EL +M+  ++    +    GS    ++    +K
Sbjct  276  ARSEAGSARMQAKADAALARENEALRSELARMRAHLSSGVQQSKGSGSRTAATATVPGKK  335

Query  372  PTFFSSMSKKLGKLNPFKHG---SKDTSNLDD---GEVDITKPRRRRFSIS  238
             +FF SMS+ L +LNPF+ G   SKDTS++ D   G +++ KP+RRR SIS
Sbjct  336  ASFFGSMSRTLSRLNPFRAGGGWSKDTSSIRDSRGGAMNVVKPKRRRSSIS  386



>ref|XP_008669932.1| PREDICTED: root phototropism protein 2-like [Zea mays]
 tpg|DAA39312.1| TPA: putative phototropic-responsive NPH3 family protein [Zea 
mays]
Length=577

 Score =   161 bits (407),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 90/177 (51%), Positives = 118/177 (67%), Gaps = 17/177 (10%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-----GAEDPK  553
            DEIEREKVCSVMDPL+LSY+AR+HASQNKRLP+Q VL  LYYDQLKIRS     G E+  
Sbjct  401  DEIEREKVCSVMDPLRLSYQARMHASQNKRLPLQAVLSVLYYDQLKIRSADGSGGTEEGW  460

Query  552  STPNAIA-TRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgs------  394
             T +A    R Q +ADV+L +ENEALR EL +M+ +++ MQ      GS    S      
Sbjct  461  ETQSAAGKARAQARADVSLARENEALRLELARMRAYVSGMQQSSKGSGSRPSSSSLVPGP  520

Query  393  sasaVRKPTFFSSMSKKLGKLNPFKHG-SKDTSNLDDG----EVDITKPRRRRFSIS  238
            + +  +K +F  S+S+ L +LNPFK G +KDT+++ DG     + + KP+RRRFSI 
Sbjct  521  ATATGKKASFLGSVSRTLSRLNPFKGGWAKDTTSIADGRDRTSMHVVKPKRRRFSIG  577



>ref|XP_004977394.1| PREDICTED: root phototropism protein 2-like [Setaria italica]
Length=560

 Score =   160 bits (404),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 117/168 (70%), Gaps = 13/168 (8%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS--GAEDPKSTP  544
            DEIEREKVCSVMDPLKLSY+AR+HASQNKRLP+Q VL ALYYDQLK+RS  GA D  +  
Sbjct  398  DEIEREKVCSVMDPLKLSYQARLHASQNKRLPLQAVLSALYYDQLKLRSAAGAGDDDTQS  457

Query  543  NAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasaVRKPTF  364
             A   R Q +AD +L +ENEALR+EL +M+ +++ +Q            S + A +K +F
Sbjct  458  AAGKARAQARADASLARENEALRSELARMRAYLSGVQP-----SKGSGSSPSPAAKKTSF  512

Query  363  FSSMSKKLGKLNPFKHG-SKDTSNLDDG-----EVDITKPRRRRFSIS  238
              S+S+ L +LNPFK G +KDT+++ DG     ++ + +P+RRR SIS
Sbjct  513  LGSVSRTLSRLNPFKGGWAKDTASVADGRDGRKDMHVVRPKRRRSSIS  560



>ref|XP_008803009.1| PREDICTED: root phototropism protein 2 [Phoenix dactylifera]
Length=583

 Score =   159 bits (401),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 87/169 (51%), Positives = 117/169 (69%), Gaps = 19/169 (11%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGA---EDPKSTP  544
            EIE+EK CSVMDPLKLS+EAR+HA++N RLP+QI+LHALY+DQLK+RSGA   +    + 
Sbjct  424  EIEKEKACSVMDPLKLSHEARLHAARNNRLPLQIILHALYFDQLKLRSGAAAKDAVAPSN  483

Query  543  NAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasaVRKPTF  364
            +A A R    AD +L++ENEALR+EL +M++ ++++Q                  ++PTF
Sbjct  484  SAAAARAGAMADASLMRENEALRSELTRMQLCLSELQG---------GSGLKGRPKRPTF  534

Query  363  FSSMSKKLGKLNPFKHGSKDTSNLDDGEVDIT-------KPRRRRFSIS  238
             SS SK LGKLNPF+HGS D S++D+G V +        KPRRRRFSIS
Sbjct  535  LSSFSKTLGKLNPFRHGSMDASSIDNGGVGVLGEALTKPKPRRRRFSIS  583



>ref|XP_002450159.1| hypothetical protein SORBIDRAFT_05g001300 [Sorghum bicolor]
 gb|EES09147.1| hypothetical protein SORBIDRAFT_05g001300 [Sorghum bicolor]
Length=587

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 88/181 (49%), Positives = 120/181 (66%), Gaps = 23/181 (13%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAE--------  562
            DEIEREKVCSVMDPL+LSY+AR+HASQNKRLP+Q VL ALYYDQLK+RS           
Sbjct  409  DEIEREKVCSVMDPLRLSYQARLHASQNKRLPLQAVLSALYYDQLKLRSADGGGGDGAEG  468

Query  561  ----DPKSTPNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgs  394
                +P+S   A   R Q +AD +L +ENEALR+EL +M+ +++ MQ      GS    +
Sbjct  469  GAGWEPQSA--AGKARAQARADASLARENEALRSELARMRAYVSGMQQHSKGSGSRSSSA  526

Query  393  ----sasaVRKPTFFSSMSKKLGKLNPFKHG-SKDTSNLDDG----EVDITKPRRRRFSI  241
                +++A +K +F  S+S+ L +LNPFK G +KDT+++ DG     + + KP+RRRFSI
Sbjct  527  SLVPASAAGKKASFLGSVSRTLSRLNPFKGGWAKDTASIADGRDRSAMHVVKPKRRRFSI  586

Query  240  S  238
             
Sbjct  587  G  587



>dbj|BAJ91259.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=568

 Score =   155 bits (391),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 115/171 (67%), Gaps = 15/171 (9%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGA-----EDPK  553
            DEIEREKVCSVMD LKLSY AR+HASQNKRLP+Q VL ALYYDQLK+RS A     ED  
Sbjct  402  DEIEREKVCSVMDTLKLSYTARLHASQNKRLPLQAVLSALYYDQLKLRSAAVSHDDEDND  461

Query  552  STPNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasaVRK  373
            +   A + R Q +AD  L +EN+ALR+EL +M+  +    + G  Q       +A+  +K
Sbjct  462  ARSEAGSARMQAKADAALARENQALRSELARMRAHM----SSGVQQSKGSGSRTAATGKK  517

Query  372  PTFFSSMSKKLGKLNPFKHG---SKDTSNLDD---GEVDITKPRRRRFSIS  238
             +FF SMS+ L +LNPF+ G   SKDTS++ D   G +++ KP+RRR SIS
Sbjct  518  ASFFGSMSRTLSRLNPFRAGGGWSKDTSSIRDSRGGAMNVVKPKRRRSSIS  568



>dbj|BAJ92463.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=568

 Score =   155 bits (391),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 115/171 (67%), Gaps = 15/171 (9%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGA-----EDPK  553
            DEIEREKVCSVMD LKLSY AR+HASQNKRLP+Q VL ALYYDQLK+RS A     ED  
Sbjct  402  DEIEREKVCSVMDTLKLSYTARLHASQNKRLPLQAVLSALYYDQLKLRSAAVSHDDEDND  461

Query  552  STPNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasaVRK  373
            +   A + R Q +AD  L +EN+ALR+EL +M+  +    + G  Q       +A+  +K
Sbjct  462  ARSEAGSARMQAKADAALARENQALRSELARMRAHM----SSGVQQSKGSGSRTAATGKK  517

Query  372  PTFFSSMSKKLGKLNPFKHG---SKDTSNLDD---GEVDITKPRRRRFSIS  238
             +FF SMS+ L +LNPF+ G   S+DTS++ D   G +++ KP+RRR SIS
Sbjct  518  ASFFGSMSRTLSRLNPFRAGGGWSRDTSSIGDSRGGAMNVVKPKRRRSSIS  568



>ref|XP_002463481.1| hypothetical protein SORBIDRAFT_01g000540 [Sorghum bicolor]
 gb|EER90479.1| hypothetical protein SORBIDRAFT_01g000540 [Sorghum bicolor]
Length=264

 Score =   149 bits (375),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 116/178 (65%), Gaps = 18/178 (10%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDP------  556
            DEIEREKVCSVMDPL+LSY+AR+HA QNKRLP+Q +L ALYYDQLK+RS           
Sbjct  87   DEIEREKVCSVMDPLRLSYQARLHAPQNKRLPLQALLDALYYDQLKLRSADGGDGAEGGG  146

Query  555  -KSTPNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgs-----  394
             +S   A   R Q +AD +L +ENEALR+EL +M+ +++ MQ      GS    +     
Sbjct  147  WESQSAAGKARAQARADASLARENEALRSELARMRAYVSGMQQHSNGSGSRSSLASASLV  206

Query  393  -sasaVRKPTFFSSMSKKLGKLNPFKHG-SKDTSNLDDGE----VDITKPRRRRFSIS  238
             +++A +K +F  S+S+ L +LNPFK G +KD +++ DG     + + KP+RRRFSI 
Sbjct  207  PASAAGKKASFLGSVSQTLSQLNPFKGGWAKDMASIADGRDRSAMHVVKPKRRRFSIG  264



>ref|XP_003577852.1| PREDICTED: root phototropism protein 2 [Brachypodium distachyon]
Length=606

 Score =   149 bits (376),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 91/173 (53%), Positives = 111/173 (64%), Gaps = 17/173 (10%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGA----EDPKS  550
            DEIEREKVCSVMDPLKLS  AR+HASQNKRLP+Q VL ALYYDQLK+RSG     ED +S
Sbjct  438  DEIEREKVCSVMDPLKLSPAARLHASQNKRLPLQAVLSALYYDQLKLRSGQLTGDEDDRS  497

Query  549  TPNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggs-----qgssvkgssas  385
               A + R Q +AD  L +ENEALR+EL +M+  ++   +  G         S   ++  
Sbjct  498  --EAGSARMQAKADAALARENEALRSELGRMRAHMSSSSSGSGRGQRSKGSGSRTPAAMK  555

Query  384  aVRKPTFFSSMSKKLGKLNPFKHG----SKDTSNLDDGEVDITKPRRRRFSIS  238
               K  FF SMS+ L +LNPF+ G    SKDTSN+ D    I KP+RRRFSI 
Sbjct  556  GKMKVGFFGSMSRTLSRLNPFRAGGGRWSKDTSNIADAA--IVKPKRRRFSIG  606



>ref|XP_006663162.1| PREDICTED: root phototropism protein 2-like [Oryza brachyantha]
Length=506

 Score =   146 bits (369),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 84/176 (48%), Positives = 115/176 (65%), Gaps = 16/176 (9%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNA  538
            DEIEREKVCSVMDPLKLSY+ R+HASQNKRLP+Q VL ALYYDQLK+RSG         +
Sbjct  331  DEIEREKVCSVMDPLKLSYQGRLHASQNKRLPLQAVLSALYYDQLKLRSGNGGGVGGDES  390

Query  537  I----------ATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssa  388
                       + R Q +A+ +L +ENE LR+EL +M+ +++ M  +    G S   ++A
Sbjct  391  GGWDAYGGMMRSARMQAKAEASLARENEELRSELARMRAYMSGMGVQQSKGGGSSSRTTA  450

Query  387  saVRKPT----FFSSMSKKLGKLNPFKHG--SKDTSNLDDGEVDITKPRRRRFSIS  238
            S+ +K T       S+S+ L +LNPFK G  +KDTS++ D ++   KP+RRRFS+S
Sbjct  451  SSGKKGTTSLWLLGSVSRTLSRLNPFKGGIWAKDTSSIGDKKIHSVKPKRRRFSVS  506



>gb|EEC68739.1| hypothetical protein OsI_37246 [Oryza sativa Indica Group]
Length=570

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 81/175 (46%), Positives = 105/175 (60%), Gaps = 26/175 (15%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS----  550
            +E+EREKVCSVMDPLKLSY+ R+HASQN RLP+Q VL ALYYDQLK+RSG E        
Sbjct  407  EEMEREKVCSVMDPLKLSYQGRLHASQNNRLPLQAVLSALYYDQLKLRSGDEGGGGWDAY  466

Query  549  ------TPNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssa  388
                  +  A + R Q + + +L +ENEALR+EL +M+ +++ MQ +     SS      
Sbjct  467  GNGVMRSSAAGSARKQAKEEASLARENEALRSELARMRAYVSGMQQQSKGSSSSRGKK--  524

Query  387  saVRKPTFFSSMSKKLGKLNPFKHG--SKDTSNLDDGEVDI---TKPRRRRFSIS  238
                      S  + L +LNPFK G   KDTS + DG+ D     K +RRRFSIS
Sbjct  525  ---------GSWLRTLSRLNPFKAGIWGKDTSGIVDGKTDAMNSVKSKRRRFSIS  570



>gb|ABG22339.1| RPT2, putative, expressed [Oryza sativa Japonica Group]
Length=539

 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 80/175 (46%), Positives = 105/175 (60%), Gaps = 26/175 (15%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS----  550
            +E+EREKVCSVMDPLKLSY+ R+HASQN RLP+Q VL ALYYD+LK+RSG E        
Sbjct  376  EEMEREKVCSVMDPLKLSYQGRLHASQNNRLPLQAVLSALYYDRLKLRSGDEGGGGWDAY  435

Query  549  ------TPNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssa  388
                  +  A + R Q + + +L +ENEALR+EL +M+ +++ MQ +     SS      
Sbjct  436  GNGVMRSSAAGSARKQAKEEASLARENEALRSELARMRAYVSGMQQQSKGSSSSR-----  490

Query  387  saVRKPTFFSSMSKKLGKLNPFKHG--SKDTSNLDDGEVDI---TKPRRRRFSIS  238
                      S  + L +LNPFK G   KDTS + DG+ D     K +RRRFSIS
Sbjct  491  ------GKKGSWLRTLSRLNPFKAGIWGKDTSGIVDGKTDAMNSVKSKRRRFSIS  539



>gb|ABA95649.1| RPT2, putative, expressed [Oryza sativa Japonica Group]
 gb|EEE52651.1| hypothetical protein OsJ_35014 [Oryza sativa Japonica Group]
Length=570

 Score =   132 bits (332),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 80/175 (46%), Positives = 105/175 (60%), Gaps = 26/175 (15%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS----  550
            +E+EREKVCSVMDPLKLSY+ R+HASQN RLP+Q VL ALYYD+LK+RSG E        
Sbjct  407  EEMEREKVCSVMDPLKLSYQGRLHASQNNRLPLQAVLSALYYDRLKLRSGDEGGGGWDAY  466

Query  549  ------TPNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssa  388
                  +  A + R Q + + +L +ENEALR+EL +M+ +++ MQ +     SS      
Sbjct  467  GNGVMRSSAAGSARKQAKEEASLARENEALRSELARMRAYVSGMQQQSKGSSSSRGKK--  524

Query  387  saVRKPTFFSSMSKKLGKLNPFKHG--SKDTSNLDDGEVDI---TKPRRRRFSIS  238
                      S  + L +LNPFK G   KDTS + DG+ D     K +RRRFSIS
Sbjct  525  ---------GSWLRTLSRLNPFKAGIWGKDTSGIVDGKTDAMNSVKSKRRRFSIS  570



>ref|NP_001065596.1| Os11g0118300 [Oryza sativa Japonica Group]
 gb|ABA91174.1| RPT2, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF27441.1| Os11g0118300 [Oryza sativa Japonica Group]
 dbj|BAG89308.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE51536.1| hypothetical protein OsJ_32738 [Oryza sativa Japonica Group]
Length=571

 Score =   132 bits (331),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 80/175 (46%), Positives = 105/175 (60%), Gaps = 26/175 (15%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS----  550
            +E+EREKVCSVMDPLKLSY+ R+HASQN RLP+Q VL ALYYD+LK+RSG E        
Sbjct  408  EEMEREKVCSVMDPLKLSYQGRLHASQNNRLPLQAVLSALYYDRLKLRSGDEGGGGWDAY  467

Query  549  ------TPNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssa  388
                  +  A + R Q + + +L +ENEALR+EL +M+ +++ MQ +     SS      
Sbjct  468  GNGVMRSSAAGSARKQAKEEASLARENEALRSELARMRAYVSGMQQQSKGSSSSR-----  522

Query  387  saVRKPTFFSSMSKKLGKLNPFKHG--SKDTSNLDDGEVDI---TKPRRRRFSIS  238
                      S  + L +LNPFK G   KDTS + DG+ D     K +RRRFSIS
Sbjct  523  ------GKKGSWLRTLSRLNPFKAGIWGKDTSGIVDGKTDAMNSVKSKRRRFSIS  571



>ref|NP_001066000.1| Os12g0117400 [Oryza sativa Japonica Group]
 dbj|BAF29019.1| Os12g0117400, partial [Oryza sativa Japonica Group]
Length=591

 Score =   132 bits (332),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 80/175 (46%), Positives = 105/175 (60%), Gaps = 26/175 (15%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS----  550
            +E+EREKVCSVMDPLKLSY+ R+HASQN RLP+Q VL ALYYD+LK+RSG E        
Sbjct  428  EEMEREKVCSVMDPLKLSYQGRLHASQNNRLPLQAVLSALYYDRLKLRSGDEGGGGWDAY  487

Query  549  ------TPNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssa  388
                  +  A + R Q + + +L +ENEALR+EL +M+ +++ MQ +     SS      
Sbjct  488  GNGVMRSSAAGSARKQAKEEASLARENEALRSELARMRAYVSGMQQQSKGSSSSRGKK--  545

Query  387  saVRKPTFFSSMSKKLGKLNPFKHG--SKDTSNLDDGEVDI---TKPRRRRFSIS  238
                      S  + L +LNPFK G   KDTS + DG+ D     K +RRRFSIS
Sbjct  546  ---------GSWLRTLSRLNPFKAGIWGKDTSGIVDGKTDAMNSVKSKRRRFSIS  591



>gb|EEC67555.1| hypothetical protein OsI_34888 [Oryza sativa Indica Group]
Length=571

 Score =   132 bits (331),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 80/175 (46%), Positives = 104/175 (59%), Gaps = 26/175 (15%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS----  550
            +E+EREKVCSVMDPLKLSY+ R+HASQN RLP+Q VL ALYYDQLK+RSG E        
Sbjct  408  EEMEREKVCSVMDPLKLSYQGRLHASQNNRLPLQAVLSALYYDQLKLRSGDEGGSGWDAY  467

Query  549  ------TPNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssa  388
                  +  A +   Q + + +L +ENEALR+EL +M+ +++ MQ +     SS      
Sbjct  468  GNGVMRSSAAGSAWKQAKEEASLARENEALRSELARMRAYVSGMQQQSKGSSSSR-----  522

Query  387  saVRKPTFFSSMSKKLGKLNPFKHG--SKDTSNLDDGEVDI---TKPRRRRFSIS  238
                      S  + L +LNPFK G   KDTS + DG+ D     K +RRRFSIS
Sbjct  523  ------GKKGSWLRTLSRLNPFKAGIWGKDTSGIVDGKTDAMNSVKAKRRRFSIS  571



>gb|AFW55920.1| putative phototropic-responsive NPH3 family protein [Zea mays]
Length=621

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 79/176 (45%), Positives = 105/176 (60%), Gaps = 17/176 (10%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAE-----DPK  553
            DEI+REKVCSVMDPLKLSY+AR HASQNKRLP+Q  L ALYYD+LK+RS A      D +
Sbjct  447  DEIQREKVCSVMDPLKLSYQARTHASQNKRLPLQAALSALYYDELKLRSAATADVVLDTQ  506

Query  552  STPNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasaVRK  373
            S+    A      AD  L +ENEALR+EL +M+ +++ M+       S+   S +   +K
Sbjct  507  SSAAGRACAQARAADAALARENEALRSELARMRAYLSGMER-SKGGRSTPPSSPSRRAKK  565

Query  372  PTFFSSMSKKLGKLNPFKHGSK----DTSNLDDGEVD-------ITKPRRRRFSIS  238
             +F  S+S+ + +LNPF+ G       TSN   G          +  P+RRR SIS
Sbjct  566  ASFLGSVSRTMSRLNPFRSGGWMAKVTTSNAAGGGRQSKTMMQHVVTPKRRRASIS  621



>ref|NP_001147592.1| LOC100281201 [Zea mays]
 gb|ACG28024.1| RPT2-like protein [Zea mays]
Length=613

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 79/176 (45%), Positives = 105/176 (60%), Gaps = 17/176 (10%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAE-----DPK  553
            DEI+REKVCSVMDPLKLSY+AR HASQNKRLP+Q  L ALYYD+LK+RS A      D +
Sbjct  439  DEIQREKVCSVMDPLKLSYQARTHASQNKRLPLQAALSALYYDELKLRSAATADVVLDTQ  498

Query  552  STPNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasaVRK  373
            S+    A      AD  L +ENEALR+EL +M+ +++ M+       S+   S +   +K
Sbjct  499  SSAAGRACAQARAADAALARENEALRSELARMRAYLSGMER-SKGGRSTPPSSPSRRAKK  557

Query  372  PTFFSSMSKKLGKLNPFKHGSK----DTSNLDDGEVD-------ITKPRRRRFSIS  238
             +F  S+S+ + +LNPF+ G       TSN   G          +  P+RRR SIS
Sbjct  558  ASFLGSVSRTMSRLNPFRSGGWMAKVTTSNAAGGGRQSKTMMQHVVTPKRRRASIS  613



>ref|XP_008661889.1| PREDICTED: LOC100281201 isoform X1 [Zea mays]
Length=636

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 79/176 (45%), Positives = 105/176 (60%), Gaps = 17/176 (10%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAE-----DPK  553
            DEI+REKVCSVMDPLKLSY+AR HASQNKRLP+Q  L ALYYD+LK+RS A      D +
Sbjct  462  DEIQREKVCSVMDPLKLSYQARTHASQNKRLPLQAALSALYYDELKLRSAATADVVLDTQ  521

Query  552  STPNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasaVRK  373
            S+    A      AD  L +ENEALR+EL +M+ +++ M+       S+   S +   +K
Sbjct  522  SSAAGRACAQARAADAALARENEALRSELARMRAYLSGMER-SKGGRSTPPSSPSRRAKK  580

Query  372  PTFFSSMSKKLGKLNPFKHGSK----DTSNLDDGEVD-------ITKPRRRRFSIS  238
             +F  S+S+ + +LNPF+ G       TSN   G          +  P+RRR SIS
Sbjct  581  ASFLGSVSRTMSRLNPFRSGGWMAKVTTSNAAGGGRQSKTMMQHVVTPKRRRASIS  636



>gb|AAV50010.1| phototropic response-like protein [Malus domestica]
Length=114

 Score =   113 bits (282),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 77/109 (71%), Gaps = 1/109 (1%)
 Frame = -2

Query  561  DPKSTPNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkg-gsqgssvkgssas  385
            D     +AI TR+Q+Q DV+L +ENE LRTELL+MKM+I D+   G  +  ++       
Sbjct  6    DENDVQDAITTRSQVQHDVSLARENEELRTELLKMKMYITDLHKTGPAAVATTSSCKGGG  65

Query  384  aVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  238
              +K  FFS +SKKLG+LNPFK GSKDTSN+ D +VDITKPRRRRFSIS
Sbjct  66   GPKKAKFFSYVSKKLGRLNPFKQGSKDTSNIVDEDVDITKPRRRRFSIS  114



>dbj|BAF95168.1| similar to ROOT PHOTOTROPISM2 protein binding [Ipomoea nil]
Length=71

 Score =   109 bits (272),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 69/70 (99%), Positives = 69/70 (99%), Gaps = 0/70 (0%)
 Frame = -2

Query  447  IADMQNkggsqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDIT  268
            IADMQNKG SQGSSVKGSSASAVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDIT
Sbjct  2    IADMQNKGSSQGSSVKGSSASAVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDIT  61

Query  267  KPRRRRFSIS  238
            KPRRRRFSIS
Sbjct  62   KPRRRRFSIS  71



>ref|XP_002441790.1| hypothetical protein SORBIDRAFT_08g002330 [Sorghum bicolor]
 gb|AAO16688.1| RPT2-like protein [Sorghum bicolor]
 gb|EES15628.1| hypothetical protein SORBIDRAFT_08g002330 [Sorghum bicolor]
Length=665

 Score =   112 bits (280),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 81/221 (37%), Positives = 108/221 (49%), Gaps = 61/221 (28%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNA  538
            DEI+REKVCSVMDPLKLSY+AR+HASQNKRLP+Q VL ALYYDQLK+RS A+   S  + 
Sbjct  445  DEIQREKVCSVMDPLKLSYQARLHASQNKRLPLQAVLSALYYDQLKLRSAADAATSMGDV  504

Query  537  IA-TRNQLQADV-----------TLVKENEALRTELLQMKMFIADMQNkggsqgssvkgs  394
            +A T+ Q  +              L +ENEALR EL +M+ +++     G  + SS   S
Sbjct  505  VADTQTQSSSAAGRARAQAMADAALARENEALRVELARMRAYMSGTMQHGKGRESSTPAS  564

Query  393  sasaVRKPTF-----------------------------------------FSSMSKKLG  337
             +   +K TF                                           S+S+ L 
Sbjct  565  PSRTAKKATFLGTELARMRAYMSGMHHSKGSGATPPASPSRTAAAKTKASLLGSVSRSLS  624

Query  336  KLNPFKHG--SKDTSNLDDGEV------DITKPRRRRFSIS  238
            +LNPFK G  +  T ++  G         +  P+RRR SI 
Sbjct  625  RLNPFKGGWTTNHTGSIAAGGRPCKTMHHVVTPKRRRSSIG  665



>ref|XP_010272171.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Nelumbo 
nucifera]
Length=620

 Score = 95.9 bits (237),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 72/179 (40%), Positives = 96/179 (54%), Gaps = 26/179 (15%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS--------GAED  559
            ++ER+KVCS+MD  KLS EA  HA+QN RLPVQIV+  LYY+Q ++R         G E 
Sbjct  448  DMERKKVCSLMDCQKLSREACAHAAQNDRLPVQIVVQVLYYEQQRLRDVMGGGNLMGGES  507

Query  558  PKSTPNAIATRNQLQAD--------VTLVKENEALRTELLQMKMFIADMQNkggsqgssv  403
            P S P  +   N   AD        V+L +ENE L+ EL++M+M +  ++       S  
Sbjct  508  P-SLPQKL---NLYSADYHSAPDEVVSLRRENEDLKIELVKMRMRLKQLEKSAEIIPSGS  563

Query  402  kgssasa----VRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  238
               SA        KP+F +S+SKKLG+L PF     D     DG+  I   R RR SIS
Sbjct  564  TPPSADKPPLPRSKPSFINSVSKKLGRLYPFVRA--DGVKPSDGKGRIKPSRNRRHSIS  620



>ref|XP_010277089.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Nelumbo nucifera]
 ref|XP_010277090.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Nelumbo nucifera]
Length=605

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 68/176 (39%), Positives = 97/176 (55%), Gaps = 20/176 (11%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDP  556
            ++ER+KVC +MD  KLS EA  HA+QN RLPVQIV+  LYY+Q ++R        GAE P
Sbjct  433  DMERKKVCRLMDCQKLSREACAHAAQNDRLPVQIVVQVLYYEQRRLRDAMSDNLMGAESP  492

Query  555  KSTPNAIATRNQLQAD---VTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssas  385
                  + +++   A    ++L +ENE L+ EL++M+M + +++  G            S
Sbjct  493  ALQKMNLHSKDYHSAPDELLSLRRENEDLKMELVKMRMRLKELEKSGEINPPESTPPIPS  552

Query  384  aVRKP------TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKP-RRRRFSIS  238
              + P      +F SSMSKKLG+L PF  G    S+   G    TKP R RR S+S
Sbjct  553  VDKPPLALPRKSFISSMSKKLGRLYPFMRGEGVKSSDGKGR---TKPSRNRRHSVS  605



>ref|XP_010277091.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X2 [Nelumbo nucifera]
Length=594

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 68/176 (39%), Positives = 97/176 (55%), Gaps = 20/176 (11%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDP  556
            ++ER+KVC +MD  KLS EA  HA+QN RLPVQIV+  LYY+Q ++R        GAE P
Sbjct  422  DMERKKVCRLMDCQKLSREACAHAAQNDRLPVQIVVQVLYYEQRRLRDAMSDNLMGAESP  481

Query  555  KSTPNAIATRNQLQAD---VTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssas  385
                  + +++   A    ++L +ENE L+ EL++M+M + +++  G            S
Sbjct  482  ALQKMNLHSKDYHSAPDELLSLRRENEDLKMELVKMRMRLKELEKSGEINPPESTPPIPS  541

Query  384  aVRKP------TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKP-RRRRFSIS  238
              + P      +F SSMSKKLG+L PF  G    S+   G    TKP R RR S+S
Sbjct  542  VDKPPLALPRKSFISSMSKKLGRLYPFMRGEGVKSSDGKGR---TKPSRNRRHSVS  594



>ref|XP_011012052.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X2 [Populus euphratica]
Length=546

 Score = 92.8 bits (229),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 66/175 (38%), Positives = 97/175 (55%), Gaps = 24/175 (14%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDP  556
            ++ER+KVCS+MD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R        G + P
Sbjct  380  DMERKKVCSLMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGNLMGGDSP  439

Query  555  KSTP--NAIATRNQLQAD--VTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssa  388
               P  N  +T  +  +D   +L +ENE L+ EL++MKM I +++       +S   +  
Sbjct  440  ALPPKVNIFSTDIRPVSDELSSLRRENEDLKIELVKMKMKIKEIERATVVSTTSSPSADK  499

Query  387  saVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRR-----RRFSIS  238
              + + +F +S+SKKLG++NPF           DG +  TK R      RR SIS
Sbjct  500  PPLPRKSFINSVSKKLGRINPFVRA--------DGPLSNTKARTRPSKDRRHSIS  546



>ref|XP_011006800.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X2 [Populus euphratica]
Length=546

 Score = 92.8 bits (229),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 66/175 (38%), Positives = 97/175 (55%), Gaps = 24/175 (14%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDP  556
            ++ER+KVCS+MD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R        G + P
Sbjct  380  DMERKKVCSLMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGNLMGGDSP  439

Query  555  KSTP--NAIATRNQLQAD--VTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssa  388
               P  N  +T  +  +D   +L +ENE L+ EL++MKM I +++       +S   +  
Sbjct  440  ALPPKVNIFSTDIRPVSDELSSLRRENEDLKIELVKMKMKIKEIERATVVSTTSSPSADK  499

Query  387  saVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRR-----RRFSIS  238
              + + +F +S+SKKLG++NPF           DG +  TK R      RR SIS
Sbjct  500  PPLPRKSFINSVSKKLGRINPFVRA--------DGPLSNTKARTRPSKDRRHSIS  546



>ref|XP_011012051.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Populus euphratica]
Length=599

 Score = 92.8 bits (229),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 66/175 (38%), Positives = 97/175 (55%), Gaps = 24/175 (14%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDP  556
            ++ER+KVCS+MD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R        G + P
Sbjct  433  DMERKKVCSLMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGNLMGGDSP  492

Query  555  KSTP--NAIATRNQLQAD--VTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssa  388
               P  N  +T  +  +D   +L +ENE L+ EL++MKM I +++       +S   +  
Sbjct  493  ALPPKVNIFSTDIRPVSDELSSLRRENEDLKIELVKMKMKIKEIERATVVSTTSSPSADK  552

Query  387  saVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRR-----RRFSIS  238
              + + +F +S+SKKLG++NPF           DG +  TK R      RR SIS
Sbjct  553  PPLPRKSFINSVSKKLGRINPFVRA--------DGPLSNTKARTRPSKDRRHSIS  599



>ref|XP_011006799.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X1 [Populus euphratica]
Length=599

 Score = 92.8 bits (229),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 66/175 (38%), Positives = 97/175 (55%), Gaps = 24/175 (14%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDP  556
            ++ER+KVCS+MD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R        G + P
Sbjct  433  DMERKKVCSLMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGNLMGGDSP  492

Query  555  KSTP--NAIATRNQLQAD--VTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssa  388
               P  N  +T  +  +D   +L +ENE L+ EL++MKM I +++       +S   +  
Sbjct  493  ALPPKVNIFSTDIRPVSDELSSLRRENEDLKIELVKMKMKIKEIERATVVSTTSSPSADK  552

Query  387  saVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRR-----RRFSIS  238
              + + +F +S+SKKLG++NPF           DG +  TK R      RR SIS
Sbjct  553  PPLPRKSFINSVSKKLGRINPFVRA--------DGPLSNTKARTRPSKDRRHSIS  599



>ref|XP_008787157.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Phoenix 
dactylifera]
Length=610

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 66/170 (39%), Positives = 92/170 (54%), Gaps = 18/170 (11%)
 Frame = -2

Query  711  IEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR--------SGAEDP  556
            +ER+KVCS+MD  +LS EA  HA+QN RLPVQ+V+  LYY+Q + R        SG E P
Sbjct  447  VERKKVCSLMDCQRLSREACAHAAQNDRLPVQLVVQVLYYEQQRHRDVMSTGNLSGGESP  506

Query  555  ----KSTPNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssa  388
                K+TP  I   N       L +EN  L+ EL +M+M + +++   G+  S+ K    
Sbjct  507  ALSQKATPYGIGYHNAPDELSRLRRENADLKLELFRMRMQLQEIEKSSGNTTSAGKPPLP  566

Query  387  saVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  238
                K +F +S+SKKLG+L PF     D      G+     P+ RR SIS
Sbjct  567  ----KKSFINSVSKKLGRLYPFMR--SDNEKTLSGKTRKKPPKDRRHSIS  610



>gb|KHN36285.1| BTB/POZ domain-containing protein [Glycine soja]
Length=618

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 66/175 (38%), Positives = 102/175 (58%), Gaps = 20/175 (11%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAI  535
            +++R+KVCSVMD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R+     +S  +++
Sbjct  448  DMDRKKVCSVMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRNAMNGSRSGESSV  507

Query  534  ATR-NQLQADV--------TLVKENEALRTELLQMKMFIADMQNkggsqgssv-kgssas  385
             ++ N    D+        TL +ENE L+ EL+++KM + +++N       +    S++ 
Sbjct  508  DSKLNVYSTDLHPVSNELSTLRRENEDLKLELVKLKMRLKEIENSTLKSTVNSPAVSASP  567

Query  384  aVRKP-----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKP-RRRRFSIS  238
            +  KP     +F SS+SKKLG+L+PF   +   S    G    TKP + RR SIS
Sbjct  568  SADKPPLPRRSFMSSVSKKLGRLSPFVR-ADGVSPFAKGR---TKPNKNRRHSIS  618



>ref|XP_003517336.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Glycine 
max]
Length=618

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 66/179 (37%), Positives = 102/179 (57%), Gaps = 28/179 (16%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAI  535
            +++R+KVCSVMD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R+     +S  +++
Sbjct  448  DMDRKKVCSVMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRNAMNGSRSGESSV  507

Query  534  ATR-NQLQADV--------TLVKENEALRTELLQMKMFIADMQNkggsqgssv-kgssas  385
             ++ N    D+        TL +ENE L+ EL+++KM + +++N       +    S++ 
Sbjct  508  DSKLNVYSTDLHPVSNELSTLRRENEDLKLELVKLKMRLKEIENSTLKSTVNSPAVSASP  567

Query  384  aVRKP-----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDI----TKP-RRRRFSIS  238
            +  KP     +F SS+SKKLG+L+PF           DG +      TKP + RR SIS
Sbjct  568  SADKPPLPRRSFMSSVSKKLGRLSPFVRA--------DGVLPFPKGRTKPNKNRRHSIS  618



>ref|XP_002533158.1| Root phototropism protein, putative [Ricinus communis]
 gb|EEF29217.1| Root phototropism protein, putative [Ricinus communis]
Length=621

 Score = 90.1 bits (222),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 61/151 (40%), Positives = 92/151 (61%), Gaps = 13/151 (9%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS---GAEDPK--S  550
            ++ER+KVCS+MD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R    G + P   +
Sbjct  454  DMERKKVCSLMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMIGGDSPTLPT  513

Query  549  TPNAIATRNQLQAD--VTLVKENEALRTELLQMKMFIADMQNkggsqgssvk-gssasaV  379
              N  AT N   +D   +L +ENE L+ EL++MKM + +++  GG +  +     ++ + 
Sbjct  514  KVNLYATNNHPVSDEISSLKRENEDLKLELVKMKMRLKEIEKSGGGRSVTSSPALNSPSA  573

Query  378  RKP-----TFFSSMSKKLGKLNPFKHGSKDT  301
             KP     +F +S+SKKLG+L PF  G  D+
Sbjct  574  DKPPLPRKSFINSVSKKLGRLYPFVRGEGDS  604



>ref|XP_006579934.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Glycine 
max]
 gb|KHN06007.1| BTB/POZ domain-containing protein [Glycine soja]
Length=590

 Score = 89.7 bits (221),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 69/179 (39%), Positives = 105/179 (59%), Gaps = 27/179 (15%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR------SGAEDP-  556
            ++E++KVCSVMD  KLS EA  HA+QN RLPVQ+V+  LYY+Q ++R      +G + P 
Sbjct  419  DMEKKKVCSVMDCQKLSREACAHAAQNDRLPVQMVVQVLYYEQQRLRDSMDGNAGWDSPN  478

Query  555  -----KSTPNAI-ATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssv-kg  397
                  S+PN +    N+L     L +ENE L+ E++++KM + +++       SS    
Sbjct  479  FRDKVNSSPNELNLVSNELS---ILRRENEDLKLEIVKLKMKLKEIERTSIRSASSSPVI  535

Query  396  ssasaVRKP-----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKP-RRRRFSIS  238
             ++ +  KP     +F +S+SKKLG+L+PF  G+  T+ L  G V   KP + RR SIS
Sbjct  536  FASPSADKPPLPRKSFINSVSKKLGRLSPFSRGNAATTLL-KGHV---KPDKNRRHSIS  590



>ref|XP_006380639.1| hypothetical protein POPTR_0007s10060g [Populus trichocarpa]
 gb|ERP58436.1| hypothetical protein POPTR_0007s10060g [Populus trichocarpa]
Length=601

 Score = 89.7 bits (221),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 62/170 (36%), Positives = 96/170 (56%), Gaps = 13/170 (8%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDP  556
            ++ER+KVCS+MD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R        G + P
Sbjct  434  DMERKKVCSLMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGNLMGGDSP  493

Query  555  KSTP--NAIATRNQLQAD--VTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssa  388
               P  N  +T  +  +D   +L +ENE L+ EL++MKM + +++       +S   +  
Sbjct  494  DLPPKVNIFSTDIRPVSDELSSLRRENEDLKIELVKMKMKMKEIERATVVSTTSSPSADK  553

Query  387  saVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  238
              + + +F +S+SKKLG++NPF     D   L + +      + RR SIS
Sbjct  554  PPLPRKSFINSVSKKLGRINPFVRA--DGFPLSNTKARTRPSKDRRHSIS  601



>ref|XP_006590635.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X2 [Glycine max]
Length=628

 Score = 89.4 bits (220),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 66/175 (38%), Positives = 100/175 (57%), Gaps = 20/175 (11%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAI  535
            +++R+KVCSVMD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R       S  +++
Sbjct  458  DMDRKKVCSVMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDAMNGSGSGESSV  517

Query  534  ATR-NQLQADV--------TLVKENEALRTELLQMKMFIADMQNkggsqgssv-kgssas  385
             ++ N    D+        TL +ENE L+ EL+++KM + +++N       +    S++ 
Sbjct  518  DSKLNVYSTDLHPVSNELSTLRRENEDLKLELVKLKMRLKEIENSTLKSTVNSPVVSASP  577

Query  384  aVRKP-----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKP-RRRRFSIS  238
            +  KP     +F SS+SKKLG+L+PF   +   S    G    TKP + RR SIS
Sbjct  578  SADKPPLPRRSFMSSVSKKLGRLSPFVR-ADGVSPFAKGR---TKPNKNRRHSIS  628



>ref|XP_003538794.2| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Glycine max]
Length=618

 Score = 89.4 bits (220),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 66/175 (38%), Positives = 100/175 (57%), Gaps = 20/175 (11%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAI  535
            +++R+KVCSVMD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R       S  +++
Sbjct  448  DMDRKKVCSVMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDAMNGSGSGESSV  507

Query  534  ATR-NQLQADV--------TLVKENEALRTELLQMKMFIADMQNkggsqgssv-kgssas  385
             ++ N    D+        TL +ENE L+ EL+++KM + +++N       +    S++ 
Sbjct  508  DSKLNVYSTDLHPVSNELSTLRRENEDLKLELVKLKMRLKEIENSTLKSTVNSPVVSASP  567

Query  384  aVRKP-----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKP-RRRRFSIS  238
            +  KP     +F SS+SKKLG+L+PF   +   S    G    TKP + RR SIS
Sbjct  568  SADKPPLPRRSFMSSVSKKLGRLSPFVR-ADGVSPFAKGR---TKPNKNRRHSIS  618



>gb|KHN12984.1| BTB/POZ domain-containing protein [Glycine soja]
Length=640

 Score = 89.4 bits (220),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 66/175 (38%), Positives = 100/175 (57%), Gaps = 20/175 (11%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAI  535
            +++R+KVCSVMD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R       S  +++
Sbjct  470  DMDRKKVCSVMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDAMNGSGSGESSV  529

Query  534  ATR-NQLQADV--------TLVKENEALRTELLQMKMFIADMQNkggsqgssv-kgssas  385
             ++ N    D+        TL +ENE L+ EL+++KM + +++N       +    S++ 
Sbjct  530  DSKLNVYSTDLHPVSNELSTLRRENEDLKLELVKLKMRLKEIENSTLKSTVNSPVVSASP  589

Query  384  aVRKP-----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKP-RRRRFSIS  238
            +  KP     +F SS+SKKLG+L+PF   +   S    G    TKP + RR SIS
Sbjct  590  SADKPPLPRRSFMSSVSKKLGRLSPFVR-ADGVSPFAKGR---TKPNKNRRHSIS  640



>ref|XP_009411062.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Musa 
acuminata subsp. malaccensis]
Length=583

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 64/168 (38%), Positives = 90/168 (54%), Gaps = 17/168 (10%)
 Frame = -2

Query  708  EREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR-------SGAEDP--  556
            ER+KVCS+MD  KLS EA  HA+QN+RLPVQ V+  L+ +Q + R       +G E P  
Sbjct  422  ERKKVCSLMDCQKLSREACAHAAQNERLPVQTVVQVLFCEQQRFRDATSGSFTGGESPAL  481

Query  555  --KSTPNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasa  382
              +STP +   R        L +EN+ LR +LL+M+M + +++   G   S+ K      
Sbjct  482  SLRSTPCSTKHRGGTDELSRLQRENDDLRMQLLRMRMLLKEVEKPSGQIPSAQKPPLP--  539

Query  381  VRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  238
              K +F +S+SKKLG+L PF H          G      P+ RR SIS
Sbjct  540  --KKSFINSLSKKLGRLYPFTHADGVKPFSSKGRTK--PPKDRRHSIS  583



>ref|XP_006380638.1| hypothetical protein POPTR_0007s10060g [Populus trichocarpa]
 gb|ERP58435.1| hypothetical protein POPTR_0007s10060g [Populus trichocarpa]
Length=643

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 62/170 (36%), Positives = 96/170 (56%), Gaps = 13/170 (8%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDP  556
            ++ER+KVCS+MD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R        G + P
Sbjct  476  DMERKKVCSLMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGNLMGGDSP  535

Query  555  KSTP--NAIATRNQLQAD--VTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssa  388
               P  N  +T  +  +D   +L +ENE L+ EL++MKM + +++       +S   +  
Sbjct  536  DLPPKVNIFSTDIRPVSDELSSLRRENEDLKIELVKMKMKMKEIERATVVSTTSSPSADK  595

Query  387  saVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  238
              + + +F +S+SKKLG++NPF     D   L + +      + RR SIS
Sbjct  596  PPLPRKSFINSVSKKLGRINPFVRA--DGFPLSNTKARTRPSKDRRHSIS  643



>ref|XP_002970426.1| hypothetical protein SELMODRAFT_231529 [Selaginella moellendorffii]
 gb|EFJ28556.1| hypothetical protein SELMODRAFT_231529 [Selaginella moellendorffii]
Length=603

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 59/176 (34%), Positives = 100/176 (57%), Gaps = 27/176 (15%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSG-----------  568
            ++ER+K+C ++D  KLS EA  HA+QN+RLPVQ+V+  LYY+Q+++R+            
Sbjct  438  DLERKKLCKLLDVQKLSQEACQHAAQNERLPVQMVVQVLYYEQMRLRTAMTTSFVDGEQV  497

Query  567  ------AEDPKSTPNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgss  406
                  A  P     AI+ R+      ++ +EN  L+ E+ +M+M + D++    +    
Sbjct  498  GPYSQKAAGPGGLSAAISPRDHYS---SIRRENRELKLEVARMRMRLTDLEKDHVNMKEG  554

Query  405  vkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  238
            ++ + +S+     F SS++K L KLNPF+   KD+SN+ + +  +   RRRR SIS
Sbjct  555  IQKTGSSSK----FLSSVTKTLSKLNPFRF--KDSSNVPNAKSGMNS-RRRRHSIS  603



>gb|EEC74727.1| hypothetical protein OsI_10455 [Oryza sativa Indica Group]
Length=626

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 68/186 (37%), Positives = 93/186 (50%), Gaps = 32/186 (17%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAI  535
            E ER+KVC  MD  KLS EA  HA+QN RLPVQ V+  LY++Q ++R+ ++ P + P+  
Sbjct  446  EGERKKVCRAMDCQKLSREACAHAAQNDRLPVQTVVQVLYHEQRRLRAPSQPPSAAPSYA  505

Query  534  AT-----------------RNQLQADVT-LVKENEALRTELLQMKMFIADMQNkggsqgs  409
                               R  +  +V+ L +EN+ LR ELL+MKM + D  +   S G 
Sbjct  506  GGESPALSYRPTPSFNGRHRPGVPDEVSRLQRENDELRMELLRMKMRLRD-PSVAFSAGG  564

Query  408  svkgssasaVRKPT---------FFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRR  256
                      +KP          F +SMSKKLG+LNPF      +  L  G V    P+ 
Sbjct  565  VPPSGRPPLPKKPGGGGGGSSGGFMNSMSKKLGRLNPFLR----SDVLGGGRVRTKPPKD  620

Query  255  RRFSIS  238
            RR SIS
Sbjct  621  RRHSIS  626



>gb|AAN77296.1| Hypothetical protein [Oryza sativa Japonica Group]
 gb|ABF94554.1| transposon protein, putative, Mutator sub-class, expressed [Oryza 
sativa Japonica Group]
 gb|EEE58548.1| hypothetical protein OsJ_09846 [Oryza sativa Japonica Group]
Length=626

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 68/186 (37%), Positives = 93/186 (50%), Gaps = 32/186 (17%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAI  535
            E ER+KVC  MD  KLS EA  HA+QN RLPVQ V+  LY++Q ++R+ ++ P + P+  
Sbjct  446  EGERKKVCRAMDCQKLSREACAHAAQNDRLPVQTVVQVLYHEQRRLRAPSQPPSAAPSYA  505

Query  534  AT-----------------RNQLQADVT-LVKENEALRTELLQMKMFIADMQNkggsqgs  409
                               R  +  +V+ L +EN+ LR ELL+MKM + D  +   S G 
Sbjct  506  GGESPALSYRPTPSFNGRHRPGVPDEVSRLQRENDELRMELLRMKMRLRD-PSVAFSAGG  564

Query  408  svkgssasaVRKPT---------FFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRR  256
                      +KP          F +SMSKKLG+LNPF      +  L  G V    P+ 
Sbjct  565  VPPSGRPPLPKKPGGGGGGSSGGFMNSMSKKLGRLNPFLR----SDVLGGGRVRTKPPKD  620

Query  255  RRFSIS  238
            RR SIS
Sbjct  621  RRHSIS  626



>ref|XP_002978505.1| hypothetical protein SELMODRAFT_443843 [Selaginella moellendorffii]
 gb|EFJ20491.1| hypothetical protein SELMODRAFT_443843 [Selaginella moellendorffii]
Length=615

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 59/176 (34%), Positives = 100/176 (57%), Gaps = 27/176 (15%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSG-----------  568
            ++ER+K+C ++D  KLS EA  HA+QN+RLPVQ+V+  LYY+Q+++R+            
Sbjct  450  DLERKKLCKLLDVQKLSQEACQHAAQNERLPVQMVVQVLYYEQMRLRTAMTTSFVDGEQV  509

Query  567  ------AEDPKSTPNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgss  406
                  A  P     AI+ R+      ++ +EN  L+ E+ +M+M + D++    +    
Sbjct  510  GPYSQKAAGPGGLSAAISPRDHYS---SIRRENRELKLEVARMRMRLTDLEKDHVNMKEG  566

Query  405  vkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  238
            ++ + +S+     F SS++K L KLNPF+   KD+SN+ + +  +   RRRR SIS
Sbjct  567  IQKTGSSSK----FLSSVTKTLSKLNPFRF--KDSSNVPNAKSGMNN-RRRRHSIS  615



>ref|XP_010412681.1| PREDICTED: putative BTB/POZ domain-containing protein At3g49970 
[Camelina sativa]
Length=243

 Score = 84.0 bits (206),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 66/182 (36%), Positives = 95/182 (52%), Gaps = 36/182 (20%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAI  535
            E+E++KVC++MD  KLS E   HA+QN RLPVQ V+  LYY+Q  +R    D  S P A 
Sbjct  75   EMEKKKVCNLMDCQKLSREKCAHAAQNDRLPVQTVVQVLYYEQQSLREILSDSDSPPAAA  134

Query  534  AT-------------RNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgss----  406
            AT              N+L     L +EN+ L+ EL+++KM   +++    +   +    
Sbjct  135  ATVEDTHPPPELSSYNNELS---KLNRENQELKLELIKVKMKFKELEKNQKAFEVTSGSD  191

Query  405  -vkgssasaVRKP-----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFS  244
                 S ++V KP     +F SS+S++LGKLNPF  G K        +V    P+ RR S
Sbjct  192  CSSSVSIASVVKPRLPRKSFMSSVSRQLGKLNPF--GQK--------QVQTKPPKGRRHS  241

Query  243  IS  238
            IS
Sbjct  242  IS  243



>ref|XP_010559030.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X2 [Tarenaya hassleriana]
Length=588

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 65/175 (37%), Positives = 91/175 (52%), Gaps = 26/175 (15%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAI  535
            E+ER+KVCS+MD  KLS EA  HA+QN RLPVQ V+  LYY+Q +IR   ++    P   
Sbjct  424  EVERKKVCSLMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRIRDVMKE-TDIPTDP  482

Query  534  ATRNQLQADVT--------LVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasaV  379
                      T        L +EN+ L+ ELL+MKM + + +       +S    SA ++
Sbjct  483  PPSILPPPKPTSYNEELSKLKRENQDLKLELLKMKMKLKEYEKSEMGSSNSNSPVSAVSM  542

Query  378  RKP-----TFFSSMSKKLGKLNPFK---HGSKDTSNLDDGEVDITKPRRRRFSIS  238
             KP     +F SS+SKKLG+L PF    H ++  +           P+ RR SIS
Sbjct  543  GKPPLPKKSFMSSVSKKLGRLYPFGISPHNARGRTK---------PPKDRRHSIS  588



>ref|XP_010559028.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Tarenaya hassleriana]
Length=589

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 65/175 (37%), Positives = 91/175 (52%), Gaps = 26/175 (15%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAI  535
            E+ER+KVCS+MD  KLS EA  HA+QN RLPVQ V+  LYY+Q +IR   ++    P   
Sbjct  425  EVERKKVCSLMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRIRDVMKE-TDIPTDP  483

Query  534  ATRNQLQADVT--------LVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasaV  379
                      T        L +EN+ L+ ELL+MKM + + +       +S    SA ++
Sbjct  484  PPSILPPPKPTSYNEELSKLKRENQDLKLELLKMKMKLKEYEKSEMGSSNSNSPVSAVSM  543

Query  378  RKP-----TFFSSMSKKLGKLNPFK---HGSKDTSNLDDGEVDITKPRRRRFSIS  238
             KP     +F SS+SKKLG+L PF    H ++  +           P+ RR SIS
Sbjct  544  GKPPLPKKSFMSSVSKKLGRLYPFGISPHNARGRTK---------PPKDRRHSIS  589



>ref|XP_006600924.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Glycine 
max]
 gb|KHN28330.1| BTB/POZ domain-containing protein [Glycine soja]
Length=583

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 55/150 (37%), Positives = 88/150 (59%), Gaps = 15/150 (10%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR------SGAEDPK  553
            ++E++KVCSVMD  KLS EA  HA+QN RLPVQ+V+  LYY+Q ++R      +G + P 
Sbjct  419  DMEKKKVCSVMDCQKLSREACAHAAQNDRLPVQMVVQVLYYEQQRLRDSMDSSAGWDSPN  478

Query  552  STPNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssv-kgssasaVR  376
                  ++ N+L     L +EN+ L+ E++++KM + + +       SS     ++ +  
Sbjct  479  FLDKVNSSPNELS---ILRRENQDLKLEIVKLKMRLKEFERTSIRSASSSPVIYASRSAD  535

Query  375  KP-----TFFSSMSKKLGKLNPFKHGSKDT  301
            KP     +F +S+SKKLG+L+PF  G   T
Sbjct  536  KPPLPRKSFINSVSKKLGRLSPFSRGDAAT  565



>ref|XP_010905283.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X2 [Elaeis guineensis]
Length=533

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 66/171 (39%), Positives = 97/171 (57%), Gaps = 19/171 (11%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR-------SGAEDP  556
            ++ER+KVCS+M+  KLS EA  HA+QN RLPVQIV+  L+++Q + R       SG E P
Sbjct  370  DMERKKVCSLMECQKLSREACAHAAQNDRLPVQIVVQVLHHEQQRRRDVMSGNFSGGESP  429

Query  555  ----KSTPNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssa  388
                K+TP  +   N       L +EN  L+ EL +M+M + +++   G+  S+ K    
Sbjct  430  ALSQKATPFGVGYHNAPDELSRLRRENADLKLELFRMRMQLKEIEKSSGNITSAGKPPLP  489

Query  387  saVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRR-RRFSIS  238
                K +F +S+SKKLG+L PF     D+     G+  +TKP + RR SIS
Sbjct  490  ----KKSFINSVSKKLGRLYPFMR--SDSVKPPSGK-RMTKPHKDRRHSIS  533



>ref|XP_010905282.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X1 [Elaeis guineensis]
Length=609

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 66/171 (39%), Positives = 97/171 (57%), Gaps = 19/171 (11%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR-------SGAEDP  556
            ++ER+KVCS+M+  KLS EA  HA+QN RLPVQIV+  L+++Q + R       SG E P
Sbjct  446  DMERKKVCSLMECQKLSREACAHAAQNDRLPVQIVVQVLHHEQQRRRDVMSGNFSGGESP  505

Query  555  ----KSTPNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssa  388
                K+TP  +   N       L +EN  L+ EL +M+M + +++   G+  S+ K    
Sbjct  506  ALSQKATPFGVGYHNAPDELSRLRRENADLKLELFRMRMQLKEIEKSSGNITSAGKPPLP  565

Query  387  saVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRR-RRFSIS  238
                K +F +S+SKKLG+L PF     D+     G+  +TKP + RR SIS
Sbjct  566  ----KKSFINSVSKKLGRLYPFMR--SDSVKPPSGK-RMTKPHKDRRHSIS  609



>emb|CDP02580.1| unnamed protein product [Coffea canephora]
Length=620

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 55/146 (38%), Positives = 83/146 (57%), Gaps = 15/146 (10%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS-TPNA  538
            ++ER+KVCSVMD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R   +  +  TPN 
Sbjct  449  DMERKKVCSVMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLREAVDGTEGETPNL  508

Query  537  IATRNQLQAD--------VTLVKENEALRTELLQMKMFIADMQNkggsqgssv-kgssas  385
                NQ  A          +L KEN+ L+ EL++M+  + +++       ++     +  
Sbjct  509  ALKVNQHPAGSHTAPQELSSLRKENQDLKLELVKMRTRLRELEKSSDKSYAASPLVITLP  568

Query  384  aVRKP-----TFFSSMSKKLGKLNPF  322
            +  KP     +  SS+S+KLGK+NPF
Sbjct  569  SAEKPPLPRKSLISSVSRKLGKINPF  594



>gb|KJB48679.1| hypothetical protein B456_008G080700 [Gossypium raimondii]
Length=355

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 60/176 (34%), Positives = 94/176 (53%), Gaps = 26/176 (15%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAI  535
            ++ER+KVCS+MD  KLS EA  HA+QN RLPVQ V+  LY++Q ++R        +P  I
Sbjct  189  DMERKKVCSLMDCQKLSREACAHAAQNDRLPVQTVVQVLYHEQQRLRDVMNGSGDSPAVI  248

Query  534  ATR-NQLQADV--------TLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasa  382
             ++ N    DV        +L +EN+ L+ EL++MKM + +++    ++ +      +  
Sbjct  249  PSKVNLYPTDVHPVSGELSSLKRENQDLKLELVKMKMRLKEIEKSTSAKTAISSPMGSIT  308

Query  381  VR-------KPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRR-RRFSIS  238
                     K +F +S+SKKLG+L PF         +  G    T+P + RR SIS
Sbjct  309  PSSDKPPLPKKSFMNSVSKKLGRLYPF---------VPSGAKGRTRPSKDRRHSIS  355



>ref|XP_004511862.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X6 [Cicer arietinum]
Length=627

 Score = 84.3 bits (207),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 61/155 (39%), Positives = 89/155 (57%), Gaps = 25/155 (16%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR---SGAEDPKSTP  544
            ++ER+KVCS+MD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R   +G E+ +S P
Sbjct  449  DMERKKVCSMMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDAMNGNENVES-P  507

Query  543  NAIATRNQLQAD----------VTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgs  394
            +A A  N    D            L +ENE L+ EL+++KM + +++       ++V  S
Sbjct  508  SANAKLNVYSGDTQFHPVSNEITGLRRENEDLKLELVKLKMKLKEIEKSTVKVKATVINS  567

Query  393  sasaVR------KP-----TFFSSMSKKLGKLNPF  322
             +          KP     +F SS+SKKLGKL+PF
Sbjct  568  PSVNSSPSGSADKPPLPRRSFISSVSKKLGKLSPF  602



>ref|XP_004511860.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X4 [Cicer arietinum]
 ref|XP_004511861.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X5 [Cicer arietinum]
Length=628

 Score = 84.3 bits (207),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 61/155 (39%), Positives = 89/155 (57%), Gaps = 25/155 (16%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR---SGAEDPKSTP  544
            ++ER+KVCS+MD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R   +G E+ +S P
Sbjct  450  DMERKKVCSMMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDAMNGNENVES-P  508

Query  543  NAIATRNQLQAD----------VTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgs  394
            +A A  N    D            L +ENE L+ EL+++KM + +++       ++V  S
Sbjct  509  SANAKLNVYSGDTQFHPVSNEITGLRRENEDLKLELVKLKMKLKEIEKSTVKVKATVINS  568

Query  393  sasaVR------KP-----TFFSSMSKKLGKLNPF  322
             +          KP     +F SS+SKKLGKL+PF
Sbjct  569  PSVNSSPSGSADKPPLPRRSFISSVSKKLGKLSPF  603



>ref|XP_010028106.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X1 [Eucalyptus grandis]
Length=615

 Score = 84.0 bits (206),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 61/151 (40%), Positives = 85/151 (56%), Gaps = 24/151 (16%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS------GAEDPK  553
            E+ER+KVCS+MD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R       G E P 
Sbjct  447  ELERKKVCSLMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRMRDAMNGSLGGESP-  505

Query  552  STPNAIATRNQLQADV--------TLVKENEALRTELLQMKMFIADMQNkggsqgssv-k  400
            + P  +   N    D+         L +ENE L+ EL++MKM + +++            
Sbjct  506  AAPRKL---NVYSTDIHPVSDELSRLKRENEDLKIELVKMKMRLREIEKSTLKSAGGSPA  562

Query  399  gssasaVRKP-----TFFSSMSKKLGKLNPF  322
            GS+ S+  KP     +F +SMSKKLG+L PF
Sbjct  563  GSTPSSADKPPLPRKSFINSMSKKLGRLYPF  593



>ref|XP_010028107.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X2 [Eucalyptus grandis]
 gb|KCW54768.1| hypothetical protein EUGRSUZ_I00715 [Eucalyptus grandis]
Length=614

 Score = 84.0 bits (206),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 61/147 (41%), Positives = 85/147 (58%), Gaps = 16/147 (11%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS------GAEDPK  553
            E+ER+KVCS+MD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R       G E P 
Sbjct  446  ELERKKVCSLMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRMRDAMNGSLGGESPA  505

Query  552  S--TPNAIATRNQLQAD--VTLVKENEALRTELLQMKMFIADMQNkggsqgssv-kgssa  388
            +    N  +T     +D    L +ENE L+ EL++MKM + +++            GS+ 
Sbjct  506  APRKLNVYSTDIHPVSDELSRLKRENEDLKIELVKMKMRLREIEKSTLKSAGGSPAGSTP  565

Query  387  saVRKP-----TFFSSMSKKLGKLNPF  322
            S+  KP     +F +SMSKKLG+L PF
Sbjct  566  SSADKPPLPRKSFINSMSKKLGRLYPF  592



>ref|XP_002983725.1| hypothetical protein SELMODRAFT_228979 [Selaginella moellendorffii]
 gb|EFJ15221.1| hypothetical protein SELMODRAFT_228979 [Selaginella moellendorffii]
Length=604

 Score = 84.0 bits (206),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 61/190 (32%), Positives = 95/190 (50%), Gaps = 35/190 (18%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-----GAEDPKS  550
            E +R+++C +MDP +LS EA  HA+QN+RLP   ++  LY++QL+I++       E PK 
Sbjct  419  EADRKRICKLMDPQRLSQEACSHAAQNERLPAHFIIQVLYFEQLRIKTALANYAIEMPKG  478

Query  549  ----TPNAIATRNQLQADV-------------TLVKENEALRTELLQMKMFIADMQNkgg  421
                TP A A R+   A                L +EN+ L+ EL +MK+ ++D++ +  
Sbjct  479  DHGPTPIAAALRSSTAAANAAAAAAADANPQSALRRENKELKIELTRMKIRLSDLEKEQS  538

Query  420  sqgssvkgssasaVRKPT---------FFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDIT  268
               S        +    +         FF ++S++LGKLNPF   S           ++ 
Sbjct  539  PGVSRASEEKRLSSPTSSAASSPGSGRFFYTVSRRLGKLNPFGKSSLKPP----ATPELQ  594

Query  267  KPRRRRFSIS  238
            KPRRRR SIS
Sbjct  595  KPRRRRHSIS  604



>ref|XP_004511857.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Cicer arietinum]
 ref|XP_004511858.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X2 [Cicer arietinum]
Length=679

 Score = 84.0 bits (206),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 61/155 (39%), Positives = 89/155 (57%), Gaps = 25/155 (16%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR---SGAEDPKSTP  544
            ++ER+KVCS+MD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R   +G E+ +S P
Sbjct  501  DMERKKVCSMMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDAMNGNENVES-P  559

Query  543  NAIATRNQLQAD----------VTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgs  394
            +A A  N    D            L +ENE L+ EL+++KM + +++       ++V  S
Sbjct  560  SANAKLNVYSGDTQFHPVSNEITGLRRENEDLKLELVKLKMKLKEIEKSTVKVKATVINS  619

Query  393  sasaVR------KP-----TFFSSMSKKLGKLNPF  322
             +          KP     +F SS+SKKLGKL+PF
Sbjct  620  PSVNSSPSGSADKPPLPRRSFISSVSKKLGKLSPF  654



>ref|XP_004511859.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X3 [Cicer arietinum]
Length=678

 Score = 84.0 bits (206),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 61/155 (39%), Positives = 89/155 (57%), Gaps = 25/155 (16%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR---SGAEDPKSTP  544
            ++ER+KVCS+MD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R   +G E+ +S P
Sbjct  500  DMERKKVCSMMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDAMNGNENVES-P  558

Query  543  NAIATRNQLQAD----------VTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgs  394
            +A A  N    D            L +ENE L+ EL+++KM + +++       ++V  S
Sbjct  559  SANAKLNVYSGDTQFHPVSNEITGLRRENEDLKLELVKLKMKLKEIEKSTVKVKATVINS  618

Query  393  sasaVR------KP-----TFFSSMSKKLGKLNPF  322
             +          KP     +F SS+SKKLGKL+PF
Sbjct  619  PSVNSSPSGSADKPPLPRRSFISSVSKKLGKLSPF  653



>ref|XP_010412682.1| PREDICTED: putative BTB/POZ domain-containing protein At3g49970 
[Camelina sativa]
Length=571

 Score = 83.6 bits (205),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 66/182 (36%), Positives = 95/182 (52%), Gaps = 36/182 (20%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAI  535
            E+E++KVC++MD  KLS E   HA+QN RLPVQ V+  LYY+Q  +R    D  S P A 
Sbjct  403  EMEKKKVCNLMDCQKLSREKCAHAAQNDRLPVQTVVQVLYYEQQSLREILSDSDSPPAAA  462

Query  534  AT-------------RNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgss----  406
            AT              N+L     L +EN+ L+ EL+++KM   +++    +   +    
Sbjct  463  ATVEDTHPPPELSSYNNELS---KLNRENQELKLELIKVKMKFKELEKNQKAFEVTSGSD  519

Query  405  -vkgssasaVRKP-----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFS  244
                 S ++V KP     +F SS+S++LGKLNPF  G K        +V    P+ RR S
Sbjct  520  CSSSVSIASVVKPRLPRKSFMSSVSRQLGKLNPF--GQK--------QVQTKPPKGRRHS  569

Query  243  IS  238
            IS
Sbjct  570  IS  571



>ref|XP_008238282.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Prunus 
mume]
 ref|XP_008238290.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Prunus 
mume]
Length=624

 Score = 83.6 bits (205),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 63/174 (36%), Positives = 94/174 (54%), Gaps = 17/174 (10%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR-------SGAEDP  556
            ++ER+KVCS+MD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R       +G E  
Sbjct  451  DMERKKVCSMMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGNLTGGESS  510

Query  555  --KSTPNAIATRNQLQAD--VTLVKENEALRTELLQMKMFIADMQNkggsqgssv-kgss  391
               S  N  +T      D    L ++NE L+ EL++MKM + +++        S   G+ 
Sbjct  511  VLPSKGNLYSTDIHPVPDELSILRRQNEELKIELVKMKMRLKELETSTMRTSMSSPMGNI  570

Query  390  asaVRKP-----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFS  244
            +++  KP     +F +S+SKKLG+L+PF      T ++  G     K RR   S
Sbjct  571  STSADKPPLPRKSFINSVSKKLGRLSPFVRTDGVTPSIPKGRTRAAKDRRHSIS  624



>ref|XP_010028108.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X3 [Eucalyptus grandis]
Length=597

 Score = 83.2 bits (204),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 64/147 (44%), Positives = 89/147 (61%), Gaps = 16/147 (11%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS------GAEDPK  553
            E+ER+KVCS+MD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R       G E P 
Sbjct  429  ELERKKVCSLMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRMRDAMNGSLGGESPA  488

Query  552  S--TPNAIATRNQLQAD--VTLVKENEALRTELLQMKMFIADMQ-Nkggsqgssvkgssa  388
            +    N  +T     +D    L +ENE L+ EL++MKM + +++ +   S G S  GS+ 
Sbjct  489  APRKLNVYSTDIHPVSDELSRLKRENEDLKIELVKMKMRLREIEKSTLKSAGGSPAGSTP  548

Query  387  saVRKP-----TFFSSMSKKLGKLNPF  322
            S+  KP     +F +SMSKKLG+L PF
Sbjct  549  SSADKPPLPRKSFINSMSKKLGRLYPF  575



>ref|XP_009342777.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Pyrus 
x bretschneideri]
Length=629

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 65/182 (36%), Positives = 101/182 (55%), Gaps = 31/182 (17%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDP  556
            ++ER+KVCS+MD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R        GAE  
Sbjct  456  DMERKKVCSMMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGNPIGAES-  514

Query  555  KSTPNAIATRNQLQA--------DVTLV-KENEALRTELLQMKMFIADMQNkggsqgssv  403
                + + ++  L +        ++T++ ++NE L+ EL++MKM + +++          
Sbjct  515  ----SVLPSKGSLYSTDIHPVPDELTILRRQNEELKIELVKMKMKLKELETSTTRTTMIS  570

Query  402  -kgssasaVRKP-----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRR-RRFS  244
              G++ ++  KP     +F +S+SKKLGKL+PF      T     G    TKP + RR S
Sbjct  571  PMGNTPTSADKPPLPRKSFMNSVSKKLGKLSPFVRADGVTPTGAKGR---TKPAKDRRHS  627

Query  243  IS  238
            IS
Sbjct  628  IS  629



>ref|XP_008341358.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ domain-containing protein 
At5g67385-like [Malus domestica]
Length=568

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 64/182 (35%), Positives = 97/182 (53%), Gaps = 31/182 (17%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDP  556
            ++ER+KVCS+MD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R        GAE  
Sbjct  395  DMERKKVCSMMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGNSIGAES-  453

Query  555  KSTPNAIATRNQLQA--------DVTLV-KENEALRTELLQMKMFIADMQNkggsqgssv  403
                + + ++  L +        ++T++ ++NE L+ EL++MKM + +++          
Sbjct  454  ----SVLPSKGSLYSTDIHPVPDELTILRRQNEELKMELVKMKMKLKELETSTTRTAMIS  509

Query  402  kgssasaVR-KP-----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRR-RRFS  244
               +      KP     +F +S+SKKLGKL+PF      T     G    TKP + RR S
Sbjct  510  PMGNTPTSXDKPPLPRKSFINSVSKKLGKLSPFVRADGVTPTGAKGR---TKPAKDRRHS  566

Query  243  IS  238
            IS
Sbjct  567  IS  568



>ref|XP_008354715.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Malus 
domestica]
Length=626

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 64/182 (35%), Positives = 97/182 (53%), Gaps = 31/182 (17%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDP  556
            ++ER+KVCS+MD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R        GAE  
Sbjct  453  DMERKKVCSMMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGNSIGAES-  511

Query  555  KSTPNAIATRNQLQA--------DVTLV-KENEALRTELLQMKMFIADMQNkggsqgssv  403
                + + ++  L +        ++T++ ++NE L+ EL++MKM + +++          
Sbjct  512  ----SVLPSKGSLYSTDIHPVPDELTILRRQNEELKMELVKMKMKLKELETSTTRTAMIS  567

Query  402  kgssasaVR-KP-----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRR-RRFS  244
               +      KP     +F +S+SKKLGKL+PF      T     G    TKP + RR S
Sbjct  568  PMGNTPTSXDKPPLPRKSFINSVSKKLGKLSPFVRADGVTPTGAKGR---TKPAKDRRHS  624

Query  243  IS  238
            IS
Sbjct  625  IS  626



>ref|XP_007156731.1| hypothetical protein PHAVU_002G012500g [Phaseolus vulgaris]
 ref|XP_007156732.1| hypothetical protein PHAVU_002G012500g [Phaseolus vulgaris]
 gb|ESW28725.1| hypothetical protein PHAVU_002G012500g [Phaseolus vulgaris]
 gb|ESW28726.1| hypothetical protein PHAVU_002G012500g [Phaseolus vulgaris]
Length=617

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 65/175 (37%), Positives = 101/175 (58%), Gaps = 20/175 (11%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAI  535
            ++ER+KVCSVMD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R       S  +++
Sbjct  447  DMERKKVCSVMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDAMNGNGSGESSV  506

Query  534  ATR-NQLQADV--------TLVKENEALRTELLQMKMFIADMQNkg-gsqgssvkgssas  385
             ++ N   +D+        TL +EN+ L+ EL+++K  + +++     S  +S   S++ 
Sbjct  507  DSKLNVYSSDLQPASNELSTLRRENQDLKLELVKLKRRLKEIETTTPKSAVNSPAVSASP  566

Query  384  aVRKP-----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKP-RRRRFSIS  238
            +  KP     +F SS+SKKLG+L+PF   +   +    G    TKP + RR SIS
Sbjct  567  SADKPPLPRRSFMSSVSKKLGRLSPFVR-ADGVAPFAKGR---TKPNKNRRHSIS  617



>ref|XP_002989054.1| hypothetical protein SELMODRAFT_272040 [Selaginella moellendorffii]
 gb|EFJ09848.1| hypothetical protein SELMODRAFT_272040 [Selaginella moellendorffii]
Length=607

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 61/193 (32%), Positives = 95/193 (49%), Gaps = 38/193 (20%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-----GAEDPKS  550
            E +R+++C +MDP +LS EA  HA+QN+RLP   ++  LY++QL+I++       E PK 
Sbjct  419  EADRKRICKLMDPQRLSQEACSHAAQNERLPAHFIIQVLYFEQLRIKTALANYAIEMPKG  478

Query  549  ----TPNAIATRNQLQADV----------------TLVKENEALRTELLQMKMFIADMQN  430
                TP A A R+   A                   L +EN+ L+ EL +MK+ ++D++ 
Sbjct  479  DHGPTPIAAALRSSTAAANAAAAAAAAAADANPQSALRRENKELKIELTRMKIRLSDLEK  538

Query  429  kggsqgssvkgssasaVRKPT---------FFSSMSKKLGKLNPFKHGSKDTSNLDDGEV  277
            +     S        +    +         FF ++S++LGKLNPF   S           
Sbjct  539  EQSPGVSRASEEKRLSSPTSSAASSPGSGRFFHTVSRRLGKLNPFGKSSLKPP----ATP  594

Query  276  DITKPRRRRFSIS  238
            ++ KPRRRR SIS
Sbjct  595  ELQKPRRRRHSIS  607



>ref|XP_007047478.1| Phototropic-responsive NPH3 family protein [Theobroma cacao]
 gb|EOX91635.1| Phototropic-responsive NPH3 family protein [Theobroma cacao]
Length=623

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 66/179 (37%), Positives = 100/179 (56%), Gaps = 24/179 (13%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR---SGAEDPKSTP  544
            ++ER+KVCS+MD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R   +G+     +P
Sbjct  449  DLERKKVCSLMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGSISSGDSP  508

Query  543  NAIATR-NQLQAD--------VTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgss  391
             AI++R N   AD         +L +ENE L+ EL++MKM + +++     + +      
Sbjct  509  -AISSRVNLYTADSHPVSDELSSLKRENEDLKLELVKMKMRLKEIEKSSSVKSAVSSPMG  567

Query  390  as--aVRKP-----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRR-RRFSIS  238
                +  KP     +F +S+SKKLG+L PF      + +   G    T+P + RR SIS
Sbjct  568  IILPSSDKPPLPRKSFMNSVSKKLGRLYPFVRSDGVSPSSAKGR---TRPSKDRRHSIS  623



>gb|KHG27515.1| hypothetical protein F383_13864 [Gossypium arboreum]
Length=471

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 52/147 (35%), Positives = 83/147 (56%), Gaps = 16/147 (11%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAI  535
            ++ER+KVCS+MD  KLS EA  HA+QN RLPVQ V+  LY++Q ++R        +P  I
Sbjct  305  DMERKKVCSLMDCQKLSREACAHAAQNDRLPVQTVVQVLYHEQQRLRDVMNGSGDSPAVI  364

Query  534  ATR-NQLQADV--------TLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasa  382
             ++ N    DV        +L +EN+ L+ EL++MKM + +++    ++ +      +  
Sbjct  365  PSKVNLYPTDVHPVSGELSSLKRENQDLKLELVKMKMRLKEIEKSTSAKTAVSSPMGSIT  424

Query  381  VR-------KPTFFSSMSKKLGKLNPF  322
                     K +F +S+SKKLG+L PF
Sbjct  425  PSSDKPPLPKKSFMNSVSKKLGRLYPF  451



>ref|XP_009115683.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Brassica rapa]
Length=567

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 57/159 (36%), Positives = 84/159 (53%), Gaps = 24/159 (15%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAI  535
            E+E++K+CS+M+  KLS EA  HA+QNKRLPV IV   L+ +Q  +R    D  S   A 
Sbjct  401  EVEKKKICSLMNSQKLSQEACAHAAQNKRLPVHIVAQVLHQEQQSLRQVLCDSDSPVAAT  460

Query  534  AT-------------RNQLQADVTLVKENEALRTELLQMKMFIADMQ--------Nkggs  418
            A               N+L     L +EN+ L+ ELL++KM + +++        +    
Sbjct  461  AIAPESPPPPTLSSYNNELS---KLNRENQDLKLELLKVKMTLKELEREKDFEIKSCSDC  517

Query  417  qgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDT  301
               S      S +R+ +F SS+S+KLGKLNPF H  + T
Sbjct  518  SSVSTASVVKSPLRRKSFISSVSRKLGKLNPFGHTQRRT  556



>gb|KJB48678.1| hypothetical protein B456_008G080700 [Gossypium raimondii]
Length=501

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 60/176 (34%), Positives = 94/176 (53%), Gaps = 26/176 (15%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAI  535
            ++ER+KVCS+MD  KLS EA  HA+QN RLPVQ V+  LY++Q ++R        +P  I
Sbjct  335  DMERKKVCSLMDCQKLSREACAHAAQNDRLPVQTVVQVLYHEQQRLRDVMNGSGDSPAVI  394

Query  534  ATR-NQLQADV--------TLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasa  382
             ++ N    DV        +L +EN+ L+ EL++MKM + +++    ++ +      +  
Sbjct  395  PSKVNLYPTDVHPVSGELSSLKRENQDLKLELVKMKMRLKEIEKSTSAKTAISSPMGSIT  454

Query  381  VR-------KPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRR-RRFSIS  238
                     K +F +S+SKKLG+L PF         +  G    T+P + RR SIS
Sbjct  455  PSSDKPPLPKKSFMNSVSKKLGRLYPF---------VPSGAKGRTRPSKDRRHSIS  501



>ref|XP_009115684.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X2 [Brassica rapa]
Length=566

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 57/159 (36%), Positives = 84/159 (53%), Gaps = 24/159 (15%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAI  535
            E+E++K+CS+M+  KLS EA  HA+QNKRLPV IV   L+ +Q  +R    D  S   A 
Sbjct  400  EVEKKKICSLMNSQKLSQEACAHAAQNKRLPVHIVAQVLHQEQQSLRQVLCDSDSPVAAT  459

Query  534  AT-------------RNQLQADVTLVKENEALRTELLQMKMFIADMQ--------Nkggs  418
            A               N+L     L +EN+ L+ ELL++KM + +++        +    
Sbjct  460  AIAPESPPPPTLSSYNNELS---KLNRENQDLKLELLKVKMTLKELEREKDFEIKSCSDC  516

Query  417  qgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDT  301
               S      S +R+ +F SS+S+KLGKLNPF H  + T
Sbjct  517  SSVSTASVVKSPLRRKSFISSVSRKLGKLNPFGHTQRRT  555



>ref|XP_009782405.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Nicotiana 
sylvestris]
Length=620

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 83/149 (56%), Gaps = 21/149 (14%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR---SGAEDPKSTP  544
            ++ER+KVC VMD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R    G++   + P
Sbjct  448  DMERKKVCGVMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLREVMDGSQLVATEP  507

Query  543  NAI--ATRNQLQADV--------TLVKENEALRTELLQMKMFIADMQNkggsqgssvkgs  394
             A+  +  NQ   D+        +L +EN+ L+ ELL+MKM + +++       +S    
Sbjct  508  PALIPSKTNQFSTDIRPISDEVSSLKRENQELKFELLKMKMRLKEIEKPSNKSATSSPLV  567

Query  393  sasaV-------RKPT-FFSSMSKKLGKL  331
                        RKP+ F SS+SKKLGK 
Sbjct  568  ITHPSADKPPLPRKPSNFISSVSKKLGKF  596



>ref|XP_002465671.1| hypothetical protein SORBIDRAFT_01g043470 [Sorghum bicolor]
 gb|EER92669.1| hypothetical protein SORBIDRAFT_01g043470 [Sorghum bicolor]
Length=598

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 65/172 (38%), Positives = 87/172 (51%), Gaps = 22/172 (13%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAI  535
            E  R+KVC VMD  KLS EA  HA+QN RLPVQ V+  LY++Q ++R   + P S P   
Sbjct  433  EAGRKKVCRVMDCQKLSREACAHAAQNDRLPVQTVVQVLYHEQRRLREAPKAP-SPPYRP  491

Query  534  ATRNQLQA--------DVT-LVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasa  382
            A    LQ         +V+ L +ENE L+ ELL+MKM + +          +        
Sbjct  492  APTPSLQGRHARTVLDEVSRLQRENEELKMELLRMKMHMREPPAALPQPSGAPPPGRRPP  551

Query  381  VRKPT-----FFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSI  241
             +K       F +++SKKLG+LNPF         LD    +  K RRRR SI
Sbjct  552  PKKAAGGSGGFMNNVSKKLGRLNPFLR-------LDAVGTEPPKDRRRRRSI  596



>ref|XP_006466487.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Citrus 
sinensis]
Length=623

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 58/153 (38%), Positives = 89/153 (58%), Gaps = 26/153 (17%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR-------SGAEDP  556
            ++ER+KVCS+MD  KLS EA  HA+QN RLPVQ V+  LY++Q +IR       +G + P
Sbjct  449  DMERKKVCSLMDCQKLSREACAHAAQNDRLPVQTVVQVLYHEQQRIRHVMDGNLTGGDSP  508

Query  555  KSTPNAIATRNQLQADV--------TLVKENEALRTELLQMKMFIADMQNkggsqgssvk  400
             + P+ I   N   AD+        +L +ENE L+ ELL+MKM + +++       ++  
Sbjct  509  -AVPSKI---NLYSADLHPVSNELSSLRRENEDLKIELLKMKMKLKEIEKSSAKSSAASS  564

Query  399  --gssasaVRKP-----TFFSSMSKKLGKLNPF  322
               ++  +  KP     +F +S+SKKLG+L PF
Sbjct  565  PLVNAQYSADKPPLPRKSFINSVSKKLGRLYPF  597



>gb|KJB48677.1| hypothetical protein B456_008G080700 [Gossypium raimondii]
Length=614

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 60/176 (34%), Positives = 94/176 (53%), Gaps = 26/176 (15%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAI  535
            ++ER+KVCS+MD  KLS EA  HA+QN RLPVQ V+  LY++Q ++R        +P  I
Sbjct  448  DMERKKVCSLMDCQKLSREACAHAAQNDRLPVQTVVQVLYHEQQRLRDVMNGSGDSPAVI  507

Query  534  ATR-NQLQADV--------TLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasa  382
             ++ N    DV        +L +EN+ L+ EL++MKM + +++    ++ +      +  
Sbjct  508  PSKVNLYPTDVHPVSGELSSLKRENQDLKLELVKMKMRLKEIEKSTSAKTAISSPMGSIT  567

Query  381  VR-------KPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRR-RRFSIS  238
                     K +F +S+SKKLG+L PF         +  G    T+P + RR SIS
Sbjct  568  PSSDKPPLPKKSFMNSVSKKLGRLYPF---------VPSGAKGRTRPSKDRRHSIS  614



>gb|KDO78972.1| hypothetical protein CISIN_1g006971mg [Citrus sinensis]
Length=623

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 58/153 (38%), Positives = 89/153 (58%), Gaps = 26/153 (17%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR-------SGAEDP  556
            ++ER+KVCS+MD  KLS EA  HA+QN RLPVQ V+  LY++Q +IR       +G + P
Sbjct  449  DMERKKVCSLMDCQKLSREACAHAAQNDRLPVQTVVQVLYHEQQRIRHVMDGNLTGGDSP  508

Query  555  KSTPNAIATRNQLQADV--------TLVKENEALRTELLQMKMFIADMQNkggsqgssvk  400
             + P+ I   N   AD+        +L +ENE L+ ELL+MKM + +++       ++  
Sbjct  509  -AVPSKI---NLYSADLHPVSNELSSLRRENEDLKIELLKMKMKLKEIEKSSAKSSAASS  564

Query  399  --gssasaVRKP-----TFFSSMSKKLGKLNPF  322
               ++  +  KP     +F +S+SKKLG+L PF
Sbjct  565  PLVNAQYSADKPPLPRKSFINSVSKKLGRLYPF  597



>ref|XP_004149698.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Cucumis 
sativus]
Length=621

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 62/177 (35%), Positives = 90/177 (51%), Gaps = 23/177 (13%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR---SGAEDPKSTP  544
            ++ER+KVCS+MD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R   +G+      P
Sbjct  448  DMERKKVCSLMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGSPTGVEVP  507

Query  543  NAIATRNQLQADV-------------TLVKENEALRTELLQMKMFIADMQNkggsqgssv  403
               A  N   A+               L +EN+ L+ EL++MKM + + +    S   + 
Sbjct  508  AVPAKLNIYSAETAAAAAHPVSDELSILRRENQDLKLELVKMKMKMREFEKPSISSPQTN  567

Query  402  kgssasaVRKP----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFS  244
                 +A + P    +F +S+SK+LG+L PF      TS    G V   K RR   S
Sbjct  568  TQLQPNAEKPPLPKKSFINSVSKRLGRLYPFVRADGVTSK---GRVRPAKDRRHSIS  621



>ref|XP_006426057.1| hypothetical protein CICLE_v10025164mg [Citrus clementina]
 gb|ESR39297.1| hypothetical protein CICLE_v10025164mg [Citrus clementina]
Length=623

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 58/153 (38%), Positives = 89/153 (58%), Gaps = 26/153 (17%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR-------SGAEDP  556
            ++ER+KVCS+MD  KLS EA  HA+QN RLPVQ V+  LY++Q +IR       +G + P
Sbjct  449  DMERKKVCSLMDCQKLSREACAHAAQNDRLPVQTVVQVLYHEQQRIRHVMDGNLTGGDSP  508

Query  555  KSTPNAIATRNQLQADV--------TLVKENEALRTELLQMKMFIADMQNkggsqgssvk  400
             + P+ I   N   AD+        +L +ENE L+ ELL+MKM + +++       ++  
Sbjct  509  -AVPSKI---NLYSADLHPVSNELSSLRRENEDLKIELLKMKMKLKEIEKSSAKSSAASS  564

Query  399  --gssasaVRKP-----TFFSSMSKKLGKLNPF  322
               ++  +  KP     +F +S+SKKLG+L PF
Sbjct  565  PLVNAQYSADKPPLPRKSFINSVSKKLGRLYPF  597



>ref|XP_010086959.1| BTB/POZ domain-containing protein [Morus notabilis]
 gb|EXB25095.1| BTB/POZ domain-containing protein [Morus notabilis]
Length=624

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 66/183 (36%), Positives = 96/183 (52%), Gaps = 31/183 (17%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDP  556
            ++ER+KVCS+MD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R        G E P
Sbjct  449  DMERKKVCSLMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGSLVGGESP  508

Query  555  KST-PNAIATRNQLQADV--------TLVKENEALRTELLQMKMFIADMQNkggsqgssv  403
             S  P+ +   N    D+         L +ENE L+ EL++MKM + +++     + +  
Sbjct  509  ASALPSKL---NLYSTDIHPVSDELSGLRRENEDLKIELVKMKMKMKEIERSTAVKSAVN  565

Query  402  k--gssasaVRKP-----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRR-RRF  247
                   S+  KP     +F +S+SK+LG+L PF      T +        TKP + RR 
Sbjct  566  SPQSVIMSSADKPPRPRKSFMNSVSKRLGRLYPFVRSDGVTPSYKGR----TKPSKDRRH  621

Query  246  SIS  238
            SIS
Sbjct  622  SIS  624



>emb|CAN71562.1| hypothetical protein VITISV_007563 [Vitis vinifera]
Length=621

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 63/191 (33%), Positives = 96/191 (50%), Gaps = 35/191 (18%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDP  556
            ++E++KVCS+MD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R        G E P
Sbjct  434  DMEKKKVCSLMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGSLMGGESP  493

Query  555  KSTPNAIATRNQLQ--AD--VTLVKENEALRTELLQMKM---------------------  451
               P +    N L   +D  ++L +ENE L+ EL++MKM                     
Sbjct  494  AIPPKSNLFSNDLHPVSDELLSLRRENEDLKLELMKMKMRLKEIEKSAVPSGVPTSLPSA  553

Query  450  FIADMQNkggsqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDI  271
            + + +Q+   S  ++   +    + + +F +S+SK+LG+L PF           DG+   
Sbjct  554  YSSILQSAASSPRNTPPSADKPPLPRKSFMNSVSKRLGRLYPFVRADGVAP---DGKART  610

Query  270  TKPRRRRFSIS  238
               R RR SIS
Sbjct  611  KPSRDRRHSIS  621



>ref|XP_002284242.2| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Vitis 
vinifera]
Length=636

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 63/191 (33%), Positives = 96/191 (50%), Gaps = 35/191 (18%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDP  556
            ++E++KVCS+MD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R        G E P
Sbjct  449  DMEKKKVCSLMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGSLMGGESP  508

Query  555  KSTPNAIATRNQLQ--AD--VTLVKENEALRTELLQMKM---------------------  451
               P +    N L   +D  ++L +ENE L+ EL++MKM                     
Sbjct  509  AIPPKSNLFSNDLHPVSDELLSLRRENEDLKLELMKMKMRLKEIEKSAVPSGVPTSLPSA  568

Query  450  FIADMQNkggsqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDI  271
            + + +Q+   S  ++   +    + + +F +S+SK+LG+L PF           DG+   
Sbjct  569  YSSILQSAASSPRNTPPSADKPPLPRKSFMNSVSKRLGRLYPFVRADGVAP---DGKART  625

Query  270  TKPRRRRFSIS  238
               R RR SIS
Sbjct  626  KPSRDRRHSIS  636



>ref|XP_006339816.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Solanum 
tuberosum]
Length=596

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 53/145 (37%), Positives = 81/145 (56%), Gaps = 17/145 (12%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAI  535
            +IER+KVC VMD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++  G++   + P A+
Sbjct  428  DIERKKVCGVMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLHDGSQLVATEPPAL  487

Query  534  A--------TRNQLQADV-TLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssas-  385
                     + N +  +V +L +EN+ L+ ELL+MK  + D++    +  ++      + 
Sbjct  488  VPSKRDHQFSTNPVSDEVSSLKRENQELKFELLKMKTRLIDIEKPNLNTSATSSPLVITH  547

Query  384  -------aVRKPTFFSSMSKKLGKL  331
                     RK  F SS+SKKLG+ 
Sbjct  548  PSAGKPPLPRKSNFMSSVSKKLGRF  572



>gb|EPS72379.1| hypothetical protein M569_02379, partial [Genlisea aurea]
Length=583

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 80/137 (58%), Gaps = 18/137 (13%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAI  535
            + ER+ VCSVMD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R   +  +S+P A 
Sbjct  429  DTERKTVCSVMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLREAVDGGESSPAAA  488

Query  534  ATRNQLQAD----VTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasaVRKP-  370
            A   +   D      L +EN  L+ E+L++KM + + +            ++AS VRKP 
Sbjct  489  AAAAKGSPDSEEVAFLRRENRELKMEVLRLKMKLKEWET---------PAAAASVVRKPP  539

Query  369  ----TFFSSMSKKLGKL  331
                +F SS+S+KLGKL
Sbjct  540  LPKKSFMSSVSQKLGKL  556



>gb|KEH27511.1| phototropic-responsive NPH3 family protein [Medicago truncatula]
Length=516

 Score = 80.5 bits (197),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 56/159 (35%), Positives = 86/159 (54%), Gaps = 29/159 (18%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR---SGAEDPKSTP  544
            ++ER+KVCS+MD  +LS EA  HA+QN RLPVQ V+  LYY+Q ++R   +G+E  +S P
Sbjct  335  DMERKKVCSIMDCQRLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDAMNGSETAES-P  393

Query  543  NAIATRNQLQADV-------TLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssas  385
            +     N    D+       +L +ENE L+ E++++KM + +++             S  
Sbjct  394  SIHTKLNVYSGDIQVSNELTSLRRENEDLKLEVVKLKMKLKEIEISTLKSTVKSTVKSTV  453

Query  384  -------------aVRKP-----TFFSSMSKKLGKLNPF  322
                         +  KP     +F SS+SKKLGKL+PF
Sbjct  454  NSPIANASPSHSHSADKPPLPRKSFISSVSKKLGKLSPF  492



>ref|XP_003597110.1| Root phototropism protein [Medicago truncatula]
 ref|XP_003611625.1| Root phototropism protein [Medicago truncatula]
 gb|AES94583.1| phototropic-responsive NPH3 family protein [Medicago truncatula]
Length=630

 Score = 80.9 bits (198),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 56/159 (35%), Positives = 86/159 (54%), Gaps = 29/159 (18%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR---SGAEDPKSTP  544
            ++ER+KVCS+MD  +LS EA  HA+QN RLPVQ V+  LYY+Q ++R   +G+E  +S P
Sbjct  449  DMERKKVCSIMDCQRLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDAMNGSETAES-P  507

Query  543  NAIATRNQLQADV-------TLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssas  385
            +     N    D+       +L +ENE L+ E++++KM + +++             S  
Sbjct  508  SIHTKLNVYSGDIQVSNELTSLRRENEDLKLEVVKLKMKLKEIEISTLKSTVKSTVKSTV  567

Query  384  -------------aVRKP-----TFFSSMSKKLGKLNPF  322
                         +  KP     +F SS+SKKLGKL+PF
Sbjct  568  NSPIANASPSHSHSADKPPLPRKSFISSVSKKLGKLSPF  606



>ref|XP_004231910.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Solanum 
lycopersicum]
Length=596

 Score = 80.9 bits (198),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 54/154 (35%), Positives = 85/154 (55%), Gaps = 20/154 (13%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAI  535
            +IER+KVC +MD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++ +G++   + P A+
Sbjct  428  DIERKKVCGIMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLHNGSQLVATEPPAL  487

Query  534  ATR--------NQLQADV-TLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasa  382
             +         N +  +V +L +EN+ L+ ELL+MK  + +++    +  +S      + 
Sbjct  488  VSSKRDDQFSTNPVSDEVSSLKRENQELKFELLKMKTRLIEIEKPKSNTSASSSPLVITQ  547

Query  381  --------VRKPTFFSSMSKKLGKL---NPFKHG  313
                     RK  F SS+SKKLG+    +   HG
Sbjct  548  PSAGKPPLPRKSNFMSSVSKKLGRFIRADGLTHG  581



>gb|ACL53070.1| unknown [Zea mays]
 tpg|DAA43884.1| TPA: putative phototropic-responsive NPH3 family protein [Zea 
mays]
Length=500

 Score = 80.1 bits (196),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 54/144 (38%), Positives = 75/144 (52%), Gaps = 13/144 (9%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDP  556
            E ER+ VC VMD  KLS EA  HA+QN RLPVQ V+  L+++Q ++R        G E P
Sbjct  331  EAERKTVCRVMDCQKLSREACAHAAQNNRLPVQTVVQVLHHEQRRLREAPTSSFYGGESP  390

Query  555  KSTPNAIATRNQLQAD--VTLVKENEALRTELLQMKMFIAD----MQNkggsqgssvkgs  394
               P+      +   D    L +ENE L+ ELL++KM + D     Q+            
Sbjct  391  TPAPSLQGRHGRSVPDEMSQLQRENEELKMELLRLKMNLRDPSAPPQHSDAPPSGRRPLP  450

Query  393  sasaVRKPTFFSSMSKKLGKLNPF  322
              +A     F +++SKKLG+LNPF
Sbjct  451  KKAAGGSGGFINNVSKKLGRLNPF  474



>gb|KFK28391.1| hypothetical protein AALP_AA8G509000 [Arabis alpina]
Length=604

 Score = 80.5 bits (197),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 65/186 (35%), Positives = 97/186 (52%), Gaps = 36/186 (19%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR--------SGAED  559
            ++ER+KVCS+MD  KLS EA  HA+QN RLPVQ ++  LYY+Q ++R        S A  
Sbjct  428  DVERKKVCSLMDCQKLSREACAHAAQNDRLPVQTIVQVLYYEQQRLRGEVTNDSESSAPQ  487

Query  558  PKSTPNAI------ATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkg  397
            P     A+      +  ++L     L +EN+ L+ ELL+MKM + + + +   +  S   
Sbjct  488  PPQQATAVLPPKLSSYNDELS---KLKRENQDLKLELLKMKMKLKEFEKESDKKSVSTTM  544

Query  396  s-------sasaVRKP------TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRR  256
            S       S +++ KP      +F +S+SKKLGKLNPF   + +             P+ 
Sbjct  545  SSIPGSPMSTASMDKPPLPPKKSFINSVSKKLGKLNPFGIPAYNARG------RTKPPKD  598

Query  255  RRFSIS  238
            RR SIS
Sbjct  599  RRHSIS  604



>ref|XP_010426528.1| PREDICTED: putative BTB/POZ domain-containing protein At3g49970 
[Camelina sativa]
Length=571

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 68/183 (37%), Positives = 94/183 (51%), Gaps = 38/183 (21%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAI  535
            E+E++KVC +MD  KLS E   HA+QN RLPVQ V+  LYY+Q  +R    D  S P A 
Sbjct  403  EMEKKKVCKLMDSQKLSREKCAHAAQNDRLPVQTVVQVLYYEQKSLREILSDSDSPPAAA  462

Query  534  AT-------------RNQLQADVTLVKENEALRTELLQMKMFIADMQN-----kggsqgs  409
            AT              N+L     L +EN+ L+ EL+++KM   +++      +  S   
Sbjct  463  ATVEDTLPPPELRTYNNELS---KLNRENQDLKLELIKVKMKFKELEKEQKDFEVTSGSD  519

Query  408  svkgssasaVRKP-----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRR-RRF  247
                 S ++V KP     +F SS+S++LGKLNPF  G K            TKP + RR 
Sbjct  520  CSSSVSIASVVKPRLPRKSFMSSVSRQLGKLNPF--GLKQVQ---------TKPAKGRRH  568

Query  246  SIS  238
            SIS
Sbjct  569  SIS  571



>tpg|DAA43883.1| TPA: putative phototropic-responsive NPH3 family protein [Zea 
mays]
Length=597

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/144 (38%), Positives = 75/144 (52%), Gaps = 13/144 (9%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDP  556
            E ER+ VC VMD  KLS EA  HA+QN RLPVQ V+  L+++Q ++R        G E P
Sbjct  428  EAERKTVCRVMDCQKLSREACAHAAQNNRLPVQTVVQVLHHEQRRLREAPTSSFYGGESP  487

Query  555  KSTPNAIATRNQLQAD--VTLVKENEALRTELLQMKMFIAD----MQNkggsqgssvkgs  394
               P+      +   D    L +ENE L+ ELL++KM + D     Q+            
Sbjct  488  TPAPSLQGRHGRSVPDEMSQLQRENEELKMELLRLKMNLRDPSAPPQHSDAPPSGRRPLP  547

Query  393  sasaVRKPTFFSSMSKKLGKLNPF  322
              +A     F +++SKKLG+LNPF
Sbjct  548  KKAAGGSGGFINNVSKKLGRLNPF  571



>gb|KFK34271.1| hypothetical protein AALP_AA5G123300 [Arabis alpina]
Length=551

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 62/165 (38%), Positives = 91/165 (55%), Gaps = 20/165 (12%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAI  535
            E+E++KVCS+MD  KLS EA  HA+QN RL VQ V+  L+Y+Q  +R    D  S P A 
Sbjct  401  EVEKKKVCSLMDCNKLSQEASAHAAQNDRLHVQTVVKVLHYEQQSLRQILRDTDS-PAAY  459

Query  534  ATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssasaV------RK  373
               ++L     L +EN+ L+ ELL++KM   + + +   +  S    S  ++      R+
Sbjct  460  NNDDELS---QLNRENQELKLELLKVKMNFKEFEEEKTFEVMSSSDYSLVSIASVVKPRR  516

Query  372  PTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  238
             +F S +S+KLGKLNPF        ++  G   I  P+ RR SIS
Sbjct  517  KSFISYVSRKLGKLNPF--------SMTQGR--IIPPKGRRHSIS  551



>gb|KDP32052.1| hypothetical protein JCGZ_12513 [Jatropha curcas]
Length=622

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 65/178 (37%), Positives = 99/178 (56%), Gaps = 24/178 (13%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR---SGAEDPKSTP  544
            +++R+KVCS+MD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R   +G      +P
Sbjct  450  DMDRKKVCSLMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGNIIGGDSP  509

Query  543  NAIATRNQLQADV--------TLVKENEALRTELLQMKMFIADMQNkggsqgssvk--gs  394
                  N   A +         L +ENE L+ EL++MKM + +++   GS+ ++     +
Sbjct  510  ALPQKMNLYSAGIPPVSDEISNLKRENEDLKIELVKMKMRLKEIEKSAGSRSATNSPLSN  569

Query  393  sasaVRKP-----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKP-RRRRFSIS  238
            S  +  KP     +F +S+SK+LG+L PF     D+  +  G    TKP + RR SIS
Sbjct  570  STPSADKPPLPRKSFINSVSKRLGRLYPFVRAEGDS--IPKGR---TKPSKNRRHSIS  622



>ref|XP_007208165.1| hypothetical protein PRUPE_ppa002888mg [Prunus persica]
 gb|EMJ09364.1| hypothetical protein PRUPE_ppa002888mg [Prunus persica]
Length=624

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 62/174 (36%), Positives = 92/174 (53%), Gaps = 17/174 (10%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDP  556
            ++ER+KVCS+MD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R        G E  
Sbjct  451  DMERKKVCSMMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGNLIGGESS  510

Query  555  --KSTPNAIATRNQLQAD--VTLVKENEALRTELLQMKMFIADMQNkggsqgssv-kgss  391
               S  N  +T      D    L ++NE L+ EL++MK  + +++        S   G+ 
Sbjct  511  VLPSKGNLYSTDIHPVPDELSILRRQNEELKIELVKMKKRLKELETSTVRTSISSPMGNI  570

Query  390  asaVRKP-----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFS  244
            +++  KP     +F +S+SKKLG+L+PF      T ++  G     K RR   S
Sbjct  571  STSADKPPLPRKSFINSVSKKLGRLSPFVRTDGVTPSIPKGRTRAAKDRRHSIS  624



>ref|XP_009780159.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Nicotiana 
sylvestris]
Length=621

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 59/170 (35%), Positives = 94/170 (55%), Gaps = 12/170 (7%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAI  535
            +IER++VCSVM+  KL+ EA  HA+QN+RLPVQ V+  LY++Q ++R   +      +  
Sbjct  453  DIERKRVCSVMNCQKLTREACAHAAQNERLPVQTVVQVLYFEQQRLRQVMDGSLDGADES  512

Query  534  ATRNQLQAD--VTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssas-------a  382
            +T N    D   +L +EN+ L+ EL++MK  + +++  G    +S      +        
Sbjct  513  STDNNPVTDEVSSLKRENQDLKFELVKMKTRLNEIEKCGDISATSTPVEITTPISSDKPR  572

Query  381  VRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKP--RRRRFSIS  238
            +R+ +F SS+S+ LGKL P   G+ D   +        KP  R RR+SIS
Sbjct  573  LRRKSFISSVSETLGKLYPISFGA-DHVIMPSASKGRYKPISRDRRYSIS  621



>emb|CDY37857.1| BnaAnng05180D [Brassica napus]
Length=600

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 61/187 (33%), Positives = 94/187 (50%), Gaps = 39/187 (21%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKST----  547
            ++ER+KVCS+MD  KLS EA  HA+QN RLPVQ ++  LYY+Q ++R    +   +    
Sbjct  425  DVERKKVCSLMDCQKLSREACAHAAQNDRLPVQTIVQVLYYEQQRLRGEVTNDSDSPAPP  484

Query  546  ----------PNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkg  397
                      P  +++ N   + V   +EN+ L+ ELL+MKM + + + +   + SS   
Sbjct  485  PPQPTATVLPPPKLSSYNDELSKVK--RENQDLKLELLKMKMKLKEFEKENNEKKSSTTT  542

Query  396  ssasaVRKP--------------TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPR  259
            + +S    P              +F +S+SKKLGKLNPF    +  +           P+
Sbjct  543  TMSSNHSSPRSTASMDKPPLPRKSFINSVSKKLGKLNPFGIPPRGRTK---------PPK  593

Query  258  RRRFSIS  238
             RR SIS
Sbjct  594  DRRHSIS  600



>gb|ACL52494.1| unknown [Zea mays]
Length=597

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 54/144 (38%), Positives = 74/144 (51%), Gaps = 13/144 (9%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDP  556
            E ER+ VC VMD  KLS EA  HA+QN RLPVQ V+  L+++Q ++R        G E P
Sbjct  428  EAERKTVCRVMDCQKLSREACAHAAQNNRLPVQTVVQVLHHEQRRLREAPTSSFYGGESP  487

Query  555  KSTPNAIATRNQLQAD--VTLVKENEALRTELLQMKMFIAD----MQNkggsqgssvkgs  394
               P+      +   D    L +ENE L+ ELL++KM + D     Q             
Sbjct  488  TPAPSLQGRHGRSVPDEMSQLQRENEELKMELLRLKMNLRDPSAPPQPSDAPPSGRRPLP  547

Query  393  sasaVRKPTFFSSMSKKLGKLNPF  322
              +A     F +++SKKLG+LNPF
Sbjct  548  KKAAGGSGGFINNVSKKLGRLNPF  571



>ref|XP_004509079.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Cicer arietinum]
 ref|XP_004509080.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X2 [Cicer arietinum]
Length=598

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 61/176 (35%), Positives = 95/176 (54%), Gaps = 22/176 (13%)
 Frame = -2

Query  708  EREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS--------GAEDPK  553
            +R+KVCS+MD  KLS EAR HA+QN RLPVQ V   LYYDQ + R+        G+E P 
Sbjct  426  DRKKVCSMMDCQKLSREARAHAAQNNRLPVQSVAQVLYYDQQRRRNDMDGIGSVGSESPL  485

Query  552  STPNAIATRNQLQA---DVT-LVKENEALRTELLQMKMFIADMQNkggsqgssvkgssas  385
            +  N     ++L     +V+ L +ENE L+ E+ ++ M I + +        S    + +
Sbjct  486  TPENRNVYSSELYPVSNEVSKLRRENEELKLEIAKLTMKIKESEKCKLESAVSSPLLNVT  545

Query  384  a-------VRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  238
            +       + K +F +S+S+KLG+L+PF       ++  D    + + + RRFSIS
Sbjct  546  SPSADKPPLHKKSFLNSVSRKLGRLSPFSRQDPVITHPKD---PVKQDKIRRFSIS  598



>dbj|BAK07863.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=613

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 69/194 (36%), Positives = 92/194 (47%), Gaps = 40/194 (21%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR-------------  574
            E ER+KVC VMD  KLS EA  HA+QN RLPVQ V+  LY++Q ++R             
Sbjct  425  EGERKKVCGVMDCQKLSREACAHAAQNDRLPVQTVVQVLYHEQRRLRVPPPSQAPSGAPS  484

Query  573  -SGAEDP----KSTPNAIA-TRNQLQADVT-LVKENEALRTELLQMKMFIAD---MQNkg  424
             +G E P    K TP+     R+   ++V+ L +EN+ LR EL+QMKM + D        
Sbjct  485  YAGGESPALSYKPTPSFNGRERSAPSSEVSRLQRENDELRMELMQMKMRLRDPSGAAPAA  544

Query  423  gsqgssvkgssasaVRKPTF------------FSSMSKKLGKLNPFKHGSKDTSNLDDGE  280
                ++    S+ A  KP                   KKLG+LNPF         L  G+
Sbjct  545  APPLAAGATRSSPASGKPPLPKKQGGASGGGGGGGFMKKLGRLNPFVR-----DPLAGGK  599

Query  279  VDITKPRRRRFSIS  238
            V    P+ RR SIS
Sbjct  600  VRTKPPKDRRHSIS  613



>emb|CDY30615.1| BnaAnng03900D [Brassica napus]
Length=499

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 80/143 (56%), Gaps = 13/143 (9%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS--TPN  541
            E+E++K+CS+M+  KLS EA  HA+QNKRLP Q +   L      + + A  P+S   P 
Sbjct  344  EVEKKKICSLMNSQKLSQEACAHAAQNKRLPQQSLRQVLCDSDSPVAATAIAPESPPPPT  403

Query  540  AIATRNQLQADVTLVKENEALRTELLQMKMFIADMQ--------Nkggsqgssvkgssas  385
              +  N+L     L +EN+ L+ ELL++KM + +++        N       S      S
Sbjct  404  LSSYNNELS---KLNRENQDLKLELLKVKMTLKELEREKDFEIKNCSDCSSVSTASVVKS  460

Query  384  aVRKPTFFSSMSKKLGKLNPFKH  316
             +R+ +F SS+S+KLGKLNPF H
Sbjct  461  PLRRKSFISSVSRKLGKLNPFGH  483



>ref|XP_007155848.1| hypothetical protein PHAVU_003G236800g [Phaseolus vulgaris]
 ref|XP_007155849.1| hypothetical protein PHAVU_003G236800g [Phaseolus vulgaris]
 gb|ESW27842.1| hypothetical protein PHAVU_003G236800g [Phaseolus vulgaris]
 gb|ESW27843.1| hypothetical protein PHAVU_003G236800g [Phaseolus vulgaris]
Length=591

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 62/175 (35%), Positives = 93/175 (53%), Gaps = 24/175 (14%)
 Frame = -2

Query  708  EREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS------GAEDPKS-  550
            E++KVCSVMD  KLS +A  HA+QN RLPVQ V+  LYY+Q ++R       G + P + 
Sbjct  421  EKKKVCSVMDCQKLSRDACAHAAQNDRLPVQTVVQVLYYEQQRLRDSVDGSVGWDSPNNF  480

Query  549  ------TPNAI-ATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssv-kgs  394
                  +PN +    N+      L +ENE L+ E++++KM + +++       SS     
Sbjct  481  RDKANLSPNGLNPVSNEFS---NLRRENEELKLEIVKLKMKLKEIERSSLISASSSPVIY  537

Query  393  sasaVRKP-----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFS  244
            ++ +  KP     +F +S+SKKLG+L+PF      T N   G V   K RR   S
Sbjct  538  ASPSADKPPLPRKSFMNSVSKKLGRLSPFSRAGAAT-NPVKGRVKPDKNRRHSIS  591



>ref|XP_009628088.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Nicotiana 
tomentosiformis]
Length=620

 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 55/149 (37%), Positives = 81/149 (54%), Gaps = 21/149 (14%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR---SGAEDPKSTP  544
            ++ER+KVC VMD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R    G++   + P
Sbjct  448  DMERKKVCGVMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLREVMDGSQLVATEP  507

Query  543  NAI--ATRNQLQADV--------TLVKENEALRTELLQMKMFIADMQNkggsqgssvkgs  394
              +  +  N    D+        +L +EN+ L+ ELL+MKM + +++       +S    
Sbjct  508  PTLIPSKTNHFSIDIPPVSDEVSSLKRENQELKFELLKMKMRLKEIEKPSNKSAASSPLV  567

Query  393  sasaV-------RKPT-FFSSMSKKLGKL  331
                        RKP+ F SS+SKKLGK 
Sbjct  568  ITHPSADKPPLPRKPSNFISSVSKKLGKF  596



>gb|AES90666.2| phototropic-responsive NPH3 family protein [Medicago truncatula]
Length=595

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 63/180 (35%), Positives = 98/180 (54%), Gaps = 30/180 (17%)
 Frame = -2

Query  708  EREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR-------SGAEDPKS  550
            +R+KVCS+MD  KLS EAR HA+QN RLP Q V   LYY+Q ++R       S   D  S
Sbjct  423  DRKKVCSMMDFQKLSREARTHAAQNNRLPAQNVAQILYYEQQRLRDNMDGTGSVGSDSPS  482

Query  549  TPNAIATRNQLQADVT--------LVKENEALRTELLQMKMFIADMQNkggsqg---ssv  403
            TP+    RN   +++         L +ENE L+ E++++K+ I +M+     +    S +
Sbjct  483  TPD---KRNVYSSELYPATNEVSKLRRENEELKLEIVKLKIKIKEMEKSTVLESPINSPL  539

Query  402  kgssasaVRKP-----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  238
               S+ +  KP     +F +S+S+KLG+L+PF+         D  ++D    + RR+SIS
Sbjct  540  LNVSSPSADKPPLPRKSFLNSVSRKLGRLSPFQRAHPVIRPKDRIQLD----KIRRYSIS  595



>ref|XP_008457766.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X1 [Cucumis melo]
Length=621

 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 61/179 (34%), Positives = 91/179 (51%), Gaps = 25/179 (14%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR---SGAEDPKSTP  544
            ++ER+KVCS+MD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R   +G+      P
Sbjct  446  DMERKKVCSLMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGSPTGVEVP  505

Query  543  NAIATRNQLQADV-------------TLVKENEALRTELLQMKMFIADMQN-kggsqgss  406
               A  +   A+               L +EN+ L+ EL++MKM + + +     S  ++
Sbjct  506  TVPAKLSIYSAETAAAAAHPVSDELSILRRENQDLKLELVKMKMKMREFEKPSISSPQTN  565

Query  405  vkgssasaVRKP-----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFS  244
             +    +   KP     +F +S+SK+LG+L PF      TS    G V   K RR   S
Sbjct  566  TRLQPTTTAEKPPLPKKSFINSVSKRLGRLYPFVRADGVTSK---GRVRPAKDRRHSIS  621



>ref|XP_008457767.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X2 [Cucumis melo]
Length=620

 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 61/179 (34%), Positives = 91/179 (51%), Gaps = 25/179 (14%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR---SGAEDPKSTP  544
            ++ER+KVCS+MD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R   +G+      P
Sbjct  445  DMERKKVCSLMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGSPTGVEVP  504

Query  543  NAIATRNQLQADV-------------TLVKENEALRTELLQMKMFIADMQN-kggsqgss  406
               A  +   A+               L +EN+ L+ EL++MKM + + +     S  ++
Sbjct  505  TVPAKLSIYSAETAAAAAHPVSDELSILRRENQDLKLELVKMKMKMREFEKPSISSPQTN  564

Query  405  vkgssasaVRKP-----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFS  244
             +    +   KP     +F +S+SK+LG+L PF      TS    G V   K RR   S
Sbjct  565  TRLQPTTTAEKPPLPKKSFINSVSKRLGRLYPFVRADGVTSK---GRVRPAKDRRHSIS  620



>ref|XP_006841959.1| hypothetical protein AMTR_s00144p00020600 [Amborella trichopoda]
 gb|ERN03634.1| hypothetical protein AMTR_s00144p00020600 [Amborella trichopoda]
Length=609

 Score = 77.8 bits (190),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 53/145 (37%), Positives = 79/145 (54%), Gaps = 21/145 (14%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR-------------  574
            EIER+KVCS+MD  KLS EA  HA+QN RLPVQ V+  LYY+Q  +R             
Sbjct  448  EIERKKVCSLMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQSLRDAMNGNLTEKEEW  507

Query  573  -SGAEDPKSTPNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkg  397
             S +    +    ++  N+L   + L +ENE L+ E+++++M + +++        + K 
Sbjct  508  LSQSHKANAHSKDLSPHNEL---LLLRRENEDLKLEMVKLRMRLKELEKLEKPPNRANKP  564

Query  396  ssasaVRKPTFFSSMSKKLGKLNPF  322
                   K +  +SMSKKLGKL PF
Sbjct  565  PLP----KKSLLNSMSKKLGKLYPF  585



>ref|XP_006364419.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Solanum 
tuberosum]
Length=602

 Score = 77.4 bits (189),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 60/173 (35%), Positives = 93/173 (54%), Gaps = 28/173 (16%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDP  556
            ++ER+KVCSVM+  KL+ EA  HA+QN+RLPVQIV+  LYY+Q ++R        GA DP
Sbjct  428  DVERKKVCSVMNCQKLTREACAHAAQNERLPVQIVVQVLYYEQQRLREVMDVSLVGA-DP  486

Query  555  KSTPNAIATRNQLQADVT-----LVKENEALRTELLQMKMFIADMQNkggsqgssvkgss  391
             S P      +   + VT     L +EN+ L+ EL+++KM   +++ +     +S     
Sbjct  487  PSRPPKFNWFSSGISPVTDEVSSLKRENQDLKFELMKLKMKCREIEKRDDKSAASTPLGI  546

Query  390  as----aVRKP--TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRR  250
             +      R P  +F +++S+KLGKL P         +    EV I  P +R+
Sbjct  547  TTPPSDKPRLPRKSFITAVSRKLGKLYP---------SFGTDEVTIPSPSKRK  590



>ref|XP_006393938.1| hypothetical protein EUTSA_v10003858mg [Eutrema salsugineum]
 gb|ESQ31224.1| hypothetical protein EUTSA_v10003858mg [Eutrema salsugineum]
Length=603

 Score = 77.4 bits (189),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 56/154 (36%), Positives = 82/154 (53%), Gaps = 26/154 (17%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKST----  547
            ++ER+KVCS+MD  KLS EA  HA+QN RLPVQ ++  LYY+Q ++R    +   +    
Sbjct  431  DVERKKVCSLMDCQKLSREACAHAAQNDRLPVQTIVQVLYYEQQRLRGEVTNDSDSPPPP  490

Query  546  -------PNAIATRNQLQADVTLVKENEALRTELLQMKMFI------------ADMQNkg  424
                   P  +++ N   +   L +EN+ L+ ELL+MKM +              M +  
Sbjct  491  PPPATVLPPKLSSYNDELSK--LKRENQDLKLELLKMKMKLKEFEKESEKKSSTTMSSNP  548

Query  423  gsqgssvkgssasaVRKPTFFSSMSKKLGKLNPF  322
             S  S+         RK TF +S+S+KLGKLNPF
Sbjct  549  SSPISTASMDKPPLPRK-TFINSVSRKLGKLNPF  581



>dbj|BAJ34215.1| unnamed protein product [Thellungiella halophila]
Length=603

 Score = 77.4 bits (189),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 56/154 (36%), Positives = 82/154 (53%), Gaps = 26/154 (17%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKST----  547
            ++ER+KVCS+MD  KLS EA  HA+QN RLPVQ ++  LYY+Q ++R    +   +    
Sbjct  431  DVERKKVCSLMDCQKLSREACAHAAQNDRLPVQTIVQVLYYEQQRLRGEVTNDSDSPPPP  490

Query  546  -------PNAIATRNQLQADVTLVKENEALRTELLQMKMFI------------ADMQNkg  424
                   P  +++ N   +   L +EN+ L+ ELL+MKM +              M +  
Sbjct  491  PPPATVLPPKLSSYNDELSK--LKRENQDLKLELLKMKMKLKEFEKESEKKSSTTMSSNP  548

Query  423  gsqgssvkgssasaVRKPTFFSSMSKKLGKLNPF  322
             S  S+         RK TF +S+S+KLGKLNPF
Sbjct  549  SSPISTASMDKPPLPRK-TFINSVSRKLGKLNPF  581



>ref|XP_009379312.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X2 [Pyrus x bretschneideri]
Length=505

 Score = 77.0 bits (188),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 60/173 (35%), Positives = 88/173 (51%), Gaps = 16/173 (9%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS------GAEDP-  556
            ++ER+KVCS+MD  KLS EA  HA+QN RLPV  V+  LYY+Q ++R       G E   
Sbjct  333  DMERKKVCSMMDCQKLSREASAHAAQNDRLPVHTVVQVLYYEQQRLRDVMNGNIGGESSV  392

Query  555  -KSTPNAIATRNQLQAD--VTLVKENEALRTELLQMKMFIADMQNkggsqgssv-kgssa  388
              S  +  +T   +  D    L ++NE L+ EL +MKM + +++        S   G++ 
Sbjct  393  LPSKGSVYSTDVHMVPDELTILRRQNEELKIELGKMKMKLKELETSTARTAMSSPMGNTP  452

Query  387  saVRKP-----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFS  244
             +  KP     +F + +SK+LGKL+PF      T     G     K RR   S
Sbjct  453  ISADKPPLPRKSFMNLVSKRLGKLSPFVRADGVTPTGTKGRTKSAKDRRHSIS  505



>ref|XP_009630229.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Nicotiana tomentosiformis]
Length=618

 Score = 77.4 bits (189),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 58/168 (35%), Positives = 93/168 (55%), Gaps = 12/168 (7%)
 Frame = -2

Query  708  EREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAIAT  529
            ER++VCSVM+  KL+ EA  HA+QN+RLPVQ V+  LY++Q ++R   +   +  +  + 
Sbjct  452  ERKRVCSVMNCQKLTREACAHAAQNERLPVQTVVQVLYHEQQRLRQVMDGSLADADQSSA  511

Query  528  RNQLQAD--VTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssas-------aVR  376
             N    D   +L +EN+ L+ EL++MK  + +++  G    +S      +        +R
Sbjct  512  DNNPVTDEFSSLKRENQDLKFELVKMKTRLKEIEKCGDKSDASTPLEITTPISSDKPRLR  571

Query  375  KPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKP--RRRRFSIS  238
            + +F SS+S+KLGKL P   G+ D   +        KP  R RR+SIS
Sbjct  572  RKSFISSVSEKLGKLYPISFGA-DHVVMPSASKGRYKPISRYRRYSIS  618



>ref|NP_001152299.1| transposon protein Mutator sub-class [Zea mays]
 gb|ACG46890.1| transposon protein Mutator sub-class [Zea mays]
Length=597

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 53/144 (37%), Positives = 73/144 (51%), Gaps = 13/144 (9%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDP  556
            E ER+ VC VMD  KLS EA  HA+ N RLPVQ V+  L+++Q ++R        G E P
Sbjct  428  EAERKAVCRVMDCQKLSREACAHAAHNNRLPVQTVVQVLHHEQRRLREAPTSSFYGGESP  487

Query  555  KSTPNAIATRNQLQAD--VTLVKENEALRTELLQMKMFIAD----MQNkggsqgssvkgs  394
               P+      +   D    L +ENE L+ ELL++KM + D     Q             
Sbjct  488  TPAPSLQGRHGRSVPDEMSQLQRENEELKMELLRLKMNLRDPSAPPQPSDAPPSGRRPLP  547

Query  393  sasaVRKPTFFSSMSKKLGKLNPF  322
              +A     F +++SKKLG+LNPF
Sbjct  548  KKAAGGSGGFINNVSKKLGRLNPF  571



>ref|XP_009379310.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Pyrus x bretschneideri]
Length=625

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 60/173 (35%), Positives = 88/173 (51%), Gaps = 16/173 (9%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS------GAEDP-  556
            ++ER+KVCS+MD  KLS EA  HA+QN RLPV  V+  LYY+Q ++R       G E   
Sbjct  453  DMERKKVCSMMDCQKLSREASAHAAQNDRLPVHTVVQVLYYEQQRLRDVMNGNIGGESSV  512

Query  555  -KSTPNAIATRNQLQAD--VTLVKENEALRTELLQMKMFIADMQNkggsqgssv-kgssa  388
              S  +  +T   +  D    L ++NE L+ EL +MKM + +++        S   G++ 
Sbjct  513  LPSKGSVYSTDVHMVPDELTILRRQNEELKIELGKMKMKLKELETSTARTAMSSPMGNTP  572

Query  387  saVRKP-----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFS  244
             +  KP     +F + +SK+LGKL+PF      T     G     K RR   S
Sbjct  573  ISADKPPLPRKSFMNLVSKRLGKLSPFVRADGVTPTGTKGRTKSAKDRRHSIS  625



>ref|XP_010503666.1| PREDICTED: putative BTB/POZ domain-containing protein At3g49970 
[Camelina sativa]
Length=571

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 63/179 (35%), Positives = 94/179 (53%), Gaps = 30/179 (17%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAI  535
            E+E++KVCS+MD  KLS E   HA+QN RLPVQ V+  LYY+Q  +R    D  S P A 
Sbjct  403  EMEKKKVCSLMDCQKLSREKCAHAAQNDRLPVQTVVQVLYYEQQSLREILSDSDSPPAAA  462

Query  534  ATRN---------QLQADVT-LVKENEALRTELLQMKMFIADMQNkggsqgss-----vk  400
             T               D++ L +EN+ L+ EL+++KM   +++ +  +   +       
Sbjct  463  VTVEDTLTPPELRTYNNDLSKLNRENQDLKLELIKVKMKFKELEKEQKAFEVTSGSDCSS  522

Query  399  gssasaVRKP-----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  238
              S ++V KP     +F SS+S++LGKLN F  G +        +V    P+ RR SIS
Sbjct  523  SVSIASVVKPRLPRKSFMSSVSRQLGKLNLF--GQR--------QVQTKPPKGRRHSIS  571



>ref|XP_010939121.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Elaeis 
guineensis]
Length=606

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 59/170 (35%), Positives = 88/170 (52%), Gaps = 17/170 (10%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDP  556
            ++ER K+CS+MD  KLS EA  H ++N RLPV IV+  LYY+Q ++R        G E P
Sbjct  443  DMERRKICSLMDSQKLSREACAHVARNDRLPVPIVVQVLYYEQQRLRDVTSGNLIGGESP  502

Query  555  ----KSTPNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgssa  388
                K+T   I   N       L +EN+ L+ EL++++M + +++   G+  ++ K    
Sbjct  503  ALSQKATSYGIGYHNAPDELSRLRRENDDLKLELVRLRMQLKEIEKSSGNIAAADKPPLP  562

Query  387  saVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  238
                K +F  S+S KLG L  F H   DT  L   +     P+  R SIS
Sbjct  563  ----KKSFIHSISNKLGHLFAFMH--SDTVKLLSDKTRRKPPKVLRHSIS  606



>ref|NP_680473.2| phototropic-responsive NPH3-like protein [Arabidopsis thaliana]
 sp|Q66GP0.2|Y5738_ARATH RecName: Full=BTB/POZ domain-containing protein At5g67385 [Arabidopsis 
thaliana]
 gb|AED98336.1| phototropic-responsive NPH3-like protein [Arabidopsis thaliana]
Length=604

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 62/181 (34%), Positives = 93/181 (51%), Gaps = 28/181 (15%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAI  535
            ++ER+KVCS+MD  KLS EA  HA+QN RLPVQ ++  LYY+Q ++R    +   +P   
Sbjct  430  DVERKKVCSLMDCQKLSREACAHAAQNDRLPVQTIVQVLYYEQQRLRGEVTNDSDSPAPP  489

Query  534  ATRNQLQADVTLV----------KENEALRTELLQMKMFIADMQNkggsqgssvkgss--  391
              +        L           +EN+ L+ ELL+MKM + + + +   + SS   S+  
Sbjct  490  PPQPAAVLPPKLSSYTDELSKLKRENQDLKLELLKMKMKLKEFEKESEKKTSSSTISTNP  549

Query  390  -----asaVRKP-----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSI  241
                  ++  KP     +F +S+SKKLGKLNPF      +    +G      P+ RR SI
Sbjct  550  SSPISTASTGKPPLPRKSFINSVSKKLGKLNPF------SITPYNGRGRTKPPKDRRHSI  603

Query  240  S  238
            S
Sbjct  604  S  604



>gb|AAU05485.1| At5g67385 [Arabidopsis thaliana]
 gb|AAU95431.1| At5g67385 [Arabidopsis thaliana]
Length=604

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 62/181 (34%), Positives = 93/181 (51%), Gaps = 28/181 (15%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAI  535
            ++ER+KVCS+MD  KLS EA  HA+QN RLPVQ ++  LYY+Q ++R    +   +P   
Sbjct  430  DVERKKVCSLMDCQKLSREACAHAAQNDRLPVQTIVQVLYYEQQRLRGEVTNDSDSPAPP  489

Query  534  ATRNQLQADVTLV----------KENEALRTELLQMKMFIADMQNkggsqgssvkgss--  391
              +        L           +EN+ L+ ELL+MKM + + + +   + SS   S+  
Sbjct  490  PPQPAAVLPPKLSSYTDELSKLKRENQDLKLELLKMKMKLKEFEKESEKKTSSSTISTNP  549

Query  390  -----asaVRKP-----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSI  241
                  ++  KP     +F +S+SKKLGKLNPF      +    +G      P+ RR SI
Sbjct  550  SSPISTASTGKPPLPRKSFINSVSKKLGKLNPF------SITPYNGRGRTKPPKDRRHSI  603

Query  240  S  238
            S
Sbjct  604  S  604



>ref|XP_009130549.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ domain-containing protein 
At5g67385-like [Brassica rapa]
Length=600

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 60/187 (32%), Positives = 93/187 (50%), Gaps = 39/187 (21%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKST----  547
            ++ER+KVCS+MD  KLS EA  HA+QN RLPVQ ++  LYY+Q ++R    +   +    
Sbjct  425  DVERKKVCSLMDCQKLSREACAHAAQNDRLPVQTIVQVLYYEQQRLRGEVTNDSDSPAPP  484

Query  546  ----------PNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkg  397
                      P  +++ N   + V   +EN+ L+ ELL+MKM + + + +   + SS   
Sbjct  485  PPQPTATVLPPPKLSSYNDELSKVK--RENQDLKLELLKMKMKLKEFEKENNEKKSSTTT  542

Query  396  ssasaVRKP--------------TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPR  259
            + +S    P              +F +S+SKKLGKL PF    +  +           P+
Sbjct  543  TMSSNHSSPRSTASMDKPPLPRKSFINSVSKKLGKLXPFGIPPRGRTK---------PPK  593

Query  258  RRRFSIS  238
             RR SIS
Sbjct  594  DRRHSIS  600



>ref|XP_010484507.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Camelina sativa]
 ref|XP_010484508.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X1 [Camelina sativa]
Length=603

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 65/180 (36%), Positives = 95/180 (53%), Gaps = 27/180 (15%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGA-EDPKSTPNA  538
            ++ER+KVCS+MD  KLS EA  HA+QN RLPVQ ++  LYY+Q ++R     D  S    
Sbjct  430  DVERKKVCSLMDCQKLSREACAHAAQNDRLPVQTIVQVLYYEQQRLRGEVTNDSDSPAPP  489

Query  537  IATRNQLQADVT--------LVKENEALRTELLQMKMFIADMQNkggsqgssvkgss---  391
                  L   ++        L +EN+ L+ ELL+MKM + + + +   + SS   S+   
Sbjct  490  PPAAAVLPPKLSSYNDELSKLKRENQDLKLELLKMKMKLKEFEKESDKKSSSSTISTNPN  549

Query  390  ----asaVRKP-----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  238
                 +++ KP     +F +S+S+KLGKLNPF  G    S    G      P+ RR SIS
Sbjct  550  SPISTASMDKPPLPRKSFINSVSRKLGKLNPF--GITPYS----GRGRTKPPKDRRHSIS  603



>ref|XP_010484509.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like isoform 
X2 [Camelina sativa]
Length=548

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 65/180 (36%), Positives = 95/180 (53%), Gaps = 27/180 (15%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGA-EDPKSTPNA  538
            ++ER+KVCS+MD  KLS EA  HA+QN RLPVQ ++  LYY+Q ++R     D  S    
Sbjct  375  DVERKKVCSLMDCQKLSREACAHAAQNDRLPVQTIVQVLYYEQQRLRGEVTNDSDSPAPP  434

Query  537  IATRNQLQADVT--------LVKENEALRTELLQMKMFIADMQNkggsqgssvkgss---  391
                  L   ++        L +EN+ L+ ELL+MKM + + + +   + SS   S+   
Sbjct  435  PPAAAVLPPKLSSYNDELSKLKRENQDLKLELLKMKMKLKEFEKESDKKSSSSTISTNPN  494

Query  390  ----asaVRKP-----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  238
                 +++ KP     +F +S+S+KLGKLNPF  G    S    G      P+ RR SIS
Sbjct  495  SPISTASMDKPPLPRKSFINSVSRKLGKLNPF--GITPYS----GRGRTKPPKDRRHSIS  548



>ref|XP_010464139.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Camelina 
sativa]
Length=603

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 65/180 (36%), Positives = 95/180 (53%), Gaps = 27/180 (15%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGA-EDPKSTPNA  538
            ++ER+KVCS+MD  KLS EA  HA+QN RLPVQ ++  LYY+Q ++R     D  S    
Sbjct  430  DVERKKVCSLMDCQKLSREACAHAAQNDRLPVQTIVQVLYYEQQRLRGEVTNDSDSPAPP  489

Query  537  IATRNQLQADVT--------LVKENEALRTELLQMKMFIADMQNkggsqgssvkgss---  391
                  L   ++        L +EN+ L+ ELL+MKM + + + +   + SS   S+   
Sbjct  490  PPAAAVLPPKLSSYNDELSKLKRENQDLKLELLKMKMKLKEFEKESDKKSSSSTISTNPN  549

Query  390  ----asaVRKP-----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSIS  238
                 +++ KP     +F +S+S+KLGKLNPF  G    S    G      P+ RR SIS
Sbjct  550  SPISTTSMDKPPLPRKSFINSVSRKLGKLNPF--GITPYS----GRGRTKPPKDRRHSIS  603



>ref|XP_006290338.1| hypothetical protein CARUB_v10016995mg [Capsella rubella]
 gb|EOA23236.1| hypothetical protein CARUB_v10016995mg [Capsella rubella]
Length=532

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 57/181 (31%), Positives = 96/181 (53%), Gaps = 34/181 (19%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR------------S  571
            E+E++KVCS++D  KLS E   HA+QN RLPVQ ++  LYY+Q  +R            +
Sbjct  364  EMEKKKVCSLIDCQKLSREKCAHAAQNDRLPVQTMVQVLYYEQQHLREILSESDSPAVAA  423

Query  570  GAEDPKSTPNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvkgss  391
             A D    P+ +++ N   + +   +EN+ L+ EL+++KM   +++ +   +  +     
Sbjct  424  TARDTLPPPDELSSYNNELSKLN--RENQDLKLELIKVKMKFKELEKEKAFEVLTSGSDC  481

Query  390  asa----------VRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSI  241
            +S+          +++ +F SS+S+KLGKLNPF         L  G+     P+ RR SI
Sbjct  482  SSSVSTASVVKPRLQRKSFISSISRKLGKLNPF--------GLKQGQTK--PPKGRRHSI  531

Query  240  S  238
            S
Sbjct  532  S  532



>ref|XP_004985270.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Setaria 
italica]
Length=614

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 66/189 (35%), Positives = 94/189 (50%), Gaps = 35/189 (19%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS------------  571
            E ER+KVC  MD  KLS EA  HA+QN RLPVQ V+  LY++Q ++R             
Sbjct  430  EPERKKVCKAMDCQKLSREACAHAAQNDRLPVQTVVQVLYHEQRRLREAPTHAPSGASSF  489

Query  570  -GAEDP------KSTPNAIATRNQLQA----DVT-LVKENEALRTELLQMKMFIADMQN-  430
             G E P      K TP+ +    +  A    +V+ L +EN+ L+ ELL++KM + D    
Sbjct  490  YGGESPPPSLPYKPTPSLMGRHARGGAAPAEEVSQLQRENDELKMELLRLKMRLRDPSAP  549

Query  429  kggsqgssvkgssasaVRKP----TFFSSMSKKLGKLNPF-KHGSKDTSNLDDGEVDITK  265
               +  +       S  +KP     F +++SKKLGKLNPF +H +         +V    
Sbjct  550  LPPTGAAPPPSGRHSMPKKPGAGGGFMNNVSKKLGKLNPFVRHDAMGVP-----KVRTKP  604

Query  264  PRRRRFSIS  238
            P+ RR SI 
Sbjct  605  PKDRRHSIG  613



>ref|XP_011099322.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Sesamum 
indicum]
Length=616

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 66/178 (37%), Positives = 96/178 (54%), Gaps = 25/178 (14%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR-----SGAEDP--  556
            ++ER+KVCSVMD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R     + +E P  
Sbjct  445  DMERKKVCSVMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLREVMDGNLSEAPAL  504

Query  555  ----KSTPNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQN--kggsqgssvkgs  394
                K +P +I          TL +EN+ L+ EL++MKM + +M+      S  S +  +
Sbjct  505  PAPSKLSPYSINVHPVNDEVSTLRRENQDLKLELVKMKMRLKEMEKPLSASSTPSPLAAA  564

Query  393  sasaVRKP-----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRR-RRFSIS  238
              +++ KP     +F SS+ KKLG+   F      +     G    TKP + RR SIS
Sbjct  565  RPTSLDKPPLPRKSFISSVGKKLGR---FIRADGISPQSSKGR---TKPAKDRRHSIS  616



>emb|CBI33715.3| unnamed protein product [Vitis vinifera]
Length=529

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 66/105 (63%), Gaps = 11/105 (10%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDP  556
            ++E++KVCS+MD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R        G E P
Sbjct  412  DMEKKKVCSLMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGSLMGGESP  471

Query  555  KSTPNAIATRNQLQ--AD--VTLVKENEALRTELLQMKMFIADMQ  433
               P +    N L   +D  ++L +ENE L+ EL++MKM + +++
Sbjct  472  AIPPKSNLFSNDLHPVSDELLSLRRENEDLKLELMKMKMRLKEIE  516



>ref|XP_002866705.1| signal transducer [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42964.1| signal transducer [Arabidopsis lyrata subsp. lyrata]
Length=604

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 62/181 (34%), Positives = 92/181 (51%), Gaps = 28/181 (15%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAI  535
            ++ER+KVCS+MD  KLS EA  HA+QN RLPVQ ++  LYY+Q ++R    +   +P   
Sbjct  430  DVERKKVCSLMDCQKLSREACAHAAQNDRLPVQTIVQVLYYEQQRLRGEVTNDSDSPAPP  489

Query  534  ATRNQLQADVTLV----------KENEALRTELLQMKMFIADMQNkggsqgssvkgss--  391
                       L           +EN+ L+ ELL+MKM + + + +   + SS   S+  
Sbjct  490  PPPPAAVLPPKLSSYTDELSKLKRENQDLKLELLKMKMKLKEFEKESEKKSSSSTISTNP  549

Query  390  -----asaVRKP-----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFSI  241
                  +++ KP     +F +S+SKKLGKLNPF           +G      P+ RR SI
Sbjct  550  SSPISTASMGKPPLPRKSFINSVSKKLGKLNPFGITPY------NGRGRTKPPKDRRHSI  603

Query  240  S  238
            S
Sbjct  604  S  604



>gb|EYU44474.1| hypothetical protein MIMGU_mgv1a027075mg [Erythranthe guttata]
Length=577

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 65/183 (36%), Positives = 91/183 (50%), Gaps = 30/183 (16%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS---TP  544
            ++ER+KVCSVMD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R   +   S   T 
Sbjct  401  DMERKKVCSVMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLREAVDGSSSLNDTS  460

Query  543  NAIATRNQLQADVTLV--------KENEALRTELLQMKMFIADMQN------------kg  424
               A       DV +V        KEN+ L+ EL++MKM + +++               
Sbjct  461  AIPAKPGPYSGDVHIVTDEVSSLRKENQDLKLELVKMKMRLNEIEKPSPTAFGSPSPATT  520

Query  423  gsqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRR-RRF  247
             S+  S        + K +F SS+SKKLG+   F      ++    G    TKP + RR 
Sbjct  521  VSRPGSADKPPLPPLPKKSFISSVSKKLGR---FIRADGLSAQGSRGR---TKPAKDRRH  574

Query  246  SIS  238
            SIS
Sbjct  575  SIS  577



>emb|CDY57361.1| BnaC08g48680D [Brassica napus]
Length=499

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 51/143 (36%), Positives = 79/143 (55%), Gaps = 13/143 (9%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKS--TPN  541
            E+E++K+CS+M+  KLS EA  H +QNKRLP Q +   L      + + A  P+S   P 
Sbjct  344  EVEKKKICSLMNSQKLSQEACAHVAQNKRLPQQSLRQVLCDSDSPVAATAIAPESPPPPT  403

Query  540  AIATRNQLQADVTLVKENEALRTELLQMKMFIADMQ--------Nkggsqgssvkgssas  385
              +  N+L     L +EN+ L+ ELL++KM + +++        +       S      S
Sbjct  404  LSSYNNELS---KLNRENQDLKLELLKVKMTLKELEREKDFEIKSCSDCSSVSTASVVKS  460

Query  384  aVRKPTFFSSMSKKLGKLNPFKH  316
             +R+ +F SS+S+KLGKLNPF H
Sbjct  461  PLRRKSFISSVSRKLGKLNPFGH  483



>ref|XP_011089989.1| PREDICTED: BTB/POZ domain-containing protein At3g44820-like [Sesamum 
indicum]
Length=628

 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 67/104 (64%), Gaps = 10/104 (10%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSG---------AE  562
            E ERE++CS++D  KLS +A  HASQN+RLP+++VL  L+++Q+++R+           E
Sbjct  450  EKEREQLCSIIDFQKLSIDACAHASQNERLPLRVVLQVLFFEQMQLRTALAGCLHLLDTE  509

Query  561  DPKSTPN-AIATRNQLQADVTLVKENEALRTELLQMKMFIADMQ  433
               + PN A   R Q    VT+V+EN+ L+T++ +M+  + +++
Sbjct  510  TAPAGPNEATGQRIQRDGWVTVVRENQVLKTDMERMRSRVVELE  553



>ref|XP_003520918.1| PREDICTED: BTB/POZ domain-containing protein At5g48800-like [Glycine 
max]
 gb|KHN29840.1| BTB/POZ domain-containing protein [Glycine soja]
Length=612

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 50/150 (33%), Positives = 85/150 (57%), Gaps = 25/150 (17%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS------GAEDPK  553
            +++++K+C ++D  KLS EA  HA+QN+RLPVQ ++  LY++QL++R+      G +DPK
Sbjct  442  DLDKKKLCKLIDFQKLSQEAGAHAAQNERLPVQSIVQVLYFEQLRLRNSLSCSYGEDDPK  501

Query  552  -----------STPNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgss  406
                       +   A++ R+      +L +EN  L+ EL +++M + D++         
Sbjct  502  PIHQSWRISSGALSAAMSPRDNY---ASLRRENRELKLELARLRMRLNDLER---EHVCM  555

Query  405  vkgssasaVRKPTFFSSMSKKLGKLNPFKH  316
             +  + S  RK  F SS SKK+GKL+ F H
Sbjct  556  KRDMAKSGSRK--FMSSFSKKIGKLSLFGH  583



>ref|XP_008368005.1| PREDICTED: BTB/POZ domain-containing protein At5g67385-like [Malus 
domestica]
Length=232

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 59/176 (34%), Positives = 89/176 (51%), Gaps = 20/176 (11%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS------GAED--  559
            ++ER+KVCS+MD   LS EA  HA+QN RLPV  V+  LYY+Q ++R       G E   
Sbjct  60   DMERKKVCSMMDCQXLSREACXHAAQNDRLPVHTVVQVLYYEQQRLRDVMNGNIGGESSV  119

Query  558  --PKSTPNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssv-kgssa  388
               K + ++            L ++N  L+ EL++MKM + +++        S   G++ 
Sbjct  120  LPSKGSVHSTDIHTVPDELTILRRQNAELKIELVKMKMKLKELETSTMRTAMSSPMGNTP  179

Query  387  saVRKP-----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRR-RRFSIS  238
             +  KP     +F + +SK+LG L+PF      T     G    TKP + RR SIS
Sbjct  180  ISADKPPLPRKSFMNLVSKRLGXLSPFVRADGVTPTGTKGR---TKPSKDRRHSIS  232



>ref|XP_003558544.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Brachypodium 
distachyon]
Length=625

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 62/190 (33%), Positives = 84/190 (44%), Gaps = 36/190 (19%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS------------  571
            E ER+KVC VMD  KLS EA  HA+QN RLPVQ V+  LY++Q ++R+            
Sbjct  441  EGERKKVCGVMDCQKLSREACAHAAQNDRLPVQTVVQVLYHEQRRLRASQTPSHSQAPSY  500

Query  570  ---GAEDPK-STPNAIATRNQLQADVT-------LVKENEALRTELLQMKMFIADMQNkg  424
               G E P  S   +   R++     +       L +EN+ LR EL+QMKM + D     
Sbjct  501  AGGGGESPALSYKPSFNGRDRSAPSPSSSSEMSRLQRENDELRLELMQMKMRLRDPSAAP  560

Query  423  gsqgssvkgssasaVRKP--------TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDIT  268
                      ++     P               KKLG+LNPF   S     +   +V   
Sbjct  561  PVAAGRGGAPASGKPPLPKKQGGAGGGGGGGFMKKLGRLNPFVRDS-----VGGAKVRAK  615

Query  267  KPRRRRFSIS  238
             P+ RR SIS
Sbjct  616  PPKDRRHSIS  625



>gb|KJB43883.1| hypothetical protein B456_007G221600 [Gossypium raimondii]
Length=375

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 53/151 (35%), Positives = 85/151 (56%), Gaps = 20/151 (13%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAI  535
            ++ER+KVCS+MD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R       S+  + 
Sbjct  203  DLERKKVCSLMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGSMSSGTSP  262

Query  534  ATRNQLQ----ADV--------TLVKENEALRTELLQMKMFIADMQNkggsqgssvkgss  391
            +  +++      D+        +L +ENE L+ EL++MKM + +++    +  S+     
Sbjct  263  SISSRVNLYPPTDIHPVSDELSSLKRENEDLKLELVKMKMRLKEIERPSSAVPSAASSPM  322

Query  390  as---aVRKP-----TFFSSMSKKLGKLNPF  322
                 +  KP     +F +S+SKKLG+L PF
Sbjct  323  GIIVPSSDKPPLPRKSFMNSVSKKLGRLYPF  353



>ref|XP_007133999.1| hypothetical protein PHAVU_010G010500g [Phaseolus vulgaris]
 gb|ESW05993.1| hypothetical protein PHAVU_010G010500g [Phaseolus vulgaris]
Length=610

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/150 (33%), Positives = 85/150 (57%), Gaps = 25/150 (17%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS------GAEDPK  553
            +++++K+C ++D  KLS EA  HA+QN+RLP+Q ++  LY++QL++R+      G +DPK
Sbjct  440  DLDKKKLCRLIDFQKLSQEAGAHAAQNERLPLQSIVQVLYFEQLRLRNSLSCSFGEDDPK  499

Query  552  -----------STPNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgss  406
                       +   A++ R+      +L +EN  L+ EL +++M + D++         
Sbjct  500  PIHQSWRISSGALSAAMSPRDNY---ASLRRENRELKLELARLRMRLNDLER---EHACM  553

Query  405  vkgssasaVRKPTFFSSMSKKLGKLNPFKH  316
             +  + S  RK  F SS SKK+GKL+ F H
Sbjct  554  KRDMAKSGSRK--FMSSFSKKIGKLSLFGH  581



>gb|KJB43882.1| hypothetical protein B456_007G221600 [Gossypium raimondii]
 gb|KJB43884.1| hypothetical protein B456_007G221600 [Gossypium raimondii]
Length=487

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 53/151 (35%), Positives = 85/151 (56%), Gaps = 20/151 (13%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAI  535
            ++ER+KVCS+MD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R       S+  + 
Sbjct  315  DLERKKVCSLMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGSMSSGTSP  374

Query  534  ATRNQLQ----ADV--------TLVKENEALRTELLQMKMFIADMQNkggsqgssvkgss  391
            +  +++      D+        +L +ENE L+ EL++MKM + +++    +  S+     
Sbjct  375  SISSRVNLYPPTDIHPVSDELSSLKRENEDLKLELVKMKMRLKEIERPSSAVPSAASSPM  434

Query  390  as---aVRKP-----TFFSSMSKKLGKLNPF  322
                 +  KP     +F +S+SKKLG+L PF
Sbjct  435  GIIVPSSDKPPLPRKSFMNSVSKKLGRLYPF  465



>gb|KJB43880.1| hypothetical protein B456_007G221600 [Gossypium raimondii]
Length=611

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 53/151 (35%), Positives = 85/151 (56%), Gaps = 20/151 (13%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAI  535
            ++ER+KVCS+MD  KLS EA  HA+QN RLPVQ V+  LYY+Q ++R       S+  + 
Sbjct  439  DLERKKVCSLMDCQKLSREACAHAAQNDRLPVQTVVQVLYYEQQRLRDVMNGSMSSGTSP  498

Query  534  ATRNQLQ----ADV--------TLVKENEALRTELLQMKMFIADMQNkggsqgssvkgss  391
            +  +++      D+        +L +ENE L+ EL++MKM + +++    +  S+     
Sbjct  499  SISSRVNLYPPTDIHPVSDELSSLKRENEDLKLELVKMKMRLKEIERPSSAVPSAASSPM  558

Query  390  as---aVRKP-----TFFSSMSKKLGKLNPF  322
                 +  KP     +F +S+SKKLG+L PF
Sbjct  559  GIIVPSSDKPPLPRKSFMNSVSKKLGRLYPF  589



>ref|XP_011089103.1| PREDICTED: BTB/POZ domain-containing protein At5g48800 [Sesamum 
indicum]
Length=612

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 49/148 (33%), Positives = 81/148 (55%), Gaps = 25/148 (17%)
 Frame = -2

Query  708  EREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGA------EDPK--  553
            +R K+C ++D  KLS EA  HA+QN+RLP+Q ++  LYY+QL++R+        EDPK  
Sbjct  444  DRRKLCKLIDFQKLSQEAGAHAAQNERLPLQSIVQVLYYEQLRLRNALFCSHPDEDPKPM  503

Query  552  ---------STPNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvk  400
                     +   A++ R+      +L +EN  L+ EL +++M + D++          +
Sbjct  504  HQSWRISSGALSAAMSPRDNY---ASLRRENRELKLELARLRMRLNDLEK---EHVCMKR  557

Query  399  gssasaVRKPTFFSSMSKKLGKLNPFKH  316
                S+ RK  F SS ++++GKLN F H
Sbjct  558  NMERSSSRK--FISSFTRRIGKLNIFAH  583



>ref|XP_006280202.1| hypothetical protein CARUB_v10026107mg [Capsella rubella]
 gb|EOA13100.1| hypothetical protein CARUB_v10026107mg [Capsella rubella]
Length=605

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 64/182 (35%), Positives = 93/182 (51%), Gaps = 29/182 (16%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGA-EDPKSTPNA  538
            ++ER+KVCS+MD  KLS EA  HA+QN RLPVQ ++  LYY+Q ++R    +D  S    
Sbjct  430  DVERKKVCSLMDCQKLSREACAHAAQNDRLPVQTIVQVLYYEQQRLRGEVTKDADSPAPP  489

Query  537  IATRNQLQADVTLV----------KENEALRTELLQMKMFIADMQNkggsqgssvkgss-  391
                        L           +EN+ L+ ELL+MKM + + + +   + SS   S+ 
Sbjct  490  PPAVAAAVLPPKLSSYNDELSKLKRENQDLKLELLKMKMKLKEFEKESEKKSSSSTISTN  549

Query  390  ------asaVRKP-----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRRFS  244
                   +++ KP     +F +S+S+KLGKLNPF  G    S    G      P+ RR S
Sbjct  550  PNSPISTASMDKPPLPRKSFINSVSRKLGKLNPF--GITPYS----GRGRTKPPKDRRHS  603

Query  243  IS  238
            IS
Sbjct  604  IS  605



>ref|XP_004233453.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X1 [Solanum lycopersicum]
Length=605

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 58/176 (33%), Positives = 91/176 (52%), Gaps = 31/176 (18%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDP  556
            ++ER+KVCSVM+  KL+ EA  HA+QN RLPVQIV+  LYY+Q ++R        GA DP
Sbjct  428  DVERKKVCSVMNCQKLTREACAHAAQNDRLPVQIVVQVLYYEQQRLRQVMDVSLVGA-DP  486

Query  555  KSTPNAIATRNQLQADV--------TLVKENEALRTELLQMKMFIADMQNkggsqgssvk  400
               P   +  N   + +        +L +EN+ L+ EL+++KM   +++       +S  
Sbjct  487  PLPPPRPSKFNWFSSGISPVTDEISSLKRENQDLKFELMKLKMKCREIEKCDDKSAASTP  546

Query  399  gssas----aVRKP--TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRR  250
                +      R P  +F +++S+KLGKL P         +    EV I  P +R+
Sbjct  547  LGITTPPSDKPRLPRKSFITAVSRKLGKLYP---------SFGADEVTIPSPSKRK  593



>ref|XP_010317168.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 isoform 
X2 [Solanum lycopersicum]
Length=570

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 58/176 (33%), Positives = 91/176 (52%), Gaps = 31/176 (18%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS-------GAEDP  556
            ++ER+KVCSVM+  KL+ EA  HA+QN RLPVQIV+  LYY+Q ++R        GA DP
Sbjct  393  DVERKKVCSVMNCQKLTREACAHAAQNDRLPVQIVVQVLYYEQQRLRQVMDVSLVGA-DP  451

Query  555  KSTPNAIATRNQLQADV--------TLVKENEALRTELLQMKMFIADMQNkggsqgssvk  400
               P   +  N   + +        +L +EN+ L+ EL+++KM   +++       +S  
Sbjct  452  PLPPPRPSKFNWFSSGISPVTDEISSLKRENQDLKFELMKLKMKCREIEKCDDKSAASTP  511

Query  399  gssas----aVRKP--TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRRR  250
                +      R P  +F +++S+KLGKL P         +    EV I  P +R+
Sbjct  512  LGITTPPSDKPRLPRKSFITAVSRKLGKLYP---------SFGADEVTIPSPSKRK  558



>ref|XP_010685004.1| PREDICTED: BTB/POZ domain-containing protein At5g48800 [Beta 
vulgaris subsp. vulgaris]
Length=610

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 50/147 (34%), Positives = 79/147 (54%), Gaps = 19/147 (13%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS--GAEDPKSTPN  541
            + ++ K+C ++D  KLS EA  HA+QN+RLP+Q ++  LY++QL++R+  G   P+  P 
Sbjct  442  DADKRKLCKMIDFQKLSQEAGAHAAQNERLPLQSIVQVLYFEQLRLRNALGCSLPEEEPK  501

Query  540  AI-----ATRNQLQADV-------TLVKENEALRTELLQMKMFIADMQNkggsqgssvkg  397
             +          L A +       +L +EN  L+ EL +M+M + D++          + 
Sbjct  502  PMFHSWRVNSGALSASMSPKDNYASLRRENRELKLELARMRMRLNDLEK---DHVCMKRT  558

Query  396  ssasaVRKPTFFSSMSKKLGKLNPFKH  316
               S  RK  F SS SKKLGKL+ F H
Sbjct  559  MQKSGSRK--FMSSFSKKLGKLSFFGH  583



>ref|XP_007201187.1| hypothetical protein PRUPE_ppa002993mg [Prunus persica]
 gb|EMJ02386.1| hypothetical protein PRUPE_ppa002993mg [Prunus persica]
Length=614

 Score = 71.6 bits (174),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 49/149 (33%), Positives = 83/149 (56%), Gaps = 24/149 (16%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR-----SGAEDPK-  553
            + +++K+C ++D  KLS EA  HA+QN+RLP+Q ++  LY++Q+++R     SG ++PK 
Sbjct  445  DTDKKKLCKMIDFQKLSQEAGAHAAQNERLPLQSIVQVLYFEQIRLRNSLGCSGEDEPKP  504

Query  552  ----------STPNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssv  403
                      +   A++ R+      +L +EN  L+ EL +++M + D++          
Sbjct  505  MHQSWRISSGALSAAMSPRDNY---ASLRRENRELKLELARLRMRLNDLER---EHVCMK  558

Query  402  kgssasaVRKPTFFSSMSKKLGKLNPFKH  316
            +    S  RK  F SS SKKLGKL+ F H
Sbjct  559  RDMEKSNSRK--FMSSFSKKLGKLSFFGH  585



>ref|XP_006650337.1| PREDICTED: BTB/POZ domain-containing protein At1g30440-like [Oryza 
brachyantha]
Length=624

 Score = 71.2 bits (173),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 35/104 (34%), Positives = 63/104 (61%), Gaps = 10/104 (10%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGA----------  565
            E ERE++C +MD  KLS EA  HA+QN+RLP+++V+  L+++QL++R+            
Sbjct  447  EAEREQLCRLMDCQKLSLEACTHAAQNERLPLRVVVQVLFFEQLQLRTSIAGCLLVSDNL  506

Query  564  EDPKSTPNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQ  433
            E  +   + IAT  +     T V+EN+ L+  +  M+M +++++
Sbjct  507  EGSRPLRSGIATSGEAGGWATAVRENQVLKVGMDNMRMRLSELE  550



>gb|AFK45576.1| unknown [Medicago truncatula]
Length=468

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 32/32 (100%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLP  622
            DEIEREKVCSVMDPLKLSYEARVHASQNKRLP
Sbjct  415  DEIEREKVCSVMDPLKLSYEARVHASQNKRLP  446



>ref|XP_009103425.1| PREDICTED: BTB/POZ domain-containing protein At5g67385 [Brassica 
rapa]
Length=601

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 58/185 (31%), Positives = 86/185 (46%), Gaps = 35/185 (19%)
 Frame = -2

Query  717  DEIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNA  538
            +++E++KVCS+MD  KLS EA  HA+QN RLPVQ ++  LYY+Q ++R    +       
Sbjct  427  NDVEKKKVCSLMDCQKLSREACAHAAQNDRLPVQTIVQVLYYEQQRLRGEVTNDSEALPP  486

Query  537  IATRNQLQADVT-------------LVKENEALRTELLQMKM-------FIADMQNkggs  418
                    A V              L +EN+ L+ E+L+MKM             +    
Sbjct  487  QPPPPAAAATVLPPKLSSYNDELSKLKRENQDLKLEILKMKMKLKEFEKENEKKSSSTAM  546

Query  417  qgssvkgssasaVRKP-----TFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRR  253
              +     S +++ KP     +F +S+S+KLGKLNPF      T            P+ R
Sbjct  547  SSNHSSPISTASMDKPPLPRKSFMNSVSRKLGKLNPFGITPGRTK----------PPKDR  596

Query  252  RFSIS  238
            R SIS
Sbjct  597  RHSIS  601



>ref|XP_004982336.1| PREDICTED: uncharacterized protein LOC101754459 [Setaria italica]
Length=1185

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 35/104 (34%), Positives = 62/104 (60%), Gaps = 10/104 (10%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGA----------  565
            E ERE++C ++D  KLS EA  HA+QN+RLP+++V+  L+++QL +R+            
Sbjct  446  EAEREQLCRLLDCQKLSLEACTHAAQNERLPLRVVVQVLFFEQLHLRTSIAGCLLVSDNL  505

Query  564  EDPKSTPNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQ  433
            E  +   + IAT  +     T V+EN+ L+  +  M+M +A+++
Sbjct  506  EGSRPLRSGIATSGEAGGWATAVRENQVLKVGMDNMRMRLAELE  549



>ref|XP_008235484.1| PREDICTED: BTB/POZ domain-containing protein At5g48800 [Prunus 
mume]
Length=614

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 83/149 (56%), Gaps = 24/149 (16%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR-----SGAEDPK-  553
            + +++K+C ++D  KLS EA  HA+QN+RLP+Q ++  LY++Q+++R     SG ++PK 
Sbjct  445  DTDKKKLCKMIDFQKLSQEAGAHAAQNERLPLQSIVQVLYFEQIRLRNSLGCSGEDEPKP  504

Query  552  ----------STPNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssv  403
                      +   A++ R+      +L +EN  L+ EL +++M + D++          
Sbjct  505  MHQSWRISSGALSAAMSPRDNY---ASLRRENRELKLELARLRMRLNDLER---EHVCMK  558

Query  402  kgssasaVRKPTFFSSMSKKLGKLNPFKH  316
            +    S  RK  F SS SKK+GKL+ F H
Sbjct  559  RDMEKSNSRK--FMSSFSKKIGKLSFFGH  585



>ref|XP_003561994.1| PREDICTED: BTB/POZ domain-containing protein At1g30440-like [Brachypodium 
distachyon]
Length=624

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/104 (34%), Positives = 63/104 (61%), Gaps = 10/104 (10%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGA----------  565
            E ERE++C +MD  KLS EA  HA+QN+RLP+++V+  L+++QL++R+            
Sbjct  447  EAEREQLCRLMDCQKLSLEACTHAAQNERLPLRVVVQVLFFEQLQLRTSIAGCLLVSDNL  506

Query  564  EDPKSTPNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQ  433
            E  +   + IAT  +     T V+EN+ L+  +  M++ +A+++
Sbjct  507  ERSRPLRSGIATSGEAGGWTTAVRENQVLKVGMDNMRIRLAELE  550



>emb|CDY12841.1| BnaC07g15920D [Brassica napus]
Length=603

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 60/185 (32%), Positives = 84/185 (45%), Gaps = 37/185 (20%)
 Frame = -2

Query  714  EIEREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRSGAEDPKSTPNAI  535
            ++E++KVCS+MD  KLS EA  HA+QN RLPVQ ++  LYY+Q ++R    +        
Sbjct  430  DVEKKKVCSLMDCQKLSREACAHAAQNDRLPVQTIVQVLYYEQQRLRGEVTNDSEALPPQ  489

Query  534  ATRNQLQADVT-------------LVKENEALRTELLQMKM-------------FIADMQ  433
                   A V              L +EN+ L+ E+L+MKM                 M 
Sbjct  490  PPPPAAAATVLPPKLSSYNDELSKLKRENQDLKLEILKMKMKLKEFEKENEKKSLSTTMS  549

Query  432  NkggsqgssvkgssasaVRKPTFFSSMSKKLGKLNPFKHGSKDTSNLDDGEVDITKPRRR  253
            +   S  S+         RK +F +S+S+KLGKLNPF      T            P+ R
Sbjct  550  SNHSSPISTASMDKPPLPRK-SFMNSVSRKLGKLNPFGITPGRTK----------PPKDR  598

Query  252  RFSIS  238
            R SIS
Sbjct  599  RHSIS  603



>ref|XP_006349069.1| PREDICTED: BTB/POZ domain-containing protein At3g44820-like isoform 
X2 [Solanum tuberosum]
Length=522

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 66/106 (62%), Gaps = 14/106 (13%)
 Frame = -2

Query  708  EREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR-------------SG  568
            E+E++C+++D  KLS +A  HASQN RLP+++VL  L+++QL++R             SG
Sbjct  344  EKEQLCNIIDFQKLSIDACAHASQNDRLPLRVVLQVLFFEQLQLRTALAGCFQVLDTESG  403

Query  567  AEDPKSTPNAIATR-NQLQADVTLVKENEALRTELLQMKMFIADMQ  433
               P + P+ +A +  Q    VT+V+EN+ L+ +L +MK  + +++
Sbjct  404  PAAPVTGPSDMAGQIVQRDGWVTVVRENQGLKVDLERMKSRVGELE  449



>ref|XP_006349068.1| PREDICTED: BTB/POZ domain-containing protein At3g44820-like isoform 
X1 [Solanum tuberosum]
Length=631

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 66/106 (62%), Gaps = 14/106 (13%)
 Frame = -2

Query  708  EREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR-------------SG  568
            E+E++C+++D  KLS +A  HASQN RLP+++VL  L+++QL++R             SG
Sbjct  453  EKEQLCNIIDFQKLSIDACAHASQNDRLPLRVVLQVLFFEQLQLRTALAGCFQVLDTESG  512

Query  567  AEDPKSTPNAIATR-NQLQADVTLVKENEALRTELLQMKMFIADMQ  433
               P + P+ +A +  Q    VT+V+EN+ L+ +L +MK  + +++
Sbjct  513  PAAPVTGPSDMAGQIVQRDGWVTVVRENQGLKVDLERMKSRVGELE  558



>ref|XP_004251006.1| PREDICTED: BTB/POZ domain-containing protein At3g44820 [Solanum 
lycopersicum]
Length=631

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 65/106 (61%), Gaps = 14/106 (13%)
 Frame = -2

Query  708  EREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIR-------------SG  568
            E+E++C+++D  KLS +A  HASQN RLP+++VL  L++ QL++R             SG
Sbjct  453  EKEQLCNIIDCQKLSIDACAHASQNDRLPLRVVLQVLFFGQLQLRTAVAGRFQVLDTESG  512

Query  567  AEDPKSTPNAIATR-NQLQADVTLVKENEALRTELLQMKMFIADMQ  433
               P + P+ +A +  Q    VT+V+EN+ L+ +L +MK  + +++
Sbjct  513  PAAPVTGPSDMAGQIVQRDGWVTVVRENQGLKVDLERMKSRVGELE  558



>gb|KDP26391.1| hypothetical protein JCGZ_17549 [Jatropha curcas]
Length=619

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/148 (33%), Positives = 81/148 (55%), Gaps = 25/148 (17%)
 Frame = -2

Query  708  EREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS------GAEDPK--  553
            +R+K+C ++D  KLS EA  HA+QN+RLP+Q ++  LY++Q+++R+      G ED K  
Sbjct  451  DRKKLCKLIDFQKLSQEAGAHAAQNERLPLQAIVQVLYFEQIRLRNALCCSYGEEDHKPM  510

Query  552  ---------STPNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvk  400
                     +   A++ R+      +L +EN  L+ EL +++M + D++          +
Sbjct  511  HQSWRISSGALSAAMSPRDNY---ASLRRENRELKLELARLRMRLNDLEK---EHVCMKR  564

Query  399  gssasaVRKPTFFSSMSKKLGKLNPFKH  316
                S  RK  F SS SKK+GKL+ F H
Sbjct  565  DMQKSHSRK--FMSSFSKKIGKLSFFGH  590



>ref|XP_002521098.1| protein binding protein, putative [Ricinus communis]
 gb|EEF41249.1| protein binding protein, putative [Ricinus communis]
Length=610

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/148 (33%), Positives = 81/148 (55%), Gaps = 25/148 (17%)
 Frame = -2

Query  708  EREKVCSVMDPLKLSYEARVHASQNKRLPVQIVLHALYYDQLKIRS------GAEDPK--  553
            +R+K+C ++D  KLS EA  HA+QN+RLP+Q ++  LY++Q+++R+      G ED K  
Sbjct  442  DRKKLCKLIDFQKLSQEAGAHAAQNERLPLQAIVQVLYFEQIRLRNALCCPYGDEDHKPM  501

Query  552  ---------STPNAIATRNQLQADVTLVKENEALRTELLQMKMFIADMQNkggsqgssvk  400
                     +   A++ R+      +L +EN  L+ EL +++M + D++          +
Sbjct  502  HQSWRISSGALSAAMSPRDNY---ASLRRENRELKLELARLRMRLNDLEK---EHVCMKR  555

Query  399  gssasaVRKPTFFSSMSKKLGKLNPFKH  316
                S  RK  F SS SKK+GKL+ F H
Sbjct  556  EMQKSHSRK--FMSSFSKKIGKLSFFGH  581



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1260188911410