BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF008K19

Length=650
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009758209.1|  PREDICTED: WD repeat-containing protein 26-l...    211   6e-61   Nicotiana sylvestris
emb|CDP17860.1|  unnamed protein product                                211   1e-60   Coffea canephora [robusta coffee]
ref|XP_009758206.1|  PREDICTED: WD repeat-containing protein 26-l...    210   1e-60   Nicotiana sylvestris
ref|XP_009631029.1|  PREDICTED: WD repeat-containing protein 26-l...    209   2e-60   Nicotiana tomentosiformis
ref|XP_009631025.1|  PREDICTED: WD repeat-containing protein 26-l...    209   6e-60   Nicotiana tomentosiformis
ref|XP_009618673.1|  PREDICTED: WD repeat-containing protein 26-like    208   1e-59   Nicotiana tomentosiformis
gb|KDO44760.1|  hypothetical protein CISIN_1g009188mg                   205   8e-59   Citrus sinensis [apfelsine]
ref|XP_009765608.1|  PREDICTED: WD repeat-containing protein 26-l...    204   1e-58   Nicotiana sylvestris
ref|XP_006484997.1|  PREDICTED: WD repeat-containing protein 26-l...    205   1e-58   Citrus sinensis [apfelsine]
ref|XP_006437085.1|  hypothetical protein CICLE_v10031058mg             205   1e-58   
ref|XP_009765607.1|  PREDICTED: WD repeat-containing protein 26-l...    205   1e-58   Nicotiana sylvestris
ref|XP_010657105.1|  PREDICTED: WD repeat-containing protein 26-like    204   2e-58   
emb|CBI22069.3|  unnamed protein product                                201   3e-58   Vitis vinifera
ref|XP_003532075.1|  PREDICTED: WD repeat-containing protein 26-like    201   3e-57   Glycine max [soybeans]
ref|XP_006354306.1|  PREDICTED: WD repeat-containing protein 26-like    200   8e-57   Solanum tuberosum [potatoes]
ref|XP_009780908.1|  PREDICTED: WD repeat-containing protein 26-like    199   2e-56   Nicotiana sylvestris
ref|XP_004149517.1|  PREDICTED: WD repeat-containing protein 26-like    199   3e-56   Cucumis sativus [cucumbers]
ref|XP_009608371.1|  PREDICTED: WD repeat-containing protein 26-l...    198   3e-56   Nicotiana tomentosiformis
ref|XP_008342331.1|  PREDICTED: WD repeat-containing protein 26-like    198   4e-56   Malus domestica [apple tree]
ref|XP_002306758.1|  hypothetical protein POPTR_0005s22820g             198   5e-56   Populus trichocarpa [western balsam poplar]
gb|KDP29808.1|  hypothetical protein JCGZ_19323                         198   7e-56   Jatropha curcas
ref|XP_009608368.1|  PREDICTED: WD repeat-containing protein 26-l...    197   7e-56   Nicotiana tomentosiformis
ref|XP_006602271.1|  PREDICTED: WD repeat-containing protein 26-l...    197   8e-56   Glycine max [soybeans]
ref|XP_006602270.1|  PREDICTED: WD repeat-containing protein 26-l...    197   2e-55   Glycine max [soybeans]
ref|XP_008229590.1|  PREDICTED: WD repeat-containing protein 26-like    196   2e-55   Prunus mume [ume]
ref|XP_004491280.1|  PREDICTED: WD repeat-containing protein 26-like    196   2e-55   Cicer arietinum [garbanzo]
ref|XP_004243618.1|  PREDICTED: WD repeat-containing protein 26         196   3e-55   Solanum lycopersicum
gb|KHG12711.1|  wdr26                                                   196   3e-55   Gossypium arboreum [tree cotton]
ref|XP_007048928.1|  Transducin family protein / WD-40 repeat fam...    196   4e-55   Theobroma cacao [chocolate]
ref|XP_009377000.1|  PREDICTED: WD repeat-containing protein 26-like    195   5e-55   Pyrus x bretschneideri [bai li]
ref|XP_010321118.1|  PREDICTED: WD repeat-containing protein 26 i...    195   6e-55   Solanum lycopersicum
ref|XP_011026207.1|  PREDICTED: WD repeat-containing protein 26-like    195   6e-55   Populus euphratica
ref|XP_007048927.1|  Transducin family protein / WD-40 repeat fam...    196   7e-55   
gb|KJB33386.1|  hypothetical protein B456_006G008900                    194   8e-55   Gossypium raimondii
ref|XP_006366633.1|  PREDICTED: WD repeat-containing protein 26-like    195   8e-55   Solanum tuberosum [potatoes]
ref|XP_004239311.1|  PREDICTED: WD repeat-containing protein 26 i...    193   2e-54   Solanum lycopersicum
ref|XP_003617329.1|  WD-repeat protein-like protein                     194   2e-54   Medicago truncatula
gb|KJB33387.1|  hypothetical protein B456_006G008900                    194   2e-54   Gossypium raimondii
ref|XP_004239310.1|  PREDICTED: WD repeat-containing protein 26 i...    194   2e-54   Solanum lycopersicum
ref|XP_003545311.1|  PREDICTED: WD repeat-containing protein 26-like    193   2e-54   Glycine max [soybeans]
ref|XP_002302127.1|  hypothetical protein POPTR_0002s05670g             193   3e-54   Populus trichocarpa [western balsam poplar]
ref|XP_003519528.1|  PREDICTED: WD repeat-containing protein 26-like    193   3e-54   Glycine max [soybeans]
ref|XP_004303899.1|  PREDICTED: WD repeat-containing protein 26         191   2e-53   Fragaria vesca subsp. vesca
ref|XP_008380168.1|  PREDICTED: WD repeat-containing protein 26-like    191   2e-53   
gb|KHG30817.1|  WD repeat-containing 26                                 190   3e-53   Gossypium arboreum [tree cotton]
ref|XP_009356585.1|  PREDICTED: WD repeat-containing protein 26-like    190   5e-53   Pyrus x bretschneideri [bai li]
ref|XP_011085429.1|  PREDICTED: WD repeat-containing protein 26-like    189   1e-52   Sesamum indicum [beniseed]
gb|KHN38353.1|  WD repeat-containing protein 26                         189   1e-52   Glycine soja [wild soybean]
ref|XP_009405376.1|  PREDICTED: WD repeat-containing protein 26-like    188   2e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010256452.1|  PREDICTED: WD repeat-containing protein 26 i...    188   3e-52   Nelumbo nucifera [Indian lotus]
ref|XP_010256454.1|  PREDICTED: WD repeat-containing protein 26 i...    187   3e-52   Nelumbo nucifera [Indian lotus]
gb|KEH33653.1|  transducin/WD40 repeat protein                          186   1e-51   Medicago truncatula
ref|XP_007146281.1|  hypothetical protein PHAVU_006G027500g             186   1e-51   Phaseolus vulgaris [French bean]
ref|XP_009419551.1|  PREDICTED: WD repeat-containing protein 26-like    185   2e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010054068.1|  PREDICTED: WD repeat-containing protein 26         186   2e-51   Eucalyptus grandis [rose gum]
gb|KJB48956.1|  hypothetical protein B456_008G095100                    185   3e-51   Gossypium raimondii
ref|XP_011100498.1|  PREDICTED: WD repeat-containing protein 26-l...    184   3e-51   Sesamum indicum [beniseed]
ref|XP_011100492.1|  PREDICTED: WD repeat-containing protein 26-l...    185   4e-51   Sesamum indicum [beniseed]
ref|XP_006448496.1|  hypothetical protein CICLE_v10014731mg             184   5e-51   Citrus clementina [clementine]
ref|XP_006468682.1|  PREDICTED: WD repeat-containing protein 26-l...    184   5e-51   Citrus sinensis [apfelsine]
ref|XP_010680145.1|  PREDICTED: uncharacterized WD repeat-contain...    184   7e-51   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007141447.1|  hypothetical protein PHAVU_008G196400g             184   8e-51   Phaseolus vulgaris [French bean]
ref|XP_008775985.1|  PREDICTED: WD repeat-containing protein 26-like    183   2e-50   Phoenix dactylifera
ref|XP_004499533.1|  PREDICTED: WD repeat-containing protein 26-l...    181   4e-50   Cicer arietinum [garbanzo]
ref|XP_007043170.1|  Transducin family protein / WD-40 repeat fam...    182   4e-50   
ref|XP_004499532.1|  PREDICTED: WD repeat-containing protein 26-l...    181   7e-50   Cicer arietinum [garbanzo]
ref|XP_010093188.1|  WD repeat-containing protein 26                    181   8e-50   
ref|XP_004171491.1|  PREDICTED: WD repeat-containing protein 26-like    181   1e-49   
ref|XP_010943696.1|  PREDICTED: uncharacterized WD repeat-contain...    179   5e-49   Elaeis guineensis
gb|KJB47107.1|  hypothetical protein B456_008G011600                    178   1e-48   Gossypium raimondii
gb|KJB47106.1|  hypothetical protein B456_008G011600                    178   1e-48   Gossypium raimondii
gb|EYU42814.1|  hypothetical protein MIMGU_mgv1a003386mg                176   1e-48   Erythranthe guttata [common monkey flower]
ref|XP_004162570.1|  PREDICTED: WD repeat-containing protein 26-like    177   2e-48   
ref|XP_004149516.1|  PREDICTED: WD repeat-containing protein 26-like    177   2e-48   
ref|XP_008466801.1|  PREDICTED: uncharacterized WD repeat-contain...    177   2e-48   Cucumis melo [Oriental melon]
ref|XP_002513152.1|  WD-repeat protein, putative                        177   2e-48   Ricinus communis
gb|EYU42813.1|  hypothetical protein MIMGU_mgv1a003386mg                177   3e-48   Erythranthe guttata [common monkey flower]
gb|EPS60063.1|  hypothetical protein M569_14740                         177   3e-48   Genlisea aurea
gb|KHG19792.1|  WD repeat-containing 26                                 175   8e-48   Gossypium arboreum [tree cotton]
ref|XP_008221109.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    174   2e-47   Prunus mume [ume]
gb|KDP40461.1|  hypothetical protein JCGZ_24460                         171   2e-47   Jatropha curcas
ref|XP_010103563.1|  WD repeat-containing protein 26                    175   3e-47   
ref|XP_010906218.1|  PREDICTED: WD repeat-containing protein 26-like    174   4e-47   Elaeis guineensis
ref|XP_010908947.1|  PREDICTED: uncharacterized WD repeat-contain...    167   4e-47   
ref|XP_007222293.1|  hypothetical protein PRUPE_ppa003324mg             174   4e-47   
ref|XP_008790475.1|  PREDICTED: WD repeat-containing protein 26-like    174   5e-47   Phoenix dactylifera
gb|EYU42800.1|  hypothetical protein MIMGU_mgv1a003351mg                173   7e-47   Erythranthe guttata [common monkey flower]
ref|XP_006351997.1|  PREDICTED: WD repeat-containing protein 26-l...    173   1e-46   Solanum tuberosum [potatoes]
gb|EAY85451.1|  hypothetical protein OsI_06831                          171   3e-46   Oryza sativa Indica Group [Indian rice]
gb|EAZ22671.1|  hypothetical protein OsJ_06341                          171   4e-46   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001132804.1|  hypothetical protein                               165   5e-46   
ref|XP_006647187.1|  PREDICTED: WD repeat-containing protein 26-like    169   3e-45   Oryza brachyantha
ref|XP_008676636.1|  PREDICTED: hypothetical protein isoform X2         166   4e-45   
ref|XP_002270103.1|  PREDICTED: WD repeat-containing protein 26         168   5e-45   Vitis vinifera
emb|CBI35349.3|  unnamed protein product                                167   5e-45   Vitis vinifera
ref|XP_006399358.1|  hypothetical protein EUTSA_v10013060mg             168   6e-45   Eutrema salsugineum [saltwater cress]
ref|XP_004972947.1|  PREDICTED: WD repeat-containing protein 26-like    168   7e-45   Setaria italica
ref|NP_196473.1|  WD40 domain-containing protein                        168   7e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008676635.1|  PREDICTED: hypothetical protein isoform X1         167   1e-44   Zea mays [maize]
ref|NP_001159293.1|  hypothetical protein                               161   1e-44   
dbj|BAK03563.1|  predicted protein                                      166   3e-44   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009412042.1|  PREDICTED: WD repeat-containing protein 26-like    165   6e-44   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT24581.1|  hypothetical protein F775_29927                         165   6e-44   
ref|XP_003578602.1|  PREDICTED: WD repeat-containing protein 26         165   9e-44   Brachypodium distachyon [annual false brome]
ref|XP_008647995.1|  PREDICTED: uncharacterized protein LOC100304...    164   1e-43   
ref|XP_006845990.1|  hypothetical protein AMTR_s00155p00039520          164   2e-43   Amborella trichopoda
ref|XP_002873372.1|  transducin family protein                          163   4e-43   
ref|XP_010491500.1|  PREDICTED: WD repeat-containing protein 26-like    163   4e-43   Camelina sativa [gold-of-pleasure]
ref|XP_006287344.1|  hypothetical protein CARUB_v10000543mg             162   6e-43   Capsella rubella
ref|XP_009131082.1|  PREDICTED: WD repeat-containing protein 26-like    162   6e-43   Brassica rapa
emb|CDX78343.1|  BnaA03g02550D                                          162   7e-43   
emb|CDY21550.1|  BnaC09g47420D                                          162   8e-43   Brassica napus [oilseed rape]
ref|XP_004253388.2|  PREDICTED: WD repeat-containing protein 26-like    160   8e-43   Solanum lycopersicum
ref|XP_010423053.1|  PREDICTED: WD repeat-containing protein 26-like    162   1e-42   Camelina sativa [gold-of-pleasure]
ref|XP_009122471.1|  PREDICTED: WD repeat-containing protein 26         161   2e-42   Brassica rapa
ref|XP_010456450.1|  PREDICTED: WD repeat-containing protein 26-like    159   3e-42   
emb|CDX81113.1|  BnaC03g03670D                                          159   7e-42   
gb|ABR16581.1|  unknown                                                 156   9e-41   Picea sitchensis
ref|XP_002982745.1|  hypothetical protein SELMODRAFT_268628             153   1e-39   
ref|XP_010546278.1|  PREDICTED: WD repeat-containing protein 26-like    153   1e-39   Tarenaya hassleriana [spider flower]
gb|EYU42858.1|  hypothetical protein MIMGU_mgv1a022069mg                150   1e-39   Erythranthe guttata [common monkey flower]
gb|EMT06242.1|  hypothetical protein F775_31507                         152   2e-39   
ref|XP_011033097.1|  PREDICTED: WD repeat-containing protein 26-like    152   2e-39   Populus euphratica
ref|XP_002311889.2|  hypothetical protein POPTR_0008s00330g             152   3e-39   
ref|XP_002990891.1|  hypothetical protein SELMODRAFT_161256             152   3e-39   
gb|EMS67128.1|  WD repeat-containing protein 26                         152   4e-39   Triticum urartu
ref|XP_006854396.1|  hypothetical protein AMTR_s00039p00186000          151   5e-39   Amborella trichopoda
ref|XP_011032764.1|  PREDICTED: WD repeat-containing protein 26-like    150   1e-38   Populus euphratica
ref|XP_001770300.1|  predicted protein                                  149   3e-38   
ref|XP_001771286.1|  predicted protein                                  149   4e-38   
tpg|DAA49690.1|  TPA: hypothetical protein ZEAMMB73_458845              139   2e-36   
ref|XP_002464509.1|  hypothetical protein SORBIDRAFT_01g019860          144   2e-36   Sorghum bicolor [broomcorn]
ref|XP_010522523.1|  PREDICTED: WD repeat-containing protein 26         140   2e-35   Tarenaya hassleriana [spider flower]
gb|KGN58314.1|  hypothetical protein Csa_3G611390                       134   2e-35   Cucumis sativus [cucumbers]
ref|XP_008664897.1|  PREDICTED: WD repeat-containing protein 26-l...    140   2e-35   Zea mays [maize]
gb|EYU42819.1|  hypothetical protein MIMGU_mgv1a005559mg                140   3e-35   Erythranthe guttata [common monkey flower]
ref|XP_004982941.1|  PREDICTED: WD repeat-containing protein 26-like    140   3e-35   Setaria italica
ref|XP_002865396.1|  transducin family protein                          140   4e-35   
ref|XP_008664896.1|  PREDICTED: WD repeat-containing protein 26-l...    139   6e-35   Zea mays [maize]
ref|XP_006280295.1|  hypothetical protein CARUB_v10026218mg             139   7e-35   
ref|XP_004173151.1|  PREDICTED: WD repeat-containing protein 26-like    134   8e-35   
gb|AAP54181.2|  WD-repeat protein 26, putative, expressed               134   9e-35   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006403164.1|  hypothetical protein EUTSA_v10003179mg             139   1e-34   Eutrema salsugineum [saltwater cress]
ref|XP_006280294.1|  hypothetical protein CARUB_v10026218mg             138   2e-34   Capsella rubella
ref|XP_009792757.1|  PREDICTED: WD repeat-containing protein 26 i...    137   4e-34   Nicotiana sylvestris
ref|NP_199205.1|  transducin/WD40 domain-containing protein             137   5e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009113968.1|  PREDICTED: WD repeat-containing protein 26         137   5e-34   Brassica rapa
ref|XP_006355901.1|  PREDICTED: WD repeat-containing protein 26-like    137   5e-34   Solanum tuberosum [potatoes]
emb|CDY41528.1|  BnaA06g22810D                                          136   6e-34   Brassica napus [oilseed rape]
ref|XP_009792756.1|  PREDICTED: WD repeat-containing protein 26 i...    136   7e-34   Nicotiana sylvestris
ref|NP_001064796.1|  Os10g0465000                                       134   7e-34   
ref|XP_003574020.1|  PREDICTED: WD repeat-containing protein 26         136   8e-34   Brachypodium distachyon [annual false brome]
ref|XP_010441956.1|  PREDICTED: WD repeat-containing protein 26         136   8e-34   
ref|XP_009150419.1|  PREDICTED: WD repeat-containing protein 26-like    136   8e-34   
ref|XP_010494385.1|  PREDICTED: WD repeat-containing protein 26-l...    136   9e-34   Camelina sativa [gold-of-pleasure]
ref|XP_010494383.1|  PREDICTED: WD repeat-containing protein 26-l...    136   9e-34   Camelina sativa [gold-of-pleasure]
ref|XP_006281895.1|  hypothetical protein CARUB_v10028093mg             136   1e-33   
ref|XP_010481799.1|  PREDICTED: WD repeat-containing protein 26-l...    135   1e-33   Camelina sativa [gold-of-pleasure]
emb|CDX84431.1|  BnaC03g50690D                                          135   1e-33   
ref|XP_002866568.1|  hypothetical protein ARALYDRAFT_919661             135   1e-33   Arabidopsis lyrata subsp. lyrata
gb|KFK31679.1|  hypothetical protein AALP_AA6G145100                    135   1e-33   Arabis alpina [alpine rockcress]
ref|XP_009370775.1|  PREDICTED: WD repeat-containing protein 26         135   2e-33   Pyrus x bretschneideri [bai li]
ref|XP_007162638.1|  hypothetical protein PHAVU_001G167600g             135   2e-33   Phaseolus vulgaris [French bean]
emb|CDY13140.1|  BnaA09g16770D                                          137   3e-33   Brassica napus [oilseed rape]
ref|XP_636788.1|  hypothetical protein DDB_G0288313                     137   4e-33   Dictyostelium discoideum AX4
ref|XP_009629555.1|  PREDICTED: WD repeat-containing protein 26 i...    134   4e-33   Nicotiana tomentosiformis
gb|EEE51100.1|  hypothetical protein OsJ_31819                          134   4e-33   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010684801.1|  PREDICTED: WD repeat-containing protein 26         134   5e-33   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004345356.1|  hypothetical protein ACA1_355860                   134   5e-33   Acanthamoeba castellanii str. Neff
gb|EEC67126.1|  hypothetical protein OsI_33942                          134   5e-33   Oryza sativa Indica Group [Indian rice]
ref|XP_009629554.1|  PREDICTED: WD repeat-containing protein 26 i...    134   7e-33   Nicotiana tomentosiformis
ref|XP_009386572.1|  PREDICTED: WD repeat-containing protein 26         133   1e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008447357.1|  PREDICTED: LOW QUALITY PROTEIN: WD repeat-co...    133   1e-32   Cucumis melo [Oriental melon]
gb|EFA80856.1|  hypothetical protein PPL_06445                          135   1e-32   Heterostelium album PN500
emb|CDY36957.1|  BnaC09g17730D                                          135   1e-32   Brassica napus [oilseed rape]
ref|XP_008382686.1|  PREDICTED: WD repeat-containing protein 26         132   2e-32   
ref|XP_004495043.1|  PREDICTED: WD repeat-containing protein 26-like    131   3e-32   Cicer arietinum [garbanzo]
ref|XP_004247123.1|  PREDICTED: WD repeat-containing protein 26         131   3e-32   Solanum lycopersicum
ref|XP_006443707.1|  hypothetical protein CICLE_v10019514mg             132   4e-32   Citrus clementina [clementine]
gb|KDO60331.1|  hypothetical protein CISIN_1g042434mg                   131   6e-32   Citrus sinensis [apfelsine]
gb|KJE91550.1|  hypothetical protein CAOG_009572                        134   7e-32   Capsaspora owczarzaki ATCC 30864
ref|XP_011083080.1|  PREDICTED: WD repeat-containing protein 26         129   2e-31   Sesamum indicum [beniseed]
ref|XP_010918959.1|  PREDICTED: WD repeat-containing protein 26         129   4e-31   Elaeis guineensis
emb|CDP03813.1|  unnamed protein product                                127   9e-31   Coffea canephora [robusta coffee]
ref|XP_004349429.2|  WD repeat-containing protein                       128   9e-31   Capsaspora owczarzaki ATCC 30864
gb|EXX54855.1|  glucose-induced degradation complex subunit GID7        127   1e-30   Rhizophagus irregularis DAOM 197198w
ref|XP_003286147.1|  hypothetical protein DICPUDRAFT_46602              130   1e-30   Dictyostelium purpureum
gb|EYU17955.1|  hypothetical protein MIMGU_mgv1a004677mg                127   1e-30   Erythranthe guttata [common monkey flower]
gb|KHF98324.1|  WD repeat-containing 26                                 127   2e-30   Gossypium arboreum [tree cotton]
gb|KJB26051.1|  hypothetical protein B456_004G222700                    127   2e-30   Gossypium raimondii
ref|XP_008775134.1|  PREDICTED: WD repeat-containing protein 26         126   2e-30   Phoenix dactylifera
ref|XP_010264797.1|  PREDICTED: WD repeat-containing protein 26 i...    126   3e-30   Nelumbo nucifera [Indian lotus]
ref|XP_010264796.1|  PREDICTED: WD repeat-containing protein 26 i...    126   3e-30   Nelumbo nucifera [Indian lotus]
ref|XP_010264794.1|  PREDICTED: WD repeat-containing protein 26 i...    126   3e-30   Nelumbo nucifera [Indian lotus]
ref|XP_010264795.1|  PREDICTED: WD repeat-containing protein 26 i...    126   3e-30   Nelumbo nucifera [Indian lotus]
ref|XP_010040357.1|  PREDICTED: WD repeat-containing protein 26-like    126   3e-30   
ref|XP_002533626.1|  WD-repeat protein, putative                        126   3e-30   Ricinus communis
gb|KHN02443.1|  WD repeat-containing protein 26                         126   3e-30   Glycine soja [wild soybean]
ref|XP_003554312.1|  PREDICTED: WD repeat-containing protein 26-like    126   3e-30   
ref|XP_010069704.1|  PREDICTED: WD repeat-containing protein 26-like    126   3e-30   Eucalyptus grandis [rose gum]
gb|KEH42443.1|  transducin/WD40 repeat protein                          126   4e-30   Medicago truncatula
ref|XP_008235562.1|  PREDICTED: WD repeat-containing protein 26         126   4e-30   Prunus mume [ume]
ref|XP_007201159.1|  hypothetical protein PRUPE_ppa004283mg             125   5e-30   
ref|XP_010091833.1|  WD repeat-containing protein 26                    125   1e-29   Morus notabilis
ref|XP_002321301.2|  hypothetical protein POPTR_0014s18590g             123   2e-29   
gb|EYU42822.1|  hypothetical protein MIMGU_mgv1a024382mg                123   2e-29   Erythranthe guttata [common monkey flower]
gb|KDP26444.1|  hypothetical protein JCGZ_17602                         123   2e-29   Jatropha curcas
ref|XP_004356287.1|  WD repeat protein                                  125   4e-29   Cavenderia fasciculata
ref|XP_006681031.1|  hypothetical protein BATDEDRAFT_20488              123   5e-29   Batrachochytrium dendrobatidis JAM81
gb|KHN09401.1|  WD repeat-containing protein 26                         122   5e-29   Glycine soja [wild soybean]
ref|XP_004292253.1|  PREDICTED: WD repeat-containing protein 26         122   9e-29   Fragaria vesca subsp. vesca
ref|XP_011118606.1|  hypothetical protein AOL_s00007g403                122   1e-28   Arthrobotrys oligospora ATCC 24927
ref|XP_011035629.1|  PREDICTED: WD repeat-containing protein 26 i...    121   1e-28   Populus euphratica
ref|XP_005765500.1|  hypothetical protein EMIHUDRAFT_452007             121   2e-28   Emiliania huxleyi CCMP1516
ref|XP_005763815.1|  hypothetical protein EMIHUDRAFT_452457             120   2e-28   Emiliania huxleyi CCMP1516
gb|KFH66422.1|  hypothetical protein MVEG_06947                         121   3e-28   Mortierella verticillata NRRL 6337
gb|ESA15537.1|  hypothetical protein GLOINDRAFT_65155                   120   3e-28   
gb|EWC47369.1|  hypothetical protein DRE_00337                          120   5e-28   Drechslerella stenobrocha 248
ref|XP_011111734.1|  hypothetical protein H072_5931                     120   7e-28   
ref|XP_010481800.1|  PREDICTED: WD repeat-containing protein 26-l...    119   8e-28   Camelina sativa [gold-of-pleasure]
ref|XP_011035628.1|  PREDICTED: WD repeat-containing protein 26 i...    118   2e-27   Populus euphratica
emb|CBI37215.3|  unnamed protein product                                118   2e-27   Vitis vinifera
ref|XP_007873440.1|  hypothetical protein PNEG_01500                    119   2e-27   Pneumocystis murina B123
ref|XP_002835107.1|  hypothetical protein                               120   2e-27   Tuber melanosporum Mel28
ref|XP_005646513.1|  WD40 repeat-like protein                           119   2e-27   Coccomyxa subellipsoidea C-169
ref|XP_002268789.2|  PREDICTED: WD repeat-containing protein 26         118   4e-27   Vitis vinifera
ref|XP_001984905.1|  GH16747                                            118   7e-27   Drosophila grimshawi
ref|XP_007216565.1|  hypothetical protein PRUPE_ppb014596mg             109   7e-27   
dbj|GAM21975.1|  hypothetical protein SAMD00019534_051500               118   8e-27   Acytostelium subglobosum LB1
ref|XP_002028320.1|  GL11887                                            116   1e-26   
ref|XP_002315365.1|  hypothetical protein POPTR_0010s26090g             116   1e-26   Populus trichocarpa [western balsam poplar]
ref|XP_011046605.1|  PREDICTED: WD repeat-containing protein 26         116   1e-26   Populus euphratica
ref|XP_001841859.1|  WD repeat protein 26                               117   1e-26   Culex quinquefasciatus
ref|XP_009014778.1|  hypothetical protein HELRODRAFT_76512              116   2e-26   Helobdella robusta
ref|XP_001354118.1|  GA20480                                            117   2e-26   Drosophila pseudoobscura pseudoobscura
ref|XP_002047612.1|  GJ11835                                            117   2e-26   
ref|XP_005834116.1|  hypothetical protein GUITHDRAFT_137736             116   3e-26   Guillardia theta CCMP2712
ref|XP_002040820.1|  GM22377                                            116   3e-26   Drosophila sechellia
ref|XP_002095310.1|  GE19765                                            116   3e-26   Drosophila yakuba
ref|XP_001973639.1|  GG16194                                            116   3e-26   Drosophila erecta
ref|NP_649326.1|  CG7611, isoform A                                     116   3e-26   Drosophila melanogaster
ref|XP_001958025.1|  GF23722                                            116   3e-26   Drosophila ananassae
ref|XP_002008397.1|  GI13472                                            116   4e-26   
ref|XP_002065853.1|  GK20426                                            116   4e-26   
emb|CDS03587.1|  hypothetical protein LRAMOSA00989                      115   5e-26   Lichtheimia ramosa
ref|XP_001652036.1|  AAEL006552-PA                                      116   6e-26   
gb|EYU42820.1|  hypothetical protein MIMGU_mgv1a018113mg                114   6e-26   Erythranthe guttata [common monkey flower]
ref|XP_007407038.1|  hypothetical protein MELLADRAFT_47296              113   6e-26   Melampsora larici-populina 98AG31
emb|CDH48456.1|  wd repeat protein                                      114   9e-26   Lichtheimia corymbifera JMRC:FSU:9682
gb|EYU42859.1|  hypothetical protein MIMGU_mgv1a005363mg                113   1e-25   Erythranthe guttata [common monkey flower]
gb|EYU42862.1|  hypothetical protein MIMGU_mgv1a021742mg                113   1e-25   Erythranthe guttata [common monkey flower]
emb|CCJ31009.1|  unnamed protein product                                113   1e-25   Pneumocystis jirovecii
ref|XP_002399371.1|  guanine nucleotide bionding protein beta sub...    114   2e-25   Ixodes scapularis [blacklegged tick]
ref|XP_004522495.1|  PREDICTED: WD repeat-containing protein 26 h...    112   2e-25   
gb|KIJ89403.1|  hypothetical protein K443DRAFT_687289                   107   3e-25   Laccaria amethystina LaAM-08-1
ref|NP_001172908.1|  Os02g0294600                                       106   3e-25   
ref|XP_009484194.1|  PREDICTED: WD repeat-containing protein 26         105   3e-25   Pelecanus crispus
gb|KIJ35759.1|  hypothetical protein M422DRAFT_61256                    112   3e-25   Sphaerobolus stellatus SS14
emb|CDY39855.1|  BnaC02g42630D                                          110   4e-25   Brassica napus [oilseed rape]
ref|XP_005851148.1|  hypothetical protein CHLNCDRAFT_7805               111   4e-25   Chlorella variabilis
emb|CCX10487.1|  Similar to WD repeat-containing protein 26; acc....    112   4e-25   Pyronema omphalodes CBS 100304
ref|XP_008294937.1|  PREDICTED: WD repeat-containing protein 26 i...    112   4e-25   Stegastes partitus
gb|EMD38068.1|  hypothetical protein CERSUDRAFT_152691                  113   5e-25   Gelatoporia subvermispora B
ref|XP_002167481.2|  PREDICTED: WD repeat-containing protein 26-like    113   5e-25   
gb|ABR26083.1|  wd-repeat protein 26                                    104   6e-25   Oryza sativa Indica Group [Indian rice]
gb|EYU42861.1|  hypothetical protein MIMGU_mgv1a020302mg                111   6e-25   Erythranthe guttata [common monkey flower]
gb|KFM70871.1|  WD repeat-containing protein 26                         110   7e-25   Stegodyphus mimosarum
ref|XP_011208078.1|  PREDICTED: WD repeat-containing protein 26 h...    112   7e-25   Bactrocera dorsalis [papaya fruit fly]
ref|XP_316089.4|  AGAP006042-PB                                         113   8e-25   Anopheles gambiae str. PEST
ref|XP_011196945.1|  PREDICTED: WD repeat-containing protein 26 h...    112   9e-25   Zeugodacus cucurbitae [melon fruit fly]
gb|KFB44976.1|  AGAP006042-PB-like protein                              113   9e-25   Anopheles sinensis
ref|XP_007863276.1|  WD40 repeat-like protein                           112   9e-25   Gloeophyllum trabeum ATCC 11539
gb|KIP06034.1|  hypothetical protein PHLGIDRAFT_477468                  112   1e-24   Phlebiopsis gigantea 11061_1 CR5-6
gb|EAW69722.1|  WD repeat domain 26, isoform CRA_c                      107   1e-24   Homo sapiens [man]
ref|XP_005177242.1|  PREDICTED: WD repeat-containing protein 26 h...    111   1e-24   Musca domestica
gb|EPT04084.1|  hypothetical protein FOMPIDRAFT_1141576                 112   1e-24   Fomitopsis pinicola FP-58527 SS1
gb|ETN63144.1|  wd-repeat protein                                       112   1e-24   Anopheles darlingi [American malaria mosquito]
ref|XP_004904369.1|  PREDICTED: WD repeat-containing protein 26 i...    110   1e-24   
ref|XP_002131526.2|  PREDICTED: WD repeat-containing protein 26         110   2e-24   Ciona intestinalis [sea vase]
ref|XP_006818835.1|  PREDICTED: WD repeat-containing protein 26-like    110   2e-24   
emb|CEG62984.1|  hypothetical protein RMATCC62417_00203                 109   2e-24   
ref|XP_005538881.1|  hypothetical protein, conserved                    111   2e-24   
ref|XP_006806085.1|  PREDICTED: WD repeat-containing protein 26-like    110   3e-24   
ref|XP_001196719.2|  PREDICTED: WD repeat-containing protein 26-like    109   3e-24   
emb|CEG62983.1|  hypothetical protein RMATCC62417_00203                 109   3e-24   
gb|KDR73582.1|  hypothetical protein GALMADRAFT_620676                  110   3e-24   
ref|XP_006157333.1|  PREDICTED: WD repeat-containing protein 26         109   4e-24   
gb|KDQ60900.1|  hypothetical protein JAAARDRAFT_55637                   110   4e-24   
ref|XP_005106829.1|  PREDICTED: WD repeat-containing protein 26-like    110   4e-24   
gb|KFV42219.1|  WD repeat-containing protein 26                         108   4e-24   
ref|XP_009808864.1|  PREDICTED: WD repeat-containing protein 26         108   4e-24   
ref|XP_006009002.1|  PREDICTED: WD repeat-containing protein 26         108   4e-24   
gb|EGW07609.1|  WD repeat-containing protein 26                         108   4e-24   
ref|XP_005409277.1|  PREDICTED: WD repeat-containing protein 26 i...    108   4e-24   
emb|CAG14617.1|  unnamed protein product                                108   4e-24   
gb|EAW69724.1|  WD repeat domain 26, isoform CRA_e                      108   4e-24   
ref|XP_006746504.1|  PREDICTED: WD repeat-containing protein 26         107   5e-24   
dbj|BAG61262.1|  unnamed protein product                                108   5e-24   
ref|XP_009923318.1|  PREDICTED: WD repeat-containing protein 26 i...    108   5e-24   
gb|KFO25370.1|  WD repeat-containing protein 26                         110   5e-24   
ref|XP_004761945.1|  PREDICTED: WD repeat-containing protein 26 i...    108   5e-24   
ref|XP_007530227.1|  PREDICTED: WD repeat-containing protein 26 i...    110   5e-24   
ref|XP_009993069.1|  PREDICTED: WD repeat-containing protein 26         108   5e-24   
ref|XP_007530226.1|  PREDICTED: WD repeat-containing protein 26 i...    110   5e-24   
dbj|BAB14955.1|  unnamed protein product                                107   5e-24   
gb|AAH31471.2|  WDR26 protein                                           107   5e-24   
gb|AAH63817.2|  WDR26 protein                                           107   6e-24   
ref|XP_008942903.1|  PREDICTED: WD repeat-containing protein 26         108   6e-24   
gb|AAH20044.2|  Wdr26 protein                                           107   6e-24   
ref|XP_784365.3|  PREDICTED: WD repeat-containing protein 26-like       109   6e-24   
ref|XP_009935639.1|  PREDICTED: WD repeat-containing protein 26         108   6e-24   
gb|AAH58601.1|  Wdr26 protein                                           108   6e-24   
ref|XP_005289643.1|  PREDICTED: WD repeat-containing protein 26 i...    108   6e-24   
ref|XP_010141755.1|  PREDICTED: WD repeat-containing protein 26         108   6e-24   
ref|XP_009975342.1|  PREDICTED: WD repeat-containing protein 26         108   6e-24   
ref|XP_005241902.1|  PREDICTED: WD repeat-containing protein 26         108   6e-24   
ref|XP_006133476.1|  PREDICTED: WD repeat-containing protein 26 i...    108   6e-24   
ref|XP_005459453.1|  PREDICTED: WD repeat-containing protein 26-l...    109   6e-24   
ref|XP_003791057.1|  PREDICTED: WD repeat-containing protein 26         110   6e-24   
ref|XP_010082833.1|  PREDICTED: WD repeat-containing protein 26         108   6e-24   
ref|XP_009684905.1|  PREDICTED: WD repeat-containing protein 26         108   6e-24   
ref|XP_006033427.1|  PREDICTED: WD repeat-containing protein 26 i...    108   6e-24   
ref|XP_005511389.1|  PREDICTED: WD repeat-containing protein 26         108   6e-24   
ref|XP_010021553.1|  PREDICTED: LOW QUALITY PROTEIN: WD repeat-co...    108   6e-24   
ref|XP_002197206.2|  PREDICTED: WD repeat-containing protein 26         108   7e-24   
ref|XP_005043087.1|  PREDICTED: WD repeat-containing protein 26 i...    108   7e-24   
ref|XP_003335516.1|  hypothetical protein PGTG_16959                    110   7e-24   
ref|XP_004626953.1|  PREDICTED: WD repeat-containing protein 26 i...    108   7e-24   
gb|KFU87472.1|  WD repeat-containing protein 26                         108   7e-24   
ref|XP_005690574.1|  PREDICTED: WD repeat-containing protein 26 i...    108   7e-24   
ref|XP_009272118.1|  PREDICTED: WD repeat-containing protein 26 i...    108   7e-24   
gb|KFW03020.1|  WD repeat-containing protein 26                         108   7e-24   
ref|XP_010215569.1|  PREDICTED: WD repeat-containing protein 26         108   7e-24   
ref|XP_003275121.1|  PREDICTED: WD repeat-containing protein 26 i...    108   7e-24   
ref|XP_006133475.1|  PREDICTED: WD repeat-containing protein 26 i...    108   7e-24   
gb|KFQ36019.1|  WD repeat-containing protein 26                         108   7e-24   
ref|XP_007647767.1|  PREDICTED: WD repeat-containing protein 26 i...    108   7e-24   
ref|XP_005043088.1|  PREDICTED: WD repeat-containing protein 26 i...    108   7e-24   
gb|KFQ44907.1|  WD repeat-containing protein 26                         108   7e-24   
ref|XP_008266576.1|  PREDICTED: WD repeat-containing protein 26         108   7e-24   
ref|XP_005947327.1|  PREDICTED: WD repeat-containing protein 26-like    109   7e-24   
ref|XP_009272115.1|  PREDICTED: WD repeat-containing protein 26 i...    108   7e-24   
gb|KFQ19813.1|  WD repeat-containing protein 26                         108   7e-24   
ref|XP_005409276.1|  PREDICTED: WD repeat-containing protein 26 i...    108   7e-24   
ref|XP_001489885.3|  PREDICTED: WD repeat-containing protein 26 i...    108   7e-24   
ref|XP_004569176.1|  PREDICTED: WD repeat-containing protein 26-like    108   7e-24   
ref|XP_006105168.1|  PREDICTED: WD repeat-containing protein 26 i...    108   7e-24   
ref|XP_005488549.1|  PREDICTED: WD repeat-containing protein 26 i...    108   7e-24   
ref|XP_004904371.1|  PREDICTED: WD repeat-containing protein 26 i...    108   7e-24   
ref|XP_004761946.1|  PREDICTED: WD repeat-containing protein 26 i...    108   7e-24   
ref|XP_011483295.1|  PREDICTED: WD repeat-containing protein 26-like    107   7e-24   
gb|EOB04346.1|  WD repeat-containing protein 26                         108   7e-24   
gb|KFZ48679.1|  WD repeat-containing protein 26                         108   7e-24   
gb|KFQ82009.1|  WD repeat-containing protein 26                         108   7e-24   
ref|XP_005289642.1|  PREDICTED: WD repeat-containing protein 26 i...    108   7e-24   
emb|CEG79669.1|  hypothetical protein RMATCC62417_14109                 108   7e-24   
gb|KFV67910.1|  WD repeat-containing protein 26                         108   8e-24   
ref|XP_004904370.1|  PREDICTED: WD repeat-containing protein 26 i...    108   8e-24   
gb|KFW08396.1|  WD repeat-containing protein 26                         108   8e-24   
gb|KFP26429.1|  WD repeat-containing protein 26                         108   8e-24   
gb|KFV16166.1|  WD repeat-containing protein 26                         108   8e-24   
gb|EFB14150.1|  hypothetical protein PANDA_011419                       108   8e-24   
gb|KFP09265.1|  WD repeat-containing protein 26                         108   8e-24   
ref|XP_004626952.1|  PREDICTED: WD repeat-containing protein 26 i...    108   8e-24   
ref|XP_005015555.1|  PREDICTED: WD repeat-containing protein 26 i...    108   8e-24   
gb|KFR12935.1|  WD repeat-containing protein 26                         108   8e-24   
gb|KFM03858.1|  WD repeat-containing protein 26                         108   8e-24   
gb|EMC90349.1|  WD repeat-containing protein 26                         108   8e-24   
ref|XP_005005635.1|  PREDICTED: WD repeat-containing protein 26 i...    108   8e-24   
ref|XP_006033426.1|  PREDICTED: WD repeat-containing protein 26 i...    108   8e-24   
ref|XP_003364597.1|  PREDICTED: WD repeat-containing protein 26 i...    108   8e-24   
ref|XP_009272117.1|  PREDICTED: WD repeat-containing protein 26 i...    108   8e-24   
ref|XP_006080989.1|  PREDICTED: LOW QUALITY PROTEIN: WD repeat do...    108   8e-24   
ref|XP_006105167.1|  PREDICTED: WD repeat-containing protein 26 i...    108   8e-24   
ref|XP_006133474.1|  PREDICTED: WD repeat-containing protein 26 i...    108   8e-24   
gb|KFV39116.1|  WD repeat-containing protein 26                         108   8e-24   
ref|XP_005289641.1|  PREDICTED: WD repeat-containing protein 26 i...    108   8e-24   
ref|NP_001070527.1|  WD repeat-containing protein 26                    108   8e-24   
ref|XP_002801964.1|  PREDICTED: WD repeat-containing protein 26-like    108   8e-24   
gb|KFO09193.1|  WD repeat-containing protein 26                         108   8e-24   
gb|EDL13128.1|  WD repeat domain 26                                     108   8e-24   
ref|XP_008124159.1|  PREDICTED: WD repeat-containing protein 26         110   8e-24   
ref|XP_007071777.1|  PREDICTED: WD repeat-containing protein 26         108   8e-24   
gb|KFZ49189.1|  WD repeat-containing protein 26                         108   8e-24   
gb|KFW92969.1|  WD repeat-containing protein 26                         108   8e-24   
dbj|BAC35923.1|  unnamed protein product                                108   8e-24   
gb|ERE72965.1|  WD repeat-containing protein 26                         108   8e-24   
gb|KFV74169.1|  WD repeat-containing protein 26                         108   8e-24   
gb|KFQ02931.1|  WD repeat-containing protein 26                         108   8e-24   
ref|NP_001102551.1|  WD repeat-containing protein 26                    108   9e-24   
ref|XP_005690573.1|  PREDICTED: WD repeat-containing protein 26 i...    108   9e-24   
ref|XP_011172577.1|  PREDICTED: WD repeat-containing protein 26-like    106   9e-24   
ref|XP_005690575.1|  PREDICTED: WD repeat-containing protein 26 i...    108   9e-24   
ref|XP_011227222.1|  PREDICTED: WD repeat-containing protein 26         108   9e-24   
ref|XP_004461978.1|  PREDICTED: WD repeat-containing protein 26 i...    108   9e-24   
gb|EPQ07946.1|  WD repeat-containing protein 26                         108   9e-24   
ref|XP_005015554.1|  PREDICTED: WD repeat-containing protein 26 i...    108   9e-24   
gb|KFP42228.1|  WD repeat-containing protein 26                         108   9e-24   
ref|XP_005005634.1|  PREDICTED: WD repeat-containing protein 26 i...    108   9e-24   
ref|XP_009064838.1|  hypothetical protein LOTGIDRAFT_168706             108   9e-24   
gb|KFO56720.1|  WD repeat-containing protein 26                         108   9e-24   
ref|XP_005866575.1|  PREDICTED: WD repeat-containing protein 26         108   9e-24   
ref|XP_005427079.1|  PREDICTED: WD repeat-containing protein 26         108   9e-24   
emb|CDQ82966.1|  unnamed protein product                                108   9e-24   
ref|XP_004461977.1|  PREDICTED: WD repeat-containing protein 26 i...    108   1e-23   
ref|XP_003410986.1|  PREDICTED: LOW QUALITY PROTEIN: WD repeat-co...    109   1e-23   
ref|XP_010745088.1|  PREDICTED: WD repeat-containing protein 26-like    108   1e-23   
ref|XP_007896408.1|  PREDICTED: WD repeat-containing protein 26 i...    108   1e-23   
ref|XP_003775467.2|  PREDICTED: LOW QUALITY PROTEIN: WD repeat-co...    108   1e-23   
ref|XP_005015553.1|  PREDICTED: WD repeat-containing protein 26 i...    108   1e-23   
dbj|GAN10316.1|  WD repeat-containing protein                           108   1e-23   
ref|XP_001921656.4|  PREDICTED: WD repeat-containing protein 26-like    107   1e-23   
ref|XP_008294938.1|  PREDICTED: WD repeat-containing protein 26 i...    108   1e-23   
ref|XP_004805457.1|  PREDICTED: WD repeat-containing protein 26 i...    109   1e-23   
ref|XP_003745506.1|  PREDICTED: WD repeat-containing protein 26-like    108   1e-23   
emb|CDO76439.1|  hypothetical protein BN946_scf184781.g16               107   1e-23   
gb|ELK32138.1|  WD repeat-containing protein 26                         107   1e-23   
ref|XP_005078282.1|  PREDICTED: WD repeat-containing protein 26         108   1e-23   
ref|XP_004805459.1|  PREDICTED: WD repeat-containing protein 26 i...    109   1e-23   
gb|ELW49572.1|  WD repeat-containing protein 26                         109   1e-23   
ref|XP_007670666.1|  PREDICTED: WD repeat-containing protein 26         108   1e-23   
ref|XP_008695650.1|  PREDICTED: WD repeat-containing protein 26         108   1e-23   
gb|ELK08887.1|  WD repeat-containing protein 26                         109   1e-23   
ref|XP_005959135.1|  PREDICTED: WD repeat-containing protein 26 i...    107   1e-23   
gb|KGL79088.1|  WD repeat-containing protein 26                         108   1e-23   
ref|XP_003767791.1|  PREDICTED: WD repeat-containing protein 26         108   1e-23   
ref|XP_010880641.1|  PREDICTED: WD repeat-containing protein 26 i...    108   1e-23   
ref|XP_004083763.1|  PREDICTED: WD repeat-containing protein 26         108   1e-23   
ref|XP_005959134.1|  PREDICTED: WD repeat-containing protein 26 i...    107   1e-23   
ref|XP_010880640.1|  PREDICTED: WD repeat-containing protein 26 i...    108   1e-23   
ref|XP_007896407.1|  PREDICTED: WD repeat-containing protein 26 i...    108   1e-23   
emb|CEP08924.1|  hypothetical protein                                   107   1e-23   
ref|XP_004867523.1|  PREDICTED: WD repeat-containing protein 26         108   2e-23   
ref|XP_006276699.1|  PREDICTED: WD repeat-containing protein 26         108   2e-23   
ref|XP_006496879.1|  PREDICTED: WD repeat-containing protein 26 i...    108   2e-23   
ref|XP_006496880.1|  PREDICTED: WD repeat-containing protein 26 i...    108   2e-23   
ref|XP_008148024.1|  PREDICTED: WD repeat-containing protein 26 i...    108   2e-23   
ref|XP_007988349.1|  PREDICTED: WD repeat-containing protein 26         108   2e-23   
emb|CAG14614.1|  unnamed protein product                                106   2e-23   
gb|EHB15308.1|  WD repeat-containing protein 26                         108   2e-23   
ref|XP_419389.3|  PREDICTED: WD repeat-containing protein 26            108   2e-23   
gb|AAI68527.1|  LOC100037096 protein                                    108   2e-23   
ref|XP_007111534.1|  PREDICTED: WD repeat-containing protein 26 i...    108   2e-23   
ref|XP_005349003.1|  PREDICTED: WD repeat-containing protein 26 i...    108   2e-23   
ref|NP_663489.4|  WD repeat-containing protein 26                       108   2e-23   
ref|XP_008493536.1|  PREDICTED: WD repeat-containing protein 26         107   2e-23   
ref|XP_005349004.1|  PREDICTED: WD repeat-containing protein 26 i...    108   2e-23   
ref|XP_004439605.1|  PREDICTED: WD repeat-containing protein 26 i...    108   2e-23   
ref|XP_010380555.1|  PREDICTED: WD repeat-containing protein 26 i...    108   2e-23   
ref|XP_004393592.1|  PREDICTED: WD repeat-containing protein 26 i...    108   2e-23   
ref|NP_001108585.2|  WD repeat-containing protein 26 isoform b          108   2e-23   
gb|ELR50564.1|  WD repeat-containing protein 26                         108   2e-23   
ref|XP_008148023.1|  PREDICTED: WD repeat-containing protein 26 i...    108   2e-23   
ref|XP_004393591.1|  PREDICTED: WD repeat-containing protein 26 i...    108   2e-23   
ref|XP_006871201.1|  PREDICTED: WD repeat-containing protein 26 i...    108   2e-23   
ref|XP_006198904.1|  PREDICTED: WD repeat-containing protein 26 i...    108   2e-23   
ref|XP_005667990.1|  PREDICTED: WD repeat-containing protein 26 i...    108   2e-23   
ref|XP_007454539.1|  PREDICTED: WD repeat-containing protein 26 i...    108   2e-23   
emb|CDQ83866.1|  unnamed protein product                                108   2e-23   
ref|XP_004271043.1|  PREDICTED: WD repeat-containing protein 26 i...    108   2e-23   
ref|XP_006898109.1|  PREDICTED: WD repeat-containing protein 26 i...    108   2e-23   
ref|XP_004693094.1|  PREDICTED: WD repeat-containing protein 26 i...    108   2e-23   
ref|XP_004578664.1|  PREDICTED: WD repeat-containing protein 26 i...    108   2e-23   
ref|XP_006761319.1|  PREDICTED: WD repeat-containing protein 26 i...    107   2e-23   
ref|XP_002147629.1|  catabolite degradation protein, putative           108   2e-23   
ref|XP_004805458.1|  PREDICTED: WD repeat-containing protein 26 i...    108   2e-23   
ref|XP_003893114.2|  PREDICTED: LOW QUALITY PROTEIN: WD repeat-co...    108   2e-23   
ref|XP_007111533.1|  PREDICTED: WD repeat-containing protein 26 i...    108   2e-23   
ref|XP_004375954.1|  PREDICTED: WD repeat-containing protein 26 i...    108   2e-23   
ref|XP_004439604.1|  PREDICTED: WD repeat-containing protein 26 i...    108   2e-23   
ref|XP_004375953.1|  PREDICTED: WD repeat-containing protein 26 i...    108   2e-23   
ref|XP_007167286.1|  PREDICTED: WD repeat-containing protein 26 i...    108   2e-23   
ref|XP_005216910.1|  PREDICTED: WD repeat-containing protein 26 i...    108   2e-23   
ref|XP_004805460.1|  PREDICTED: WD repeat-containing protein 26 i...    108   2e-23   
ref|XP_005541014.1|  PREDICTED: WD repeat-containing protein 26 i...    108   2e-23   
ref|XP_007626433.1|  PREDICTED: WD repeat-containing protein 26 i...    108   2e-23   
ref|XP_002760516.1|  PREDICTED: WD repeat-containing protein 26 i...    108   2e-23   
ref|XP_006916264.1|  PREDICTED: WD repeat-containing protein 26 i...    107   2e-23   
ref|XP_005216911.1|  PREDICTED: WD repeat-containing protein 26 i...    108   2e-23   
ref|XP_005488548.1|  PREDICTED: WD repeat-containing protein 26 i...    108   2e-23   
ref|XP_006898110.1|  PREDICTED: WD repeat-containing protein 26 i...    108   2e-23   
ref|XP_006761318.1|  PREDICTED: WD repeat-containing protein 26 i...    107   2e-23   
ref|XP_003735262.1|  PREDICTED: WD repeat-containing protein 26 i...    108   2e-23   
ref|XP_004578665.1|  PREDICTED: WD repeat-containing protein 26 i...    108   2e-23   
ref|XP_006625750.1|  PREDICTED: WD repeat-containing protein 26-like    108   2e-23   
ref|XP_010380554.1|  PREDICTED: WD repeat-containing protein 26 i...    108   2e-23   
ref|NP_079436.4|  WD repeat-containing protein 26 isoform a             108   2e-23   
gb|EAW69720.1|  WD repeat domain 26, isoform CRA_a                      108   2e-23   
ref|XP_006871202.1|  PREDICTED: WD repeat-containing protein 26 i...    108   2e-23   
ref|XP_006198903.1|  PREDICTED: WD repeat-containing protein 26 i...    108   2e-23   
ref|XP_005667991.1|  PREDICTED: WD repeat-containing protein 26 i...    108   2e-23   
ref|XP_007167287.1|  PREDICTED: WD repeat-containing protein 26 i...    108   2e-23   
ref|XP_007454538.1|  PREDICTED: WD repeat-containing protein 26 i...    108   2e-23   
ref|XP_004693093.1|  PREDICTED: WD repeat-containing protein 26 i...    108   2e-23   
emb|CEI97303.1|  hypothetical protein RMCBS344292_11439                 107   2e-23   
ref|XP_004271042.1|  PREDICTED: WD repeat-containing protein 26 i...    108   2e-23   
ref|XP_005523355.1|  PREDICTED: WD repeat-containing protein 26         108   2e-23   
ref|XP_006797280.1|  PREDICTED: WD repeat-containing protein 26-like    108   2e-23   
ref|XP_008311108.1|  PREDICTED: WD repeat-containing protein 26 i...    107   2e-23   
ref|XP_005449665.1|  PREDICTED: WD repeat-containing protein 26-like    108   2e-23   



>ref|XP_009758209.1| PREDICTED: WD repeat-containing protein 26-like isoform X2 [Nicotiana 
sylvestris]
Length=547

 Score =   211 bits (536),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L NQEIHLWNI+G+V  I+K+KGHKR+RFVVRSCFGGLD+AF+ASGSEDSQVYIWHRSSG
Sbjct  426  LWNQEIHLWNIEGTVKLISKYKGHKRSRFVVRSCFGGLDQAFVASGSEDSQVYIWHRSSG  485

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVHHCNG  289
            EL+ T+ GHSGTVNCVSWN ANPHMLASASDD TIRIWGL QVN+K   T  NGVH+CNG
Sbjct  486  ELIETMAGHSGTVNCVSWNPANPHMLASASDDHTIRIWGLNQVNMKHYDTFSNGVHYCNG  545

Query  288  GS  283
            G+
Sbjct  546  GT  547



>emb|CDP17860.1| unnamed protein product [Coffea canephora]
Length=588

 Score =   211 bits (536),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            LLN+EIHLWNI+G V  +AK+KGHKR+RFV+RSCFGGL++AF+ASGSEDSQVYIWHRSSG
Sbjct  467  LLNEEIHLWNIEGHVRLLAKYKGHKRSRFVIRSCFGGLEQAFVASGSEDSQVYIWHRSSG  526

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVHHCNG  289
            ELV TL GHSGTVNCVSWN +NPHMLASASDDRTIRIWGLK+V +K N    NGVH+CNG
Sbjct  527  ELVMTLPGHSGTVNCVSWNPSNPHMLASASDDRTIRIWGLKEVKMKHNGAHTNGVHYCNG  586

Query  288  GS  283
            GS
Sbjct  587  GS  588



>ref|XP_009758206.1| PREDICTED: WD repeat-containing protein 26-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009758207.1| PREDICTED: WD repeat-containing protein 26-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009758208.1| PREDICTED: WD repeat-containing protein 26-like isoform X1 [Nicotiana 
sylvestris]
Length=581

 Score =   210 bits (535),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L NQEIHLWNI+G+V  I+K+KGHKR+RFVVRSCFGGLD+AF+ASGSEDSQVYIWHRSSG
Sbjct  460  LWNQEIHLWNIEGTVKLISKYKGHKRSRFVVRSCFGGLDQAFVASGSEDSQVYIWHRSSG  519

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVHHCNG  289
            EL+ T+ GHSGTVNCVSWN ANPHMLASASDD TIRIWGL QVN+K   T  NGVH+CNG
Sbjct  520  ELIETMAGHSGTVNCVSWNPANPHMLASASDDHTIRIWGLNQVNMKHYDTFSNGVHYCNG  579

Query  288  GS  283
            G+
Sbjct  580  GT  581



>ref|XP_009631029.1| PREDICTED: WD repeat-containing protein 26-like isoform X2 [Nicotiana 
tomentosiformis]
Length=547

 Score =   209 bits (532),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L NQEIHLWNI+G+V  I+K+KGHKR+RFVVRSCFGGL +AF+ASGSEDSQVYIWHRSSG
Sbjct  426  LWNQEIHLWNIEGTVKLISKYKGHKRSRFVVRSCFGGLGQAFVASGSEDSQVYIWHRSSG  485

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVHHCNG  289
            EL+ TL GHSGTVNCVSWN ANPHMLASASDD TIRIWG+ QVN+K   TV NGVH+CNG
Sbjct  486  ELIETLAGHSGTVNCVSWNPANPHMLASASDDHTIRIWGMNQVNMKHYDTVSNGVHYCNG  545

Query  288  GS  283
            G+
Sbjct  546  GT  547



>ref|XP_009631025.1| PREDICTED: WD repeat-containing protein 26-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009631026.1| PREDICTED: WD repeat-containing protein 26-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009631027.1| PREDICTED: WD repeat-containing protein 26-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009631028.1| PREDICTED: WD repeat-containing protein 26-like isoform X1 [Nicotiana 
tomentosiformis]
Length=581

 Score =   209 bits (531),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L NQEIHLWNI+G+V  I+K+KGHKR+RFVVRSCFGGL +AF+ASGSEDSQVYIWHRSSG
Sbjct  460  LWNQEIHLWNIEGTVKLISKYKGHKRSRFVVRSCFGGLGQAFVASGSEDSQVYIWHRSSG  519

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVHHCNG  289
            EL+ TL GHSGTVNCVSWN ANPHMLASASDD TIRIWG+ QVN+K   TV NGVH+CNG
Sbjct  520  ELIETLAGHSGTVNCVSWNPANPHMLASASDDHTIRIWGMNQVNMKHYDTVSNGVHYCNG  579

Query  288  GS  283
            G+
Sbjct  580  GT  581



>ref|XP_009618673.1| PREDICTED: WD repeat-containing protein 26-like [Nicotiana tomentosiformis]
Length=581

 Score =   208 bits (529),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L NQEIHLW+I G+V  IAK+KGHKR+RFVVRSCFGGLD+AF+ASGSEDSQVYIWHR SG
Sbjct  460  LWNQEIHLWDIQGTVKLIAKYKGHKRSRFVVRSCFGGLDQAFVASGSEDSQVYIWHRGSG  519

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVHHCNG  289
            ELVGTL GHSGTVNCVSWN ANPHMLASASDDR+IRIWGL +VN+KQ+ TV NGV+ CNG
Sbjct  520  ELVGTLAGHSGTVNCVSWNPANPHMLASASDDRSIRIWGLNRVNMKQHGTVTNGVNCCNG  579

Query  288  GS  283
             S
Sbjct  580  RS  581



>gb|KDO44760.1| hypothetical protein CISIN_1g009188mg [Citrus sinensis]
Length=540

 Score =   205 bits (521),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            LLNQEIHLWNI+G V  +AK+KGHKR+RFV+RSCFGGL++AFIASGSEDSQVYIWHR+S 
Sbjct  419  LLNQEIHLWNIEGEVKLVAKYKGHKRSRFVIRSCFGGLEQAFIASGSEDSQVYIWHRASC  478

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVHHCNG  289
            +L+G L GHSG VNCVSWN ANPHMLASASDDRTIRIWGLK +N+K+     NGVH+CNG
Sbjct  479  DLIGALPGHSGAVNCVSWNPANPHMLASASDDRTIRIWGLKDLNVKRKDCHSNGVHYCNG  538

Query  288  GS  283
            G+
Sbjct  539  GT  540



>ref|XP_009765608.1| PREDICTED: WD repeat-containing protein 26-like isoform X2 [Nicotiana 
sylvestris]
Length=540

 Score =   204 bits (520),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L NQEIHLW++ G+V  I+K+KGHKR+RFVVRSCFGGLD+AF+ASGSEDSQVYIWHR SG
Sbjct  419  LCNQEIHLWDVQGTVKLISKYKGHKRSRFVVRSCFGGLDQAFVASGSEDSQVYIWHRGSG  478

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVHHCNG  289
            ELVGTL GHSGTVNCVSWN ANPHMLASASDDR+IRIWGL +VN+KQ+ TV NG   CNG
Sbjct  479  ELVGTLAGHSGTVNCVSWNPANPHMLASASDDRSIRIWGLNRVNMKQHGTVTNGASCCNG  538

Query  288  GS  283
             S
Sbjct  539  RS  540



>ref|XP_006484997.1| PREDICTED: WD repeat-containing protein 26-like isoform X1 [Citrus 
sinensis]
 ref|XP_006484998.1| PREDICTED: WD repeat-containing protein 26-like isoform X2 [Citrus 
sinensis]
 ref|XP_006484999.1| PREDICTED: WD repeat-containing protein 26-like isoform X3 [Citrus 
sinensis]
 ref|XP_006485000.1| PREDICTED: WD repeat-containing protein 26-like isoform X4 [Citrus 
sinensis]
Length=581

 Score =   205 bits (522),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            LLNQEIHLWNI+G V  +AK+KGHKR+RFV+RSCFGGL++AFIASGSEDSQVYIWHR+S 
Sbjct  460  LLNQEIHLWNIEGEVKLVAKYKGHKRSRFVIRSCFGGLEQAFIASGSEDSQVYIWHRASC  519

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVHHCNG  289
            +L+G L GHSG VNCVSWN ANPHMLASASDDRTIRIWGLK +N+K+     NGVH+CNG
Sbjct  520  DLIGALPGHSGAVNCVSWNPANPHMLASASDDRTIRIWGLKDLNVKRKDCHSNGVHYCNG  579

Query  288  GS  283
            G+
Sbjct  580  GT  581



>ref|XP_006437085.1| hypothetical protein CICLE_v10031058mg [Citrus clementina]
 ref|XP_006437086.1| hypothetical protein CICLE_v10031058mg [Citrus clementina]
 ref|XP_006437087.1| hypothetical protein CICLE_v10031058mg [Citrus clementina]
 ref|XP_006437088.1| hypothetical protein CICLE_v10031058mg [Citrus clementina]
 gb|ESR50325.1| hypothetical protein CICLE_v10031058mg [Citrus clementina]
 gb|ESR50326.1| hypothetical protein CICLE_v10031058mg [Citrus clementina]
 gb|ESR50327.1| hypothetical protein CICLE_v10031058mg [Citrus clementina]
 gb|ESR50328.1| hypothetical protein CICLE_v10031058mg [Citrus clementina]
Length=581

 Score =   205 bits (522),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            LLNQEIHLWNI+G V  +AK+KGHKR+RFV+RSCFGGL++AFIASGSEDSQVYIWHR+S 
Sbjct  460  LLNQEIHLWNIEGEVKLVAKYKGHKRSRFVIRSCFGGLEQAFIASGSEDSQVYIWHRASC  519

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVHHCNG  289
            +L+G L GHSG VNCVSWN ANPHMLASASDDRTIRIWGLK +N+K+     NGVH+CNG
Sbjct  520  DLIGALPGHSGAVNCVSWNPANPHMLASASDDRTIRIWGLKDLNVKRKDCHSNGVHYCNG  579

Query  288  GS  283
            G+
Sbjct  580  GT  581



>ref|XP_009765607.1| PREDICTED: WD repeat-containing protein 26-like isoform X1 [Nicotiana 
sylvestris]
Length=581

 Score =   205 bits (521),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L NQEIHLW++ G+V  I+K+KGHKR+RFVVRSCFGGLD+AF+ASGSEDSQVYIWHR SG
Sbjct  460  LCNQEIHLWDVQGTVKLISKYKGHKRSRFVVRSCFGGLDQAFVASGSEDSQVYIWHRGSG  519

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVHHCNG  289
            ELVGTL GHSGTVNCVSWN ANPHMLASASDDR+IRIWGL +VN+KQ+ TV NG   CNG
Sbjct  520  ELVGTLAGHSGTVNCVSWNPANPHMLASASDDRSIRIWGLNRVNMKQHGTVTNGASCCNG  579

Query  288  GS  283
             S
Sbjct  580  RS  581



>ref|XP_010657105.1| PREDICTED: WD repeat-containing protein 26-like [Vitis vinifera]
Length=581

 Score =   204 bits (520),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            LLNQEIHLWNI+G    IAK+KGHKR RF++RSCFGG +EAFIASGSEDSQVYIWH+SSG
Sbjct  460  LLNQEIHLWNIEGEAKFIAKYKGHKRERFIIRSCFGGFEEAFIASGSEDSQVYIWHKSSG  519

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVHHCNG  289
            EL+  L GHSG+VNCVSWN ANPHMLASASDDRTIRIWGL ++N+K+  T  NG H+CNG
Sbjct  520  ELIEVLPGHSGSVNCVSWNPANPHMLASASDDRTIRIWGLNKINMKRKGTHPNGTHYCNG  579

Query  288  GS  283
            G+
Sbjct  580  GT  581



>emb|CBI22069.3| unnamed protein product [Vitis vinifera]
Length=467

 Score =   201 bits (512),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            LLNQEIHLWNI+G    IAK+KGHKR RF++RSCFGG +EAFIASGSEDSQVYIWH+SSG
Sbjct  346  LLNQEIHLWNIEGEAKFIAKYKGHKRERFIIRSCFGGFEEAFIASGSEDSQVYIWHKSSG  405

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVHHCNG  289
            EL+  L GHSG+VNCVSWN ANPHMLASASDDRTIRIWGL ++N+K+  T  NG H+CNG
Sbjct  406  ELIEVLPGHSGSVNCVSWNPANPHMLASASDDRTIRIWGLNKINMKRKGTHPNGTHYCNG  465

Query  288  GS  283
            G+
Sbjct  466  GT  467



>ref|XP_003532075.1| PREDICTED: WD repeat-containing protein 26-like [Glycine max]
 gb|KHM99675.1| WD repeat-containing protein 26 [Glycine soja]
Length=581

 Score =   201 bits (512),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 90/121 (74%), Positives = 106/121 (88%), Gaps = 0/121 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            LLNQEIHLWNI+G    + K++ HKR+RFV+RSCFGGL+++FIASGSEDSQVYIWHRSSG
Sbjct  458  LLNQEIHLWNIEGDPKLVGKYRSHKRSRFVIRSCFGGLEQSFIASGSEDSQVYIWHRSSG  517

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVHHCNG  289
            +L+ TL GHSG VNCVSWN ANPHMLASASDDRTIRIWGLK++N+K  +   NGVH+CNG
Sbjct  518  DLIETLPGHSGAVNCVSWNPANPHMLASASDDRTIRIWGLKRLNVKYPNVRTNGVHYCNG  577

Query  288  G  286
            G
Sbjct  578  G  578



>ref|XP_006354306.1| PREDICTED: WD repeat-containing protein 26-like [Solanum tuberosum]
Length=581

 Score =   200 bits (509),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L NQEIHLW+I+G+   I+K+ GHKR+RFVVRSCFGGL++AFIASGSEDSQVYIWH SSG
Sbjct  460  LWNQEIHLWDIEGTAKLISKYNGHKRSRFVVRSCFGGLNQAFIASGSEDSQVYIWHISSG  519

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVHHCNG  289
            ELV TL GHSGTVNCVSWN A+PHMLASASDD TIRIWGL QV +K   TV NGVH+CNG
Sbjct  520  ELVETLAGHSGTVNCVSWNPADPHMLASASDDHTIRIWGLNQVKMKHTDTVSNGVHYCNG  579

Query  288  GS  283
            G+
Sbjct  580  GT  581



>ref|XP_009780908.1| PREDICTED: WD repeat-containing protein 26-like [Nicotiana sylvestris]
 ref|XP_009780909.1| PREDICTED: WD repeat-containing protein 26-like [Nicotiana sylvestris]
Length=579

 Score =   199 bits (507),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 106/124 (85%), Gaps = 2/124 (2%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L NQEIHLW I+GSV  +AK+KGHKR+RFVVRSCFGGLD++FIASGSEDSQVYIWH+ S 
Sbjct  456  LWNQEIHLWYIEGSVKLVAKYKGHKRSRFVVRSCFGGLDQSFIASGSEDSQVYIWHKCSQ  515

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQ--NSTVCNGVHHC  295
             L+ TL GHSGTVNCVSWN ANPHMLASASDDRTIRIWGL Q N+K   N  + NGVH+C
Sbjct  516  ALLATLAGHSGTVNCVSWNPANPHMLASASDDRTIRIWGLNQANMKHNGNGAISNGVHYC  575

Query  294  NGGS  283
            NGG+
Sbjct  576  NGGT  579



>ref|XP_004149517.1| PREDICTED: WD repeat-containing protein 26-like [Cucumis sativus]
 gb|KGN54949.1| hypothetical protein Csa_4G614220 [Cucumis sativus]
Length=584

 Score =   199 bits (505),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            LLNQEIHLW++ G    ++K+KGH+R RFV+RSCFGGL+EAFIASGSEDSQVYIWHR SG
Sbjct  461  LLNQEIHLWSLVGEPNLVSKYKGHRRTRFVIRSCFGGLEEAFIASGSEDSQVYIWHRGSG  520

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVHHCNG  289
            EL+ +L GHSG+VNCVSWN  NPHMLASASDD TIRIWGLK +N+K+N+   NGVH+CNG
Sbjct  521  ELIESLPGHSGSVNCVSWNPTNPHMLASASDDHTIRIWGLKGLNIKRNNAYSNGVHYCNG  580

Query  288  GS  283
            G+
Sbjct  581  GT  582



>ref|XP_009608371.1| PREDICTED: WD repeat-containing protein 26-like isoform X2 [Nicotiana 
tomentosiformis]
Length=545

 Score =   198 bits (503),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 105/124 (85%), Gaps = 2/124 (2%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L NQEIHLW I+GSV  +AK+KGHKR RFVVRSCFGGLD++FIASGSEDSQVYIWH+ S 
Sbjct  422  LWNQEIHLWYIEGSVKLVAKYKGHKRFRFVVRSCFGGLDQSFIASGSEDSQVYIWHKCSQ  481

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQ--NSTVCNGVHHC  295
             L+ TL GHSGTVNCVSWN ANPHMLASASDDRTIRIWGL Q N+K   N  + NGVH+C
Sbjct  482  ALLATLAGHSGTVNCVSWNPANPHMLASASDDRTIRIWGLNQANMKHNVNGAISNGVHYC  541

Query  294  NGGS  283
            NGG+
Sbjct  542  NGGT  545



>ref|XP_008342331.1| PREDICTED: WD repeat-containing protein 26-like [Malus domestica]
 ref|XP_008342332.1| PREDICTED: WD repeat-containing protein 26-like [Malus domestica]
Length=578

 Score =   198 bits (504),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 102/122 (84%), Gaps = 0/122 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            LLNQEIHLWNI+G +  +AK+KGHKR RFV+RSCFGGL+EAF+ASGSEDSQVY+W RSSG
Sbjct  457  LLNQEIHLWNIEGEIKPVAKYKGHKRTRFVIRSCFGGLEEAFVASGSEDSQVYVWQRSSG  516

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVHHCNG  289
            EL+  L GHSG VNCVSWN ANPHM ASASDDRTIRIWGL +  +K      NG+H+CNG
Sbjct  517  ELIEALPGHSGAVNCVSWNPANPHMFASASDDRTIRIWGLSEQTVKHRGAHSNGIHYCNG  576

Query  288  GS  283
            G+
Sbjct  577  GT  578



>ref|XP_002306758.1| hypothetical protein POPTR_0005s22820g [Populus trichocarpa]
 gb|EEE93754.1| hypothetical protein POPTR_0005s22820g [Populus trichocarpa]
Length=581

 Score =   198 bits (503),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            LLNQEIHLWNIDG +  +A +KGHKR RFV+RSCFGG ++AFIASGSEDSQ+Y+WHR+S 
Sbjct  460  LLNQEIHLWNIDGDIRLVATYKGHKRTRFVIRSCFGGHEQAFIASGSEDSQIYLWHRASR  519

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVHHCNG  289
            ELV  L GHSG VNCVSWN ANPHMLASASDDRTIRIWG+  + +K  S  CNG+H+CNG
Sbjct  520  ELVEALPGHSGAVNCVSWNPANPHMLASASDDRTIRIWGVNALQVKHKSAHCNGIHYCNG  579

Query  288  GS  283
            GS
Sbjct  580  GS  581



>gb|KDP29808.1| hypothetical protein JCGZ_19323 [Jatropha curcas]
Length=581

 Score =   198 bits (503),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 102/122 (84%), Gaps = 0/122 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            LLNQEIHLWNIDG +  IAK+KGHKR RFV+RSCFGGL++ FIASGSEDSQVYIWH+ S 
Sbjct  460  LLNQEIHLWNIDGGIKLIAKYKGHKRTRFVIRSCFGGLEQTFIASGSEDSQVYIWHKCSR  519

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVHHCNG  289
            EL+  L GHSG VNCVSWN  NPHMLASASDDRTIRIWGL  + +KQ  T  NG+H+CNG
Sbjct  520  ELIEALPGHSGAVNCVSWNPKNPHMLASASDDRTIRIWGLNALCMKQKGTHSNGIHYCNG  579

Query  288  GS  283
            G+
Sbjct  580  GT  581



>ref|XP_009608368.1| PREDICTED: WD repeat-containing protein 26-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009608369.1| PREDICTED: WD repeat-containing protein 26-like isoform X1 [Nicotiana 
tomentosiformis]
Length=579

 Score =   197 bits (502),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 105/124 (85%), Gaps = 2/124 (2%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L NQEIHLW I+GSV  +AK+KGHKR RFVVRSCFGGLD++FIASGSEDSQVYIWH+ S 
Sbjct  456  LWNQEIHLWYIEGSVKLVAKYKGHKRFRFVVRSCFGGLDQSFIASGSEDSQVYIWHKCSQ  515

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQ--NSTVCNGVHHC  295
             L+ TL GHSGTVNCVSWN ANPHMLASASDDRTIRIWGL Q N+K   N  + NGVH+C
Sbjct  516  ALLATLAGHSGTVNCVSWNPANPHMLASASDDRTIRIWGLNQANMKHNVNGAISNGVHYC  575

Query  294  NGGS  283
            NGG+
Sbjct  576  NGGT  579



>ref|XP_006602271.1| PREDICTED: WD repeat-containing protein 26-like isoform X2 [Glycine 
max]
 gb|KHN28541.1| WD repeat-containing protein 26 [Glycine soja]
Length=546

 Score =   197 bits (500),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            LLNQEIHLWNI+G    + K++ HKR RFV+RSC GGL ++FIASGSEDSQVYIWHRSSG
Sbjct  423  LLNQEIHLWNIEGDPKLVGKYRSHKRTRFVIRSCLGGLKQSFIASGSEDSQVYIWHRSSG  482

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVHHCNG  289
            +LV  L GHSG VNCVSWN ANPHMLASASDDRTIRIWGLK++N+K  +   NGVH+CNG
Sbjct  483  DLVEALPGHSGAVNCVSWNPANPHMLASASDDRTIRIWGLKRLNVKYPNVRTNGVHYCNG  542

Query  288  G  286
            G
Sbjct  543  G  543



>ref|XP_006602270.1| PREDICTED: WD repeat-containing protein 26-like isoform X1 [Glycine 
max]
Length=580

 Score =   197 bits (500),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            LLNQEIHLWNI+G    + K++ HKR RFV+RSC GGL ++FIASGSEDSQVYIWHRSSG
Sbjct  457  LLNQEIHLWNIEGDPKLVGKYRSHKRTRFVIRSCLGGLKQSFIASGSEDSQVYIWHRSSG  516

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVHHCNG  289
            +LV  L GHSG VNCVSWN ANPHMLASASDDRTIRIWGLK++N+K  +   NGVH+CNG
Sbjct  517  DLVEALPGHSGAVNCVSWNPANPHMLASASDDRTIRIWGLKRLNVKYPNVRTNGVHYCNG  576

Query  288  G  286
            G
Sbjct  577  G  577



>ref|XP_008229590.1| PREDICTED: WD repeat-containing protein 26-like [Prunus mume]
 ref|XP_008229591.1| PREDICTED: WD repeat-containing protein 26-like [Prunus mume]
Length=578

 Score =   196 bits (499),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            LLNQEIHLW+I+G +  +AK+KGHKR RFV+RSCFGGL++AFIASGSEDSQVY+WHR SG
Sbjct  457  LLNQEIHLWSIEGEIKLVAKYKGHKRTRFVIRSCFGGLEQAFIASGSEDSQVYVWHRGSG  516

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVHHCNG  289
            EL+  L GHSG VNCVSWN  N HMLASASDDRTIRIWGLK++ +K      NGVH+CNG
Sbjct  517  ELIEALPGHSGAVNCVSWNPTNTHMLASASDDRTIRIWGLKELKVKHRDAHSNGVHYCNG  576

Query  288  GS  283
            G+
Sbjct  577  GT  578



>ref|XP_004491280.1| PREDICTED: WD repeat-containing protein 26-like [Cicer arietinum]
Length=572

 Score =   196 bits (499),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 101/122 (83%), Gaps = 0/122 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            LLNQEIHLWNI+G    + K+KGH+R RFV+RSCFGGL +AFIASGSEDSQVYIWHRSSG
Sbjct  451  LLNQEIHLWNIEGDPKLVGKYKGHRRARFVIRSCFGGLKQAFIASGSEDSQVYIWHRSSG  510

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVHHCNG  289
            E +  L GHSG VNCVSWN ANPHMLASASDDRTIRIWGL  +N K  +   NGVH+CNG
Sbjct  511  EPIEALPGHSGAVNCVSWNPANPHMLASASDDRTIRIWGLNSLNRKYQNAHSNGVHYCNG  570

Query  288  GS  283
            G+
Sbjct  571  GT  572



>ref|XP_004243618.1| PREDICTED: WD repeat-containing protein 26 [Solanum lycopersicum]
 ref|XP_010323928.1| PREDICTED: WD repeat-containing protein 26 [Solanum lycopersicum]
 ref|XP_010323929.1| PREDICTED: WD repeat-containing protein 26 [Solanum lycopersicum]
Length=580

 Score =   196 bits (498),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 105/122 (86%), Gaps = 1/122 (1%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L NQEIHLWNI+G+V  +AK+KGHKR+RFVVRSCFGGLD+AFIASGSEDSQVYIWHR SG
Sbjct  460  LSNQEIHLWNIEGTVKLVAKYKGHKRSRFVVRSCFGGLDQAFIASGSEDSQVYIWHRGSG  519

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVHHCNG  289
            ELV TL GHSG VNCVSWN  NPHMLASASDD TIRIWG  +VN KQ+ T  NGV++CNG
Sbjct  520  ELVATLAGHSGAVNCVSWNPTNPHMLASASDDGTIRIWGDNRVNTKQHDT-ANGVNYCNG  578

Query  288  GS  283
             S
Sbjct  579  RS  580



>gb|KHG12711.1| wdr26 [Gossypium arboreum]
 gb|KHG12712.1| wdr26 [Gossypium arboreum]
Length=580

 Score =   196 bits (498),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            LLNQEIHLWNI+G    ++K++GHKR RF++RSCFGGL++AFIASGSEDS VYIWHR +G
Sbjct  459  LLNQEIHLWNIEGDPKLVSKYRGHKRTRFIIRSCFGGLEQAFIASGSEDSLVYIWHRGTG  518

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVHHCNG  289
            EL+ TL GHSG VNCVSWN ANPHMLASASDDRTIRIWGL  ++ K+     NG+H+CNG
Sbjct  519  ELIETLPGHSGAVNCVSWNPANPHMLASASDDRTIRIWGLNNLSTKRKEPCSNGIHYCNG  578

Query  288  G  286
            G
Sbjct  579  G  579



>ref|XP_007048928.1| Transducin family protein / WD-40 repeat family protein isoform 
2 [Theobroma cacao]
 ref|XP_007048929.1| Transducin family protein / WD-40 repeat family protein isoform 
2 [Theobroma cacao]
 gb|EOX93085.1| Transducin family protein / WD-40 repeat family protein isoform 
2 [Theobroma cacao]
 gb|EOX93086.1| Transducin family protein / WD-40 repeat family protein isoform 
2 [Theobroma cacao]
Length=580

 Score =   196 bits (497),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            LLNQEIHLWNI+G +  ++K+KGHKR RF++RSCFGGL++AFIASGSEDS VYIWHR +G
Sbjct  459  LLNQEIHLWNIEGDLKLVSKYKGHKRTRFIIRSCFGGLEQAFIASGSEDSLVYIWHRGTG  518

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVHHCNG  289
            EL+  L GHSG VNCVSWN ANPHMLASASDDRTIRIWGL  ++ K   T  NG+H+CNG
Sbjct  519  ELIEALPGHSGAVNCVSWNPANPHMLASASDDRTIRIWGLNNLSTKLKDTHSNGIHYCNG  578

Query  288  GS  283
            G+
Sbjct  579  GT  580



>ref|XP_009377000.1| PREDICTED: WD repeat-containing protein 26-like [Pyrus x bretschneideri]
 ref|XP_009377004.1| PREDICTED: WD repeat-containing protein 26-like [Pyrus x bretschneideri]
Length=578

 Score =   195 bits (496),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 101/122 (83%), Gaps = 0/122 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            LLNQEIHLWNI+G +  +AK+KGHKR RFV+RSCFGGL+EAF+ASGSEDSQVY+W R SG
Sbjct  457  LLNQEIHLWNIEGEIKPVAKYKGHKRTRFVIRSCFGGLEEAFVASGSEDSQVYVWRRGSG  516

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVHHCNG  289
            EL+  L GHSG VNCVSWN ANPHM ASASDDRTIRIWGL +  +K      NG+H+CNG
Sbjct  517  ELIEALPGHSGAVNCVSWNPANPHMFASASDDRTIRIWGLGEQTVKHRGAHSNGIHYCNG  576

Query  288  GS  283
            G+
Sbjct  577  GT  578



>ref|XP_010321118.1| PREDICTED: WD repeat-containing protein 26 isoform X2 [Solanum 
lycopersicum]
Length=549

 Score =   195 bits (495),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L NQEIHLW+I+G+   ++K+ GHKR+RFV+RSCFGGL++ FI+SGSEDSQVYIWH SSG
Sbjct  428  LWNQEIHLWDIEGTAKLLSKYNGHKRSRFVIRSCFGGLNQEFISSGSEDSQVYIWHISSG  487

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVHHCNG  289
            ELV TL GHSGTVNCVSWN A+PHMLASASDD TIRIWGL QV ++ N TV N VH+CNG
Sbjct  488  ELVETLAGHSGTVNCVSWNPADPHMLASASDDHTIRIWGLNQVKMEHNDTVSNDVHYCNG  547

Query  288  GS  283
            G+
Sbjct  548  GT  549



>ref|XP_011026207.1| PREDICTED: WD repeat-containing protein 26-like [Populus euphratica]
Length=580

 Score =   195 bits (496),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            LLNQEIHLW+IDG++  +AK+KGH+R RFV+RSCFGGL++AFIA GSEDSQVYIWHR SG
Sbjct  459  LLNQEIHLWSIDGNIRLVAKYKGHRRTRFVIRSCFGGLEQAFIACGSEDSQVYIWHRGSG  518

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVHHCNG  289
            +LV  L GHSG VNCVSWN ANPHMLASASDDRTIRIWGL  +++K  S   NG H+CNG
Sbjct  519  DLVEALPGHSGAVNCVSWNPANPHMLASASDDRTIRIWGLNSLHVKHKSAHSNGTHYCNG  578

Query  288  GS  283
            G+
Sbjct  579  GT  580



>ref|XP_007048927.1| Transducin family protein / WD-40 repeat family protein isoform 
1 [Theobroma cacao]
 gb|EOX93084.1| Transducin family protein / WD-40 repeat family protein isoform 
1 [Theobroma cacao]
Length=619

 Score =   196 bits (497),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            LLNQEIHLWNI+G +  ++K+KGHKR RF++RSCFGGL++AFIASGSEDS VYIWHR +G
Sbjct  498  LLNQEIHLWNIEGDLKLVSKYKGHKRTRFIIRSCFGGLEQAFIASGSEDSLVYIWHRGTG  557

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVHHCNG  289
            EL+  L GHSG VNCVSWN ANPHMLASASDDRTIRIWGL  ++ K   T  NG+H+CNG
Sbjct  558  ELIEALPGHSGAVNCVSWNPANPHMLASASDDRTIRIWGLNNLSTKLKDTHSNGIHYCNG  617

Query  288  GS  283
            G+
Sbjct  618  GT  619



>gb|KJB33386.1| hypothetical protein B456_006G008900 [Gossypium raimondii]
Length=546

 Score =   194 bits (494),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            LLNQEIHLWNI+G    ++K++GHKR RF++RSCFGGL++AFIASGSEDS VYIWHR +G
Sbjct  425  LLNQEIHLWNIEGDPKLVSKYRGHKRTRFIIRSCFGGLEQAFIASGSEDSLVYIWHRGTG  484

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVHHCNG  289
            EL+ TL GHSG VNCVSWN ANPHMLASASDDRTIRIWGL  ++ K+     NG+H+CNG
Sbjct  485  ELIETLPGHSGAVNCVSWNPANPHMLASASDDRTIRIWGLNNLSTKRKEPCSNGIHYCNG  544



>ref|XP_006366633.1| PREDICTED: WD repeat-containing protein 26-like [Solanum tuberosum]
Length=580

 Score =   195 bits (495),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 106/122 (87%), Gaps = 1/122 (1%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L NQEIHLWNI+G+V  +AK+KGHKR+RFVVRSCFGGL +AFIASGSEDSQVYIWHR SG
Sbjct  460  LSNQEIHLWNIEGTVKLVAKYKGHKRSRFVVRSCFGGLHQAFIASGSEDSQVYIWHRGSG  519

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVHHCNG  289
            ELVGTL GHSGTVNCVSWN  NPHMLASASDD TIR+WG  +VN KQ+ T  NGV++CNG
Sbjct  520  ELVGTLAGHSGTVNCVSWNPRNPHMLASASDDGTIRVWGYNRVNTKQHDT-DNGVNYCNG  578

Query  288  GS  283
             S
Sbjct  579  RS  580



>ref|XP_004239311.1| PREDICTED: WD repeat-containing protein 26 isoform X3 [Solanum 
lycopersicum]
Length=540

 Score =   193 bits (491),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L NQEIHLW+I+G+   ++K+ GHKR+RFV+RSCFGGL++ FI+SGSEDSQVYIWH SSG
Sbjct  419  LWNQEIHLWDIEGTAKLLSKYNGHKRSRFVIRSCFGGLNQEFISSGSEDSQVYIWHISSG  478

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVHHCNG  289
            ELV TL GHSGTVNCVSWN A+PHMLASASDD TIRIWGL QV ++ N TV N VH+CNG
Sbjct  479  ELVETLAGHSGTVNCVSWNPADPHMLASASDDHTIRIWGLNQVKMEHNDTVSNDVHYCNG  538

Query  288  GS  283
            G+
Sbjct  539  GT  540



>ref|XP_003617329.1| WD-repeat protein-like protein [Medicago truncatula]
 gb|AET00288.1| transducin/WD40 repeat protein [Medicago truncatula]
Length=572

 Score =   194 bits (493),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            LLNQEI+LWNI+G+   I K+KGH+R+RF++RSCFGGL++AFIASGSEDSQVYIWHRSSG
Sbjct  451  LLNQEINLWNIEGNPKLIGKYKGHRRSRFIIRSCFGGLEQAFIASGSEDSQVYIWHRSSG  510

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVHHCNG  289
            E +  L GHSG VNCVSWN ANPHMLASASDDRTIRIWGL  +N K      NG+H+CNG
Sbjct  511  EPIEALPGHSGAVNCVSWNPANPHMLASASDDRTIRIWGLNSLNKKYQHAHSNGIHYCNG  570

Query  288  GS  283
            G+
Sbjct  571  GT  572



>gb|KJB33387.1| hypothetical protein B456_006G008900 [Gossypium raimondii]
 gb|KJB33388.1| hypothetical protein B456_006G008900 [Gossypium raimondii]
Length=580

 Score =   194 bits (493),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            LLNQEIHLWNI+G    ++K++GHKR RF++RSCFGGL++AFIASGSEDS VYIWHR +G
Sbjct  459  LLNQEIHLWNIEGDPKLVSKYRGHKRTRFIIRSCFGGLEQAFIASGSEDSLVYIWHRGTG  518

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVHHCNG  289
            EL+ TL GHSG VNCVSWN ANPHMLASASDDRTIRIWGL  ++ K+     NG+H+CNG
Sbjct  519  ELIETLPGHSGAVNCVSWNPANPHMLASASDDRTIRIWGLNNLSTKRKEPCSNGIHYCNG  578



>ref|XP_004239310.1| PREDICTED: WD repeat-containing protein 26 isoform X1 [Solanum 
lycopersicum]
Length=580

 Score =   194 bits (492),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L NQEIHLW+I+G+   ++K+ GHKR+RFV+RSCFGGL++ FI+SGSEDSQVYIWH SSG
Sbjct  459  LWNQEIHLWDIEGTAKLLSKYNGHKRSRFVIRSCFGGLNQEFISSGSEDSQVYIWHISSG  518

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVHHCNG  289
            ELV TL GHSGTVNCVSWN A+PHMLASASDD TIRIWGL QV ++ N TV N VH+CNG
Sbjct  519  ELVETLAGHSGTVNCVSWNPADPHMLASASDDHTIRIWGLNQVKMEHNDTVSNDVHYCNG  578

Query  288  GS  283
            G+
Sbjct  579  GT  580



>ref|XP_003545311.1| PREDICTED: WD repeat-containing protein 26-like [Glycine max]
 gb|KHN11996.1| WD repeat-containing protein 26 [Glycine soja]
Length=572

 Score =   193 bits (491),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            LLNQEIHLWNI+G    + K+KGHKR RF++RSCFGGL +AFIASGSEDSQVYIWHRSSG
Sbjct  451  LLNQEIHLWNIEGDPKLVGKYKGHKRARFIIRSCFGGLKQAFIASGSEDSQVYIWHRSSG  510

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVHHCNG  289
            EL+  L GHSG+VNCVSWN ANPHMLASASDDRTIR+WGL  ++ K  +   NG+H+CNG
Sbjct  511  ELIEALAGHSGSVNCVSWNPANPHMLASASDDRTIRVWGLNCLHNKYQNVHSNGIHYCNG  570

Query  288  GS  283
            G+
Sbjct  571  GT  572



>ref|XP_002302127.1| hypothetical protein POPTR_0002s05670g [Populus trichocarpa]
 gb|EEE81400.1| hypothetical protein POPTR_0002s05670g [Populus trichocarpa]
Length=580

 Score =   193 bits (491),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            LLNQEIHLW+IDG++  +AK+KGH+R RFV+RSCFGGL++AFIA GSEDSQVYIWHR SG
Sbjct  459  LLNQEIHLWSIDGNIRLVAKYKGHRRTRFVIRSCFGGLEQAFIACGSEDSQVYIWHRGSG  518

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVHHCNG  289
            +LV  L GHSG VNCVSWN ANP+MLASASDDRTIRIWGL  +++K  S   NG H+CNG
Sbjct  519  DLVEALPGHSGAVNCVSWNPANPYMLASASDDRTIRIWGLNSLHVKHKSAHSNGTHYCNG  578

Query  288  GS  283
            G+
Sbjct  579  GT  580



>ref|XP_003519528.1| PREDICTED: WD repeat-containing protein 26-like [Glycine max]
Length=573

 Score =   193 bits (491),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            LLNQEIHLWNI+G    + K+KGHKR RF++RSCFGGL +AFIASGSEDSQVYIWHRSSG
Sbjct  452  LLNQEIHLWNIEGDPKLVGKYKGHKRARFIIRSCFGGLKQAFIASGSEDSQVYIWHRSSG  511

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVHHCNG  289
            EL+  L GHSG+VNCVSWN ANPHMLASASDDRTIR+WGL  ++ K  +   NG+H+CNG
Sbjct  512  ELIEALTGHSGSVNCVSWNPANPHMLASASDDRTIRVWGLNCMHNKYQNVHSNGIHYCNG  571

Query  288  GS  283
            G+
Sbjct  572  GT  573



>ref|XP_004303899.1| PREDICTED: WD repeat-containing protein 26 [Fragaria vesca subsp. 
vesca]
Length=578

 Score =   191 bits (485),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 100/122 (82%), Gaps = 0/122 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            LLNQEIHLW+I G V  +AK++GHKR RFV+RSCFGGL+EAFIASGSEDSQVY+WHR SG
Sbjct  457  LLNQEIHLWSIAGEVKLVAKYQGHKRTRFVIRSCFGGLEEAFIASGSEDSQVYVWHRCSG  516

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVHHCNG  289
            EL+  L GHSG VN VSWN  NPHMLASASDDRTIRIWGL ++ +K      NG+H CNG
Sbjct  517  ELIEVLPGHSGAVNSVSWNPKNPHMLASASDDRTIRIWGLNELKVKHKDAHSNGIHCCNG  576

Query  288  GS  283
            GS
Sbjct  577  GS  578



>ref|XP_008380168.1| PREDICTED: WD repeat-containing protein 26-like [Malus domestica]
 ref|XP_008380169.1| PREDICTED: WD repeat-containing protein 26-like [Malus domestica]
 ref|XP_008380170.1| PREDICTED: WD repeat-containing protein 26-like [Malus domestica]
 ref|XP_008380171.1| PREDICTED: WD repeat-containing protein 26-like [Malus domestica]
Length=579

 Score =   191 bits (485),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/123 (72%), Positives = 101/123 (82%), Gaps = 1/123 (1%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            LLNQEIHLWNI+G    +AK+KGHKR RFV+RSCFGGL+EAF+ASGSEDSQVY+WHR SG
Sbjct  457  LLNQEIHLWNIEGENKLVAKYKGHKRTRFVIRSCFGGLEEAFVASGSEDSQVYVWHRGSG  516

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVH-HCN  292
            EL+  L GHSG VNCVSWN ANPHM ASASDDRTIRIWGL +  +K      NG+H +CN
Sbjct  517  ELIEALPGHSGAVNCVSWNPANPHMFASASDDRTIRIWGLSEQKVKHRGAHSNGIHLNCN  576

Query  291  GGS  283
            GG+
Sbjct  577  GGT  579



>gb|KHG30817.1| WD repeat-containing 26 [Gossypium arboreum]
Length=546

 Score =   190 bits (483),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 83/122 (68%), Positives = 102/122 (84%), Gaps = 0/122 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            LLNQEIHLW+I+  +  ++K++GHKR RF++RSCFGGL++AF+ASGSEDS VYIWHR +G
Sbjct  425  LLNQEIHLWSIEDDLKLVSKYRGHKRTRFIIRSCFGGLEQAFVASGSEDSLVYIWHRGTG  484

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVHHCNG  289
            EL+  L GHSG VNCVSWN  NPHMLASASDDRTIRIWGL  ++ KQ  T  NG+H+CNG
Sbjct  485  ELIEALPGHSGAVNCVSWNPTNPHMLASASDDRTIRIWGLNNLSAKQKDTHGNGIHYCNG  544

Query  288  GS  283
            G+
Sbjct  545  GT  546



>ref|XP_009356585.1| PREDICTED: WD repeat-containing protein 26-like [Pyrus x bretschneideri]
 ref|XP_009356586.1| PREDICTED: WD repeat-containing protein 26-like [Pyrus x bretschneideri]
 ref|XP_009356587.1| PREDICTED: WD repeat-containing protein 26-like [Pyrus x bretschneideri]
Length=579

 Score =   190 bits (482),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 100/123 (81%), Gaps = 1/123 (1%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            LLNQEIHLWNI+G    +AK+KGHKR RFV+RSCFGGL+EAF+ASGSEDSQVYIWHR SG
Sbjct  457  LLNQEIHLWNIEGENKLVAKYKGHKRTRFVIRSCFGGLEEAFVASGSEDSQVYIWHRGSG  516

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVH-HCN  292
            EL+  L GHSG VNCVSWN ANPHM ASASDDRTIRIWGL    +K      NGVH +CN
Sbjct  517  ELIEALPGHSGAVNCVSWNPANPHMFASASDDRTIRIWGLSGQKVKHRGAHSNGVHLNCN  576

Query  291  GGS  283
            GG+
Sbjct  577  GGT  579



>ref|XP_011085429.1| PREDICTED: WD repeat-containing protein 26-like [Sesamum indicum]
 ref|XP_011085430.1| PREDICTED: WD repeat-containing protein 26-like [Sesamum indicum]
Length=580

 Score =   189 bits (480),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L N+E+HLWNIDG+   +AK+KGHKR+RF+VRSCFGGL++AFIASGSEDSQVYIWHR SG
Sbjct  459  LSNEELHLWNIDGTAKLVAKYKGHKRSRFIVRSCFGGLNQAFIASGSEDSQVYIWHRLSG  518

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVHHCNG  289
            EL+ TL GHSG VNCVSWN  NPHMLASASDDRTIRIWGL +VN+  N     GV+ CNG
Sbjct  519  ELILTLAGHSGAVNCVSWNPTNPHMLASASDDRTIRIWGLSRVNMNFNGRHSTGVNCCNG  578



>gb|KHN38353.1| WD repeat-containing protein 26 [Glycine soja]
Length=570

 Score =   189 bits (479),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/119 (72%), Positives = 100/119 (84%), Gaps = 0/119 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            LLNQEIHLWNI+G    + K+KGHKR RF++RSCFGGL +AFIASGSEDSQVYIWHRSSG
Sbjct  452  LLNQEIHLWNIEGDPKLVGKYKGHKRARFIIRSCFGGLKQAFIASGSEDSQVYIWHRSSG  511

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVHHCN  292
            EL+  L GHSG+VNCVSWN ANPHMLASASDDRTIR+WGL  ++ K  +   NG+H+CN
Sbjct  512  ELIEALTGHSGSVNCVSWNPANPHMLASASDDRTIRVWGLNCMHNKYQNVHSNGIHYCN  570



>ref|XP_009405376.1| PREDICTED: WD repeat-containing protein 26-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009405377.1| PREDICTED: WD repeat-containing protein 26-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009405378.1| PREDICTED: WD repeat-containing protein 26-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009405379.1| PREDICTED: WD repeat-containing protein 26-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009405380.1| PREDICTED: WD repeat-containing protein 26-like [Musa acuminata 
subsp. malaccensis]
Length=582

 Score =   188 bits (478),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 101/121 (83%), Gaps = 1/121 (1%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L+NQEIHLWNI      + ++KGHKR+RF++RSCFGG ++AFIASGSEDSQVYIWHRSSG
Sbjct  459  LINQEIHLWNIKDDPKLVTRYKGHKRSRFLIRSCFGGTEQAFIASGSEDSQVYIWHRSSG  518

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNG-VHHCN  292
            +L+ TL GHSGTVNCVSWN +NPHMLASASDD TIRIWGL +VNLK+     NG VH CN
Sbjct  519  DLIQTLPGHSGTVNCVSWNPSNPHMLASASDDHTIRIWGLNRVNLKRKEIYSNGTVHLCN  578

Query  291  G  289
            G
Sbjct  579  G  579



>ref|XP_010256452.1| PREDICTED: WD repeat-containing protein 26 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010256453.1| PREDICTED: WD repeat-containing protein 26 isoform X1 [Nelumbo 
nucifera]
Length=584

 Score =   188 bits (477),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 102/124 (82%), Gaps = 3/124 (2%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            LLNQEIHLW+I+G    IAK+KGHKR RFV+RSC GG ++ FIASGSEDSQVYIWHR + 
Sbjct  460  LLNQEIHLWSIEGDPKLIAKYKGHKRTRFVIRSCLGGFNQTFIASGSEDSQVYIWHRGTA  519

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNS--TVCNG-VHH  298
            EL+  L GHSGTVNCVSWN A+PHMLASASDDRTIRIWGL +VNLK+    +  NG VHH
Sbjct  520  ELLEVLPGHSGTVNCVSWNPADPHMLASASDDRTIRIWGLNRVNLKRKDIHSHSNGVVHH  579

Query  297  CNGG  286
            CNGG
Sbjct  580  CNGG  583



>ref|XP_010256454.1| PREDICTED: WD repeat-containing protein 26 isoform X2 [Nelumbo 
nucifera]
Length=543

 Score =   187 bits (475),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 102/124 (82%), Gaps = 3/124 (2%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            LLNQEIHLW+I+G    IAK+KGHKR RFV+RSC GG ++ FIASGSEDSQVYIWHR + 
Sbjct  419  LLNQEIHLWSIEGDPKLIAKYKGHKRTRFVIRSCLGGFNQTFIASGSEDSQVYIWHRGTA  478

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNS--TVCNG-VHH  298
            EL+  L GHSGTVNCVSWN A+PHMLASASDDRTIRIWGL +VNLK+    +  NG VHH
Sbjct  479  ELLEVLPGHSGTVNCVSWNPADPHMLASASDDRTIRIWGLNRVNLKRKDIHSHSNGVVHH  538

Query  297  CNGG  286
            CNGG
Sbjct  539  CNGG  542



>gb|KEH33653.1| transducin/WD40 repeat protein [Medicago truncatula]
Length=581

 Score =   186 bits (473),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 101/122 (83%), Gaps = 1/122 (1%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            LLNQEIHLWNI+G +  + K+K H+R+RFV+RSCFGGL ++FIASGSEDSQVYIWHRSSG
Sbjct  458  LLNQEIHLWNIEGDLKLVGKYKSHRRSRFVIRSCFGGLKQSFIASGSEDSQVYIWHRSSG  517

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNG-VHHCN  292
            +LV  L GHSG VNCVSWN ANPHMLASASDDRT+RIWGLK ++ K  +   NG  HHCN
Sbjct  518  DLVDALPGHSGAVNCVSWNPANPHMLASASDDRTVRIWGLKCLDAKYPNAYSNGNSHHCN  577

Query  291  GG  286
             G
Sbjct  578  CG  579



>ref|XP_007146281.1| hypothetical protein PHAVU_006G027500g [Phaseolus vulgaris]
 gb|ESW18275.1| hypothetical protein PHAVU_006G027500g [Phaseolus vulgaris]
Length=586

 Score =   186 bits (473),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 102/124 (82%), Gaps = 3/124 (2%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            LL+QEIHLWNI+G    I K++ HKR R +VRSCFGGL ++FIASGSEDSQVYIWHR+SG
Sbjct  459  LLDQEIHLWNIEGDPKLIGKYRSHKRTRLIVRSCFGGLKQSFIASGSEDSQVYIWHRNSG  518

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLK--QNSTVCNG-VHH  298
            +LV  L GHSG VNCVSWN ANPHMLASASDDRTIRIWGLK++N+K   N    NG VH+
Sbjct  519  DLVEALPGHSGAVNCVSWNPANPHMLASASDDRTIRIWGLKRLNVKYPPNLLRTNGVVHY  578

Query  297  CNGG  286
            CNGG
Sbjct  579  CNGG  582



>ref|XP_009419551.1| PREDICTED: WD repeat-containing protein 26-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009419552.1| PREDICTED: WD repeat-containing protein 26-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009419553.1| PREDICTED: WD repeat-containing protein 26-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009419554.1| PREDICTED: WD repeat-containing protein 26-like [Musa acuminata 
subsp. malaccensis]
Length=543

 Score =   185 bits (470),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 101/124 (81%), Gaps = 2/124 (2%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L+NQEIHLWNI      +  +KGHKR+RF++RSCFGGL++AFIASGSEDSQVYIWHRS+G
Sbjct  419  LINQEIHLWNIRNDPKLVTTYKGHKRSRFLIRSCFGGLEQAFIASGSEDSQVYIWHRSTG  478

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNG--VHHC  295
            +L+  L GHSGTVNCVSWN +NPHMLASASDD TIRIWGL +VN K+  T  NG  +H C
Sbjct  479  DLLEALPGHSGTVNCVSWNPSNPHMLASASDDHTIRIWGLSKVNRKRKETYSNGTVLHLC  538

Query  294  NGGS  283
            NG S
Sbjct  539  NGSS  542



>ref|XP_010054068.1| PREDICTED: WD repeat-containing protein 26 [Eucalyptus grandis]
 gb|KCW89786.1| hypothetical protein EUGRSUZ_A02037 [Eucalyptus grandis]
 gb|KCW89787.1| hypothetical protein EUGRSUZ_A02037 [Eucalyptus grandis]
 gb|KCW89788.1| hypothetical protein EUGRSUZ_A02037 [Eucalyptus grandis]
Length=584

 Score =   186 bits (471),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            LLNQEIHLW+I G    +AK+KG KR+RFV+RSCFGGL +AF+ASGSEDSQVYIWH+ SG
Sbjct  461  LLNQEIHLWDIKGDFRLVAKYKGLKRSRFVIRSCFGGLKQAFVASGSEDSQVYIWHKGSG  520

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVHHCNG  289
            EL+  L GHSG VNCVSWN AN HMLASASDDRTIRIWGL ++N +      NGVH+CNG
Sbjct  521  ELIEPLPGHSGAVNCVSWNPANHHMLASASDDRTIRIWGLNELNTRHKGARPNGVHYCNG  580



>gb|KJB48956.1| hypothetical protein B456_008G095100 [Gossypium raimondii]
 gb|KJB48957.1| hypothetical protein B456_008G095100 [Gossypium raimondii]
 gb|KJB48958.1| hypothetical protein B456_008G095100 [Gossypium raimondii]
Length=580

 Score =   185 bits (470),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 82/122 (67%), Positives = 100/122 (82%), Gaps = 0/122 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            LLNQEIHLW+I+  +  ++K++GHKR RF++RSCFGGL++AF+ASGSEDS VYIWHR +G
Sbjct  459  LLNQEIHLWSIEDDLKLVSKYRGHKRTRFIIRSCFGGLEQAFVASGSEDSLVYIWHRGTG  518

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVHHCNG  289
            EL+  L GHSG VNCVSWN  NPHMLASASDDRTIRIWGL  ++ KQ  T  NG H+ NG
Sbjct  519  ELIEALPGHSGAVNCVSWNPTNPHMLASASDDRTIRIWGLNNLSAKQKDTHGNGFHYSNG  578

Query  288  GS  283
            G+
Sbjct  579  GT  580



>ref|XP_011100498.1| PREDICTED: WD repeat-containing protein 26-like isoform X2 [Sesamum 
indicum]
Length=544

 Score =   184 bits (468),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L N+E+HLWNIDG +  IAK+KGHKR+RFVVRSCFGGL++AFIASGSEDSQV+IWH+ SG
Sbjct  418  LFNEELHLWNIDGCIRLIAKYKGHKRSRFVVRSCFGGLEQAFIASGSEDSQVHIWHKVSG  477

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVHHCNG  289
            EL+ TL GHSG VNCVSWN ANPHMLASASDDRTIRIWGL Q N+  +    NG+H   G
Sbjct  478  ELILTLAGHSGAVNCVSWNPANPHMLASASDDRTIRIWGLNQDNMNCSGRHSNGIHCVMG  537



>ref|XP_011100492.1| PREDICTED: WD repeat-containing protein 26-like isoform X1 [Sesamum 
indicum]
 ref|XP_011100493.1| PREDICTED: WD repeat-containing protein 26-like isoform X1 [Sesamum 
indicum]
 ref|XP_011100494.1| PREDICTED: WD repeat-containing protein 26-like isoform X1 [Sesamum 
indicum]
 ref|XP_011100495.1| PREDICTED: WD repeat-containing protein 26-like isoform X1 [Sesamum 
indicum]
 ref|XP_011100497.1| PREDICTED: WD repeat-containing protein 26-like isoform X1 [Sesamum 
indicum]
Length=585

 Score =   185 bits (469),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 99/116 (85%), Gaps = 0/116 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L N+E+HLWNIDG +  IAK+KGHKR+RFVVRSCFGGL++AFIASGSEDSQV+IWH+ SG
Sbjct  459  LFNEELHLWNIDGCIRLIAKYKGHKRSRFVVRSCFGGLEQAFIASGSEDSQVHIWHKVSG  518

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVH  301
            EL+ TL GHSG VNCVSWN ANPHMLASASDDRTIRIWGL Q N+  +    NG+H
Sbjct  519  ELILTLAGHSGAVNCVSWNPANPHMLASASDDRTIRIWGLNQDNMNCSGRHSNGIH  574



>ref|XP_006448496.1| hypothetical protein CICLE_v10014731mg [Citrus clementina]
 ref|XP_006448497.1| hypothetical protein CICLE_v10014731mg [Citrus clementina]
 ref|XP_006448498.1| hypothetical protein CICLE_v10014731mg [Citrus clementina]
 ref|XP_006448499.1| hypothetical protein CICLE_v10014731mg [Citrus clementina]
 gb|ESR61736.1| hypothetical protein CICLE_v10014731mg [Citrus clementina]
 gb|ESR61737.1| hypothetical protein CICLE_v10014731mg [Citrus clementina]
 gb|ESR61738.1| hypothetical protein CICLE_v10014731mg [Citrus clementina]
 gb|ESR61739.1| hypothetical protein CICLE_v10014731mg [Citrus clementina]
Length=581

 Score =   184 bits (468),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L+NQEIHLW+I+     ++++KGHKR RFV+RSCFGG ++AFIASGSEDSQVYIWHR +G
Sbjct  460  LINQEIHLWSIESDPKLVSRYKGHKRARFVIRSCFGGFEQAFIASGSEDSQVYIWHRYTG  519

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVHHCNG  289
            ELV  L GHSG+VNCVSWN AN HMLASASDDRTIRIWGL Q+N+K        VHHCNG
Sbjct  520  ELVLALAGHSGSVNCVSWNPANLHMLASASDDRTIRIWGLDQINMKHRDQSNGIVHHCNG  579



>ref|XP_006468682.1| PREDICTED: WD repeat-containing protein 26-like isoform X1 [Citrus 
sinensis]
 ref|XP_006468683.1| PREDICTED: WD repeat-containing protein 26-like isoform X2 [Citrus 
sinensis]
 gb|KDO77040.1| hypothetical protein CISIN_1g008011mg [Citrus sinensis]
 gb|KDO77041.1| hypothetical protein CISIN_1g008011mg [Citrus sinensis]
Length=581

 Score =   184 bits (468),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L+NQEIHLW+I+     ++++KGHKR RFV+RSCFGG ++AFIASGSEDSQVYIWHR +G
Sbjct  460  LINQEIHLWSIESDPKLVSRYKGHKRARFVIRSCFGGFEQAFIASGSEDSQVYIWHRYTG  519

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVHHCNG  289
            ELV  L GHSG+VNCVSWN AN HMLASASDDRTIRIWGL Q+N+K        VHHCNG
Sbjct  520  ELVLALAGHSGSVNCVSWNPANLHMLASASDDRTIRIWGLDQINMKHRDQSNGIVHHCNG  579



>ref|XP_010680145.1| PREDICTED: uncharacterized WD repeat-containing protein C343.04c 
[Beta vulgaris subsp. vulgaris]
Length=582

 Score =   184 bits (467),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 85/122 (70%), Positives = 100/122 (82%), Gaps = 0/122 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L NQEIHLW IDG +  +A++KGHKR+RFVVRSCFGGL+++FIASGSEDSQVYIWHRSSG
Sbjct  461  LANQEIHLWTIDGDIKLVAQYKGHKRSRFVVRSCFGGLEQSFIASGSEDSQVYIWHRSSG  520

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVHHCNG  289
            +LV  L GHSG VNCVSWN  + HMLA+ASDDRTIRIWGL   N+++     NG H+CNG
Sbjct  521  QLVDILPGHSGVVNCVSWNPVDHHMLATASDDRTIRIWGLNGANMRRRVCQSNGSHNCNG  580

Query  288  GS  283
             S
Sbjct  581  KS  582



>ref|XP_007141447.1| hypothetical protein PHAVU_008G196400g [Phaseolus vulgaris]
 gb|ESW13441.1| hypothetical protein PHAVU_008G196400g [Phaseolus vulgaris]
Length=573

 Score =   184 bits (467),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 99/121 (82%), Gaps = 1/121 (1%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            LLNQEIHLWNI+G    + K+KGH+  RF++RSCFGGL +AFIASGSEDSQVYIWHRSSG
Sbjct  451  LLNQEIHLWNIEGDPRLVGKYKGHRSARFIIRSCFGGLKQAFIASGSEDSQVYIWHRSSG  510

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGV-HHCN  292
            EL+  L GHSG+VNCVSWN ANPHMLASASDDRTIRIWGL  ++    +   NG+ HHCN
Sbjct  511  ELIEALPGHSGSVNCVSWNPANPHMLASASDDRTIRIWGLNCLHNNYQNVPSNGIHHHCN  570

Query  291  G  289
            G
Sbjct  571  G  571



>ref|XP_008775985.1| PREDICTED: WD repeat-containing protein 26-like [Phoenix dactylifera]
Length=582

 Score =   183 bits (464),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/121 (69%), Positives = 97/121 (80%), Gaps = 1/121 (1%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            LLNQEIHLW++      + ++ GHKR+RF++RSCFGG +EAFIASGSEDSQVYIWHR +G
Sbjct  459  LLNQEIHLWSVTDDPILVTRYTGHKRSRFLIRSCFGGYEEAFIASGSEDSQVYIWHRGTG  518

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGV-HHCN  292
            +L+  L GHSG VNCVSWN ANPHMLASASDD TIRIWGLK+  LK+     NGV HHCN
Sbjct  519  DLIEALPGHSGAVNCVSWNPANPHMLASASDDHTIRIWGLKKATLKRKEAYSNGVIHHCN  578

Query  291  G  289
            G
Sbjct  579  G  579



>ref|XP_004499533.1| PREDICTED: WD repeat-containing protein 26-like isoform X2 [Cicer 
arietinum]
Length=540

 Score =   181 bits (460),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 98/122 (80%), Gaps = 1/122 (1%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            LLNQEIHLWNI G +  + K+K HKR RFV+RSCFGG  ++FIASGSEDSQVYIWHR+S 
Sbjct  418  LLNQEIHLWNI-GDLQLVRKYKSHKRARFVIRSCFGGFRQSFIASGSEDSQVYIWHRNSE  476

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVHHCNG  289
            +LV  L GHSG VNCVSWN ANPHMLASASDDRTIRIWGLK +N+K  +   NG HH NG
Sbjct  477  DLVDVLPGHSGAVNCVSWNPANPHMLASASDDRTIRIWGLKCLNVKYPNAYSNGNHHSNG  536

Query  288  GS  283
            G 
Sbjct  537  GE  538



>ref|XP_007043170.1| Transducin family protein / WD-40 repeat family protein isoform 
1 [Theobroma cacao]
 ref|XP_007043171.1| Transducin family protein / WD-40 repeat family protein isoform 
1 [Theobroma cacao]
 ref|XP_007043172.1| Transducin family protein / WD-40 repeat family protein isoform 
1 [Theobroma cacao]
 gb|EOX99001.1| Transducin family protein / WD-40 repeat family protein isoform 
1 [Theobroma cacao]
 gb|EOX99002.1| Transducin family protein / WD-40 repeat family protein isoform 
1 [Theobroma cacao]
 gb|EOX99003.1| Transducin family protein / WD-40 repeat family protein isoform 
1 [Theobroma cacao]
Length=581

 Score =   182 bits (462),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 96/122 (79%), Gaps = 0/122 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L+NQEIHLW+I+G    ++K+KGHKR RFV+RSCFGGL +AFIASGSEDSQVYIWHR S 
Sbjct  460  LINQEIHLWSIEGDPKLVSKYKGHKRTRFVIRSCFGGLGQAFIASGSEDSQVYIWHRCSR  519

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVHHCNG  289
            EL+  L GHSG VNCVSWN AN HMLASASDDRTIRIWGL   NLK        +HHCNG
Sbjct  520  ELLLALPGHSGAVNCVSWNPANLHMLASASDDRTIRIWGLDHFNLKHRDQNNGAIHHCNG  579

Query  288  GS  283
             S
Sbjct  580  RS  581



>ref|XP_004499532.1| PREDICTED: WD repeat-containing protein 26-like isoform X1 [Cicer 
arietinum]
Length=574

 Score =   181 bits (460),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 98/122 (80%), Gaps = 1/122 (1%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            LLNQEIHLWNI G +  + K+K HKR RFV+RSCFGG  ++FIASGSEDSQVYIWHR+S 
Sbjct  452  LLNQEIHLWNI-GDLQLVRKYKSHKRARFVIRSCFGGFRQSFIASGSEDSQVYIWHRNSE  510

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVHHCNG  289
            +LV  L GHSG VNCVSWN ANPHMLASASDDRTIRIWGLK +N+K  +   NG HH NG
Sbjct  511  DLVDVLPGHSGAVNCVSWNPANPHMLASASDDRTIRIWGLKCLNVKYPNAYSNGNHHSNG  570

Query  288  GS  283
            G 
Sbjct  571  GE  572



>ref|XP_010093188.1| WD repeat-containing protein 26 [Morus notabilis]
 gb|EXB53676.1| WD repeat-containing protein 26 [Morus notabilis]
Length=588

 Score =   181 bits (460),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 86/133 (65%), Positives = 99/133 (74%), Gaps = 11/133 (8%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQV--------  493
            LLNQEIHLWNI G +  + K+KGHKR RFV+RSCFGG ++AFIASGSEDSQV        
Sbjct  456  LLNQEIHLWNIQGEIKLVTKYKGHKRTRFVIRSCFGGTEQAFIASGSEDSQVTNLAMPIQ  515

Query  492  -YIWHRSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTV  316
             YIWHR +GEL+  L GHSG VNCVSWN  NPHMLASASDDRTIRIWGL  +N+K     
Sbjct  516  VYIWHRGTGELIEALPGHSGAVNCVSWNPVNPHMLASASDDRTIRIWGLNNLNVKSKGKD  575

Query  315  C--NGVHHCNGGS  283
               NG+H+CNG +
Sbjct  576  AHSNGIHYCNGKT  588



>ref|XP_004171491.1| PREDICTED: WD repeat-containing protein 26-like, partial [Cucumis 
sativus]
Length=571

 Score =   181 bits (458),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 96/110 (87%), Gaps = 0/110 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            LLNQEIHLW++ G    ++K+KGH+R RFV+RSCFGGL+EAFIASGSEDSQVYIWHR SG
Sbjct  461  LLNQEIHLWSLVGEPNLVSKYKGHRRTRFVIRSCFGGLEEAFIASGSEDSQVYIWHRGSG  520

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNST  319
            EL+ +L GHSG+VNCVSWN  NPHMLASASDD TIRIWGLK +N+K+N+ 
Sbjct  521  ELIESLPGHSGSVNCVSWNPTNPHMLASASDDHTIRIWGLKGLNIKRNNA  570



>ref|XP_010943696.1| PREDICTED: uncharacterized WD repeat-containing protein C343.04c-like 
[Elaeis guineensis]
 ref|XP_010943697.1| PREDICTED: uncharacterized WD repeat-containing protein C343.04c-like 
[Elaeis guineensis]
Length=582

 Score =   179 bits (454),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 96/121 (79%), Gaps = 1/121 (1%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L+NQEIHLW+I      + +++GHKR+RF++RSCFGG ++ FIASGSEDSQVYIWHR +G
Sbjct  459  LVNQEIHLWSIKDDPGLVTRYRGHKRSRFLIRSCFGGYEQTFIASGSEDSQVYIWHRETG  518

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGV-HHCN  292
            EL+  L GHSG VNCVSWN ANPHMLASASDD TIRIWGL + NLK+     NGV H CN
Sbjct  519  ELIKALPGHSGAVNCVSWNPANPHMLASASDDHTIRIWGLNRANLKRKEAYSNGVTHQCN  578

Query  291  G  289
            G
Sbjct  579  G  579



>gb|KJB47107.1| hypothetical protein B456_008G011600 [Gossypium raimondii]
Length=574

 Score =   178 bits (451),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/122 (70%), Positives = 96/122 (79%), Gaps = 0/122 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L+NQEIHLW+I+G    I+++KGHKR RFV+RSCFGGLD++FIASGSEDSQVYIWHR SG
Sbjct  453  LMNQEIHLWSIEGDPKLISEYKGHKRTRFVIRSCFGGLDQSFIASGSEDSQVYIWHRCSG  512

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVHHCNG  289
            EL+  L GHSG VNCVSWN  N HMLASASDD TIRIWGL + NLK         HHCNG
Sbjct  513  ELLLALPGHSGAVNCVSWNPGNLHMLASASDDGTIRIWGLDRFNLKGGEQSNGSNHHCNG  572

Query  288  GS  283
             S
Sbjct  573  RS  574



>gb|KJB47106.1| hypothetical protein B456_008G011600 [Gossypium raimondii]
 gb|KJB47109.1| hypothetical protein B456_008G011600 [Gossypium raimondii]
 gb|KJB47110.1| hypothetical protein B456_008G011600 [Gossypium raimondii]
Length=580

 Score =   178 bits (451),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/122 (70%), Positives = 96/122 (79%), Gaps = 0/122 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L+NQEIHLW+I+G    I+++KGHKR RFV+RSCFGGLD++FIASGSEDSQVYIWHR SG
Sbjct  459  LMNQEIHLWSIEGDPKLISEYKGHKRTRFVIRSCFGGLDQSFIASGSEDSQVYIWHRCSG  518

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVHHCNG  289
            EL+  L GHSG VNCVSWN  N HMLASASDD TIRIWGL + NLK         HHCNG
Sbjct  519  ELLLALPGHSGAVNCVSWNPGNLHMLASASDDGTIRIWGLDRFNLKGGEQSNGSNHHCNG  578

Query  288  GS  283
             S
Sbjct  579  RS  580



>gb|EYU42814.1| hypothetical protein MIMGU_mgv1a003386mg [Erythranthe guttata]
 gb|EYU42816.1| hypothetical protein MIMGU_mgv1a003386mg [Erythranthe guttata]
Length=489

 Score =   176 bits (447),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            LLN E+H+WNIDG    +AK+KGHKR RFVVRSCFGGL++AFIASGSEDSQVYIWHR S 
Sbjct  358  LLNGELHVWNIDGCTRLVAKYKGHKRTRFVVRSCFGGLEQAFIASGSEDSQVYIWHRLSK  417

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNL  334
            EL+ TL GH+  VNCVSWN ANP+MLASASDDRTIRIWGL QVN+
Sbjct  418  ELILTLAGHTAAVNCVSWNPANPYMLASASDDRTIRIWGLNQVNM  462



>ref|XP_004162570.1| PREDICTED: WD repeat-containing protein 26-like [Cucumis sativus]
 gb|KGN54948.1| hypothetical protein Csa_4G614210 [Cucumis sativus]
Length=591

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 102/130 (78%), Gaps = 8/130 (6%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            LLNQEIHLWN++G    +  + GHKR RFV+RSCFGGLD+AFIASGSEDS VYIWHR +G
Sbjct  461  LLNQEIHLWNLEGEAEIVTTYTGHKRTRFVIRSCFGGLDQAFIASGSEDSLVYIWHRGTG  520

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQV-------NLKQNSTV-C  313
            E++  L GHSG+VNCVSWN  NPHMLASASDD TIRIWGL+++       N +Q+S+   
Sbjct  521  EVIEALAGHSGSVNCVSWNPTNPHMLASASDDHTIRIWGLRELDDVVKFKNTEQHSSSNG  580

Query  312  NGVHHCNGGS  283
            NGVH+ NGG+
Sbjct  581  NGVHYTNGGT  590



>ref|XP_004149516.1| PREDICTED: WD repeat-containing protein 26-like [Cucumis sativus]
Length=591

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 102/130 (78%), Gaps = 8/130 (6%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            LLNQEIHLWN++G    +  + GHKR RFV+RSCFGGLD+AFIASGSEDS VYIWHR +G
Sbjct  461  LLNQEIHLWNLEGEAEIVTTYTGHKRTRFVIRSCFGGLDQAFIASGSEDSLVYIWHRGTG  520

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQV-------NLKQNSTV-C  313
            E++  L GHSG+VNCVSWN  NPHMLASASDD TIRIWGL+++       N +Q+S+   
Sbjct  521  EVIEALAGHSGSVNCVSWNPTNPHMLASASDDHTIRIWGLRELDDVVKFKNTEQHSSSNG  580

Query  312  NGVHHCNGGS  283
            NGVH+ NGG+
Sbjct  581  NGVHYTNGGT  590



>ref|XP_008466801.1| PREDICTED: uncharacterized WD repeat-containing protein C343.04c-like 
[Cucumis melo]
Length=594

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 101/133 (76%), Gaps = 11/133 (8%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            LLNQEIHLWN++G    +  + GHKR RFV+RSCFGGLD+AFIASGSEDS VYIWHR +G
Sbjct  461  LLNQEIHLWNLEGEAEIVTTYTGHKRTRFVIRSCFGGLDQAFIASGSEDSLVYIWHRGTG  520

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQV-------NLKQNSTV--  316
            E++  L GHSG+VNCVSWN  NPHMLASASDD TIRIWGL+++       N +Q S+   
Sbjct  521  EVIEALEGHSGSVNCVSWNPTNPHMLASASDDHTIRIWGLRELDDVVKFKNTEQYSSSNG  580

Query  315  --CNGVHHCNGGS  283
               NGVH+ NGG+
Sbjct  581  NGPNGVHYSNGGT  593



>ref|XP_002513152.1| WD-repeat protein, putative [Ricinus communis]
 gb|EEF49655.1| WD-repeat protein, putative [Ricinus communis]
Length=578

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/122 (67%), Positives = 94/122 (77%), Gaps = 0/122 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L+NQE+HLWNI+GS   ++ +KGH R RF++RSCFGG ++AFIASGSEDSQVYIWHR SG
Sbjct  457  LINQELHLWNIEGSPKIVSTYKGHTRTRFIIRSCFGGFEQAFIASGSEDSQVYIWHRGSG  516

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVHHCNG  289
            EL+  L GHSG VNCVSWN  N HMLAS SDDRTIRIWGL   +LKQ       VH CNG
Sbjct  517  ELLLALPGHSGAVNCVSWNPENLHMLASGSDDRTIRIWGLNHYSLKQREQSNGTVHRCNG  576

Query  288  GS  283
             S
Sbjct  577  RS  578



>gb|EYU42813.1| hypothetical protein MIMGU_mgv1a003386mg [Erythranthe guttata]
 gb|EYU42815.1| hypothetical protein MIMGU_mgv1a003386mg [Erythranthe guttata]
Length=588

 Score =   177 bits (449),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            LLN E+H+WNIDG    +AK+KGHKR RFVVRSCFGGL++AFIASGSEDSQVYIWHR S 
Sbjct  457  LLNGELHVWNIDGCTRLVAKYKGHKRTRFVVRSCFGGLEQAFIASGSEDSQVYIWHRLSK  516

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNL  334
            EL+ TL GH+  VNCVSWN ANP+MLASASDDRTIRIWGL QVN+
Sbjct  517  ELILTLAGHTAAVNCVSWNPANPYMLASASDDRTIRIWGLNQVNM  561



>gb|EPS60063.1| hypothetical protein M569_14740 [Genlisea aurea]
Length=622

 Score =   177 bits (450),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            LLN+E+HLWNIDG    I+K+KGHKR+RFVVRSCFGGLDEAFI SGSEDSQVYIWHR SG
Sbjct  482  LLNEELHLWNIDGVPKVISKYKGHKRSRFVVRSCFGGLDEAFIGSGSEDSQVYIWHRVSG  541

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVN  337
            EL+ TL GHSG VNCVSWN  NPHMLAS SDDRTIRIWGL +++
Sbjct  542  ELILTLGGHSGAVNCVSWNPTNPHMLASGSDDRTIRIWGLNRMD  585



>gb|KHG19792.1| WD repeat-containing 26 [Gossypium arboreum]
Length=539

 Score =   175 bits (444),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 84/122 (69%), Positives = 95/122 (78%), Gaps = 0/122 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L+NQEIHLW+I+G    I+++KGHKR RFV+RSCFGGLD++FIASGSEDSQVYIWHR SG
Sbjct  418  LMNQEIHLWSIEGDPKLISEYKGHKRTRFVIRSCFGGLDQSFIASGSEDSQVYIWHRCSG  477

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVHHCNG  289
            EL+  L GHSG VNCVSWN  N HMLASASDD TIRIWGL + NLK         H CNG
Sbjct  478  ELLLALPGHSGAVNCVSWNPGNLHMLASASDDGTIRIWGLDRFNLKGGEQSNGSNHQCNG  537

Query  288  GS  283
             S
Sbjct  538  RS  539



>ref|XP_008221109.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized WD repeat-containing 
protein C343.04c [Prunus mume]
Length=562

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 95/117 (81%), Gaps = 0/117 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L+NQEIHLW+I+     ++K+KGHKR RFV+RSCFGG ++AFIASGSEDSQVYIWHR SG
Sbjct  437  LINQEIHLWSIESEPKVVSKYKGHKRARFVIRSCFGGFEQAFIASGSEDSQVYIWHRGSG  496

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVHH  298
            +L+  L GHSG VNCVSWN  N HMLASASDDRTIR+WGL  +NL++  +  NG+ H
Sbjct  497  KLLLALPGHSGAVNCVSWNPVNLHMLASASDDRTIRVWGLDHLNLRRKVSQSNGIAH  553



>gb|KDP40461.1| hypothetical protein JCGZ_24460 [Jatropha curcas]
Length=366

 Score =   171 bits (432),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/122 (67%), Positives = 96/122 (79%), Gaps = 0/122 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L+NQEIHLW+I+G+   ++K+KGH R RFV+RSCFGG ++AFIASGSEDSQVYIWHR SG
Sbjct  245  LINQEIHLWSIEGNPKIVSKYKGHTRARFVIRSCFGGFEQAFIASGSEDSQVYIWHRGSG  304

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVHHCNG  289
            EL+  L GHSG VNCVSWN AN HMLAS SDDRTIRIWGL   +L+Q +      H CNG
Sbjct  305  ELLLALPGHSGAVNCVSWNPANLHMLASGSDDRTIRIWGLNHHSLEQRNQSNGITHACNG  364

Query  288  GS  283
             S
Sbjct  365  RS  366



>ref|XP_010103563.1| WD repeat-containing protein 26 [Morus notabilis]
 gb|EXB96340.1| WD repeat-containing protein 26 [Morus notabilis]
Length=721

 Score =   175 bits (444),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 100/123 (81%), Gaps = 3/123 (2%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L+NQEIHLWNI+G +  +AK+KGHKR RFV+RSCFGGL +AF+ASGSEDSQVYIWHR SG
Sbjct  459  LINQEIHLWNIEGEIKVVAKYKGHKRARFVIRSCFGGLGQAFVASGSEDSQVYIWHRDSG  518

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGL-KQVNLKQNSTVCNGVHH--  298
            EL+ +L GHSG VNCVSW+ +N HMLASASDDRTIRIWGL KQ+N  +   V + +    
Sbjct  519  ELIMSLPGHSGAVNCVSWSPSNLHMLASASDDRTIRIWGLKKQLNSMRGEKVRHALAEAL  578

Query  297  CNG  289
            CNG
Sbjct  579  CNG  581



>ref|XP_010906218.1| PREDICTED: WD repeat-containing protein 26-like [Elaeis guineensis]
 ref|XP_010906219.1| PREDICTED: WD repeat-containing protein 26-like [Elaeis guineensis]
Length=584

 Score =   174 bits (441),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 97/125 (78%), Gaps = 3/125 (2%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L+NQEIHLW+I      I K+KGHKR+R V+RSCFGG ++AF+ASGSEDSQVYIWHR  G
Sbjct  459  LINQEIHLWSIVDEPMLITKYKGHKRSRLVIRSCFGGFEQAFVASGSEDSQVYIWHRDGG  518

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNST--VCNG-VHH  298
            +LV  L GH+G VNCVSWN  N HMLASASDD TIR+WGL +VNLK+  +   CNG VH 
Sbjct  519  DLVRALPGHAGAVNCVSWNPTNHHMLASASDDHTIRVWGLNRVNLKRKDSGYYCNGVVHQ  578

Query  297  CNGGS  283
            CNG S
Sbjct  579  CNGNS  583



>ref|XP_010908947.1| PREDICTED: uncharacterized WD repeat-containing protein C343.04c-like 
[Elaeis guineensis]
Length=272

 Score =   167 bits (424),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 94/121 (78%), Gaps = 1/121 (1%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L+NQEIHLW+I      + +++GHKR+RF++RSCFGG ++ FIASGSEDSQVYIW+R +G
Sbjct  149  LVNQEIHLWSIKDDPILVTRYRGHKRSRFLIRSCFGGYEQTFIASGSEDSQVYIWYRETG  208

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGV-HHCN  292
            +L+  L GHSG VNCVSWN  N HMLASASDD TIRIWGL + NLK+     NGV H CN
Sbjct  209  DLIRALPGHSGAVNCVSWNPTNLHMLASASDDHTIRIWGLNRANLKRKEAYSNGVAHQCN  268

Query  291  G  289
            G
Sbjct  269  G  269



>ref|XP_007222293.1| hypothetical protein PRUPE_ppa003324mg [Prunus persica]
 gb|EMJ23492.1| hypothetical protein PRUPE_ppa003324mg [Prunus persica]
Length=585

 Score =   174 bits (441),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 94/117 (80%), Gaps = 0/117 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L+NQEIHLW+I+     ++K+KGHKR RFV+RSCFGG ++AFIASGSEDSQVYIWHR SG
Sbjct  460  LINQEIHLWSIESEPKVVSKYKGHKRARFVIRSCFGGFEQAFIASGSEDSQVYIWHRGSG  519

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVHH  298
            EL+  L GHSG VNCVSWN  N HMLASASDDRTIR+WGL  +NL++  +  N + H
Sbjct  520  ELLLALPGHSGAVNCVSWNPVNLHMLASASDDRTIRVWGLDHLNLRRKVSQSNDIAH  576



>ref|XP_008790475.1| PREDICTED: WD repeat-containing protein 26-like [Phoenix dactylifera]
Length=582

 Score =   174 bits (440),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 95/121 (79%), Gaps = 1/121 (1%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L+NQEIHLW+I     C+ +++GHKR+RF++RSCFGG  +AFIASGSEDSQVYIWHR +G
Sbjct  459  LVNQEIHLWSIKDDPVCVTRYRGHKRSRFLIRSCFGGYKQAFIASGSEDSQVYIWHRGTG  518

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGV-HHCN  292
            +L+  L GHSG VNCVSWN A+PHMLASASDD TIRIWGL + +LK      NGV   CN
Sbjct  519  DLIKALPGHSGAVNCVSWNPADPHMLASASDDHTIRIWGLNRAHLKCKEAYSNGVADQCN  578

Query  291  G  289
            G
Sbjct  579  G  579



>gb|EYU42800.1| hypothetical protein MIMGU_mgv1a003351mg [Erythranthe guttata]
Length=590

 Score =   173 bits (439),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 96/168 (57%), Positives = 112/168 (67%), Gaps = 34/168 (20%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            LLN+E+H+WNIDG    +AK+KGHKR+RFVVRSCFGGL++AFIASGSEDSQVYIWHR S 
Sbjct  452  LLNEELHVWNIDGCTKLVAKYKGHKRSRFVVRSCFGGLEQAFIASGSEDSQVYIWHRLSK  511

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVHHCNG  289
            EL+ TL GHS TVNCVSWN  NP+MLASASDDRTIRIWGL QVN+ +N            
Sbjct  512  ELILTLAGHSATVNCVSWNPVNPYMLASASDDRTIRIWGLNQVNMNKN------------  559

Query  288  GS*NWGCFT*GGSFSSIDGCFRVNPLQVNVQQNCTVRTVSNGVHHCNG  145
                      GG +S             N   N   R+ SNGV++CNG
Sbjct  560  ----------GGQYSH------------NNNNNNNSRSNSNGVNYCNG  585



>ref|XP_006351997.1| PREDICTED: WD repeat-containing protein 26-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006351998.1| PREDICTED: WD repeat-containing protein 26-like isoform X2 [Solanum 
tuberosum]
Length=584

 Score =   173 bits (438),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 81/122 (66%), Positives = 97/122 (80%), Gaps = 3/122 (2%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            LLNQEIHLW+IDG +  +  +KGHK+ RF+VR CFGGL +AFIASGSEDSQ+YIWHR S 
Sbjct  460  LLNQEIHLWSIDGIIKLLHIYKGHKQKRFIVRPCFGGLRQAFIASGSEDSQIYIWHRCSQ  519

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNS---TVCNGVHH  298
            +L+G L GH+GTVNCVSWN ANPHMLAS  DDRTIRIWGL   N+ +++    V NGV+ 
Sbjct  520  QLLGKLAGHTGTVNCVSWNPANPHMLASGGDDRTIRIWGLNPANVMKHNDEGAVSNGVND  579

Query  297  CN  292
            CN
Sbjct  580  CN  581



>gb|EAY85451.1| hypothetical protein OsI_06831 [Oryza sativa Indica Group]
Length=554

 Score =   171 bits (433),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 101/135 (75%), Gaps = 13/135 (10%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L+++ IHLWNI      + ++ GHKR+RFV+RSCFGG ++AFIASGSEDSQ+YIWHR++G
Sbjct  418  LISEAIHLWNIRNCPIRVNRYAGHKRSRFVIRSCFGGSEQAFIASGSEDSQIYIWHRATG  477

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQ------NSTVCNG  307
            +L+ TL GH+GTVNCVSWN ANPHMLASASDD TIRIWGLK+ NLK+      N    NG
Sbjct  478  DLIETLPGHTGTVNCVSWNPANPHMLASASDDHTIRIWGLKKANLKRKDVGSSNGIYANG  537

Query  306  -------VHHCNGGS  283
                   VH CNG S
Sbjct  538  NTPSNGVVHQCNGNS  552



>gb|EAZ22671.1| hypothetical protein OsJ_06341 [Oryza sativa Japonica Group]
Length=554

 Score =   171 bits (433),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 101/135 (75%), Gaps = 13/135 (10%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L+++ IHLWNI      + ++ GHKR+RFV+RSCFGG ++AFIASGSEDSQ+YIWHR++G
Sbjct  418  LISEAIHLWNIRNCPIRVNRYAGHKRSRFVIRSCFGGSEQAFIASGSEDSQIYIWHRATG  477

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQ------NSTVCNG  307
            +L+ TL GH+GTVNCVSWN ANPHMLASASDD TIRIWGLK+ NLK+      N    NG
Sbjct  478  DLIETLPGHTGTVNCVSWNPANPHMLASASDDHTIRIWGLKKANLKRKDVGSSNGIYANG  537

Query  306  -------VHHCNGGS  283
                   VH CNG S
Sbjct  538  NTPSNGVVHQCNGNS  552



>ref|NP_001132804.1| hypothetical protein [Zea mays]
 gb|ACF81801.1| unknown [Zea mays]
 gb|AFW61289.1| hypothetical protein ZEAMMB73_320588 [Zea mays]
Length=279

 Score =   165 bits (417),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 95/119 (80%), Gaps = 3/119 (3%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L+++EIHLWNI      + ++ GHKR RFV+RSCFGG ++AFIASGSEDSQVYIWHR++G
Sbjct  139  LVSEEIHLWNIRNDPVRVNRYNGHKRTRFVIRSCFGGFEQAFIASGSEDSQVYIWHRATG  198

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVHHCN  292
            +L+ TL GHSGTVNCVSWN ANPHMLASASDD T+RIWG K+ +LK+      G  +CN
Sbjct  199  DLIETLAGHSGTVNCVSWNPANPHMLASASDDHTVRIWGAKKSSLKRKDV---GSSNCN  254



>ref|XP_006647187.1| PREDICTED: WD repeat-containing protein 26-like [Oryza brachyantha]
Length=592

 Score =   169 bits (428),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 101/135 (75%), Gaps = 13/135 (10%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L ++ IHLWNI      ++++ GHKR+RFV+RSCFGG ++AFIASGSEDSQ+YIWHR++G
Sbjct  456  LTSEAIHLWNIRSCPLRVSRYSGHKRSRFVIRSCFGGSEQAFIASGSEDSQIYIWHRATG  515

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQN------------  325
            +L+ TL GH+GTVNCVSWN  NPHMLASASDD TIRIWGLK+ +LK+             
Sbjct  516  DLIETLSGHTGTVNCVSWNPVNPHMLASASDDHTIRIWGLKKASLKRKDVGSSNGIYANG  575

Query  324  STVCNG-VHHCNGGS  283
            +T  NG VH CNG S
Sbjct  576  NTPSNGVVHQCNGNS  590



>ref|XP_008676636.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
Length=421

 Score =   166 bits (420),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 95/119 (80%), Gaps = 3/119 (3%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L+++EIHLWNI      + ++ GHKR RFV+RSCFGG ++AFIASGSEDSQVYIWHR++G
Sbjct  281  LVSEEIHLWNIRNDPVRVNRYNGHKRTRFVIRSCFGGFEQAFIASGSEDSQVYIWHRATG  340

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVHHCN  292
            +L+ TL GHSGTVNCVSWN ANPHMLASASDD T+RIWG K+ +LK+      G  +CN
Sbjct  341  DLIETLAGHSGTVNCVSWNPANPHMLASASDDHTVRIWGAKKSSLKRKDV---GSSNCN  396



>ref|XP_002270103.1| PREDICTED: WD repeat-containing protein 26 [Vitis vinifera]
 ref|XP_010655963.1| PREDICTED: WD repeat-containing protein 26 [Vitis vinifera]
 ref|XP_010655964.1| PREDICTED: WD repeat-containing protein 26 [Vitis vinifera]
 ref|XP_010655965.1| PREDICTED: WD repeat-containing protein 26 [Vitis vinifera]
 ref|XP_010655966.1| PREDICTED: WD repeat-containing protein 26 [Vitis vinifera]
Length=586

 Score =   168 bits (426),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 93/121 (77%), Gaps = 0/121 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            LLNQEIHLW + G    +++++GHKR RF++RSCFGGL++AFIASGSEDS+VY+WHR + 
Sbjct  464  LLNQEIHLWRLGGDPDVVSRYRGHKRTRFLIRSCFGGLEQAFIASGSEDSKVYVWHRDTP  523

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVHHCNG  289
            E +  L GHSG VNCVSW+  NPHMLAS SDD TIRIWGL QV LK      NG++H + 
Sbjct  524  EPLFALPGHSGAVNCVSWSPTNPHMLASGSDDYTIRIWGLDQVKLKNRDNQRNGINHHSK  583

Query  288  G  286
            G
Sbjct  584  G  584



>emb|CBI35349.3| unnamed protein product [Vitis vinifera]
Length=541

 Score =   167 bits (424),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 93/121 (77%), Gaps = 0/121 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            LLNQEIHLW + G    +++++GHKR RF++RSCFGGL++AFIASGSEDS+VY+WHR + 
Sbjct  419  LLNQEIHLWRLGGDPDVVSRYRGHKRTRFLIRSCFGGLEQAFIASGSEDSKVYVWHRDTP  478

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVHHCNG  289
            E +  L GHSG VNCVSW+  NPHMLAS SDD TIRIWGL QV LK      NG++H + 
Sbjct  479  EPLFALPGHSGAVNCVSWSPTNPHMLASGSDDYTIRIWGLDQVKLKNRDNQRNGINHHSK  538

Query  288  G  286
            G
Sbjct  539  G  539



>ref|XP_006399358.1| hypothetical protein EUTSA_v10013060mg [Eutrema salsugineum]
 ref|XP_006399359.1| hypothetical protein EUTSA_v10013060mg [Eutrema salsugineum]
 gb|ESQ40811.1| hypothetical protein EUTSA_v10013060mg [Eutrema salsugineum]
 gb|ESQ40812.1| hypothetical protein EUTSA_v10013060mg [Eutrema salsugineum]
Length=587

 Score =   168 bits (425),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 95/126 (75%), Gaps = 6/126 (5%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            LLNQEI LWNI+G    +A++KGHKR+RF++RSCFGG  +AFIASGSEDSQVYIWHRS+G
Sbjct  461  LLNQEIRLWNIEGDPKIVARYKGHKRSRFIIRSCFGGYKQAFIASGSEDSQVYIWHRSTG  520

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNG------  307
            +L+  L GH+G VNCVSW+  N HMLASASDD TIRIWGL ++N +       G      
Sbjct  521  KLILELPGHAGAVNCVSWSPTNLHMLASASDDGTIRIWGLDRINPQNQRKQVQGSSSNGV  580

Query  306  VHHCNG  289
            +H CNG
Sbjct  581  IHRCNG  586



>ref|XP_004972947.1| PREDICTED: WD repeat-containing protein 26-like [Setaria italica]
Length=599

 Score =   168 bits (425),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 102/139 (73%), Gaps = 17/139 (12%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L+N+ IHLWNI      ++++ GHKR+RFV+RSCFGG ++AFIASGSEDSQVYIWHR++G
Sbjct  459  LVNEVIHLWNIRNGPIRVSRYSGHKRSRFVIRSCFGGSEQAFIASGSEDSQVYIWHRATG  518

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQN---STVCNG---  307
            +L+ TL GHSGTVNCVSWN ANPHMLASASDD TIRIWG K+ +LK+    S+ C+    
Sbjct  519  DLIETLAGHSGTVNCVSWNPANPHMLASASDDHTIRIWGAKKASLKRKDVGSSSCSSNGI  578

Query  306  -----------VHHCNGGS  283
                       +H CNG S
Sbjct  579  HANGNTHGNGFIHQCNGNS  597



>ref|NP_196473.1| WD40 domain-containing protein [Arabidopsis thaliana]
 ref|NP_001078546.1| WD40 domain-containing protein [Arabidopsis thaliana]
 dbj|BAB10005.1| WD-repeat protein-like [Arabidopsis thaliana]
 gb|AAK96726.1| WD-repeat protein-like [Arabidopsis thaliana]
 gb|AAL47352.1| WD-repeat protein-like [Arabidopsis thaliana]
 gb|AED91320.1| WD40 domain-containing protein [Arabidopsis thaliana]
 gb|AED91321.1| WD40 domain-containing protein [Arabidopsis thaliana]
Length=589

 Score =   168 bits (425),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 97/127 (76%), Gaps = 7/127 (6%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            LLNQEI LWNI+G    ++++KGHKR+RF++RSCFGG  +AFIASGSEDSQVYIWHRS+G
Sbjct  462  LLNQEIRLWNIEGDPKIVSRYKGHKRSRFIIRSCFGGYKQAFIASGSEDSQVYIWHRSTG  521

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVN-------LKQNSTVCN  310
            +L+  L GH+G VNCVSW+  N HMLASASDD TIRIWGL ++N       L Q S+   
Sbjct  522  KLIVELPGHAGAVNCVSWSPTNLHMLASASDDGTIRIWGLDRINQQNQKKKLVQGSSSNG  581

Query  309  GVHHCNG  289
             +H CNG
Sbjct  582  VIHRCNG  588



>ref|XP_008676635.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|AFW61288.1| hypothetical protein ZEAMMB73_320588 [Zea mays]
Length=598

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 95/119 (80%), Gaps = 3/119 (3%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L+++EIHLWNI      + ++ GHKR RFV+RSCFGG ++AFIASGSEDSQVYIWHR++G
Sbjct  458  LVSEEIHLWNIRNDPVRVNRYNGHKRTRFVIRSCFGGFEQAFIASGSEDSQVYIWHRATG  517

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVHHCN  292
            +L+ TL GHSGTVNCVSWN ANPHMLASASDD T+RIWG K+ +LK+      G  +CN
Sbjct  518  DLIETLAGHSGTVNCVSWNPANPHMLASASDDHTVRIWGAKKSSLKRKDV---GSSNCN  573



>ref|NP_001159293.1| hypothetical protein [Zea mays]
 gb|ACN25711.1| unknown [Zea mays]
Length=280

 Score =   161 bits (408),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 100/127 (79%), Gaps = 6/127 (5%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L+++EIHLWNI      + ++ GHK +RFV+RSCFGG ++AFIASGSEDSQVYIWHR++G
Sbjct  140  LVSEEIHLWNIRNDPVRVNRYNGHKHSRFVIRSCFGGSEQAFIASGSEDSQVYIWHRATG  199

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQN---STVC--NGV  304
            +L+ TL GHSGTVNCVSWN  NPHMLASASDD T+RIWG K V+LK+    S+ C  NG 
Sbjct  200  DLIETLAGHSGTVNCVSWNPVNPHMLASASDDHTVRIWGAK-VSLKRKDVGSSNCNSNGF  258

Query  303  HHCNGGS  283
            HH NG +
Sbjct  259  HHSNGNA  265



>dbj|BAK03563.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=595

 Score =   166 bits (420),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 95/118 (81%), Gaps = 2/118 (2%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L+N++IHLWNI      + ++ GHKR+RFV+RSCFGG ++AFIASGSED++VYIWHR+SG
Sbjct  458  LINEQIHLWNIRNDPIRVKRYTGHKRSRFVIRSCFGGSEQAFIASGSEDAKVYIWHRASG  517

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNS--TVCNGVH  301
            +++ TL GHSG VNCVSWN ANPHMLASASDD TIRIWGLK+   K+    +  NG+H
Sbjct  518  DVIETLSGHSGAVNCVSWNPANPHMLASASDDHTIRIWGLKKATAKRRDAGSSSNGIH  575



>ref|XP_009412042.1| PREDICTED: WD repeat-containing protein 26-like [Musa acuminata 
subsp. malaccensis]
Length=586

 Score =   165 bits (418),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 97/125 (78%), Gaps = 5/125 (4%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L+NQEIHLW I      I ++KGH+R+R+++RSCFGG+ +AFIASGSEDSQVYIWHR SG
Sbjct  459  LINQEIHLWCIKDDPRLITRYKGHRRSRYLIRSCFGGIKQAFIASGSEDSQVYIWHRGSG  518

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGL-KQVNLKQNSTV-CNGV---  304
            +LV  L GHSG VNCVSWN +NPHMLASASDD TIR+WGL K+V+LK  S    NGV   
Sbjct  519  DLVEALPGHSGAVNCVSWNPSNPHMLASASDDHTIRVWGLSKKVDLKPTSEGHSNGVVAH  578

Query  303  HHCNG  289
              CNG
Sbjct  579  RQCNG  583



>gb|EMT24581.1| hypothetical protein F775_29927 [Aegilops tauschii]
Length=557

 Score =   165 bits (417),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 97/120 (81%), Gaps = 4/120 (3%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L+N++IHLWNI      + ++ GHKR+RFV+RSCFGG ++AFIASGSED++VYIWHR+SG
Sbjct  418  LINEQIHLWNIRTDPIRVKRYTGHKRSRFVIRSCFGGSEQAFIASGSEDAKVYIWHRASG  477

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQ----NSTVCNGVH  301
            +++ TL GHSG VNCVSWN  NPHMLASASDD TIRIWGLK+  +K+    +S+  NG+H
Sbjct  478  DVIETLSGHSGAVNCVSWNPTNPHMLASASDDHTIRIWGLKKATVKRRDAGSSSGSNGIH  537



>ref|XP_003578602.1| PREDICTED: WD repeat-containing protein 26 [Brachypodium distachyon]
Length=595

 Score =   165 bits (417),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 98/134 (73%), Gaps = 14/134 (10%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L+ +EIHLWNI        ++ GHKR+RFV+RSCFGG +++FIASGSEDS+VYIWHR++G
Sbjct  458  LMTEEIHLWNIRNDPIRCKRYTGHKRSRFVIRSCFGGSEQSFIASGSEDSKVYIWHRATG  517

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQ-------NSTVCN  310
            +++ TL GHSG VNCVSWN  NPHMLASASDD TIRIWGLK+ ++K+       N T  N
Sbjct  518  DVIETLSGHSGAVNCVSWNPTNPHMLASASDDHTIRIWGLKKASMKRKDVGSSSNGTCMN  577

Query  309  G-------VHHCNG  289
            G       VH CNG
Sbjct  578  GSANGNGFVHQCNG  591



>ref|XP_008647995.1| PREDICTED: uncharacterized protein LOC100304385 isoform X1 [Zea 
mays]
 ref|XP_008647996.1| PREDICTED: uncharacterized protein LOC100304385 isoform X1 [Zea 
mays]
 ref|XP_008647997.1| PREDICTED: uncharacterized protein LOC100304385 isoform X1 [Zea 
mays]
 gb|AFW74459.1| hypothetical protein ZEAMMB73_133126 [Zea mays]
Length=599

 Score =   164 bits (416),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 100/127 (79%), Gaps = 6/127 (5%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L+++EIHLWNI      + ++ GHK +RFV+RSCFGG ++AFIASGSEDSQVYIWHR++G
Sbjct  459  LVSEEIHLWNIRNDPVRVNRYNGHKHSRFVIRSCFGGSEQAFIASGSEDSQVYIWHRATG  518

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQN---STVC--NGV  304
            +L+ TL GHSGTVNCVSWN  NPHMLASASDD T+RIWG K V+LK+    S+ C  NG 
Sbjct  519  DLIETLAGHSGTVNCVSWNPVNPHMLASASDDHTVRIWGAK-VSLKRKDVGSSNCNSNGF  577

Query  303  HHCNGGS  283
            HH NG +
Sbjct  578  HHSNGNA  584



>ref|XP_006845990.1| hypothetical protein AMTR_s00155p00039520 [Amborella trichopoda]
 gb|ERN07665.1| hypothetical protein AMTR_s00155p00039520 [Amborella trichopoda]
Length=579

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 96/123 (78%), Gaps = 2/123 (2%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L+N+EIHLW+I+G    + +++GHKR+R V+RSCFGGL++AFIASGSEDSQVY+WHR + 
Sbjct  457  LVNEEIHLWSINGEPKLVGRYRGHKRSRLVIRSCFGGLEQAFIASGSEDSQVYLWHRGTR  516

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQN-STVCNG-VHHC  295
            EL   L GHSG VNCVSWN  N HM ASASDD TIRIWG++ V  K+  +   NG +HHC
Sbjct  517  ELFEVLPGHSGAVNCVSWNPVNAHMFASASDDSTIRIWGVEGVGSKRKGACSSNGTIHHC  576

Query  294  NGG  286
            NGG
Sbjct  577  NGG  579



>ref|XP_002873372.1| transducin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49631.1| transducin family protein [Arabidopsis lyrata subsp. lyrata]
Length=587

 Score =   163 bits (412),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 96/126 (76%), Gaps = 6/126 (5%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L NQEI LWNI+G    ++++KGHKR+RF++RSCFGG  +AF+ASGSEDSQVYIWHRS+G
Sbjct  461  LHNQEIRLWNIEGDPKIVSRYKGHKRSRFIIRSCFGGYKQAFVASGSEDSQVYIWHRSTG  520

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLK------QNSTVCNG  307
            +L+  L GH+G VNCVSW+  N HMLASASDD TIRIWGL ++N +      Q S+    
Sbjct  521  KLIVELPGHAGAVNCVSWSPTNLHMLASASDDGTIRIWGLDRINQQNQKKHVQGSSSNGV  580

Query  306  VHHCNG  289
            +H CNG
Sbjct  581  IHRCNG  586



>ref|XP_010491500.1| PREDICTED: WD repeat-containing protein 26-like [Camelina sativa]
Length=587

 Score =   163 bits (412),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 96/126 (76%), Gaps = 6/126 (5%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            LLNQEI LWNI+G    ++++KGH+R+RF++RSCFGG  +AFIASGSEDSQVYIWHRS+G
Sbjct  461  LLNQEIRLWNIEGDPKIVSRYKGHRRSRFIIRSCFGGYKQAFIASGSEDSQVYIWHRSTG  520

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNG------  307
            +L+  L GH+G VNCVSW+  N HMLASASDD TIRIWGL+++N +       G      
Sbjct  521  KLIIELPGHAGAVNCVSWSPTNLHMLASASDDGTIRIWGLERINQQNQKKQVQGSSSNGV  580

Query  306  VHHCNG  289
            +H CNG
Sbjct  581  IHRCNG  586



>ref|XP_006287344.1| hypothetical protein CARUB_v10000543mg [Capsella rubella]
 gb|EOA20242.1| hypothetical protein CARUB_v10000543mg [Capsella rubella]
Length=587

 Score =   162 bits (411),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 95/126 (75%), Gaps = 6/126 (5%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            LLNQEI LWNI+G    ++++KGH+R+RF++RSCFGG  +AFIASGSEDSQVYIWHRS+G
Sbjct  461  LLNQEIRLWNIEGDPKIVSRYKGHRRSRFIIRSCFGGYKQAFIASGSEDSQVYIWHRSTG  520

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNG------  307
            +L+  L GH+G VNCVSW+  N HMLASASDD TIRIWGL ++N +       G      
Sbjct  521  KLIIELPGHAGAVNCVSWSPTNLHMLASASDDGTIRIWGLDRINQQNQKKQVQGSSSNGV  580

Query  306  VHHCNG  289
            +H CNG
Sbjct  581  IHRCNG  586



>ref|XP_009131082.1| PREDICTED: WD repeat-containing protein 26-like [Brassica rapa]
 ref|XP_009131084.1| PREDICTED: WD repeat-containing protein 26-like [Brassica rapa]
Length=589

 Score =   162 bits (411),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 96/126 (76%), Gaps = 6/126 (5%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            LLNQEI LWNI+G    + ++KGHKR+RF++RSCFGG  +AFIASGSEDSQVYIWHRS+G
Sbjct  463  LLNQEIRLWNIEGEPKIVMRYKGHKRSRFLIRSCFGGYKQAFIASGSEDSQVYIWHRSTG  522

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQV-----NLKQNSTVCNGV  304
            +L+  L GH+G VNCVSW+  N HMLASASDD TIRIWGL ++       +  ++  NGV
Sbjct  523  KLIIELPGHAGAVNCVSWSPTNLHMLASASDDGTIRIWGLDKINQQNQKKQVQASSSNGV  582

Query  303  -HHCNG  289
             H CNG
Sbjct  583  LHRCNG  588



>emb|CDX78343.1| BnaA03g02550D [Brassica napus]
Length=589

 Score =   162 bits (410),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 96/126 (76%), Gaps = 6/126 (5%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            LLNQEI LWNI+G    + ++KGHKR+RF++RSCFGG  +AFIASGSEDSQVYIWHRS+G
Sbjct  463  LLNQEIRLWNIEGEPKIVMRYKGHKRSRFLIRSCFGGYKQAFIASGSEDSQVYIWHRSTG  522

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQV-----NLKQNSTVCNGV  304
            +L+  L GH+G VNCVSW+  N HMLASASDD TIRIWGL ++       +  ++  NGV
Sbjct  523  KLIIELPGHAGAVNCVSWSPTNLHMLASASDDGTIRIWGLDKINQQNQKKQVQASSSNGV  582

Query  303  -HHCNG  289
             H CNG
Sbjct  583  LHRCNG  588



>emb|CDY21550.1| BnaC09g47420D [Brassica napus]
Length=578

 Score =   162 bits (409),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 97/126 (77%), Gaps = 6/126 (5%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            LLNQEI LW+I+G    + ++KGHKR+RF++RSCFGG ++ FIASGSEDSQVYIWHRS+G
Sbjct  452  LLNQEIRLWSIEGDPKIVTRYKGHKRSRFLIRSCFGGYEQGFIASGSEDSQVYIWHRSTG  511

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNL-KQNSTV----CNGV  304
            +L+  L GH+G VNCVSW+  N H++ASASDD TIRIWGL ++N  KQ   V     NGV
Sbjct  512  KLITELPGHAGAVNCVSWSPTNLHVMASASDDGTIRIWGLDRINPHKQEKQVQGSSSNGV  571

Query  303  -HHCNG  289
             H CNG
Sbjct  572  LHQCNG  577



>ref|XP_004253388.2| PREDICTED: WD repeat-containing protein 26-like [Solanum lycopersicum]
Length=460

 Score =   160 bits (406),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 94/123 (76%), Gaps = 5/123 (4%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            LLNQEIHLW+IDG +  +  +KGHK+ RF+++ CFGGL +AFIASGSEDSQVYIW R S 
Sbjct  336  LLNQEIHLWSIDGVIKLVHIYKGHKQERFIIKPCFGGLRQAFIASGSEDSQVYIWDRCSQ  395

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNS-----TVCNGV  304
            +L+  L GHSGTVNCVSWN ANPHMLAS SDD+TIRIWGL   N+ +++     + C G 
Sbjct  396  QLLRKLAGHSGTVNCVSWNPANPHMLASGSDDQTIRIWGLNPANVMKHNDEGAVSNCVGD  455

Query  303  HHC  295
             HC
Sbjct  456  CHC  458



>ref|XP_010423053.1| PREDICTED: WD repeat-containing protein 26-like [Camelina sativa]
Length=587

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 95/126 (75%), Gaps = 6/126 (5%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            LLNQEI LWNI+G    ++ +KGH+R+RF++RSCFGG  +AFIASGSEDSQVYIWHRS+G
Sbjct  461  LLNQEIRLWNIEGDPKIVSSYKGHRRSRFIIRSCFGGYKQAFIASGSEDSQVYIWHRSTG  520

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNG------  307
            +L+  L GH+G VNCVSW+  N HMLASASDD TIRIWGL+++N +       G      
Sbjct  521  KLIIELPGHAGAVNCVSWSPTNLHMLASASDDGTIRIWGLERINQQNQKKQVQGSSSNGV  580

Query  306  VHHCNG  289
            +H CNG
Sbjct  581  IHRCNG  586



>ref|XP_009122471.1| PREDICTED: WD repeat-containing protein 26 [Brassica rapa]
 emb|CDX69939.1| BnaA10g22880D [Brassica napus]
Length=580

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 96/126 (76%), Gaps = 6/126 (5%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            LLNQEI LW+I+G    + ++KGHKR+RF++RSCFGG ++ FIASGSEDSQVYIWHRS+G
Sbjct  454  LLNQEIRLWSIEGDPKIVTRYKGHKRSRFLIRSCFGGYEQGFIASGSEDSQVYIWHRSTG  513

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNL-KQNSTV----CNGV  304
            +L+  L GH+G VNCVSW+  N  M+ASASDD TIRIWGL ++N  KQ   V     NGV
Sbjct  514  KLIIELPGHAGAVNCVSWSPTNLQMMASASDDGTIRIWGLNRINPHKQEKQVQGSSSNGV  573

Query  303  -HHCNG  289
             H CNG
Sbjct  574  LHQCNG  579



>ref|XP_010456450.1| PREDICTED: WD repeat-containing protein 26-like, partial [Camelina 
sativa]
Length=441

 Score =   159 bits (401),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 96/127 (76%), Gaps = 7/127 (6%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            LLNQEI LWNI+G    ++++KGH+R+RF++RSCFGG  +AFIASGSEDSQVYIWHRS+G
Sbjct  314  LLNQEIRLWNIEGDPKIVSRYKGHRRSRFIIRSCFGGYKQAFIASGSEDSQVYIWHRSTG  373

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLK-------QNSTVCN  310
            +L+  L GH+G VNCVSW+  N HMLASASDD TIRIWGL ++N +       Q S    
Sbjct  374  KLITELPGHAGAVNCVSWSPTNLHMLASASDDGTIRIWGLDKINQQNQKKKQVQGSNSNG  433

Query  309  GVHHCNG  289
             +H CNG
Sbjct  434  VIHRCNG  440



>emb|CDX81113.1| BnaC03g03670D [Brassica napus]
Length=589

 Score =   159 bits (403),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 95/126 (75%), Gaps = 6/126 (5%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            LLNQEI LWNI+G    + ++KGHKR+RF++RSCFGG  +AFIASGSEDS VYIWHRS+G
Sbjct  463  LLNQEIRLWNIEGDPKIVMRYKGHKRSRFLIRSCFGGYQQAFIASGSEDSLVYIWHRSTG  522

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQV-----NLKQNSTVCNGV  304
            +L+  L GH+G VNCVSW+  N HMLASASDD TIRIWGL ++       +  ++  NGV
Sbjct  523  KLIIELPGHAGAVNCVSWSPTNLHMLASASDDGTIRIWGLDRINQQNQKKQVQASSSNGV  582

Query  303  -HHCNG  289
             H CNG
Sbjct  583  LHRCNG  588



>gb|ABR16581.1| unknown [Picea sitchensis]
Length=584

 Score =   156 bits (395),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 74/124 (60%), Positives = 92/124 (74%), Gaps = 2/124 (2%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L NQEIHLW+I      + ++ GH++ R+V+RSCFGG D AF+ SGSEDSQV+IWHR +G
Sbjct  461  LANQEIHLWDIGAPSKLLLRYTGHRQGRYVIRSCFGGSDLAFVVSGSEDSQVHIWHRGNG  520

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLK-QNSTVCNG-VHHC  295
            EL+  L GHSGTVNCVSWN  NPH+ ASASDD TIRIWG+ +   K +N++  NG VH  
Sbjct  521  ELLAVLPGHSGTVNCVSWNPVNPHLFASASDDYTIRIWGVNRNTFKSKNASSSNGVVHLA  580

Query  294  NGGS  283
            NGG 
Sbjct  581  NGGP  584



>ref|XP_002982745.1| hypothetical protein SELMODRAFT_268628 [Selaginella moellendorffii]
 gb|EFJ15990.1| hypothetical protein SELMODRAFT_268628 [Selaginella moellendorffii]
Length=588

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 91/123 (74%), Gaps = 2/123 (2%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L++QEIHLW++  +     K+KGH++ R+V+RSCFGG D AFI SGSEDSQVYIWHR +G
Sbjct  447  LVSQEIHLWDMALNSRSPCKYKGHRQGRYVIRSCFGGSDHAFIVSGSEDSQVYIWHRGNG  506

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLK--QVNLKQNSTVCNGVHHC  295
            EL+  L GHSGTVNCVSWN +NPHM ASASDD TIRIWGL   + +  + S+  +     
Sbjct  507  ELLEVLPGHSGTVNCVSWNPSNPHMFASASDDHTIRIWGLSATKRDRHRRSSAASPTPKS  566

Query  294  NGG  286
            NGG
Sbjct  567  NGG  569



>ref|XP_010546278.1| PREDICTED: WD repeat-containing protein 26-like [Tarenaya hassleriana]
 ref|XP_010546280.1| PREDICTED: WD repeat-containing protein 26-like [Tarenaya hassleriana]
Length=578

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 94/127 (74%), Gaps = 7/127 (6%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L+NQEI LW+I+G  + +++++GHKR RF++RSCFGG  + FIASGSEDSQVYIWHR+SG
Sbjct  451  LINQEIRLWDIEGEPSLVSRYRGHKRARFIIRSCFGGYKQGFIASGSEDSQVYIWHRASG  510

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGL---KQVNLKQN--STVCNG-  307
            E +  L GHSG VNCVSWN  +  MLAS SDD TIRIWGL   +++N ++       NG 
Sbjct  511  EQLQVLPGHSGAVNCVSWNPTDLQMLASGSDDGTIRIWGLLDHRRINPEEKVGPHSSNGL  570

Query  306  -VHHCNG  289
             +H CNG
Sbjct  571  VIHQCNG  577



>gb|EYU42858.1| hypothetical protein MIMGU_mgv1a022069mg, partial [Erythranthe 
guttata]
Length=372

 Score =   150 bits (380),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/101 (69%), Positives = 83/101 (82%), Gaps = 2/101 (2%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSV--TCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRS  475
            +LN+EIHLWNI+ S     + K+KGH+R R VV++CFGG+ + FIASGSEDS+VYIW+R 
Sbjct  268  MLNEEIHLWNIEDSAFPVMVMKYKGHRRRRLVVKACFGGIGQGFIASGSEDSKVYIWNRW  327

Query  474  SGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  352
            SGEL+ TL GHS  VNCVSWN ANPHMLASASDDR IRIWG
Sbjct  328  SGELICTLEGHSAVVNCVSWNPANPHMLASASDDRAIRIWG  368



>gb|EMT06242.1| hypothetical protein F775_31507 [Aegilops tauschii]
Length=590

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 99/147 (67%), Gaps = 27/147 (18%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQV--------  493
            L++++IHLWNI    + + ++ GHKR+RFV+RSCFGG D+AFIASGSEDS+V        
Sbjct  440  LISEKIHLWNIRNDPSRVKQYIGHKRSRFVIRSCFGGSDQAFIASGSEDSKVFSARFCSE  499

Query  492  ---YIWHRSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQ--  328
               YIWHR++ +++ TL GHSG VNCVSWN  NPHMLASASDD TIRIWGLK+ + K+  
Sbjct  500  YLVYIWHRATEDVIETLSGHSGAVNCVSWNPTNPHMLASASDDHTIRIWGLKKASTKRKD  559

Query  327  -------NSTVCNG-------VHHCNG  289
                   N T  NG       VH CNG
Sbjct  560  IGSSSSSNGTHMNGSANGNGFVHQCNG  586



>ref|XP_011033097.1| PREDICTED: WD repeat-containing protein 26-like [Populus euphratica]
 ref|XP_011033098.1| PREDICTED: WD repeat-containing protein 26-like [Populus euphratica]
 ref|XP_011033099.1| PREDICTED: WD repeat-containing protein 26-like [Populus euphratica]
Length=529

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L NQEIHLW+++G    +A++KGH R+RF++RSCFGG +EAFIASGSED+QVY+WHR SG
Sbjct  415  LTNQEIHLWSLEGYPQVVARYKGHTRSRFIIRSCFGGCEEAFIASGSEDTQVYVWHRRSG  474

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  352
            +L+  L GHSG VNCVSWN  N +MLASASDD  IRIWG
Sbjct  475  KLIQALDGHSGAVNCVSWNPVNIYMLASASDDGAIRIWG  513



>ref|XP_002311889.2| hypothetical protein POPTR_0008s00330g [Populus trichocarpa]
 gb|EEE89256.2| hypothetical protein POPTR_0008s00330g [Populus trichocarpa]
Length=529

 Score =   152 bits (383),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L NQEIHLW+++G    +A++KGH R+RF++RSCFGG +EAFIASGSED+QVY+WHR SG
Sbjct  415  LTNQEIHLWSLEGYPQVVARYKGHTRSRFIIRSCFGGCEEAFIASGSEDAQVYVWHRGSG  474

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  352
            +L+  L GHSG VNCVSWN  N +MLASASDD  IRIWG
Sbjct  475  KLIQALDGHSGAVNCVSWNPVNIYMLASASDDGAIRIWG  513



>ref|XP_002990891.1| hypothetical protein SELMODRAFT_161256 [Selaginella moellendorffii]
 gb|EFJ07935.1| hypothetical protein SELMODRAFT_161256 [Selaginella moellendorffii]
Length=548

 Score =   152 bits (383),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 89/123 (72%), Gaps = 2/123 (2%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L++QEIHLW++  +     K+KGH++ R+V+RSCFGG D AFI SGSEDSQVYIWHR +G
Sbjct  407  LVSQEIHLWDMALNSRSPCKYKGHRQGRYVIRSCFGGSDHAFIVSGSEDSQVYIWHRGNG  466

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQV--NLKQNSTVCNGVHHC  295
            EL+  L GHSGTVNCVSWN +NPHM ASASDD TIRIWGL     +  + S+        
Sbjct  467  ELLEVLPGHSGTVNCVSWNPSNPHMFASASDDHTIRIWGLSSTKRDRHRRSSAAAPTPKS  526

Query  294  NGG  286
            NGG
Sbjct  527  NGG  529



>gb|EMS67128.1| WD repeat-containing protein 26 [Triticum urartu]
Length=590

 Score =   152 bits (383),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 99/147 (67%), Gaps = 27/147 (18%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQV--------  493
            L++++IHLWNI    + + ++ GHKR+RFV+RSCFGG D+AFIASGSEDS+V        
Sbjct  440  LISEKIHLWNIRNDPSRVKQYIGHKRSRFVIRSCFGGSDQAFIASGSEDSKVFSASFCSE  499

Query  492  ---YIWHRSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQ--  328
               YIWHR++ +++ TL GHSG VNCVSWN  NPHMLASASDD TIRIWG+K+ + K+  
Sbjct  500  YLVYIWHRATEDVIETLSGHSGAVNCVSWNPTNPHMLASASDDHTIRIWGVKKASTKRKD  559

Query  327  -------NSTVCNG-------VHHCNG  289
                   N T  NG       VH CNG
Sbjct  560  IGSSSSSNGTHMNGSANGNGFVHQCNG  586



>ref|XP_006854396.1| hypothetical protein AMTR_s00039p00186000 [Amborella trichopoda]
 gb|ERN15863.1| hypothetical protein AMTR_s00039p00186000 [Amborella trichopoda]
Length=541

 Score =   151 bits (381),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 67/102 (66%), Positives = 84/102 (82%), Gaps = 0/102 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L NQEIH+W++ G +   ++F+GH+++R+V+RSCFGGLD AFIASGSEDSQ+YIWHR + 
Sbjct  437  LNNQEIHMWDLAGRLGDPSRFRGHRQSRYVIRSCFGGLDHAFIASGSEDSQIYIWHRRNC  496

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQ  343
            EL+  L GHS TVNCVSWN  NP M ASASDDRTIRIWG+ +
Sbjct  497  ELIEVLGGHSSTVNCVSWNPMNPQMFASASDDRTIRIWGVSR  538



>ref|XP_011032764.1| PREDICTED: WD repeat-containing protein 26-like [Populus euphratica]
 ref|XP_011032766.1| PREDICTED: WD repeat-containing protein 26-like [Populus euphratica]
 ref|XP_011032767.1| PREDICTED: WD repeat-containing protein 26-like [Populus euphratica]
 ref|XP_011032768.1| PREDICTED: WD repeat-containing protein 26-like [Populus euphratica]
 ref|XP_011032769.1| PREDICTED: WD repeat-containing protein 26-like [Populus euphratica]
 ref|XP_011032770.1| PREDICTED: WD repeat-containing protein 26-like [Populus euphratica]
Length=558

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            LLNQEIHLWNIDG +  +A +KGHKR+RFV+RSCFGG ++AFIASGSEDSQ+Y+WHR+S 
Sbjct  460  LLNQEIHLWNIDGDIRLVATYKGHKRSRFVIRSCFGGHEQAFIASGSEDSQIYLWHRASR  519

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLAS  385
            ELV  L GHSG VNCVSWN ANPHMLAS
Sbjct  520  ELVEALPGHSGAVNCVSWNPANPHMLAS  547



>ref|XP_001770300.1| predicted protein [Physcomitrella patens]
 gb|EDQ64975.1| predicted protein [Physcomitrella patens]
Length=559

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 90/128 (70%), Gaps = 6/128 (5%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAK-FKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSS  472
            L++QEIHLW+I  +   + K ++GHK+ R+V+RSCFGG D AFI SGSEDSQVYIWHR +
Sbjct  417  LVSQEIHLWDISAATKDLPKKYRGHKQGRYVIRSCFGGTDYAFIVSGSEDSQVYIWHRWN  476

Query  471  GELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLK----QNSTVCNGV  304
            GEL+  L GHSGTVN VSWN  NPHM ASASDD TIRIWGL    +     +     NG 
Sbjct  477  GELLDVLSGHSGTVNSVSWNPVNPHMFASASDDHTIRIWGLSNRPMPKKHDEKPGSSNGF  536

Query  303  HH-CNGGS  283
             H  NGG+
Sbjct  537  DHLVNGGT  544



>ref|XP_001771286.1| predicted protein [Physcomitrella patens]
 gb|EDQ63846.1| predicted protein [Physcomitrella patens]
Length=559

 Score =   149 bits (375),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 92/128 (72%), Gaps = 6/128 (5%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAK-FKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSS  472
            L++QEIHLW+I  +   + K ++GH++ R+V+RSCFGG D AFI SGSEDSQVYIWHR +
Sbjct  417  LVSQEIHLWDISAATRDLPKKYRGHRQGRYVIRSCFGGTDYAFIVSGSEDSQVYIWHRWN  476

Query  471  GELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGL----KQVNLKQNSTVCNGV  304
            GEL+  L GHSGTVN VSWN  NPHM ASASDD TIRIWGL    K     + +   NG+
Sbjct  477  GELLDVLSGHSGTVNSVSWNPVNPHMFASASDDHTIRIWGLSNRPKIKKHDEKAGSSNGI  536

Query  303  HH-CNGGS  283
             H  NGG+
Sbjct  537  DHLVNGGT  544



>tpg|DAA49690.1| TPA: hypothetical protein ZEAMMB73_458845 [Zea mays]
Length=240

 Score =   139 bits (349),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L +QEIHLW I+ S T   KF GHK+++FV+RSCFGG + +FIASGSEDSQVYIW R   
Sbjct  135  LNSQEIHLWKINESCTVPEKFMGHKQDKFVIRSCFGGSNSSFIASGSEDSQVYIWKRHVE  194

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIW  355
              +  LHGH+  VNCVSWN A PHMLASASDDRT+RIW
Sbjct  195  MPIKVLHGHTMIVNCVSWNPARPHMLASASDDRTVRIW  232



>ref|XP_002464509.1| hypothetical protein SORBIDRAFT_01g019860 [Sorghum bicolor]
 gb|EER91507.1| hypothetical protein SORBIDRAFT_01g019860 [Sorghum bicolor]
Length=530

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L +QEIHLW I+ S T   KFKGHK+++FV+RSCFGG +  FIASGSEDSQVYIW R   
Sbjct  423  LTSQEIHLWKINESCTVPEKFKGHKQDKFVIRSCFGGSNSLFIASGSEDSQVYIWKRHVE  482

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLK  331
              +  LHGH+  VNCVSWN A PHMLASASDDRT+RIW  ++++ K
Sbjct  483  MPIKVLHGHTMIVNCVSWNPARPHMLASASDDRTVRIWVARKMHSK  528



>ref|XP_010522523.1| PREDICTED: WD repeat-containing protein 26 [Tarenaya hassleriana]
Length=524

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/99 (65%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L ++EIHLW+++G      KF GHK++++V+RSCFGGL+ +FIASGSEDSQVYIW+R S 
Sbjct  412  LNSEEIHLWDVEGENEQPVKFTGHKQSKYVIRSCFGGLNSSFIASGSEDSQVYIWNRKSS  471

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  352
            + +  L GHS TVNCVSWN   P MLASASDDRTIRIWG
Sbjct  472  KPLEVLSGHSMTVNCVSWNPKKPRMLASASDDRTIRIWG  510



>gb|KGN58314.1| hypothetical protein Csa_3G611390 [Cucumis sativus]
Length=190

 Score =   134 bits (338),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 77/99 (78%), Gaps = 0/99 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L NQEIH+W++ G      K+ GH++N++V+RSCFGG++ AFIASGSE+S+VYIW R S 
Sbjct  80   LNNQEIHMWDVAGEWQQPLKYTGHQQNKYVIRSCFGGVNSAFIASGSENSEVYIWSRHSS  139

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  352
            + +  L GHS TVNCVSWN   P MLASASDD+TIRIWG
Sbjct  140  KPIEVLSGHSTTVNCVSWNPKRPKMLASASDDQTIRIWG  178



>ref|XP_008664897.1| PREDICTED: WD repeat-containing protein 26-like isoform X2 [Zea 
mays]
Length=425

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L +QEIHLW I+ S T   KF GHK+++FV+RSCFGG + +FIASGSEDSQVYIW R   
Sbjct  320  LNSQEIHLWKINESCTVPEKFMGHKQDKFVIRSCFGGSNSSFIASGSEDSQVYIWKRHVE  379

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIW  355
              +  LHGH+  VNCVSWN A PHMLASASDDRT+RIW
Sbjct  380  MPIKVLHGHTMIVNCVSWNPARPHMLASASDDRTVRIW  417



>gb|EYU42819.1| hypothetical protein MIMGU_mgv1a005559mg [Erythranthe guttata]
Length=479

 Score =   140 bits (353),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 77/100 (77%), Gaps = 1/100 (1%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAK-FKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSS  472
            LLN+EI LWNI      I K F+GHKR +F+VR+CFGG  + F+ASGSED+QVY+W R+S
Sbjct  380  LLNEEIQLWNIGLEQPVIVKTFEGHKRQKFIVRTCFGGKGQGFVASGSEDTQVYVWDRAS  439

Query  471  GELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  352
            GE++  L GHS TV CVSWN  NP MLASASDD TIRIWG
Sbjct  440  GEIIRKLEGHSRTVTCVSWNPTNPSMLASASDDGTIRIWG  479



>ref|XP_004982941.1| PREDICTED: WD repeat-containing protein 26-like [Setaria italica]
Length=522

 Score =   140 bits (353),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/98 (67%), Positives = 75/98 (77%), Gaps = 0/98 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L +QEIHLW I+ S T   KFKGHK+ +FV+RSCFGG +  FIASGSEDSQVYIW R   
Sbjct  415  LSSQEIHLWKINESSTVPEKFKGHKQEKFVIRSCFGGSNSLFIASGSEDSQVYIWKRHLE  474

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIW  355
              +  LHGH+  VNCVSWN A PHMLASASDDRT+RIW
Sbjct  475  TPIKVLHGHTMIVNCVSWNPARPHMLASASDDRTVRIW  512



>ref|XP_002865396.1| transducin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41655.1| transducin family protein [Arabidopsis lyrata subsp. lyrata]
Length=523

 Score =   140 bits (352),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 80/105 (76%), Gaps = 0/105 (0%)
 Frame = -3

Query  639  QEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSGELV  460
            QEIHLW++ G      KF GH+++++V+RSCFGGLD +FIASGSEDSQVYIW+  + + +
Sbjct  419  QEIHLWDLAGEWKLPLKFSGHRQSKYVIRSCFGGLDSSFIASGSEDSQVYIWNLKNAKPL  478

Query  459  GTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQN  325
              L GHS TVNCVSWN  NP MLASASDD+TIRIWG  + N  +N
Sbjct  479  EVLSGHSMTVNCVSWNPKNPRMLASASDDQTIRIWGPGKPNKPEN  523



>ref|XP_008664896.1| PREDICTED: WD repeat-containing protein 26-like isoform X1 [Zea 
mays]
 tpg|DAA49691.1| TPA: hypothetical protein ZEAMMB73_458845 [Zea mays]
Length=528

 Score =   139 bits (351),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 76/98 (78%), Gaps = 0/98 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L +QEIHLW I+ S T   KF GHK+++FV+RSCFGG + +FIASGSEDSQVYIW R   
Sbjct  423  LNSQEIHLWKINESCTVPEKFMGHKQDKFVIRSCFGGSNSSFIASGSEDSQVYIWKRHVE  482

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIW  355
              +  LHGH+  VNCVSWN A PHMLASASDDRT+RIW
Sbjct  483  MPIKVLHGHTMIVNCVSWNPARPHMLASASDDRTVRIW  520



>ref|XP_006280295.1| hypothetical protein CARUB_v10026218mg [Capsella rubella]
 gb|EOA13193.1| hypothetical protein CARUB_v10026218mg [Capsella rubella]
Length=437

 Score =   139 bits (349),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 81/108 (75%), Gaps = 0/108 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L +QEIHLW++ G      KF GH+++++V+RSCFGGLD +FIASGSEDSQVY+W+    
Sbjct  296  LSSQEIHLWDLAGEWKQPLKFSGHRQSKYVIRSCFGGLDSSFIASGSEDSQVYLWNLKKA  355

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQN  325
            + +  L GHS TVNCVSWN  NP MLASASDD+TIRIWG  + N  +N
Sbjct  356  KPLEVLSGHSMTVNCVSWNPRNPRMLASASDDQTIRIWGPGKPNRPEN  403



>ref|XP_004173151.1| PREDICTED: WD repeat-containing protein 26-like, partial [Cucumis 
sativus]
Length=224

 Score =   134 bits (337),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 77/99 (78%), Gaps = 0/99 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L NQEIH+W++ G      K+ GH++N++V+RSCFGG++ AFIASGSE+S+VYIW R S 
Sbjct  114  LNNQEIHMWDVAGEWQQPLKYTGHQQNKYVIRSCFGGVNSAFIASGSENSEVYIWSRHSS  173

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  352
            + +  L GHS TVNCVSWN   P MLASASDD+TIRIWG
Sbjct  174  KPIEVLSGHSTTVNCVSWNPKRPKMLASASDDQTIRIWG  212



>gb|AAP54181.2| WD-repeat protein 26, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABG66126.1| WD-repeat protein 26, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABG66127.1| WD-repeat protein 26, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAG92818.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99292.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99438.1| unnamed protein product [Oryza sativa Japonica Group]
Length=246

 Score =   134 bits (338),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 75/99 (76%), Gaps = 1/99 (1%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIA-KFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSS  472
            L +QEIHLW I  S T    KFKGHK+ +FV+RSCFGG +  FIASGSEDSQVYIW R  
Sbjct  135  LNSQEIHLWRISESSTAADNKFKGHKQGKFVIRSCFGGSNSLFIASGSEDSQVYIWKRHL  194

Query  471  GELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIW  355
               +  L+GHS TVNCVSWN A PHMLASASDDRT+RIW
Sbjct  195  ETPIKVLYGHSLTVNCVSWNPAKPHMLASASDDRTVRIW  233



>ref|XP_006403164.1| hypothetical protein EUTSA_v10003179mg [Eutrema salsugineum]
 gb|ESQ44617.1| hypothetical protein EUTSA_v10003179mg [Eutrema salsugineum]
Length=530

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L +QEIHLW++ G      KF GHK++++V+RSCFGGLD +FIASGSEDSQVYIW+   G
Sbjct  416  LSSQEIHLWDLAGEWKQPLKFSGHKQSKYVIRSCFGGLDSSFIASGSEDSQVYIWNLKKG  475

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  352
            + +  L GHS TVNCVSWN  NP MLASASDD+TIRIWG
Sbjct  476  KPLEVLSGHSMTVNCVSWNPRNPLMLASASDDQTIRIWG  514



>ref|XP_006280294.1| hypothetical protein CARUB_v10026218mg [Capsella rubella]
 gb|EOA13192.1| hypothetical protein CARUB_v10026218mg [Capsella rubella]
Length=531

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 81/108 (75%), Gaps = 0/108 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L +QEIHLW++ G      KF GH+++++V+RSCFGGLD +FIASGSEDSQVY+W+    
Sbjct  417  LSSQEIHLWDLAGEWKQPLKFSGHRQSKYVIRSCFGGLDSSFIASGSEDSQVYLWNLKKA  476

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQN  325
            + +  L GHS TVNCVSWN  NP MLASASDD+TIRIWG  + N  +N
Sbjct  477  KPLEVLSGHSMTVNCVSWNPRNPRMLASASDDQTIRIWGPGKPNRPEN  524



>ref|XP_009792757.1| PREDICTED: WD repeat-containing protein 26 isoform X2 [Nicotiana 
sylvestris]
Length=485

 Score =   137 bits (344),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L +QEIH+W++ G      K+KGH+++++V+RSCFGGLD  FIASGSEDS+VYIW+R   
Sbjct  381  LNSQEIHMWDVAGEWLSPMKYKGHRQHKYVIRSCFGGLDSTFIASGSEDSKVYIWNRRGS  440

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  352
            + +  L GH+ TVNCVSWN   PHMLASASDD+TIRIWG
Sbjct  441  KPIEILCGHTMTVNCVSWNPKRPHMLASASDDQTIRIWG  479



>ref|NP_199205.1| transducin/WD40 domain-containing protein [Arabidopsis thaliana]
 dbj|BAB09052.1| WD-repeat protein-like [Arabidopsis thaliana]
 dbj|BAE99272.1| WD-repeat protein-like [Arabidopsis thaliana]
 gb|ABQ85545.1| will die slowly [Arabidopsis thaliana]
 gb|AED95028.1| transducin/WD40 domain-containing protein [Arabidopsis thaliana]
Length=523

 Score =   137 bits (344),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 79/105 (75%), Gaps = 0/105 (0%)
 Frame = -3

Query  639  QEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSGELV  460
            QEIHLW++ G      KF GH+++++V+RSCFGGLD +FIASGSEDSQVYIW+  + + +
Sbjct  419  QEIHLWDLAGEWKQPLKFSGHRQSKYVIRSCFGGLDSSFIASGSEDSQVYIWNLKNTKPL  478

Query  459  GTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQN  325
              L GHS TVNCVSWN  NP MLASASDD+TIRIWG  + N   N
Sbjct  479  EVLSGHSMTVNCVSWNPKNPRMLASASDDQTIRIWGPGKPNKPLN  523



>ref|XP_009113968.1| PREDICTED: WD repeat-containing protein 26 [Brassica rapa]
Length=526

 Score =   137 bits (344),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 80/104 (77%), Gaps = 0/104 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L +QEIHLW++ G      KF GH+++++V+RSCFGGLD +FIASGSEDSQVYIW+  + 
Sbjct  416  LSSQEIHLWDLAGEWKQPLKFTGHRQSKYVIRSCFGGLDSSFIASGSEDSQVYIWNVKNK  475

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVN  337
            + +  L GHS TVNCVSWN  NP MLASASDD+TIRIWG  + N
Sbjct  476  KPLEVLSGHSMTVNCVSWNPRNPRMLASASDDQTIRIWGPGKPN  519



>ref|XP_006355901.1| PREDICTED: WD repeat-containing protein 26-like [Solanum tuberosum]
Length=516

 Score =   137 bits (344),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 77/99 (78%), Gaps = 0/99 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L +QEIH+W+I G      KF+GHK++++V+RSCFGGLD  FIASGSEDS+VYIW+R   
Sbjct  412  LNSQEIHMWDIAGEWLSPMKFEGHKQHKYVIRSCFGGLDSTFIASGSEDSKVYIWNRRGS  471

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  352
            + +  L GHS TVNCVSWN   P MLASASDD+TIRIWG
Sbjct  472  KPIKILCGHSMTVNCVSWNPKRPQMLASASDDQTIRIWG  510



>emb|CDY41528.1| BnaA06g22810D [Brassica napus]
Length=479

 Score =   136 bits (343),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 78/104 (75%), Gaps = 5/104 (5%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTC--IAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHR-  478
            L+ QEIH+W IDG      + KF GHKRNRFV+RSCFGG D+ FIASGSED+QVYIWH  
Sbjct  374  LITQEIHVWMIDGRREPRRVYKFSGHKRNRFVIRSCFGGYDDNFIASGSEDTQVYIWHTD  433

Query  477  -SSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGL  349
              +G     L GH G VNCVSWN A+ HMLASASDD+TIRIWGL
Sbjct  434  FETGPCC-VLPGHGGAVNCVSWNPADLHMLASASDDKTIRIWGL  476



>ref|XP_009792756.1| PREDICTED: WD repeat-containing protein 26 isoform X1 [Nicotiana 
sylvestris]
Length=516

 Score =   136 bits (343),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L +QEIH+W++ G      K+KGH+++++V+RSCFGGLD  FIASGSEDS+VYIW+R   
Sbjct  412  LNSQEIHMWDVAGEWLSPMKYKGHRQHKYVIRSCFGGLDSTFIASGSEDSKVYIWNRRGS  471

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  352
            + +  L GH+ TVNCVSWN   PHMLASASDD+TIRIWG
Sbjct  472  KPIEILCGHTMTVNCVSWNPKRPHMLASASDDQTIRIWG  510



>ref|NP_001064796.1| Os10g0465000 [Oryza sativa Japonica Group]
 dbj|BAF26710.1| Os10g0465000, partial [Oryza sativa Japonica Group]
Length=317

 Score =   134 bits (337),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 75/99 (76%), Gaps = 1/99 (1%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIA-KFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSS  472
            L +QEIHLW I  S T    KFKGHK+ +FV+RSCFGG +  FIASGSEDSQVYIW R  
Sbjct  206  LNSQEIHLWRISESSTAADNKFKGHKQGKFVIRSCFGGSNSLFIASGSEDSQVYIWKRHL  265

Query  471  GELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIW  355
               +  L+GHS TVNCVSWN A PHMLASASDDRT+RIW
Sbjct  266  ETPIKVLYGHSLTVNCVSWNPAKPHMLASASDDRTVRIW  304



>ref|XP_003574020.1| PREDICTED: WD repeat-containing protein 26 [Brachypodium distachyon]
Length=533

 Score =   136 bits (343),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 73/98 (74%), Gaps = 0/98 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L +QEIHLW  +GS +   KFKGHK+ +FV+RSCFGG D  FIASGSEDSQVYIW R   
Sbjct  427  LNSQEIHLWKTNGSSSVPDKFKGHKQGKFVIRSCFGGSDSLFIASGSEDSQVYIWKRCME  486

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIW  355
              +  LHGHS TVNCVSWN   P MLASASDD T+RIW
Sbjct  487  MPIKVLHGHSMTVNCVSWNPTRPQMLASASDDCTVRIW  524



>ref|XP_010441956.1| PREDICTED: WD repeat-containing protein 26 [Camelina sativa]
Length=531

 Score =   136 bits (343),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 63/104 (61%), Positives = 80/104 (77%), Gaps = 0/104 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L +QEIHLW++ G      KF GH+++++V+RSCFGGLD +FIASGSEDSQVY+W+  + 
Sbjct  416  LSSQEIHLWDLAGEWNQPLKFSGHRQSKYVIRSCFGGLDSSFIASGSEDSQVYLWNLKNA  475

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVN  337
            + +  L GHS TVNCVSWN  NP MLASASDD+TIRIWG  + N
Sbjct  476  KPLEVLSGHSMTVNCVSWNPRNPRMLASASDDQTIRIWGPGKPN  519



>ref|XP_009150419.1| PREDICTED: WD repeat-containing protein 26-like [Brassica rapa]
Length=477

 Score =   136 bits (342),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 78/104 (75%), Gaps = 5/104 (5%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTC--IAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHR-  478
            L+ QEIH+W IDG      + KF GHKRNRFV+RSCFGG D+ FIASGSED+QVYIWH  
Sbjct  372  LITQEIHVWMIDGRREPRRVYKFSGHKRNRFVIRSCFGGYDDNFIASGSEDTQVYIWHTD  431

Query  477  -SSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGL  349
              +G     L GH G VNCVSWN A+ HMLASASDD+TIRIWGL
Sbjct  432  FETGPCC-VLPGHGGAVNCVSWNPADLHMLASASDDKTIRIWGL  474



>ref|XP_010494385.1| PREDICTED: WD repeat-containing protein 26-like isoform X2 [Camelina 
sativa]
Length=531

 Score =   136 bits (343),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 63/104 (61%), Positives = 80/104 (77%), Gaps = 0/104 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L +QEIHLW++ G      KF GH+++++V+RSCFGGLD +FIASGSEDSQVY+W+  + 
Sbjct  416  LSSQEIHLWDLAGEWKQPLKFSGHRQSKYVIRSCFGGLDSSFIASGSEDSQVYLWNLKNA  475

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVN  337
            + +  L GHS TVNCVSWN  NP MLASASDD+TIRIWG  + N
Sbjct  476  KPLEVLSGHSMTVNCVSWNPRNPRMLASASDDQTIRIWGPGKPN  519



>ref|XP_010494383.1| PREDICTED: WD repeat-containing protein 26-like isoform X1 [Camelina 
sativa]
Length=533

 Score =   136 bits (343),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 63/104 (61%), Positives = 80/104 (77%), Gaps = 0/104 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L +QEIHLW++ G      KF GH+++++V+RSCFGGLD +FIASGSEDSQVY+W+  + 
Sbjct  418  LSSQEIHLWDLAGEWKQPLKFSGHRQSKYVIRSCFGGLDSSFIASGSEDSQVYLWNLKNA  477

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVN  337
            + +  L GHS TVNCVSWN  NP MLASASDD+TIRIWG  + N
Sbjct  478  KPLEVLSGHSMTVNCVSWNPRNPRMLASASDDQTIRIWGPGKPN  521



>ref|XP_006281895.1| hypothetical protein CARUB_v10028093mg, partial [Capsella rubella]
 gb|EOA14793.1| hypothetical protein CARUB_v10028093mg, partial [Capsella rubella]
Length=531

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 76/101 (75%), Gaps = 2/101 (2%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWH--RS  475
            L+ Q+IH+WNI+G     +++ GHKR+RF++RSCFGG  ++FIASGSEDSQVYIW   R 
Sbjct  393  LITQKIHMWNIEGEPYLCSEYTGHKRSRFIIRSCFGGYKDSFIASGSEDSQVYIWKILRP  452

Query  474  SGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  352
              E    L GHSG VNCVSWN  + HMLASASDD TIRIWG
Sbjct  453  QKEPCSVLRGHSGAVNCVSWNPTDLHMLASASDDGTIRIWG  493



>ref|XP_010481799.1| PREDICTED: WD repeat-containing protein 26-like isoform X1 [Camelina 
sativa]
Length=531

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 82/108 (76%), Gaps = 0/108 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L +QEIHLW++ G      KF GH+++++V+RSCFGGL+ +FIASGSEDSQVY+W+  + 
Sbjct  416  LSSQEIHLWDLAGDWKQPLKFSGHRQSKYVIRSCFGGLNSSFIASGSEDSQVYLWNLKNA  475

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQN  325
            + +  L GHS TVNCVSWN  NP MLASASDD+TIRIWG  + N  +N
Sbjct  476  KPLEVLSGHSMTVNCVSWNPRNPRMLASASDDQTIRIWGPGKPNNPEN  523



>emb|CDX84431.1| BnaC03g50690D [Brassica napus]
Length=504

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/103 (67%), Positives = 75/103 (73%), Gaps = 3/103 (3%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTC--IAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRS  475
            L+ QEIH+W IDG      + KF GHKR+RFV+RSCFGG DE FIASGSEDSQVYIWH  
Sbjct  399  LITQEIHVWMIDGRREPRRVYKFSGHKRSRFVIRSCFGGYDENFIASGSEDSQVYIWHTD  458

Query  474  SGE-LVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGL  349
                    L GH G VNCVSWN  + HMLASASDDRTIRIWGL
Sbjct  459  FERGPCCVLPGHGGAVNCVSWNPTDIHMLASASDDRTIRIWGL  501



>ref|XP_002866568.1| hypothetical protein ARALYDRAFT_919661 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42827.1| hypothetical protein ARALYDRAFT_919661 [Arabidopsis lyrata subsp. 
lyrata]
Length=513

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 77/102 (75%), Gaps = 2/102 (2%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIW--HRS  475
            L+ Q+IH+WNI+G      ++ GHKR+RF++RSCFGG +++FIASGSEDSQVYIW   R 
Sbjct  407  LITQKIHVWNIEGQPYKCFEYNGHKRSRFIIRSCFGGYEDSFIASGSEDSQVYIWIIRRL  466

Query  474  SGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGL  349
              E    L GHSG VNCVSWN  N HMLASASDD TIRIWGL
Sbjct  467  QKEPCIVLRGHSGAVNCVSWNPINLHMLASASDDGTIRIWGL  508



>gb|KFK31679.1| hypothetical protein AALP_AA6G145100 [Arabis alpina]
Length=529

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 77/99 (78%), Gaps = 0/99 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L +QEIHLW++ G      KF GHK++++V+RSCFGGLD +FIASGSE+SQVYIW+    
Sbjct  417  LSSQEIHLWDLAGEWKQPLKFSGHKQSKYVIRSCFGGLDSSFIASGSENSQVYIWNLKKA  476

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  352
            + +  L GHS TVNCVSWN  NP MLASASDD+TIRIWG
Sbjct  477  KPLEVLSGHSMTVNCVSWNPRNPRMLASASDDQTIRIWG  515



>ref|XP_009370775.1| PREDICTED: WD repeat-containing protein 26 [Pyrus x bretschneideri]
 ref|XP_009370783.1| PREDICTED: WD repeat-containing protein 26 [Pyrus x bretschneideri]
 ref|XP_009370792.1| PREDICTED: WD repeat-containing protein 26 [Pyrus x bretschneideri]
 ref|XP_009370800.1| PREDICTED: WD repeat-containing protein 26 [Pyrus x bretschneideri]
Length=522

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 80/107 (75%), Gaps = 0/107 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L +QEIH+W++ G      KF GHK++++V+RSCFGGL+ AFIASGSE+SQVYIW+R + 
Sbjct  411  LNSQEIHMWDVAGKWEKPLKFTGHKQSKYVIRSCFGGLNSAFIASGSENSQVYIWNRRNS  470

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQ  328
            + +  LHGHS TV CVSWN   P MLASASDD TIRIWG  + N  Q
Sbjct  471  KPIEVLHGHSMTVKCVSWNHKRPQMLASASDDHTIRIWGSSRPNKIQ  517



>ref|XP_007162638.1| hypothetical protein PHAVU_001G167600g [Phaseolus vulgaris]
 gb|ESW34632.1| hypothetical protein PHAVU_001G167600g [Phaseolus vulgaris]
Length=528

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L +QEIH+W++DG     ++FKGHK++++V+RSCFGGL+  FIASGSE+SQVYIW+R + 
Sbjct  419  LNSQEIHMWDVDGKWDMPSRFKGHKQHKYVIRSCFGGLNNTFIASGSENSQVYIWNRRNP  478

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  352
              +  L GHS TVNCVSWN   P MLASASDD TIRIWG
Sbjct  479  TPIEVLSGHSMTVNCVSWNPKIPQMLASASDDYTIRIWG  517



>emb|CDY13140.1| BnaA09g16770D [Brassica napus]
Length=1106

 Score =   137 bits (346),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 80/104 (77%), Gaps = 0/104 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L +QEIHLW++ G      KF GH+++++V+RSCFGGLD +FIASGSEDSQVYIW+  + 
Sbjct  415  LSSQEIHLWDLAGEWKQPLKFTGHRQSKYVIRSCFGGLDSSFIASGSEDSQVYIWNVKNK  474

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVN  337
            + +  L GHS TVNCVSWN  NP MLASASDD+TIRIWG  + N
Sbjct  475  KPLEVLSGHSMTVNCVSWNPRNPRMLASASDDQTIRIWGPGKPN  518



>ref|XP_636788.1| hypothetical protein DDB_G0288313 [Dictyostelium discoideum AX4]
 gb|EAL63299.1| hypothetical protein DDB_G0288313 [Dictyostelium discoideum AX4]
Length=1040

 Score =   137 bits (345),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 58/96 (60%), Positives = 77/96 (80%), Gaps = 1/96 (1%)
 Frame = -3

Query  642   NQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSGEL  463
             NQEIHLW+++  +  + K++GHK+ RFV+RSCFGG+D+AF+ SGSEDS +YIWHRSSG L
Sbjct  930   NQEIHLWDLEKQII-VQKYRGHKQGRFVIRSCFGGVDQAFVLSGSEDSTIYIWHRSSGIL  988

Query  462   VGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIW  355
             + TL  HSGTVN V W+  NP +  SASDD+TI++W
Sbjct  989   LETLSRHSGTVNTVCWSPCNPFIFCSASDDQTIKVW  1024



>ref|XP_009629555.1| PREDICTED: WD repeat-containing protein 26 isoform X2 [Nicotiana 
tomentosiformis]
Length=486

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 77/99 (78%), Gaps = 0/99 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L +QEIH+W++ G      K+K H+++++V+RSCFGGLD  FIASGSEDS+VYIW+R   
Sbjct  381  LNSQEIHMWDVAGEWFSPMKYKSHRQHKYVIRSCFGGLDSTFIASGSEDSKVYIWNRRGS  440

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  352
            + +  L GH+ TVNCVSWN   PHMLASASDD+TIRIWG
Sbjct  441  KPIEILCGHTMTVNCVSWNPKRPHMLASASDDQTIRIWG  479



>gb|EEE51100.1| hypothetical protein OsJ_31819 [Oryza sativa Japonica Group]
Length=533

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 75/99 (76%), Gaps = 1/99 (1%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIA-KFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSS  472
            L +QEIHLW I  S T    KFKGHK+ +FV+RSCFGG +  FIASGSEDSQVYIW R  
Sbjct  422  LNSQEIHLWRISESSTAADNKFKGHKQGKFVIRSCFGGSNSLFIASGSEDSQVYIWKRHL  481

Query  471  GELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIW  355
               +  L+GHS TVNCVSWN A PHMLASASDDRT+RIW
Sbjct  482  ETPIKVLYGHSLTVNCVSWNPAKPHMLASASDDRTVRIW  520



>ref|XP_010684801.1| PREDICTED: WD repeat-containing protein 26 [Beta vulgaris subsp. 
vulgaris]
Length=549

 Score =   134 bits (337),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 77/99 (78%), Gaps = 0/99 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L +QEIHLW++ G      K+ GH++N++V+RSCFGG + AFIASGSE+S+VYIW+R   
Sbjct  437  LNSQEIHLWDVAGKWKKPLKYTGHRQNKYVIRSCFGGFNSAFIASGSENSEVYIWNRQKS  496

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  352
            E +  L GHS TVN VSWN  NPH+LASASDD+T+RIWG
Sbjct  497  EPIAILSGHSMTVNSVSWNPRNPHLLASASDDQTVRIWG  535



>ref|XP_004345356.1| hypothetical protein ACA1_355860 [Acanthamoeba castellanii str. 
Neff]
 gb|ELR21230.1| hypothetical protein ACA1_355860 [Acanthamoeba castellanii str. 
Neff]
Length=598

 Score =   134 bits (338),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 86/120 (72%), Gaps = 2/120 (2%)
 Frame = -3

Query  642  NQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSGEL  463
            +QE+HLW++D S T + K+ GHK++RFV+RSCFGG+D+ F+ SGSED+ VYIW+R  G L
Sbjct  416  SQEVHLWDLD-SRTLVQKYSGHKQSRFVIRSCFGGVDQGFVVSGSEDNNVYIWNREHGTL  474

Query  462  VGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNG-VHHCNGG  286
            + +L GH+ TVN V+WN  NPH LA+ASDD TIRIW  +    +++ T      H  NGG
Sbjct  475  LDSLTGHTATVNSVTWNPKNPHQLAAASDDHTIRIWESEHAGAQRHGTKRKTRAHEENGG  534



>gb|EEC67126.1| hypothetical protein OsI_33942 [Oryza sativa Indica Group]
Length=533

 Score =   134 bits (337),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 75/99 (76%), Gaps = 1/99 (1%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIA-KFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSS  472
            L +QEIHLW I  S T    KFKGHK+ +FV+RSCFGG +  FIASGSEDSQVYIW R  
Sbjct  422  LNSQEIHLWRISESSTAPDNKFKGHKQGKFVIRSCFGGSNSLFIASGSEDSQVYIWKRHL  481

Query  471  GELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIW  355
               +  L+GHS TVNCVSWN A PHMLASASDDRT+RIW
Sbjct  482  ETPIKVLYGHSLTVNCVSWNPAKPHMLASASDDRTVRIW  520



>ref|XP_009629554.1| PREDICTED: WD repeat-containing protein 26 isoform X1 [Nicotiana 
tomentosiformis]
Length=517

 Score =   134 bits (336),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 77/99 (78%), Gaps = 0/99 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L +QEIH+W++ G      K+K H+++++V+RSCFGGLD  FIASGSEDS+VYIW+R   
Sbjct  412  LNSQEIHMWDVAGEWFSPMKYKSHRQHKYVIRSCFGGLDSTFIASGSEDSKVYIWNRRGS  471

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  352
            + +  L GH+ TVNCVSWN   PHMLASASDD+TIRIWG
Sbjct  472  KPIEILCGHTMTVNCVSWNPKRPHMLASASDDQTIRIWG  510



>ref|XP_009386572.1| PREDICTED: WD repeat-containing protein 26 [Musa acuminata subsp. 
malaccensis]
Length=532

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 75/98 (77%), Gaps = 0/98 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L ++EIHLWNI+ S +   KF+GHK+ ++V+RSCFGG +  FIASGSEDSQ+YIW R   
Sbjct  423  LNSEEIHLWNINVSSSLPDKFRGHKQGKYVIRSCFGGSNSLFIASGSEDSQIYIWQRHRE  482

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIW  355
              +  L GHS TVNCVSWN A P MLASASDDRT+RIW
Sbjct  483  TPIKILTGHSMTVNCVSWNPAKPRMLASASDDRTVRIW  520



>ref|XP_008447357.1| PREDICTED: LOW QUALITY PROTEIN: WD repeat-containing protein 
26 [Cucumis melo]
Length=522

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 76/99 (77%), Gaps = 0/99 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L NQEIH+W++ G      K+ GH++N++V+RSCFGG + AFIASGSE+S+VYIW R S 
Sbjct  412  LNNQEIHMWDVAGEWQQPLKYTGHQQNKYVIRSCFGGXNSAFIASGSENSEVYIWSRHSS  471

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  352
            + +  L GHS TVNCVSWN   P MLASASDD+TIRIWG
Sbjct  472  KPIEVLSGHSTTVNCVSWNPKRPKMLASASDDQTIRIWG  510



>gb|EFA80856.1| hypothetical protein PPL_06445 [Polysphondylium pallidum PN500]
Length=760

 Score =   135 bits (339),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 55/103 (53%), Positives = 79/103 (77%), Gaps = 1/103 (1%)
 Frame = -3

Query  642  NQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSGEL  463
            NQEIHLW+++  +  + K++G ++ RFV+RSCFGG+DE FI SGSEDS++YIW R +G L
Sbjct  629  NQEIHLWDLEKRII-VQKYRGQRQGRFVIRSCFGGVDEGFILSGSEDSKIYIWRRQNGAL  687

Query  462  VGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNL  334
            +  L GH+ TVNCV+W+  +P++  SASDD TIR+W  K++ L
Sbjct  688  LECLSGHTKTVNCVAWSPTDPYLFCSASDDETIRVWTRKELEL  730



>emb|CDY36957.1| BnaC09g17730D [Brassica napus]
Length=1092

 Score =   135 bits (341),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L +QEIHLW++ G      KF GH+++++V+RSCFGGLD +FIASGSEDSQVYIW+  + 
Sbjct  415  LSSQEIHLWDLAGEWKQPLKFTGHRQSKYVIRSCFGGLDSSFIASGSEDSQVYIWNVKNK  474

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  352
            + +  L GHS TVNCVSWN  NP MLASASDD+TIRIWG
Sbjct  475  KPLEVLSGHSMTVNCVSWNPRNPLMLASASDDQTIRIWG  513



>ref|XP_008382686.1| PREDICTED: WD repeat-containing protein 26 [Malus domestica]
 ref|XP_008382687.1| PREDICTED: WD repeat-containing protein 26 [Malus domestica]
 ref|XP_008382688.1| PREDICTED: WD repeat-containing protein 26 [Malus domestica]
Length=522

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 79/112 (71%), Gaps = 0/112 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L +QEIH+W++ G      K+ GHK++++V+RSCFGGL+  FIASGSE+SQVYIW+R + 
Sbjct  411  LNSQEIHMWDVAGEWEKPLKYMGHKQSKYVIRSCFGGLNSTFIASGSENSQVYIWNRRNS  470

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVC  313
              +  L GH  TVNCVSWN   P MLASASDD TIRIWG  + N  Q   +C
Sbjct  471  RPIEVLRGHLMTVNCVSWNLKRPQMLASASDDHTIRIWGSSRPNKIQPQKLC  522



>ref|XP_004495043.1| PREDICTED: WD repeat-containing protein 26-like [Cicer arietinum]
Length=513

 Score =   131 bits (330),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 76/99 (77%), Gaps = 0/99 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L +QEIH+W++ G+     K+ GHK+ ++V+RSCFGGLD  FIASGSE+S+VYIW+  S 
Sbjct  412  LNSQEIHMWDVAGTWKKPLKYMGHKQCKYVIRSCFGGLDSTFIASGSENSEVYIWNSRSS  471

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  352
            + +  L GHS TVNCVSWN   PHMLASASDD TIRIWG
Sbjct  472  KPIEVLSGHSLTVNCVSWNPKRPHMLASASDDHTIRIWG  510



>ref|XP_004247123.1| PREDICTED: WD repeat-containing protein 26 [Solanum lycopersicum]
Length=516

 Score =   131 bits (330),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 76/99 (77%), Gaps = 0/99 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L +QEIH+W+I G      KF+GH+++++V+RSCFGGLD  FIASGSEDS+VYIW+R   
Sbjct  412  LNSQEIHMWDIAGEWLSPMKFEGHRQHKYVIRSCFGGLDSTFIASGSEDSKVYIWNRRGS  471

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  352
            + +  L GHS TVN VSWN   P MLASASDD+TIRIWG
Sbjct  472  KPIEILCGHSMTVNSVSWNPKRPQMLASASDDQTIRIWG  510



>ref|XP_006443707.1| hypothetical protein CICLE_v10019514mg [Citrus clementina]
 ref|XP_006479415.1| PREDICTED: WD repeat-containing protein 26-like isoform X1 [Citrus 
sinensis]
 gb|ESR56947.1| hypothetical protein CICLE_v10019514mg [Citrus clementina]
Length=565

 Score =   132 bits (331),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 76/102 (75%), Gaps = 0/102 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L +QEIH+W++ G      K+ GH +N++V+RSCFGGLD  FIASGSE+SQ+YIW+R + 
Sbjct  460  LNSQEIHMWDVAGKWEKPFKYTGHSQNKYVIRSCFGGLDSTFIASGSENSQIYIWNRRNS  519

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQ  343
            + +  L GHS TVNCVSWN   P MLASASDD TIRIWG  Q
Sbjct  520  KPIEILSGHSMTVNCVSWNPKRPKMLASASDDHTIRIWGPCQ  561



>gb|KDO60331.1| hypothetical protein CISIN_1g042434mg [Citrus sinensis]
Length=517

 Score =   131 bits (329),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 76/102 (75%), Gaps = 0/102 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L +QEIH+W++ G      K+ GH +N++V+RSCFGGLD  FIASGSE+SQ+YIW+R + 
Sbjct  412  LNSQEIHMWDVAGKWEKPFKYTGHSQNKYVIRSCFGGLDGTFIASGSENSQIYIWNRRNS  471

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQ  343
            + +  L GHS TVNCVSWN   P MLASASDD TIRIWG  Q
Sbjct  472  KPIEILSGHSMTVNCVSWNPKRPKMLASASDDHTIRIWGPCQ  513



>gb|KJE91550.1| hypothetical protein CAOG_009572 [Capsaspora owczarzaki ATCC 
30864]
Length=1043

 Score =   134 bits (336),  Expect = 7e-32, Method: Composition-based stats.
 Identities = 56/93 (60%), Positives = 74/93 (80%), Gaps = 1/93 (1%)
 Frame = -3

Query  633  IHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSGELVGT  454
            IHLW+I+  V  + K+ GH+++ +V+RSCFGGL+E+FIASGSEDS +YIWHR  G+L+  
Sbjct  467  IHLWDIEKRVL-VNKYYGHRQSSYVIRSCFGGLNESFIASGSEDSLIYIWHRHHGQLLER  525

Query  453  LHGHSGTVNCVSWNGANPHMLASASDDRTIRIW  355
            L GHS T+NCV+WN  NP M ASASDD T+R+W
Sbjct  526  LAGHSNTINCVTWNSQNPFMFASASDDFTVRVW  558



>ref|XP_011083080.1| PREDICTED: WD repeat-containing protein 26 [Sesamum indicum]
Length=515

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 73/99 (74%), Gaps = 0/99 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L +QEIH+W+I G      K+ GH++ ++V+RSCFGGL+  FIASGSEDS+VYIW+R S 
Sbjct  412  LNSQEIHMWDIAGKWLKPLKYNGHRQQKYVIRSCFGGLNSMFIASGSEDSKVYIWNRRSS  471

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  352
              +  L GH  TVNCVSWN   P MLASASDD TIRIWG
Sbjct  472  NPIEILSGHLMTVNCVSWNPRRPEMLASASDDNTIRIWG  510



>ref|XP_010918959.1| PREDICTED: WD repeat-containing protein 26 [Elaeis guineensis]
Length=542

 Score =   129 bits (323),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 72/98 (73%), Gaps = 0/98 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L ++EIHLW ++ +     KF+GHK+ ++V+RSCFGG +  FIASGSEDSQ+YIW R   
Sbjct  434  LNSEEIHLWKVNATSDVPDKFRGHKQGKYVIRSCFGGSNCLFIASGSEDSQIYIWQRHHE  493

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIW  355
              +  L GHS TVNCVSWN   PHMLASASDD T+RIW
Sbjct  494  TPIKVLSGHSKTVNCVSWNPTKPHMLASASDDDTVRIW  531



>emb|CDP03813.1| unnamed protein product [Coffea canephora]
Length=511

 Score =   127 bits (320),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 74/99 (75%), Gaps = 0/99 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L +QEIH+W++ G      K++GH + ++V+RSCFGGLD  FIASGSEDSQVY+W++ S 
Sbjct  409  LNSQEIHMWDVAGKWVKPWKYEGHMQQKYVIRSCFGGLDSRFIASGSEDSQVYVWNQLSS  468

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  352
              +  L GH  TVNCVSWN   P MLASASDD+TIRIWG
Sbjct  469  YPIEILSGHLMTVNCVSWNPRRPQMLASASDDQTIRIWG  507



>ref|XP_004349429.2| WD repeat-containing protein [Capsaspora owczarzaki ATCC 30864]
 ref|XP_011270165.1| WD repeat-containing protein, variant [Capsaspora owczarzaki 
ATCC 30864]
Length=594

 Score =   128 bits (322),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 74/93 (80%), Gaps = 1/93 (1%)
 Frame = -3

Query  633  IHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSGELVGT  454
            IHLW+I+  V  + K+ GH+++ +V+RSCFGGL+E+FIASGSEDS +YIWHR  G+L+  
Sbjct  467  IHLWDIEKRV-LVNKYYGHRQSSYVIRSCFGGLNESFIASGSEDSLIYIWHRHHGQLLER  525

Query  453  LHGHSGTVNCVSWNGANPHMLASASDDRTIRIW  355
            L GHS T+NCV+WN  NP M ASASDD T+R+W
Sbjct  526  LAGHSNTINCVTWNSQNPFMFASASDDFTVRVW  558



>gb|EXX54855.1| glucose-induced degradation complex subunit GID7 [Rhizophagus 
irregularis DAOM 197198w]
Length=546

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 73/99 (74%), Gaps = 1/99 (1%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L  +EIHLW+ID     + K+ G K+ +FV+RSCFGG+D+ FI SGSEDS++Y+WHR   
Sbjct  435  LSTKEIHLWDIDER-RIVRKYLGQKQGKFVIRSCFGGIDQGFIVSGSEDSKIYVWHREHA  493

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  352
            +L+ TL GH G VN V+W+  NP+M ASA DD TIRIWG
Sbjct  494  DLIETLSGHKGAVNSVNWSPVNPYMFASAGDDNTIRIWG  532



>ref|XP_003286147.1| hypothetical protein DICPUDRAFT_46602 [Dictyostelium purpureum]
 gb|EGC37333.1| hypothetical protein DICPUDRAFT_46602 [Dictyostelium purpureum]
Length=1022

 Score =   130 bits (326),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 55/95 (58%), Positives = 74/95 (78%), Gaps = 1/95 (1%)
 Frame = -3

Query  639   QEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSGELV  460
             QEIHLW+++     + K++G K+ RFV+RSCFGG+DEAFI SGSEDS +YIWHR +G L+
Sbjct  921   QEIHLWDLEKQ-NIVQKYRGQKQGRFVIRSCFGGVDEAFILSGSEDSTIYIWHRQTGTLL  979

Query  459   GTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIW  355
              TL  HSGTVN V W+  +P++  SASDD+TI++W
Sbjct  980   ETLSRHSGTVNTVCWSPCSPNIFCSASDDQTIKVW  1014



>gb|EYU17955.1| hypothetical protein MIMGU_mgv1a004677mg [Erythranthe guttata]
Length=515

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 72/99 (73%), Gaps = 0/99 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L +QEIH+W+I         +KGH + ++V+RSCFGGL+  FIASGSEDS+VYIW+R S 
Sbjct  412  LNSQEIHMWDITREGVKSQTYKGHVQQKYVIRSCFGGLNSMFIASGSEDSKVYIWNRRSP  471

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  352
              +  L GHS TVNCVSWN   P MLASASDD TIRIWG
Sbjct  472  VPIEILSGHSMTVNCVSWNPRRPQMLASASDDNTIRIWG  510



>gb|KHF98324.1| WD repeat-containing 26 [Gossypium arboreum]
Length=524

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 76/107 (71%), Gaps = 0/107 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L +QEIHL ++ G      K+ GHK+N++V+RSCFGG++  FIASGSE++QVYIW+R S 
Sbjct  412  LNSQEIHLRDVAGKWAKPLKYTGHKQNKYVIRSCFGGINSMFIASGSENTQVYIWNRQSS  471

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQ  328
              +  L GHS TVN VSWN   P MLASASDD TIRIWG  Q N  Q
Sbjct  472  TPIEVLSGHSMTVNSVSWNPKRPLMLASASDDHTIRIWGPSQSNKIQ  518



>gb|KJB26051.1| hypothetical protein B456_004G222700 [Gossypium raimondii]
Length=524

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 76/107 (71%), Gaps = 0/107 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L +QEIHL ++ G      K+ GHK+N++V+RSCFGG++  FIASGSE++QVYIW+R S 
Sbjct  412  LNSQEIHLRDVAGKWAKPLKYTGHKQNKYVIRSCFGGINSMFIASGSENTQVYIWNRQSS  471

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQ  328
              +  L GHS TVN VSWN   P MLASASDD TIRIWG  Q N  Q
Sbjct  472  TPIEVLSGHSMTVNSVSWNPKRPLMLASASDDHTIRIWGPSQSNKIQ  518



>ref|XP_008775134.1| PREDICTED: WD repeat-containing protein 26 [Phoenix dactylifera]
Length=542

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 72/98 (73%), Gaps = 0/98 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L ++EIHLWN++ +     KF+GHK+ ++V+RSCFGG +  FIASGSEDSQ+YIW R   
Sbjct  434  LNSEEIHLWNVNATSDVPDKFRGHKQGKYVIRSCFGGSNCLFIASGSEDSQIYIWQRHHE  493

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIW  355
              +  L GHS TVN VSWN   PHMLASASDD T+RIW
Sbjct  494  MPIKVLSGHSKTVNSVSWNPMKPHMLASASDDETVRIW  531



>ref|XP_010264797.1| PREDICTED: WD repeat-containing protein 26 isoform X4 [Nelumbo 
nucifera]
Length=518

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 73/99 (74%), Gaps = 0/99 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L +QEIHLW +        K+ GH++ ++V+RSCFGGL+  FIASGSEDSQVYIW+R S 
Sbjct  412  LNSQEIHLWGVAEKWDKPLKYVGHRQGKYVIRSCFGGLNCMFIASGSEDSQVYIWNRKSC  471

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  352
            + +  L GH  TVNCVSWN   P MLASASDD+TIRIWG
Sbjct  472  KPIEVLPGHRMTVNCVSWNPRRPQMLASASDDQTIRIWG  510



>ref|XP_010264796.1| PREDICTED: WD repeat-containing protein 26 isoform X3 [Nelumbo 
nucifera]
Length=519

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 73/99 (74%), Gaps = 0/99 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L +QEIHLW +        K+ GH++ ++V+RSCFGGL+  FIASGSEDSQVYIW+R S 
Sbjct  413  LNSQEIHLWGVAEKWDKPLKYVGHRQGKYVIRSCFGGLNCMFIASGSEDSQVYIWNRKSC  472

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  352
            + +  L GH  TVNCVSWN   P MLASASDD+TIRIWG
Sbjct  473  KPIEVLPGHRMTVNCVSWNPRRPQMLASASDDQTIRIWG  511



>ref|XP_010264794.1| PREDICTED: WD repeat-containing protein 26 isoform X1 [Nelumbo 
nucifera]
Length=528

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 73/99 (74%), Gaps = 0/99 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L +QEIHLW +        K+ GH++ ++V+RSCFGGL+  FIASGSEDSQVYIW+R S 
Sbjct  422  LNSQEIHLWGVAEKWDKPLKYVGHRQGKYVIRSCFGGLNCMFIASGSEDSQVYIWNRKSC  481

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  352
            + +  L GH  TVNCVSWN   P MLASASDD+TIRIWG
Sbjct  482  KPIEVLPGHRMTVNCVSWNPRRPQMLASASDDQTIRIWG  520



>ref|XP_010264795.1| PREDICTED: WD repeat-containing protein 26 isoform X2 [Nelumbo 
nucifera]
Length=527

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 73/99 (74%), Gaps = 0/99 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L +QEIHLW +        K+ GH++ ++V+RSCFGGL+  FIASGSEDSQVYIW+R S 
Sbjct  421  LNSQEIHLWGVAEKWDKPLKYVGHRQGKYVIRSCFGGLNCMFIASGSEDSQVYIWNRKSC  480

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  352
            + +  L GH  TVNCVSWN   P MLASASDD+TIRIWG
Sbjct  481  KPIEVLPGHRMTVNCVSWNPRRPQMLASASDDQTIRIWG  519



>ref|XP_010040357.1| PREDICTED: WD repeat-containing protein 26-like [Eucalyptus grandis]
 ref|XP_010040358.1| PREDICTED: WD repeat-containing protein 26-like [Eucalyptus grandis]
 ref|XP_010040359.1| PREDICTED: WD repeat-containing protein 26-like [Eucalyptus grandis]
 gb|KCW45283.1| hypothetical protein EUGRSUZ_L01054 [Eucalyptus grandis]
Length=524

 Score =   126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 75/99 (76%), Gaps = 0/99 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L +QEIH+W++ G     +++ GHK++++V+RSCFGGL+  FIASGSED+QVY+W+R S 
Sbjct  411  LNSQEIHMWDVAGKFVKPSRYIGHKQHKYVIRSCFGGLNSRFIASGSEDAQVYLWNRRSP  470

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  352
            + +  L GH  TVN VSWN   P MLASASDD+TIR+W 
Sbjct  471  QPIEILSGHKTTVNSVSWNPRRPQMLASASDDQTIRVWA  509



>ref|XP_002533626.1| WD-repeat protein, putative [Ricinus communis]
 gb|EEF28755.1| WD-repeat protein, putative [Ricinus communis]
Length=523

 Score =   126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 77/102 (75%), Gaps = 0/102 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L +QEIHLW++ G+     ++ GHK++++V+RSCFGGL+ +FIASGSE+SQVYIW+R + 
Sbjct  412  LNSQEIHLWDVAGNWEKALRYMGHKQHKYVIRSCFGGLNSSFIASGSENSQVYIWNRQNS  471

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQ  343
              +  L GH  TVNCVSWN     MLASASDD+TIRIWG  Q
Sbjct  472  RPIEVLSGHLMTVNCVSWNPRRHQMLASASDDQTIRIWGPSQ  513



>gb|KHN02443.1| WD repeat-containing protein 26 [Glycine soja]
Length=523

 Score =   126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 74/99 (75%), Gaps = 0/99 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L +QEIH+W++ G      +F GHK++++V+RSCFGGL+  FIASGSE+SQVYIW+  + 
Sbjct  414  LNSQEIHMWDVAGKWDKPLRFMGHKQHKYVIRSCFGGLNNTFIASGSENSQVYIWNCRNS  473

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  352
              V  L GHS TVNCVSWN   P MLASASDD TIRIWG
Sbjct  474  RPVEVLSGHSMTVNCVSWNPKIPQMLASASDDYTIRIWG  512



>ref|XP_003554312.1| PREDICTED: WD repeat-containing protein 26-like [Glycine max]
Length=523

 Score =   126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 74/99 (75%), Gaps = 0/99 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L +QEIH+W++ G      +F GHK++++V+RSCFGGL+  FIASGSE+SQVYIW+  + 
Sbjct  414  LNSQEIHMWDVAGKWDKPLRFMGHKQHKYVIRSCFGGLNNTFIASGSENSQVYIWNCRNS  473

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  352
              V  L GHS TVNCVSWN   P MLASASDD TIRIWG
Sbjct  474  RPVEVLSGHSMTVNCVSWNPKIPQMLASASDDYTIRIWG  512



>ref|XP_010069704.1| PREDICTED: WD repeat-containing protein 26-like [Eucalyptus grandis]
 gb|KCW58124.1| hypothetical protein EUGRSUZ_H00847 [Eucalyptus grandis]
Length=524

 Score =   126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 75/99 (76%), Gaps = 0/99 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L +QEIH+W++ G     +++ GHK++++V+RSCFGGL+  FIASGSED+QVY+W+R S 
Sbjct  411  LNSQEIHMWDVAGKFVKPSRYIGHKQHKYVIRSCFGGLNSRFIASGSEDAQVYLWNRRSP  470

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  352
            + +  L GH  TVN VSWN   P MLASASDD+TIR+W 
Sbjct  471  QPIEILSGHKTTVNSVSWNPRRPQMLASASDDQTIRVWA  509



>gb|KEH42443.1| transducin/WD40 repeat protein [Medicago truncatula]
Length=507

 Score =   126 bits (316),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 74/99 (75%), Gaps = 0/99 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L +QEIH+W++ G+     ++ GHK+ ++V+RSCFGG D  FIASGSE+S+VYIW+  S 
Sbjct  406  LNSQEIHMWDVAGTWKNPLRYTGHKQCKYVIRSCFGGSDSTFIASGSENSEVYIWNSRSS  465

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  352
            + +  L GHS TVNCVSWN   P MLASASDD TIRIWG
Sbjct  466  KPIEVLSGHSLTVNCVSWNPKRPQMLASASDDHTIRIWG  504



>ref|XP_008235562.1| PREDICTED: WD repeat-containing protein 26 [Prunus mume]
Length=522

 Score =   126 bits (316),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 74/99 (75%), Gaps = 0/99 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L +QEIH+W++ G      K+ GHK++++V+RSCFG L+  FIASGSE++QVYIW+R + 
Sbjct  411  LNSQEIHMWDVAGEWVKPLKYMGHKQSKYVIRSCFGPLNSTFIASGSENAQVYIWNRRNS  470

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  352
              +  L GHS TVNCVSWN   P MLASASDD +IRIWG
Sbjct  471  RPIEVLRGHSMTVNCVSWNHRRPQMLASASDDHSIRIWG  509



>ref|XP_007201159.1| hypothetical protein PRUPE_ppa004283mg [Prunus persica]
 gb|EMJ02358.1| hypothetical protein PRUPE_ppa004283mg [Prunus persica]
Length=518

 Score =   125 bits (315),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 75/99 (76%), Gaps = 0/99 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L +QEIH+W++ G      K+ GHK++++V+RSCFGGL+  FIASGSE++QVYIW+R + 
Sbjct  411  LNSQEIHMWDVAGEWVRPQKYMGHKQSKYVIRSCFGGLNSTFIASGSENAQVYIWNRRNH  470

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  352
              +  L GHS TVNCVSWN   P +LASASDD +IRIWG
Sbjct  471  RPIEVLRGHSMTVNCVSWNHRRPQLLASASDDHSIRIWG  509



>ref|XP_010091833.1| WD repeat-containing protein 26 [Morus notabilis]
 gb|EXB46041.1| WD repeat-containing protein 26 [Morus notabilis]
Length=533

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 73/97 (75%), Gaps = 0/97 (0%)
 Frame = -3

Query  642  NQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSGEL  463
            +QEIH+W++ G      K+ GHK++++V+RSCFGGL   FIASGSE++QVYIW+R +   
Sbjct  436  SQEIHMWDVAGKWEKPMKYTGHKQSKYVIRSCFGGLTSKFIASGSENTQVYIWNRRNSRP  495

Query  462  VGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  352
            +  L GHS TVNCVSWN     MLASASDD+TIRIWG
Sbjct  496  IEVLSGHSMTVNCVSWNPRRHRMLASASDDQTIRIWG  532



>ref|XP_002321301.2| hypothetical protein POPTR_0014s18590g [Populus trichocarpa]
 gb|EEE99616.2| hypothetical protein POPTR_0014s18590g [Populus trichocarpa]
Length=383

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 73/99 (74%), Gaps = 0/99 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L +QEIHLW++ G      K+ GH+++++V+RSCFGGLD +FIASGSE+SQVYIW+R + 
Sbjct  276  LNSQEIHLWDVAGKWKKPLKYIGHQQHKYVIRSCFGGLDSSFIASGSENSQVYIWNRRNS  335

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  352
              +  L GH  TVNCV WN     MLASASDD TIRIWG
Sbjct  336  RPIEVLSGHLMTVNCVCWNPKRHQMLASASDDHTIRIWG  374



>gb|EYU42822.1| hypothetical protein MIMGU_mgv1a024382mg [Erythranthe guttata]
Length=468

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 77/101 (76%), Gaps = 8/101 (8%)
 Frame = -3

Query  648  LLNQEIHLWNI---DGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHR  478
            L N+EIHLWNI   D  +  +  +KGHK  ++VVR+CF G    FIASGSEDS VY+WHR
Sbjct  372  LSNEEIHLWNIGLEDPEIVMV--YKGHKCKKYVVRACFFG---RFIASGSEDSWVYVWHR  426

Query  477  SSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIW  355
             SGEL+GT+HGHS TVN V+WN A+P ++AS SDDRT+RIW
Sbjct  427  GSGELLGTVHGHSDTVNSVTWNPAHPLLVASGSDDRTVRIW  467



>gb|KDP26444.1| hypothetical protein JCGZ_17602 [Jatropha curcas]
Length=416

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 78/110 (71%), Gaps = 1/110 (1%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L +QEIHLW++ G    + K+ GHK++++V+RSCFGGL+ +FIASGSE+SQVYIW+R   
Sbjct  308  LNSQEIHLWDVAGKQKAL-KYMGHKQHKYVIRSCFGGLNSSFIASGSENSQVYIWNRRIP  366

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNST  319
              +  L GH  TVNCVSWN     MLASASDD TIRIWG +    K  +T
Sbjct  367  MPIEVLSGHLMTVNCVSWNPRRHQMLASASDDHTIRIWGPRPSQSKNITT  416



>ref|XP_004356287.1| WD repeat protein [Dictyostelium fasciculatum]
 gb|EGG17803.1| WD repeat protein [Dictyostelium fasciculatum]
Length=819

 Score =   125 bits (314),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 54/96 (56%), Positives = 75/96 (78%), Gaps = 1/96 (1%)
 Frame = -3

Query  642  NQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSGEL  463
            NQEIHLW+++   T I K++G ++ RFV+RSCFGG D+ FI SGSEDS++YIW+R +G L
Sbjct  566  NQEIHLWDLEKR-TIIQKYRGMRQGRFVIRSCFGGADQTFIISGSEDSKIYIWNRLNGTL  624

Query  462  VGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIW  355
            + TL GH GTVN V W+  +P++  SASDD++I+IW
Sbjct  625  LETLSGHFGTVNSVHWSPTDPYLFCSASDDQSIKIW  660



>ref|XP_006681031.1| hypothetical protein BATDEDRAFT_20488 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF78340.1| hypothetical protein BATDEDRAFT_20488 [Batrachochytrium dendrobatidis 
JAM81]
Length=555

 Score =   123 bits (308),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 71/95 (75%), Gaps = 2/95 (2%)
 Frame = -3

Query  639  QEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSGELV  460
            QEIHLW+++     + K+ G K+ RFV+RSCFGG+ + FI SGSEDSQVYIWH  SG+L+
Sbjct  453  QEIHLWSLEHK-RLVRKYVGQKQGRFVIRSCFGGIHDNFILSGSEDSQVYIWHAESGKLM  511

Query  459  GTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIW  355
             TL GH+G VNCVSWN   P   ASASDD TIRIW
Sbjct  512  ETLEGHAGCVNCVSWNPTEP-AFASASDDNTIRIW  545



>gb|KHN09401.1| WD repeat-containing protein 26 [Glycine soja]
Length=402

 Score =   122 bits (306),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 73/99 (74%), Gaps = 0/99 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L +QEIH+W++ G      +F GHK++++V+RSCFGGL+  FIASG E+SQVYIW+  + 
Sbjct  296  LNSQEIHMWDVAGKWDKPLRFMGHKQHKYVIRSCFGGLNNTFIASGCENSQVYIWNCRNS  355

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  352
              +  L GHS TVNCVSWN   P MLASASDD TIR+WG
Sbjct  356  RPIEVLSGHSITVNCVSWNPKIPQMLASASDDYTIRVWG  394



>ref|XP_004292253.1| PREDICTED: WD repeat-containing protein 26 [Fragaria vesca subsp. 
vesca]
Length=524

 Score =   122 bits (306),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 74/99 (75%), Gaps = 0/99 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L +QEIH+W++ G +    K+ GH ++++V+RSCFGG +  FIASGSE++QVYIW+R + 
Sbjct  413  LNSQEIHMWDVAGKMEKPLKYMGHMQSKYVIRSCFGGANSTFIASGSENTQVYIWNRRNS  472

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  352
              +  L GH+ TVN VSWN   P MLASASDD+TIRIWG
Sbjct  473  RPIEVLCGHTMTVNSVSWNLRRPQMLASASDDQTIRIWG  511



>ref|XP_011118606.1| hypothetical protein AOL_s00007g403 [Arthrobotrys oligospora 
ATCC 24927]
 gb|EGX52620.1| hypothetical protein AOL_s00007g403 [Arthrobotrys oligospora 
ATCC 24927]
Length=565

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 68/89 (76%), Gaps = 0/89 (0%)
 Frame = -3

Query  597  IAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSGELVGTLHGHSGTVNCVS  418
            +  FKGHK+ +FV++SCFGG DE F+ SGSED  +Y+WH+ +G+L+ +L GH+GTVNCV+
Sbjct  461  VRTFKGHKQGKFVIKSCFGGADENFVVSGSEDCLIYVWHKDNGQLMESLEGHTGTVNCVA  520

Query  417  WNGANPHMLASASDDRTIRIWGLKQVNLK  331
            WN  NP M ASA DD+ +RIW +   +LK
Sbjct  521  WNPTNPQMFASAGDDKVVRIWSVASDSLK  549



>ref|XP_011035629.1| PREDICTED: WD repeat-containing protein 26 isoform X2 [Populus 
euphratica]
Length=519

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 73/99 (74%), Gaps = 0/99 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L +QEIHLW++ G      K+ GH+++++V+RSCFGGLD +FIASGSE+S+VYIW+R + 
Sbjct  412  LNSQEIHLWDVAGKWKKPLKYIGHQQHKYVIRSCFGGLDSSFIASGSENSKVYIWNRRNS  471

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  352
              +  L GH  TVNCV WN     MLASASDD TIRIWG
Sbjct  472  RPIEVLSGHLMTVNCVCWNPKRHQMLASASDDHTIRIWG  510



>ref|XP_005765500.1| hypothetical protein EMIHUDRAFT_452007 [Emiliania huxleyi CCMP1516]
 gb|EOD13071.1| hypothetical protein EMIHUDRAFT_452007 [Emiliania huxleyi CCMP1516]
Length=513

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 74/103 (72%), Gaps = 1/103 (1%)
 Frame = -3

Query  642  NQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSGEL  463
            +QE+H W++DG    +  + GH++ RFV+RS FGG  +  + SGSED+QVY+WHR SG L
Sbjct  411  SQEVHAWDVDGRRR-LGSYSGHRQGRFVIRSAFGGKHDGLVLSGSEDTQVYVWHRHSGAL  469

Query  462  VGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNL  334
            +  L GHS  VN VSW+ A+PH+ ASASDD T+RIWGL   ++
Sbjct  470  LRKLPGHSCAVNSVSWSPASPHLFASASDDHTVRIWGLPPPSV  512



>ref|XP_005763815.1| hypothetical protein EMIHUDRAFT_452457 [Emiliania huxleyi CCMP1516]
 gb|EOD11386.1| hypothetical protein EMIHUDRAFT_452457 [Emiliania huxleyi CCMP1516]
Length=513

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 74/103 (72%), Gaps = 1/103 (1%)
 Frame = -3

Query  642  NQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSGEL  463
            +QE+H W++DG    +  + GH++ RFV+RS FGG  +  + SGSED+QVY+WHR SG L
Sbjct  411  SQEVHAWDVDGRRR-LGSYSGHRQGRFVIRSAFGGKHDGLVLSGSEDTQVYVWHRHSGAL  469

Query  462  VGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNL  334
            +  L GHS  VN VSW+ A+PH+ ASASDD T+RIWGL   ++
Sbjct  470  LRKLPGHSCAVNSVSWSPASPHLFASASDDHTVRIWGLPPPSV  512



>gb|KFH66422.1| hypothetical protein MVEG_06947 [Mortierella verticillata NRRL 
6337]
Length=559

 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 75/112 (67%), Gaps = 3/112 (3%)
 Frame = -3

Query  639  QEIHLWNID-GSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSGEL  463
            +EIHLWN++ G +    ++ GHK+ R+++RSCFGG D+ F+ SGSEDS + IWHR +G L
Sbjct  447  REIHLWNLEEGRIE--RRYVGHKQGRYIIRSCFGGWDDRFVISGSEDSTICIWHRDNGNL  504

Query  462  VGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNG  307
            V TL GH   V CV+WN  +P ML SASDD TIRIWG  +        + NG
Sbjct  505  VQTLEGHHRPVTCVAWNPTHPTMLVSASDDNTIRIWGTPEDASDDQGPLVNG  556



>gb|ESA15537.1| hypothetical protein GLOINDRAFT_65155 [Rhizophagus irregularis 
DAOM 181602]
Length=535

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 72/100 (72%), Gaps = 1/100 (1%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L  +EIHLW+ID     + K+ G K+ +FV+RSCFGG+D+ FI SGSEDS++Y+WHR   
Sbjct  435  LSTKEIHLWDIDER-RIVRKYLGQKQGKFVIRSCFGGIDQGFIVSGSEDSKIYVWHREHA  493

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGL  349
            +L+ TL GH G VN V+W+  NP+M ASA DD TIR+  L
Sbjct  494  DLIETLSGHKGAVNSVNWSPVNPYMFASAGDDNTIRMLVL  533



>gb|EWC47369.1| hypothetical protein DRE_00337 [Drechslerella stenobrocha 248]
Length=577

 Score =   120 bits (302),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 48/89 (54%), Positives = 66/89 (74%), Gaps = 0/89 (0%)
 Frame = -3

Query  597  IAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSGELVGTLHGHSGTVNCVS  418
            +  FKGHK+ +FV++SCFGG DE F+ SGSED  +Y+WH+ +G L+ +L GH GTVNCV+
Sbjct  475  VRAFKGHKQGKFVIKSCFGGADENFVVSGSEDCMIYVWHKDNGMLIESLAGHKGTVNCVT  534

Query  417  WNGANPHMLASASDDRTIRIWGLKQVNLK  331
            WN  NP M ASA DD+ +RIW +   ++K
Sbjct  535  WNPTNPQMFASAGDDKVVRIWAVANDSMK  563



>ref|XP_011111734.1| hypothetical protein H072_5931 [Dactylellina haptotyla CBS 200.50]
 gb|EPS40252.1| hypothetical protein H072_5931 [Dactylellina haptotyla CBS 200.50]
Length=550

 Score =   120 bits (300),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 65/89 (73%), Gaps = 0/89 (0%)
 Frame = -3

Query  597  IAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSGELVGTLHGHSGTVNCVS  418
            +  FKGHK+ +FV++SCFGG DE F+ SGSED  +Y+WH+ +G L+ +L GH GTVNCV+
Sbjct  448  VRTFKGHKQGKFVIKSCFGGADENFVVSGSEDCMIYVWHKENGLLMESLSGHEGTVNCVA  507

Query  417  WNGANPHMLASASDDRTIRIWGLKQVNLK  331
            WN  NP M ASA DD+ +RIW +    LK
Sbjct  508  WNPTNPQMFASAGDDKVVRIWSVSGDTLK  536



>ref|XP_010481800.1| PREDICTED: WD repeat-containing protein 26-like isoform X2 [Camelina 
sativa]
Length=511

 Score =   119 bits (299),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 74/96 (77%), Gaps = 0/96 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L +QEIHLW++ G      KF GH+++++V+RSCFGGL+ +FIASGSEDSQVY+W+  + 
Sbjct  416  LSSQEIHLWDLAGDWKQPLKFSGHRQSKYVIRSCFGGLNSSFIASGSEDSQVYLWNLKNA  475

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIR  361
            + +  L GHS TVNCVSWN  NP MLASASD++ ++
Sbjct  476  KPLEVLSGHSMTVNCVSWNPRNPRMLASASDNQKMQ  511



>ref|XP_011035628.1| PREDICTED: WD repeat-containing protein 26 isoform X1 [Populus 
euphratica]
Length=520

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 73/100 (73%), Gaps = 1/100 (1%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDS-QVYIWHRSS  472
            L +QEIHLW++ G      K+ GH+++++V+RSCFGGLD +FIASGSE+S QVYIW+R +
Sbjct  412  LNSQEIHLWDVAGKWKKPLKYIGHQQHKYVIRSCFGGLDSSFIASGSENSKQVYIWNRRN  471

Query  471  GELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  352
               +  L GH  TVNCV WN     MLASASDD TIRIWG
Sbjct  472  SRPIEVLSGHLMTVNCVCWNPKRHQMLASASDDHTIRIWG  511



>emb|CBI37215.3| unnamed protein product [Vitis vinifera]
Length=460

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 71/102 (70%), Gaps = 0/102 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L ++EIH+W++ G      K+ GHK+N++V+RSCFGG    FIASGSE+S VYIW+R + 
Sbjct  352  LNSEEIHMWDVAGKWEKPLKYTGHKQNKYVIRSCFGGFHCTFIASGSENSLVYIWNRGNS  411

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQ  343
              +  L GH  TVNCVSWN     MLASASDD TIRIWG  Q
Sbjct  412  TPLEVLSGHLMTVNCVSWNPRRHQMLASASDDHTIRIWGPSQ  453



>ref|XP_007873440.1| hypothetical protein PNEG_01500 [Pneumocystis murina B123]
 gb|EMR10228.1| hypothetical protein PNEG_01500 [Pneumocystis murina B123]
Length=552

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 69/97 (71%), Gaps = 1/97 (1%)
 Frame = -3

Query  642  NQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSGEL  463
            +QE++LW+++  +  + K+ G  +  +++RSCFGG  E FI SGSEDSQVY+WHR +G L
Sbjct  440  SQEVYLWDLE-KMQVVKKYAGQHQGNYIIRSCFGGAQENFILSGSEDSQVYVWHRENGSL  498

Query  462  VGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  352
            + TL  H GTVN VSW+  NP M ASA DD T+RIW 
Sbjct  499  IETLKSHKGTVNSVSWSPINPVMFASAGDDHTVRIWA  535



>ref|XP_002835107.1| hypothetical protein [Tuber melanosporum Mel28]
 emb|CAZ79228.1| unnamed protein product [Tuber melanosporum]
Length=835

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 70/106 (66%), Gaps = 2/106 (2%)
 Frame = -3

Query  639  QEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSGELV  460
            QE+ L NI+     +  F G K+  FVVR+CFGG DE F+ SGSEDS VY+W + +G LV
Sbjct  468  QELRLLNIETGAD-VRHFSGTKQEEFVVRNCFGGADENFVVSGSEDSNVYVWRKENGALV  526

Query  459  GTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG-LKQVNLKQN  325
              L GHSG VNCV+WN  NP+M ASA DDR +RIW    Q  LK+ 
Sbjct  527  EVLPGHSGIVNCVAWNPTNPYMFASAGDDRNVRIWSKAPQPQLKEQ  572



>ref|XP_005646513.1| WD40 repeat-like protein [Coccomyxa subellipsoidea C-169]
 gb|EIE21969.1| WD40 repeat-like protein [Coccomyxa subellipsoidea C-169]
Length=565

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 69/93 (74%), Gaps = 6/93 (6%)
 Frame = -3

Query  615  DGSVTCIA------KFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSGELVGT  454
            D +V C+       K   +++ RF++RSCFGG + +F+ASGSED +V+IWHR SG+L+  
Sbjct  461  DEAVQCMTEPAMEYKMDPNRQPRFIIRSCFGGSNASFVASGSEDCRVHIWHRESGDLLAQ  520

Query  453  LHGHSGTVNCVSWNGANPHMLASASDDRTIRIW  355
            L GHSGTVN VSWN  NP MLASASDD+T+RIW
Sbjct  521  LEGHSGTVNSVSWNPTNPFMLASASDDKTVRIW  553



>ref|XP_002268789.2| PREDICTED: WD repeat-containing protein 26 [Vitis vinifera]
Length=551

 Score =   118 bits (295),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 71/102 (70%), Gaps = 0/102 (0%)
 Frame = -3

Query  648  LLNQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            L ++EIH+W++ G      K+ GHK+N++V+RSCFGG    FIASGSE+S VYIW+R + 
Sbjct  443  LNSEEIHMWDVAGKWEKPLKYTGHKQNKYVIRSCFGGFHCTFIASGSENSLVYIWNRGNS  502

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQ  343
              +  L GH  TVNCVSWN     MLASASDD TIRIWG  Q
Sbjct  503  TPLEVLSGHLMTVNCVSWNPRRHQMLASASDDHTIRIWGPSQ  544



>ref|XP_001984905.1| GH16747 [Drosophila grimshawi]
 gb|EDV97253.1| GH16747 [Drosophila grimshawi]
Length=652

 Score =   118 bits (295),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 71/99 (72%), Gaps = 1/99 (1%)
 Frame = -3

Query  642  NQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSGEL  463
            NQ +HLW+I+     + +F+G +++ F + SCFGGL+E+F+ASGSED  VYIWH    E 
Sbjct  530  NQGLHLWDIEDKC-LVRRFQGIRQSNFAIHSCFGGLNESFVASGSEDKVVYIWHLKREEP  588

Query  462  VGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLK  346
            +  L GH+ TVNCVSWN   P +LASASDD T+RIWG K
Sbjct  589  LAKLAGHTKTVNCVSWNPVYPSLLASASDDATVRIWGPK  627



>ref|XP_007216565.1| hypothetical protein PRUPE_ppb014596mg [Prunus persica]
 gb|EMJ17764.1| hypothetical protein PRUPE_ppb014596mg [Prunus persica]
Length=77

 Score =   109 bits (272),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = -3

Query  498  QVYIWHRSSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNST  319
            QVY+WHR SGEL+  L GHSG VNCVSWN  N HMLASASDDRTIRIWGLK++ +K    
Sbjct  6    QVYVWHRGSGELIEALPGHSGAVNCVSWNPTNTHMLASASDDRTIRIWGLKELKVKHRDA  65

Query  318  VCNGVHHCNGGS  283
              NGVH+CNGG+
Sbjct  66   HSNGVHYCNGGT  77



>dbj|GAM21975.1| hypothetical protein SAMD00019534_051500, partial [Acytostelium 
subglobosum LB1]
Length=702

 Score =   118 bits (296),  Expect = 8e-27, Method: Composition-based stats.
 Identities = 49/99 (49%), Positives = 72/99 (73%), Gaps = 1/99 (1%)
 Frame = -3

Query  642  NQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSGEL  463
            NQEIHLW+++  +  + K++G K+ RFV+RSCFGG+D+ F+ SGSED++VYIW R +  L
Sbjct  570  NQEIHLWDLEKRII-VQKYRGQKQMRFVIRSCFGGVDQGFVLSGSEDAKVYIWRRQNSVL  628

Query  462  VGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLK  346
            +  L GH+  VN V W+  +P++  SASDD TI++W  K
Sbjct  629  LECLTGHTKMVNSVCWSPTDPYLFCSASDDETIKVWTRK  667



>ref|XP_002028320.1| GL11887 [Drosophila persimilis]
 gb|EDW39535.1| GL11887 [Drosophila persimilis]
Length=502

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 71/99 (72%), Gaps = 1/99 (1%)
 Frame = -3

Query  642  NQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSGEL  463
            NQ +HLW+I+     + +F+G +++ F + SCFGG++E+F+ASGSED  VYIWH    E 
Sbjct  380  NQGLHLWDIEDKC-LVRRFQGIRQSNFAIHSCFGGINESFVASGSEDKVVYIWHIKREEP  438

Query  462  VGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLK  346
            +  L GH+ TVNCVSWN   P +LASASDD T+RIWG K
Sbjct  439  LAKLAGHTKTVNCVSWNPVYPSLLASASDDATVRIWGPK  477



>ref|XP_002315365.1| hypothetical protein POPTR_0010s26090g [Populus trichocarpa]
 gb|EEF01536.1| hypothetical protein POPTR_0010s26090g [Populus trichocarpa]
Length=505

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 72/101 (71%), Gaps = 2/101 (2%)
 Frame = -3

Query  648  LLNQEIHLWNI-DGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSS  472
            LLN+ IH W++ +G    I++++G    RF++RSC GGL+E FIASGSEDS+V+IWHR  
Sbjct  402  LLNRGIHFWSLLEGYEGLISRYEGRISTRFIIRSCLGGLEETFIASGSEDSRVFIWHRGQ  461

Query  471  GELVGTLHG-HSGTVNCVSWNGANPHMLASASDDRTIRIWG  352
               +  L   H+GTVNCVSWN  N HMLASASDD  I IWG
Sbjct  462  RIPIMQLQSIHTGTVNCVSWNPTNIHMLASASDDHKIVIWG  502



>ref|XP_011046605.1| PREDICTED: WD repeat-containing protein 26 [Populus euphratica]
Length=520

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 72/101 (71%), Gaps = 2/101 (2%)
 Frame = -3

Query  648  LLNQEIHLWNI-DGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSS  472
            LLN+ IH W++ +G    I++++G    RF++RSC GGL+E FIASGSEDS+V+IWHR  
Sbjct  402  LLNRGIHFWSLLEGYEGLISRYEGRISTRFIIRSCLGGLEETFIASGSEDSRVFIWHRGQ  461

Query  471  GELVGTLHG-HSGTVNCVSWNGANPHMLASASDDRTIRIWG  352
               +  L   H+GTVNCVSWN  N HMLASASDD  I IWG
Sbjct  462  RIPIMQLQSIHTGTVNCVSWNPTNIHMLASASDDHKIVIWG  502



>ref|XP_001841859.1| WD repeat protein 26 [Culex quinquefasciatus]
 gb|EDS31712.1| WD repeat protein 26 [Culex quinquefasciatus]
Length=736

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 79/117 (68%), Gaps = 4/117 (3%)
 Frame = -3

Query  648  LLN---QEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHR  478
            LLN   Q +HLW++      + +F+G  +  + + SCFGG++E+F+ASGSED++VYIWH 
Sbjct  582  LLNISSQGLHLWDLQDKC-LVRRFQGVTQGNYTIYSCFGGVNESFVASGSEDNKVYIWHI  640

Query  477  SSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNG  307
               E + TL GH+ TVNCVSWN   P +LASASDD T+RIWG KQ  L   +T  NG
Sbjct  641  RREEPLATLVGHTRTVNCVSWNPVYPSLLASASDDGTVRIWGPKQPQLAWAATSNNG  697



>ref|XP_009014778.1| hypothetical protein HELRODRAFT_76512 [Helobdella robusta]
 gb|ESO07400.1| hypothetical protein HELRODRAFT_76512 [Helobdella robusta]
Length=600

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 80/127 (63%), Gaps = 9/127 (7%)
 Frame = -3

Query  642  NQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSGEL  463
            NQ I++W++ G  T I +++G  +  F V S FGGL+E FIASGSED ++YIWH ++   
Sbjct  427  NQGINMWDM-GCKTLIRRYRGPTQGFFTVHSTFGGLNEDFIASGSEDQKIYIWHVNNELP  485

Query  462  VGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLK--------QVNLKQNSTVCNG  307
            + TL GH+GTVNCV WN   P MLASASDD T+RIWG K        +  ++     CNG
Sbjct  486  LTTLEGHNGTVNCVHWNPQIPSMLASASDDNTVRIWGPKSRADSPTLECAMENEDIACNG  545

Query  306  VHHCNGG  286
            V    GG
Sbjct  546  VDSGLGG  552



>ref|XP_001354118.1| GA20480 [Drosophila pseudoobscura pseudoobscura]
 gb|EAL29857.1| GA20480 [Drosophila pseudoobscura pseudoobscura]
Length=634

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 71/99 (72%), Gaps = 1/99 (1%)
 Frame = -3

Query  642  NQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSGEL  463
            NQ +HLW+I+     + +F+G +++ F + SCFGG++E+F+ASGSED  VYIWH    E 
Sbjct  512  NQGLHLWDIEDKC-LVRRFQGIRQSNFAIHSCFGGINESFVASGSEDKVVYIWHIKREEP  570

Query  462  VGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLK  346
            +  L GH+ TVNCVSWN   P +LASASDD T+RIWG K
Sbjct  571  LAKLAGHTKTVNCVSWNPVYPSLLASASDDATVRIWGPK  609



>ref|XP_002047612.1| GJ11835 [Drosophila virilis]
 gb|EDW69954.1| GJ11835 [Drosophila virilis]
Length=641

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 71/101 (70%), Gaps = 1/101 (1%)
 Frame = -3

Query  642  NQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSGEL  463
            NQ +HLW+I+     + +F+G +++ F + SCFGG++E+F+ASGSED  VYIWH    E 
Sbjct  519  NQGLHLWDIEDKC-LVRRFQGIRQSNFAIHSCFGGVNESFVASGSEDKVVYIWHLKREEP  577

Query  462  VGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQV  340
            +  L GH+ TVNCVSWN   P +LASASDD T+RIWG K  
Sbjct  578  LAKLAGHTKTVNCVSWNPVYPSLLASASDDATVRIWGPKPT  618



>ref|XP_005834116.1| hypothetical protein GUITHDRAFT_137736 [Guillardia theta CCMP2712]
 gb|EKX47136.1| hypothetical protein GUITHDRAFT_137736 [Guillardia theta CCMP2712]
Length=628

 Score =   116 bits (291),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/118 (46%), Positives = 76/118 (64%), Gaps = 7/118 (6%)
 Frame = -3

Query  636  EIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSGELVG  457
            E+HLW++D     + +++GHK+ R+V+RS FGG  +AF+  GSED +V++WHR S  L+ 
Sbjct  509  EVHLWDLDEK-KLLKRYRGHKQGRYVIRSSFGGNRDAFVVGGSEDCRVFLWHRDSAALIH  567

Query  456  TLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNGVHHCNGGS  283
             L GHSGT+N V+WN  +  M ASASDD TIR+WG      ++         H NGGS
Sbjct  568  ALQGHSGTINSVAWNPKDAVMFASASDDNTIRVWG------RKTKKTEAKKEHMNGGS  619



>ref|XP_002040820.1| GM22377 [Drosophila sechellia]
 ref|XP_002085807.1| GD14968 [Drosophila simulans]
 gb|EDW44373.1| GM22377 [Drosophila sechellia]
 gb|EDX11392.1| GD14968 [Drosophila simulans]
Length=630

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 71/99 (72%), Gaps = 1/99 (1%)
 Frame = -3

Query  642  NQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSGEL  463
            NQ +HLW+I+     + +F+G +++ F + SCFGG++E+F+ASGSED  VYIWH    E 
Sbjct  508  NQGLHLWDIEDKC-LVRRFQGIRQSNFAIHSCFGGVNESFVASGSEDKVVYIWHIKREEP  566

Query  462  VGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLK  346
            +  L GH+ TVNCVSWN   P +LASASDD T+RIWG K
Sbjct  567  LAKLAGHTKTVNCVSWNPVYPSLLASASDDATVRIWGPK  605



>ref|XP_002095310.1| GE19765 [Drosophila yakuba]
 gb|EDW95022.1| GE19765 [Drosophila yakuba]
Length=629

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 71/99 (72%), Gaps = 1/99 (1%)
 Frame = -3

Query  642  NQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSGEL  463
            NQ +HLW+I+     + +F+G +++ F + SCFGG++E+F+ASGSED  VYIWH    E 
Sbjct  507  NQGLHLWDIEDKC-LVRRFQGIRQSNFAIHSCFGGVNESFVASGSEDKVVYIWHIKREEP  565

Query  462  VGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLK  346
            +  L GH+ TVNCVSWN   P +LASASDD T+RIWG K
Sbjct  566  LAKLAGHTKTVNCVSWNPVYPSLLASASDDATVRIWGPK  604



>ref|XP_001973639.1| GG16194 [Drosophila erecta]
 gb|EDV52665.1| GG16194 [Drosophila erecta]
Length=630

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 71/99 (72%), Gaps = 1/99 (1%)
 Frame = -3

Query  642  NQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSGEL  463
            NQ +HLW+I+     + +F+G +++ F + SCFGG++E+F+ASGSED  VYIWH    E 
Sbjct  508  NQGLHLWDIEDKC-LVRRFQGIRQSNFAIHSCFGGVNESFVASGSEDKVVYIWHIKREEP  566

Query  462  VGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLK  346
            +  L GH+ TVNCVSWN   P +LASASDD T+RIWG K
Sbjct  567  LAKLAGHTKTVNCVSWNPVYPSLLASASDDATVRIWGPK  605



>ref|NP_649326.1| CG7611, isoform A [Drosophila melanogaster]
 ref|NP_730644.1| CG7611, isoform B [Drosophila melanogaster]
 ref|NP_730645.1| CG7611, isoform C [Drosophila melanogaster]
 ref|NP_730646.1| CG7611, isoform D [Drosophila melanogaster]
 ref|NP_730647.1| CG7611, isoform E [Drosophila melanogaster]
 ref|NP_730648.1| CG7611, isoform J [Drosophila melanogaster]
 ref|NP_730649.1| CG7611, isoform G [Drosophila melanogaster]
 ref|NP_730650.1| CG7611, isoform H [Drosophila melanogaster]
 ref|NP_001163489.1| CG7611, isoform I [Drosophila melanogaster]
 sp|Q7K0L4.1|WDR26_DROME RecName: Full=WD repeat-containing protein 26 homolog [Drosophila 
melanogaster]
 gb|AAF51739.2| CG7611, isoform A [Drosophila melanogaster]
 gb|AAG22180.1| CG7611, isoform B [Drosophila melanogaster]
 gb|AAG22181.1| CG7611, isoform D [Drosophila melanogaster]
 gb|AAL39862.1| LP01609p [Drosophila melanogaster]
 gb|AAG22182.2| CG7611, isoform C [Drosophila melanogaster]
 gb|AAN12172.1| CG7611, isoform E [Drosophila melanogaster]
 gb|AAN12173.1| CG7611, isoform J [Drosophila melanogaster]
 gb|AAN12174.1| CG7611, isoform G [Drosophila melanogaster]
 gb|AAN12175.1| CG7611, isoform H [Drosophila melanogaster]
 gb|ACL86305.1| CG7611-PA, partial [synthetic construct]
 gb|ACZ94760.1| CG7611, isoform I [Drosophila melanogaster]
Length=630

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 71/99 (72%), Gaps = 1/99 (1%)
 Frame = -3

Query  642  NQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSGEL  463
            NQ +HLW+I+     + +F+G +++ F + SCFGG++E+F+ASGSED  VYIWH    E 
Sbjct  508  NQGLHLWDIEDKC-LVRRFQGIRQSNFAIHSCFGGVNESFVASGSEDKVVYIWHIKREEP  566

Query  462  VGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLK  346
            +  L GH+ TVNCVSWN   P +LASASDD T+RIWG K
Sbjct  567  LAKLAGHTKTVNCVSWNPVYPSLLASASDDATVRIWGPK  605



>ref|XP_001958025.1| GF23722 [Drosophila ananassae]
 gb|EDV40831.1| GF23722 [Drosophila ananassae]
Length=630

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 71/99 (72%), Gaps = 1/99 (1%)
 Frame = -3

Query  642  NQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSGEL  463
            NQ +HLW+I+     + +F+G +++ F + SCFGG++E+F+ASGSED  VYIWH    E 
Sbjct  508  NQGLHLWDIEDKC-LVRRFQGIRQSNFAIHSCFGGVNESFVASGSEDKVVYIWHIKREEP  566

Query  462  VGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLK  346
            +  L GH+ TVNCVSWN   P +LASASDD T+RIWG K
Sbjct  567  LAKLAGHTKTVNCVSWNPVYPSLLASASDDATVRIWGPK  605



>ref|XP_002008397.1| GI13472 [Drosophila mojavensis]
 gb|EDW18873.1| GI13472 [Drosophila mojavensis]
Length=643

 Score =   116 bits (290),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 71/99 (72%), Gaps = 1/99 (1%)
 Frame = -3

Query  642  NQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSGEL  463
            NQ +HLW+I+     + +F+G +++ F + SCFGG++E+F+ASGSED  VYIWH    E 
Sbjct  521  NQGLHLWDIEDKC-LVRRFQGIRQSNFAIHSCFGGVNESFVASGSEDKVVYIWHLKREEP  579

Query  462  VGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLK  346
            +  L GH+ TVNCVSWN   P +LASASDD T+RIWG K
Sbjct  580  LAKLIGHTKTVNCVSWNPVYPSLLASASDDATVRIWGPK  618



>ref|XP_002065853.1| GK20426 [Drosophila willistoni]
 gb|EDW76839.1| GK20426 [Drosophila willistoni]
Length=669

 Score =   116 bits (290),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 70/99 (71%), Gaps = 1/99 (1%)
 Frame = -3

Query  642  NQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSGEL  463
            NQ +HLW+I+     + +F+G ++  F + SCFGG++E+F+ASGSED  VYIWH    E 
Sbjct  547  NQGLHLWDIEDKC-LVRRFQGIRQTNFAIHSCFGGVNESFVASGSEDKVVYIWHIKREEP  605

Query  462  VGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLK  346
            +  L GH+ TVNCVSWN   P +LASASDD T+RIWG K
Sbjct  606  LAKLAGHTKTVNCVSWNPVFPSLLASASDDATVRIWGPK  644



>emb|CDS03587.1| hypothetical protein LRAMOSA00989 [Absidia idahoensis var. thermophila]
Length=577

 Score =   115 bits (288),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 67/98 (68%), Gaps = 1/98 (1%)
 Frame = -3

Query  642  NQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSGEL  463
             QE+HLW+++     I K+ G K+  FV+RS FGG DE+FI SGSED+ VYIW R    L
Sbjct  466  TQELHLWDLEER-QLIRKYTGQKQKSFVIRSTFGGDDESFILSGSEDNCVYIWSRDYQTL  524

Query  462  VGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGL  349
            +  L GH+G VNC SW    P M ASASDD+T+RIWG+
Sbjct  525  LEVLEGHTGIVNCTSWCPVGPPMFASASDDKTVRIWGV  562



>ref|XP_001652036.1| AAEL006552-PA [Aedes aegypti]
 gb|EAT41843.1| AAEL006552-PA [Aedes aegypti]
Length=756

 Score =   116 bits (290),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 79/117 (68%), Gaps = 4/117 (3%)
 Frame = -3

Query  648  LLN---QEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHR  478
            LLN   Q +HLW++      + +F+G  +  + + SCFGG++E+F+ASGSED++VYIWH 
Sbjct  603  LLNISSQGLHLWDLQDKC-LVRRFQGVTQGNYTIYSCFGGVNESFVASGSEDNKVYIWHI  661

Query  477  SSGELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGLKQVNLKQNSTVCNG  307
               E + TL GH+ TVNCVSWN   P +LASASDD T+RIWG KQ  L   ++  NG
Sbjct  662  RREEPLATLVGHTRTVNCVSWNPVYPSLLASASDDGTVRIWGPKQPQLAWAASSNNG  718



>gb|EYU42820.1| hypothetical protein MIMGU_mgv1a018113mg [Erythranthe guttata]
Length=472

 Score =   114 bits (284),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 71/99 (72%), Gaps = 3/99 (3%)
 Frame = -3

Query  642  NQEIHLWNI--DGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSG  469
            N+E+H+W+I  DG V  +  + G  R RFVVRSCF G+D+  IASGSEDS+VYIW+R +G
Sbjct  375  NRELHVWDIGLDGPVMLLT-YDGITRQRFVVRSCFCGIDQTLIASGSEDSKVYIWNRETG  433

Query  468  ELVGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  352
             L+ TL GHS  VNCV+ N    +MLAS SDD TI IWG
Sbjct  434  VLMCTLEGHSDVVNCVASNPVRTNMLASGSDDCTIAIWG  472



>ref|XP_007407038.1| hypothetical protein MELLADRAFT_47296 [Melampsora larici-populina 
98AG31]
 gb|EGG09984.1| hypothetical protein MELLADRAFT_47296 [Melampsora larici-populina 
98AG31]
Length=447

 Score =   113 bits (283),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 75/102 (74%), Gaps = 5/102 (5%)
 Frame = -3

Query  648  LLNQ---EIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHR  478
            L+NQ   E+HL+++D +   I ++ G K+  FV+RSCFGGLD  FI SGSEDS++Y+WH+
Sbjct  332  LINQSPNEVHLYSLD-THCLIRRYVGQKQGEFVIRSCFGGLDRNFILSGSEDSKIYVWHK  390

Query  477  SSGELVGTLHGHS-GTVNCVSWNGANPHMLASASDDRTIRIW  355
             +G L+  L+GHS G+VN V+WN  +P M ASA DD T+RIW
Sbjct  391  ETGSLIEVLNGHSEGSVNAVAWNPKHPTMFASAGDDHTVRIW  432



>emb|CDH48456.1| wd repeat protein [Lichtheimia corymbifera JMRC:FSU:9682]
Length=587

 Score =   114 bits (286),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 67/98 (68%), Gaps = 1/98 (1%)
 Frame = -3

Query  642  NQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSGEL  463
             QE+HLW+++     I K+ G K+  FV+RS FGG DE+FI SGSED+ VYIW R    L
Sbjct  479  TQELHLWDLEER-QLIRKYIGQKQKSFVIRSTFGGDDESFIISGSEDNCVYIWSRDYQTL  537

Query  462  VGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWGL  349
            +  L GH+G VNC SW    P M ASASDD+TIRIWG+
Sbjct  538  LEVLEGHTGIVNCTSWCPVGPPMFASASDDKTIRIWGV  575



>gb|EYU42859.1| hypothetical protein MIMGU_mgv1a005363mg [Erythranthe guttata]
Length=487

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 66/97 (68%), Gaps = 0/97 (0%)
 Frame = -3

Query  642  NQEIHLWNIDGSVTCIAKFKGHKRNRFVVRSCFGGLDEAFIASGSEDSQVYIWHRSSGEL  463
            NQE+HLW+I+     +  +K H+   + VR+CFGG  +  I  GS DSQVYIW R +  L
Sbjct  380  NQELHLWSIEVPPKLVKVYKAHRPPSYSVRACFGGPRQMLIVCGSVDSQVYIWDRETEGL  439

Query  462  VGTLHGHSGTVNCVSWNGANPHMLASASDDRTIRIWG  352
            +GTL GH+  VNCVS +  +P+MLAS SDD TIRIWG
Sbjct  440  IGTLAGHTKRVNCVSCHPVDPYMLASGSDDNTIRIWG  476



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 987899701625