BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF008I17

Length=690
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009624871.1|  PREDICTED: putative glycosyltransferase 7          292   5e-93   Nicotiana tomentosiformis
ref|XP_006363813.1|  PREDICTED: putative glycosyltransferase 7-li...    290   1e-92   Solanum tuberosum [potatoes]
ref|XP_006363812.1|  PREDICTED: putative glycosyltransferase 7-li...    291   2e-92   Solanum tuberosum [potatoes]
ref|XP_009761597.1|  PREDICTED: putative glycosyltransferase 7          291   2e-92   Nicotiana sylvestris
ref|XP_004231937.1|  PREDICTED: putative glycosyltransferase 7          287   6e-91   Solanum lycopersicum
gb|EYU44510.1|  hypothetical protein MIMGU_mgv1a018855mg                274   2e-86   Erythranthe guttata [common monkey flower]
ref|XP_011099399.1|  PREDICTED: glycosyltransferase 6-like              275   3e-86   Sesamum indicum [beniseed]
ref|XP_011073681.1|  PREDICTED: glycosyltransferase 6                   273   2e-85   Sesamum indicum [beniseed]
ref|XP_010646814.1|  PREDICTED: LOW QUALITY PROTEIN: putative gly...    269   9e-85   
emb|CAN80825.1|  hypothetical protein VITISV_015452                     268   5e-84   Vitis vinifera
gb|EYU41378.1|  hypothetical protein MIMGU_mgv1a006348mg                268   6e-84   Erythranthe guttata [common monkey flower]
ref|XP_009777954.1|  PREDICTED: putative glycosyltransferase 7 is...    261   2e-81   Nicotiana sylvestris
ref|XP_009777953.1|  PREDICTED: putative glycosyltransferase 7 is...    260   6e-81   Nicotiana sylvestris
ref|XP_009618872.1|  PREDICTED: putative glycosyltransferase 7          259   2e-80   Nicotiana tomentosiformis
emb|CDP02616.1|  unnamed protein product                                258   9e-80   Coffea canephora [robusta coffee]
gb|ACE60602.1|  putative galactomannan galactosyl transferase           256   3e-79   Coffea arabica [arabica coffee]
ref|XP_010273069.1|  PREDICTED: putative glycosyltransferase 7          256   4e-79   Nelumbo nucifera [Indian lotus]
gb|EPS69883.1|  hypothetical protein M569_04879                         251   9e-78   Genlisea aurea
ref|XP_004141854.1|  PREDICTED: galactomannan galactosyltransfera...    247   1e-75   Cucumis sativus [cucumbers]
ref|XP_010274411.1|  PREDICTED: galactomannan galactosyltransfera...    245   1e-74   Nelumbo nucifera [Indian lotus]
ref|XP_010106924.1|  Galactomannan galactosyltransferase 1              244   2e-74   Morus notabilis
ref|XP_008440417.1|  PREDICTED: galactomannan galactosyltransfera...    242   8e-74   Cucumis melo [Oriental melon]
gb|ADL36661.1|  CAMTA domain class transcription factor                 241   3e-73   Malus domestica [apple tree]
ref|XP_007205195.1|  hypothetical protein PRUPE_ppa005681mg             240   5e-73   Prunus persica
ref|XP_009362595.1|  PREDICTED: LOW QUALITY PROTEIN: galactomanna...    241   6e-73   Pyrus x bretschneideri [bai li]
gb|ADL36663.1|  CAMTA domain class transcription factor                 239   1e-72   Malus domestica [apple tree]
ref|XP_008347885.1|  PREDICTED: galactomannan galactosyltransfera...    239   2e-72   
ref|XP_008362135.1|  PREDICTED: galactomannan galactosyltransfera...    239   3e-72   
ref|XP_008237711.1|  PREDICTED: galactomannan galactosyltransfera...    238   4e-72   Prunus mume [ume]
gb|KHG22205.1|  Putative glycosyltransferase 7 -like protein            238   4e-72   Gossypium arboreum [tree cotton]
gb|KJB18050.1|  hypothetical protein B456_003G031400                    238   6e-72   Gossypium raimondii
ref|XP_004288265.1|  PREDICTED: galactomannan galactosyltransfera...    237   8e-72   Fragaria vesca subsp. vesca
gb|KHG22229.1|  Putative glycosyltransferase 7 -like protein            236   2e-71   Gossypium arboreum [tree cotton]
gb|KJB46680.1|  hypothetical protein B456_008G0841002                   235   3e-71   Gossypium raimondii
ref|XP_003539263.1|  PREDICTED: galactomannan galactosyltransfera...    235   7e-71   Glycine max [soybeans]
ref|XP_007047569.1|  Galactosyl transferase GMA12/MNN10 family pr...    235   7e-71   
gb|KJB46678.1|  hypothetical protein B456_008G0841002                   234   9e-71   Gossypium raimondii
emb|CDP02619.1|  unnamed protein product                                234   3e-70   Coffea canephora [robusta coffee]
ref|XP_006426098.1|  hypothetical protein CICLE_v10025585mg             233   5e-70   Citrus clementina [clementine]
ref|XP_006350640.1|  PREDICTED: putative glycosyltransferase 7-like     231   6e-70   Solanum tuberosum [potatoes]
ref|XP_006466460.1|  PREDICTED: putative glycosyltransferase 7-like     232   6e-70   Citrus sinensis [apfelsine]
ref|XP_007156700.1|  hypothetical protein PHAVU_002G009900g             232   9e-70   Phaseolus vulgaris [French bean]
ref|XP_003611556.1|  Galactomannan galactosyltransferase                228   2e-68   Medicago truncatula
ref|XP_004234713.2|  PREDICTED: glycosyltransferase 6-like              228   2e-68   
gb|KDP32091.1|  hypothetical protein JCGZ_12552                         228   3e-68   Jatropha curcas
ref|XP_003517354.1|  PREDICTED: galactomannan galactosyltransfera...    227   8e-68   Glycine max [soybeans]
emb|CAI79403.1|  galactomannan galactosyltransferase                    226   1e-67   Senna occidentalis [antbush]
gb|KJB43940.1|  hypothetical protein B456_007G224800                    226   2e-67   Gossypium raimondii
gb|KDO78929.1|  hypothetical protein CISIN_1g045999mg                   225   2e-67   Citrus sinensis [apfelsine]
ref|XP_002310890.2|  alpha galactosyltransferase family protein         226   2e-67   
ref|XP_011007841.1|  PREDICTED: putative glycosyltransferase 7          225   5e-67   Populus euphratica
ref|XP_002320005.2|  alpha galactosyltransferase family protein         224   6e-67   Populus trichocarpa [western balsam poplar]
ref|XP_011031309.1|  PREDICTED: putative glycosyltransferase 7          224   1e-66   Populus euphratica
ref|XP_006857127.1|  hypothetical protein AMTR_s00065p00144450          224   2e-66   Amborella trichopoda
gb|KHN36310.1|  Galactomannan galactosyltransferase 1                   222   2e-66   Glycine soja [wild soybean]
ref|XP_002525290.1|  transferase, putative                              222   4e-66   Ricinus communis
ref|XP_004511818.1|  PREDICTED: galactomannan galactosyltransfera...    223   4e-66   
ref|XP_011099400.1|  PREDICTED: glycosyltransferase 6-like              221   6e-66   Sesamum indicum [beniseed]
ref|XP_009394361.1|  PREDICTED: galactomannan galactosyltransfera...    221   1e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010109205.1|  Galactomannan galactosyltransferase 1              218   2e-64   Morus notabilis
ref|XP_004231939.1|  PREDICTED: glycosyltransferase 6-like              216   9e-64   Solanum lycopersicum
emb|CAI11452.1|  alpha-6-galactosyltransferase                          215   2e-63   Solanum tuberosum [potatoes]
ref|XP_006404757.1|  hypothetical protein EUTSA_v10000162mg             215   2e-63   Eutrema salsugineum [saltwater cress]
emb|CDY49440.1|  BnaA09g42270D                                          215   3e-63   Brassica napus [oilseed rape]
ref|XP_009117319.1|  PREDICTED: putative glycosyltransferase 7          215   3e-63   Brassica rapa
ref|XP_010531308.1|  PREDICTED: putative glycosyltransferase 7          214   3e-63   Tarenaya hassleriana [spider flower]
emb|CDX76887.1|  BnaC08g34730D                                          214   4e-63   
ref|XP_006363811.1|  PREDICTED: putative glycosyltransferase 7-like     214   6e-63   
ref|XP_002880469.1|  galactosyl transferase GMA12/MNN10 family pr...    213   1e-62   
ref|XP_009607432.1|  PREDICTED: glycosyltransferase 6-like              213   1e-62   Nicotiana tomentosiformis
ref|XP_010417049.1|  PREDICTED: putative glycosyltransferase 7          213   2e-62   Camelina sativa [gold-of-pleasure]
emb|CDP02617.1|  unnamed protein product                                212   3e-62   Coffea canephora [robusta coffee]
ref|XP_010429224.1|  PREDICTED: putative glycosyltransferase 7          212   5e-62   Camelina sativa [gold-of-pleasure]
ref|XP_010472288.1|  PREDICTED: putative glycosyltransferase 7          212   5e-62   Camelina sativa [gold-of-pleasure]
ref|NP_565544.1|  putative glycosyltransferase 7                        211   5e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006294199.1|  hypothetical protein CARUB_v10023195mg             211   9e-62   Capsella rubella
ref|NP_001105164.1|  alpha-6-galactosyltransferase                      209   3e-61   Zea mays [maize]
gb|ACH58908.1|  galactosyl transferase                                  209   4e-61   Coffea canephora [robusta coffee]
emb|CAI11453.1|  alpha-6-galactosyltransferase                          209   7e-61   Nicotiana benthamiana
ref|XP_009761596.1|  PREDICTED: glycosyltransferase 6-like              207   2e-60   Nicotiana sylvestris
gb|KHN20359.1|  Galactomannan galactosyltransferase 1                   201   4e-60   Glycine soja [wild soybean]
ref|XP_002513422.1|  transferase, putative                              204   2e-59   
ref|XP_009345079.1|  PREDICTED: putative glycosyltransferase 7          205   2e-59   Pyrus x bretschneideri [bai li]
ref|XP_010432039.1|  PREDICTED: glycosyltransferase 6                   204   3e-59   Camelina sativa [gold-of-pleasure]
ref|XP_010437192.1|  PREDICTED: glycosyltransferase 6-like              204   3e-59   Camelina sativa [gold-of-pleasure]
emb|CAD98924.1|  galactomannan galactosyltransferase                    203   5e-59   Lotus japonicus
ref|XP_008806204.1|  PREDICTED: galactomannan galactosyltransfera...    204   6e-59   Phoenix dactylifera
ref|XP_008392336.1|  PREDICTED: putative glycosyltransferase 7          203   7e-59   
ref|XP_008363062.1|  PREDICTED: glycosyltransferase 6-like              203   7e-59   
gb|KDP25125.1|  hypothetical protein JCGZ_22660                         202   1e-58   Jatropha curcas
ref|XP_004294205.1|  PREDICTED: galactomannan galactosyltransfera...    202   1e-58   Fragaria vesca subsp. vesca
ref|XP_006411860.1|  hypothetical protein EUTSA_v10027092mg             202   2e-58   
ref|NP_001281283.1|  putative glycosyltransferase 7                     202   3e-58   Malus domestica [apple tree]
ref|XP_003525869.1|  PREDICTED: galactomannan galactosyltransfera...    201   4e-58   Glycine max [soybeans]
ref|XP_010028081.1|  PREDICTED: putative glycosyltransferase 7          201   5e-58   Eucalyptus grandis [rose gum]
ref|XP_010446636.1|  PREDICTED: LOW QUALITY PROTEIN: glycosyltran...    201   5e-58   Camelina sativa [gold-of-pleasure]
ref|XP_009361779.1|  PREDICTED: glycosyltransferase 6-like              201   5e-58   
ref|XP_008226081.1|  PREDICTED: putative glycosyltransferase 7          199   1e-57   Prunus mume [ume]
ref|NP_680773.1|  glycosyltransferase 6                                 199   2e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007211970.1|  hypothetical protein PRUPE_ppa006622mg             198   2e-57   
ref|XP_010939020.1|  PREDICTED: LOW QUALITY PROTEIN: galactomanna...    199   4e-57   Elaeis guineensis
ref|XP_009138524.1|  PREDICTED: glycosyltransferase 6                   197   8e-57   Brassica rapa
emb|CDY29577.1|  BnaA03g54220D                                          197   8e-57   Brassica napus [oilseed rape]
emb|CAI11454.1|  alpha-6-galactosyltransferase                          197   8e-57   Medicago truncatula
ref|XP_003608541.1|  Alpha-6-galactosyltransferase                      197   1e-56   
gb|KFK30380.1|  hypothetical protein AALP_AA7G253700                    196   3e-56   Arabis alpina [alpine rockcress]
gb|EAY87343.1|  hypothetical protein OsI_08746                          195   7e-56   Oryza sativa Indica Group [Indian rice]
emb|CDX72649.1|  BnaC07g46710D                                          195   7e-56   
ref|NP_001047970.1|  Os02g0723200                                       195   1e-55   
ref|XP_002868971.1|  galactosyl transferase GMA12/MNN10 family pr...    194   3e-55   Arabidopsis lyrata subsp. lyrata
emb|CAB52246.1|  alpha galactosyltransferase                            193   4e-55   Trigonella foenum-graecum [fenugreek]
ref|XP_009394626.1|  PREDICTED: galactomannan galactosyltransfera...    193   5e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002454367.1|  hypothetical protein SORBIDRAFT_04g029500          193   7e-55   Sorghum bicolor [broomcorn]
gb|ACF33173.1|  putative galactomannan galactosyl transferase           192   1e-54   Coffea canephora [robusta coffee]
ref|XP_009362594.1|  PREDICTED: glycosyltransferase 6-like              192   1e-54   Pyrus x bretschneideri [bai li]
emb|CDP02618.1|  unnamed protein product                                192   1e-54   Coffea canephora [robusta coffee]
gb|EAY81250.1|  hypothetical protein OsI_36429                          192   2e-54   Oryza sativa Indica Group [Indian rice]
ref|NP_001068066.1|  Os11g0546500                                       192   2e-54   
ref|XP_006663513.1|  PREDICTED: putative glycosyltransferase 7-like     187   8e-54   Oryza brachyantha
ref|XP_010679659.1|  PREDICTED: putative glycosyltransferase 7          189   2e-53   Beta vulgaris subsp. vulgaris [field beet]
sp|Q564G7.1|GMGT1_CYATE  RecName: Full=Galactomannan galactosyltr...    188   3e-53   Cyamopsis tetragonoloba [cluster bean]
dbj|BAK05879.1|  predicted protein                                      182   6e-51   Hordeum vulgare subsp. vulgare [two-rowed barley]
tpg|DAA64594.1|  TPA: putative galacto(gluco)mannan alpha-1,6-gal...    174   1e-50   Pinus taeda
ref|XP_007208181.1|  hypothetical protein PRUPE_ppa017391mg             178   5e-50   
ref|XP_003608540.1|  Galactomannan galactosyltransferase                179   7e-50   Medicago truncatula
ref|XP_008238162.1|  PREDICTED: glycosyltransferase 6-like              179   1e-49   Prunus mume [ume]
ref|XP_004953741.1|  PREDICTED: galactomannan galactosyltransfera...    177   6e-49   Setaria italica
ref|XP_008363070.1|  PREDICTED: LOW QUALITY PROTEIN: galactomanna...    174   2e-48   
gb|AFW64907.1|  glycosyltransferase 6                                   175   5e-48   
ref|XP_003570475.1|  PREDICTED: galactomannan galactosyltransfera...    174   7e-48   Brachypodium distachyon [annual false brome]
ref|XP_002449648.1|  hypothetical protein SORBIDRAFT_05g020910          174   1e-47   Sorghum bicolor [broomcorn]
ref|NP_001152534.1|  glycosyltransferase 6                              174   2e-47   
ref|XP_003575986.2|  PREDICTED: galactomannan galactosyltransfera...    172   6e-47   
gb|ADE76992.1|  unknown                                                 172   7e-47   Picea sitchensis
gb|EMS46901.1|  Galactomannan galactosyltransferase 1                   165   1e-45   Triticum urartu
ref|XP_008679453.1|  PREDICTED: galactomannan galactosyltransfera...    167   2e-45   Zea mays [maize]
gb|ABK25085.1|  unknown                                                 166   1e-44   Picea sitchensis
ref|XP_004980586.1|  PREDICTED: galactomannan galactosyltransfera...    165   2e-44   Setaria italica
ref|XP_004980585.1|  PREDICTED: galactomannan galactosyltransfera...    162   2e-44   Setaria italica
ref|XP_008795673.1|  PREDICTED: glycosyltransferase 6-like              166   2e-44   
ref|XP_008679454.1|  PREDICTED: galactomannan galactosyltransfera...    164   4e-44   Zea mays [maize]
ref|XP_004980588.1|  PREDICTED: galactomannan galactosyltransfera...    161   2e-43   Setaria italica
gb|AHC98115.1|  putative galacto(gluco)mannan alpha-1,6-galactosy...    162   3e-43   Pinus radiata
dbj|BAJ96459.1|  predicted protein                                      162   6e-43   Hordeum vulgare subsp. vulgare [two-rowed barley]
tpg|DAA64590.1|  TPA: putative galacto(gluco)mannan alpha-1,6-gal...    161   1e-42   Pinus taeda
ref|XP_009406736.1|  PREDICTED: galactomannan galactosyltransfera...    160   2e-42   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT11268.1|  Putative glycosyltransferase 7                          154   1e-41   
ref|XP_002450906.1|  hypothetical protein SORBIDRAFT_05g020930          154   3e-40   
ref|XP_008784727.1|  PREDICTED: putative glycosyltransferase 7          152   7e-40   Phoenix dactylifera
ref|XP_004980587.1|  PREDICTED: galactomannan galactosyltransfera...    152   8e-40   Setaria italica
ref|XP_010943187.1|  PREDICTED: galactomannan galactosyltransfera...    153   2e-39   Elaeis guineensis
ref|XP_010919073.1|  PREDICTED: galactomannan galactosyltransfera...    140   2e-35   Elaeis guineensis
emb|CBI25835.3|  unnamed protein product                                129   3e-32   Vitis vinifera
ref|XP_009379786.1|  PREDICTED: putative glycosyltransferase 5          112   4e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004987031.1|  PREDICTED: xyloglucan 6-xylosyltransferase-like    110   1e-24   Setaria italica
ref|XP_001761988.1|  predicted protein                                  109   2e-24   
ref|XP_010907157.1|  PREDICTED: putative glycosyltransferase 5          108   4e-24   Elaeis guineensis
ref|XP_009385087.1|  PREDICTED: putative glycosyltransferase 5          108   4e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010678459.1|  PREDICTED: putative glycosyltransferase 5          108   5e-24   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_001765298.1|  predicted protein                                  107   1e-23   
ref|XP_009420521.1|  PREDICTED: putative glycosyltransferase 5          107   2e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010912249.1|  PREDICTED: putative glycosyltransferase 5          107   2e-23   Elaeis guineensis
ref|XP_006399253.1|  hypothetical protein EUTSA_v10013509mg             107   2e-23   Eutrema salsugineum [saltwater cress]
ref|XP_008783986.1|  PREDICTED: LOW QUALITY PROTEIN: putative gly...    106   2e-23   
ref|XP_011075649.1|  PREDICTED: putative glycosyltransferase 5          106   3e-23   Sesamum indicum [beniseed]
ref|XP_009393375.1|  PREDICTED: putative glycosyltransferase 5          106   3e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008453679.1|  PREDICTED: putative glycosyltransferase 3          103   4e-23   Cucumis melo [Oriental melon]
ref|NP_001047014.1|  Os02g0529600                                       106   5e-23   
ref|XP_008788330.1|  PREDICTED: putative glycosyltransferase 5          105   5e-23   Phoenix dactylifera
gb|ACN27080.1|  unknown                                                 103   6e-23   Zea mays [maize]
ref|XP_006838788.1|  hypothetical protein AMTR_s00002p00259350          105   7e-23   
ref|XP_008453680.1|  PREDICTED: putative glycosyltransferase 3          102   8e-23   Cucumis melo [Oriental melon]
gb|KHN48702.1|  Putative glycosyltransferase 3                          103   9e-23   Glycine soja [wild soybean]
ref|XP_002990216.1|  glycosyltransferase CAZy family GT34-like pr...    105   9e-23   Selaginella moellendorffii
ref|XP_004952632.1|  PREDICTED: putative glycosyltransferase 5-like     105   1e-22   Setaria italica
gb|EMT32015.1|  Xyloglucan 6-xylosyltransferase                         101   1e-22   
gb|KCW44805.1|  hypothetical protein EUGRSUZ_L01630                     101   1e-22   Eucalyptus grandis [rose gum]
ref|XP_010258549.1|  PREDICTED: putative glycosyltransferase 5 is...    104   1e-22   
gb|KFK25153.1|  hypothetical protein AALP_AA8G072800                    104   1e-22   Arabis alpina [alpine rockcress]
ref|XP_006647332.1|  PREDICTED: putative glycosyltransferase 5-like     105   1e-22   Oryza brachyantha
ref|XP_010040898.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2       101   1e-22   Eucalyptus grandis [rose gum]
ref|XP_010258542.1|  PREDICTED: putative glycosyltransferase 5 is...    104   2e-22   
ref|XP_010943718.1|  PREDICTED: putative glycosyltransferase 5          104   2e-22   Elaeis guineensis
gb|KEH31956.1|  xyloglucan xylosyltransferase                           104   2e-22   Medicago truncatula
ref|XP_010030248.1|  PREDICTED: putative glycosyltransferase 5          104   2e-22   Eucalyptus grandis [rose gum]
dbj|BAO02547.1|  (1-6)-alpha-D-xylosyltransferase ortholog              103   2e-22   Nicotiana alata [flowering tobacco]
dbj|BAK00169.1|  predicted protein                                      103   2e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010498276.1|  PREDICTED: putative glycosyltransferase 5          103   2e-22   Camelina sativa [gold-of-pleasure]
ref|XP_011047184.1|  PREDICTED: putative glycosyltransferase 5          103   2e-22   Populus euphratica
ref|XP_002514720.1|  Xyloglucan 6-xylosyltransferase, putative          103   2e-22   Ricinus communis
emb|CDX85826.1|  BnaC06g23080D                                          101   3e-22   
gb|KJB28609.1|  hypothetical protein B456_005G060400                    103   3e-22   Gossypium raimondii
ref|XP_008239899.1|  PREDICTED: putative glycosyltransferase 5          103   3e-22   Prunus mume [ume]
ref|XP_010098280.1|  Xyloglucan 6-xylosyltransferase                    103   3e-22   Morus notabilis
ref|XP_008374566.1|  PREDICTED: putative glycosyltransferase 5          103   3e-22   Malus domestica [apple tree]
ref|XP_009338860.1|  PREDICTED: putative glycosyltransferase 5          103   3e-22   Pyrus x bretschneideri [bai li]
ref|XP_007209124.1|  hypothetical protein PRUPE_ppa005479mg             103   3e-22   Prunus persica
ref|XP_009339134.1|  PREDICTED: putative glycosyltransferase 5          103   3e-22   Pyrus x bretschneideri [bai li]
ref|XP_004508717.1|  PREDICTED: putative glycosyltransferase 5-like     103   3e-22   Cicer arietinum [garbanzo]
gb|KHN43518.1|  Xyloglucan 6-xylosyltransferase                         103   3e-22   Glycine soja [wild soybean]
gb|EMT32465.1|  Putative glycosyltransferase 3                          103   3e-22   
ref|XP_006374450.1|  hypothetical protein POPTR_0015s07290g             103   3e-22   Populus trichocarpa [western balsam poplar]
ref|XP_006494985.1|  PREDICTED: putative glycosyltransferase 3-like     103   4e-22   Citrus sinensis [apfelsine]
ref|XP_006440652.1|  hypothetical protein CICLE_v10020086mg             103   4e-22   Citrus clementina [clementine]
gb|EYU45549.1|  hypothetical protein MIMGU_mgv1a027105mg                103   4e-22   Erythranthe guttata [common monkey flower]
dbj|BAK03947.1|  predicted protein                                      103   4e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFW71661.1|  putative glycosyltransferase                            103   4e-22   
ref|NP_001105849.1|  putative glycosyltransferase                       103   4e-22   
gb|AFK30382.1|  galactosyltransferase A                                 103   4e-22   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002453927.1|  hypothetical protein SORBIDRAFT_04g021570          103   4e-22   Sorghum bicolor [broomcorn]
ref|XP_010497538.1|  PREDICTED: putative glycosyltransferase 5          100   4e-22   
ref|XP_010477058.1|  PREDICTED: putative glycosyltransferase 4          103   5e-22   
ref|XP_001767750.1|  predicted protein                                  102   5e-22   
ref|XP_009764347.1|  PREDICTED: putative glycosyltransferase 5          103   5e-22   Nicotiana sylvestris
ref|XP_003554517.1|  PREDICTED: putative glycosyltransferase 2-like     103   5e-22   Glycine max [soybeans]
gb|KJB50959.1|  hypothetical protein B456_008G195000                    103   5e-22   Gossypium raimondii
ref|NP_001049886.1|  Os03g0305800                                       103   6e-22   
ref|XP_003558113.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...    102   6e-22   Brachypodium distachyon [annual false brome]
gb|KDP31286.1|  hypothetical protein JCGZ_11662                         102   6e-22   Jatropha curcas
ref|XP_009600562.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2       103   6e-22   Nicotiana tomentosiformis
emb|CDX96540.1|  BnaA07g31510D                                          100   6e-22   
ref|XP_008393187.1|  PREDICTED: putative glycosyltransferase 5          102   6e-22   
ref|XP_009780568.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...    103   6e-22   Nicotiana sylvestris
ref|XP_010459505.1|  PREDICTED: putative glycosyltransferase 4          103   6e-22   
gb|KHN18571.1|  Putative glycosyltransferase 3                          100   7e-22   Glycine soja [wild soybean]
ref|XP_003524717.1|  PREDICTED: putative glycosyltransferase 5-like     102   7e-22   Glycine max [soybeans]
gb|EMS58373.1|  Putative glycosyltransferase 2                          102   7e-22   Triticum urartu
ref|XP_010522780.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2       102   7e-22   Tarenaya hassleriana [spider flower]
ref|XP_004500012.1|  PREDICTED: putative glycosyltransferase 5-like     102   8e-22   Cicer arietinum [garbanzo]
ref|XP_007050873.1|  Alpha-1,6-xylosyltransferase isoform 1             102   8e-22   
gb|KDP27794.1|  hypothetical protein JCGZ_18874                         102   8e-22   Jatropha curcas
ref|XP_002318600.2|  hypothetical protein POPTR_0012s07020g             102   8e-22   Populus trichocarpa [western balsam poplar]
ref|XP_001781241.1|  predicted protein                                  101   9e-22   
dbj|BAK06777.1|  predicted protein                                      102   9e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT04084.1|  Xyloglucan 6-xylosyltransferase                         102   9e-22   
ref|XP_010468926.1|  PREDICTED: xyloglucan 6-xylosyltransferase 1       102   1e-21   Camelina sativa [gold-of-pleasure]
ref|XP_007035584.1|  CAMTA domain class transcription factor            102   1e-21   
ref|XP_007050874.1|  Alpha-1,6-xylosyltransferase isoform 2             102   1e-21   
ref|XP_010238722.1|  PREDICTED: putative glycosyltransferase 5          102   1e-21   Brachypodium distachyon [annual false brome]
ref|XP_008660215.1|  PREDICTED: xyloglucan 6-xylosyltransferase-l...    102   1e-21   
emb|CDX93965.1|  BnaC04g21240D                                          102   1e-21   
gb|AFW88602.1|  hypothetical protein ZEAMMB73_854435                    101   1e-21   
gb|KJB19373.1|  hypothetical protein B456_003G098400                    102   1e-21   Gossypium raimondii
gb|ACF82576.1|  unknown                                                 100   1e-21   Zea mays [maize]
ref|XP_007155288.1|  hypothetical protein PHAVU_003G188200g             102   1e-21   Phaseolus vulgaris [French bean]
ref|XP_007163097.1|  hypothetical protein PHAVU_001G206000g             102   1e-21   Phaseolus vulgaris [French bean]
ref|XP_004494368.1|  PREDICTED: putative glycosyltransferase 2-like     102   1e-21   Cicer arietinum [garbanzo]
ref|XP_010259619.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2       102   1e-21   Nelumbo nucifera [Indian lotus]
ref|XP_009138722.1|  PREDICTED: xyloglucan 6-xylosyltransferase-like    102   1e-21   Brassica rapa
ref|XP_010108713.1|  Putative glycosyltransferase 3                     102   1e-21   Morus notabilis
ref|XP_004154960.1|  PREDICTED: putative glycosyltransferase 5-like     102   1e-21   
ref|XP_002465378.1|  hypothetical protein SORBIDRAFT_01g037530          102   1e-21   Sorghum bicolor [broomcorn]
ref|XP_004138178.1|  PREDICTED: putative glycosyltransferase 5-like     102   1e-21   Cucumis sativus [cucumbers]
gb|EAY82266.1|  hypothetical protein OsI_37474                          102   1e-21   Oryza sativa Indica Group [Indian rice]
ref|NP_191831.1|  xyloglucan 6-xylosyltransferase                       102   1e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002876686.1|  hypothetical protein ARALYDRAFT_907847             102   1e-21   Arabidopsis lyrata subsp. lyrata
ref|XP_004138179.1|  PREDICTED: putative glycosyltransferase 3-like     102   1e-21   Cucumis sativus [cucumbers]
ref|XP_004154959.1|  PREDICTED: putative glycosyltransferase 3-like     102   1e-21   
emb|CDY70418.1|  BnaA04g27220D                                          102   2e-21   Brassica napus [oilseed rape]
emb|CAI11451.1|  alpha-1,6-xylosyltransferase                           101   2e-21   Gossypium raimondii
gb|KFK30846.1|  hypothetical protein AALP_AA6G033100                    104   2e-21   Arabis alpina [alpine rockcress]
ref|XP_010537379.1|  PREDICTED: putative glycosyltransferase 5          101   2e-21   Tarenaya hassleriana [spider flower]
ref|XP_002465379.1|  hypothetical protein SORBIDRAFT_01g037540          101   2e-21   Sorghum bicolor [broomcorn]
dbj|BAK06850.1|  predicted protein                                      101   2e-21   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002972516.1|  glycosyltransferase CAZy family GT34-like pr...    101   2e-21   
ref|NP_196389.1|  xyloglucan 6-xylosyltransferase                       101   2e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011071657.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...    101   2e-21   
emb|CDY26738.1|  BnaA06g12840D                                          102   2e-21   Brassica napus [oilseed rape]
gb|KEH24376.1|  xyloglucan xylosyltransferase                           101   2e-21   Medicago truncatula
gb|AHC98117.1|  putative xyloglucan alpha-1,6-xylosyltransferase        101   2e-21   Pinus radiata
ref|XP_010683109.1|  PREDICTED: putative glycosyltransferase 5          101   2e-21   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009342118.1|  PREDICTED: putative glycosyltransferase 2          101   2e-21   Pyrus x bretschneideri [bai li]
ref|XP_010230173.1|  PREDICTED: xyloglucan 6-xylosyltransferase 1...    101   2e-21   
ref|XP_002516919.1|  Xyloglucan 6-xylosyltransferase, putative          101   2e-21   Ricinus communis
ref|XP_006841140.1|  hypothetical protein AMTR_s00086p00128700          101   2e-21   Amborella trichopoda
ref|NP_173304.2|  putative glycosyltransferase 4                        102   2e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009149356.1|  PREDICTED: putative glycosyltransferase 4          102   2e-21   Brassica rapa
ref|XP_007037433.1|  Galactosyl transferase GMA12/MNN10 family pr...    101   2e-21   
ref|XP_009606203.1|  PREDICTED: putative glycosyltransferase 3          101   2e-21   Nicotiana tomentosiformis
ref|NP_001049853.1|  Os03g0300000                                       100   2e-21   
gb|AFK30383.1|  galactosyltransferase B1                                101   2e-21   
dbj|BAD43079.1|  hypothetical protein                                   102   2e-21   
ref|NP_001066160.1|  Os12g0149300                                       101   2e-21   
ref|XP_006307492.1|  hypothetical protein CARUB_v10009116mg             101   2e-21   
ref|XP_003549688.1|  PREDICTED: putative glycosyltransferase 5-like     101   2e-21   
emb|CDO98874.1|  unnamed protein product                                101   2e-21   
emb|CBX24469.1|  hypothetical_protein                                   101   2e-21   
ref|XP_004301136.1|  PREDICTED: putative glycosyltransferase 5          101   2e-21   
gb|KJB22531.1|  hypothetical protein B456_004G052700                    101   2e-21   
ref|XP_004984900.1|  PREDICTED: putative glycosyltransferase 2-like     101   2e-21   
gb|EYU28806.1|  hypothetical protein MIMGU_mgv1a003740mg                102   2e-21   
ref|XP_002992573.1|  glycosyltransferase CAZy family GT34-like pr...    100   3e-21   
gb|ACE95677.1|  putative xylosyl transferase                            101   3e-21   
gb|KHG26935.1|  Putative glycosyltransferase 2 -like protein            101   3e-21   
ref|XP_006402349.1|  hypothetical protein EUTSA_v10005949mg             101   3e-21   
gb|KJB84424.1|  hypothetical protein B456_N024600                       101   3e-21   
gb|EAY89653.1|  hypothetical protein OsI_11184                          100   3e-21   
gb|ADE59448.1|  galactosyltransferase                                   101   3e-21   
ref|XP_008368989.1|  PREDICTED: putative glycosyltransferase 2          100   3e-21   
ref|NP_001150077.1|  glycosyltransferase 5                              100   3e-21   
gb|AFW88652.1|  glycosyltransferase 5                                   100   3e-21   
gb|ACN29046.1|  unknown                                                 100   3e-21   
ref|XP_006649941.1|  PREDICTED: putative glycosyltransferase 2-like     100   3e-21   
gb|ABF95475.1|  Glycosyltransferase 5, putative, expressed              100   3e-21   
emb|CAI11456.1|  putative glycosyltransferase                           100   3e-21   
gb|EPS66800.1|  hypothetical protein M569_07974                         100   3e-21   
ref|XP_010235491.1|  PREDICTED: putative glycosyltransferase 3          101   3e-21   
ref|XP_006287708.1|  hypothetical protein CARUB_v10000915mg             100   3e-21   
ref|XP_010422579.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...    100   3e-21   
ref|NP_567241.1|  UDP-xylosyltransferase 2                              100   4e-21   
ref|NP_001151451.1|  glycosyltransferase 5                              100   4e-21   
ref|XP_008235042.1|  PREDICTED: putative glycosyltransferase 2          100   4e-21   
ref|XP_010269507.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2       100   4e-21   
ref|XP_002871288.1|  galactosyl transferase GMA12/MNN10 family pr...    100   4e-21   
gb|KEH33442.1|  xyloglucan xylosyltransferase                           100   4e-21   
gb|AAC78266.1|  putative glycosyltransferase                            100   4e-21   
ref|XP_010456020.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2       100   4e-21   
ref|XP_006396461.1|  hypothetical protein EUTSA_v10028641mg             100   4e-21   
ref|XP_006287623.1|  hypothetical protein CARUB_v10000835mg             101   4e-21   
ref|XP_009116931.1|  PREDICTED: xyloglucan 6-xylosyltransferase         100   4e-21   
ref|XP_010429788.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...    100   4e-21   
ref|XP_002465400.1|  hypothetical protein SORBIDRAFT_01g038000          100   4e-21   
ref|XP_010523942.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...    100   4e-21   
gb|KDO71643.1|  hypothetical protein CISIN_1g047753mg                   100   5e-21   
ref|XP_009122397.1|  PREDICTED: putative glycosyltransferase 3          100   5e-21   
emb|CDX69995.1|  BnaA10g23440D                                          100   5e-21   
ref|XP_010413252.1|  PREDICTED: xyloglucan 6-xylosyltransferase 1...    100   5e-21   
gb|KHN20409.1|  Putative glycosyltransferase 2                        97.4    5e-21   
ref|XP_010037455.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...    100   5e-21   
ref|XP_006291070.1|  hypothetical protein CARUB_v10017185mg             100   5e-21   
ref|XP_006356974.1|  PREDICTED: putative glycosyltransferase 2-like     100   5e-21   
ref|XP_002284667.1|  PREDICTED: putative glycosyltransferase 5          100   5e-21   
emb|CDX99024.1|  BnaC09g48110D                                          100   5e-21   
ref|XP_010512668.1|  PREDICTED: xyloglucan 6-xylosyltransferase 1...    100   5e-21   
ref|XP_011006778.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...    100   6e-21   
ref|XP_010523024.1|  PREDICTED: putative glycosyltransferase 3          100   6e-21   
emb|CAN80739.1|  hypothetical protein VITISV_027037                     100   6e-21   
ref|XP_006389383.1|  glycosyltransferase 2 family protein               100   6e-21   
ref|XP_008663454.1|  PREDICTED: putative glycosyltransferase 2        98.6    6e-21   
ref|XP_011000518.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...    100   6e-21   
ref|XP_002315554.2|  glycosyltransferase 2 family protein               100   6e-21   
ref|XP_006419581.1|  hypothetical protein CICLE_v10004948mg             100   7e-21   
ref|XP_004229187.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2       100   7e-21   
ref|XP_006489090.1|  PREDICTED: putative glycosyltransferase 2-like     100   7e-21   
emb|CBX25402.1|  hypothetical_protein                                 99.8    7e-21   
emb|CBI26079.3|  unnamed protein product                              99.8    7e-21   
emb|CDP21247.1|  unnamed protein product                              99.8    7e-21   
dbj|BAK08324.1|  predicted protein                                    99.8    8e-21   
ref|XP_002887538.1|  galactosyl transferase GMA12/MNN10 family pr...  99.8    8e-21   
ref|XP_006663818.1|  PREDICTED: putative glycosyltransferase 3-like   99.8    8e-21   
gb|KFK41883.1|  hypothetical protein AALP_AA2G184600                  99.8    9e-21   
gb|AFW56047.1|  hypothetical protein ZEAMMB73_697365                    102   9e-21   
gb|ABF95527.1|  Glycosyltransferase 3, putative                       99.4    9e-21   
ref|XP_010428421.1|  PREDICTED: putative glycosyltransferase 5 is...  99.8    9e-21   
gb|EYU35800.1|  hypothetical protein MIMGU_mgv1a006038mg              99.8    9e-21   
gb|EAY89696.1|  hypothetical protein OsI_11232                        99.4    1e-20   
ref|XP_007201035.1|  hypothetical protein PRUPE_ppa005690mg           99.4    1e-20   
ref|NP_001173389.1|  Os03g0306100                                     99.4    1e-20   
ref|XP_006390433.1|  hypothetical protein EUTSA_v10018522mg           99.4    1e-20   
ref|XP_010416293.1|  PREDICTED: putative glycosyltransferase 5        99.4    1e-20   
ref|XP_006300466.1|  hypothetical protein CARUB_v10020269mg           99.4    1e-20   
ref|NP_177578.1|  xyloglucan xylosyltransferase 5                     99.4    1e-20   
ref|XP_010471529.1|  PREDICTED: putative glycosyltransferase 5        99.4    1e-20   
ref|XP_006651307.1|  PREDICTED: xyloglucan 6-xylosyltransferase-like  99.0    1e-20   
ref|XP_001759108.1|  predicted protein                                98.6    1e-20   
ref|XP_003628458.1|  Alpha-1 6-xylosyltransferase                       100   1e-20   
ref|XP_010922270.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...  99.0    1e-20   
ref|XP_009414141.1|  PREDICTED: putative glycosyltransferase 2        99.0    1e-20   
ref|XP_010452740.1|  PREDICTED: putative glycosyltransferase 3        99.4    1e-20   
ref|XP_002890293.1|  hypothetical protein ARALYDRAFT_312817             100   1e-20   
ref|XP_010652172.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2     99.0    1e-20   
ref|XP_009106103.1|  PREDICTED: putative glycosyltransferase 5        99.0    1e-20   
gb|EPS71488.1|  hypothetical protein M569_03267                       99.0    1e-20   
ref|XP_010491391.1|  PREDICTED: putative glycosyltransferase 3        99.0    1e-20   
ref|XP_008663804.1|  PREDICTED: putative glycosyltransferase 3        99.8    2e-20   
ref|XP_010423175.1|  PREDICTED: putative glycosyltransferase 3        99.0    2e-20   
gb|KHN26556.1|  Putative glycosyltransferase 2                        97.8    2e-20   
ref|XP_009761185.1|  PREDICTED: putative glycosyltransferase 5        99.0    2e-20   
gb|KHN14624.1|  Putative glycosyltransferase 2                        97.8    2e-20   
ref|XP_002980080.1|  glycosyltransferase CAZy family GT34-like pr...  97.8    2e-20   
emb|CAN77730.1|  hypothetical protein VITISV_027412                   99.0    2e-20   
gb|AFW59084.1|  hypothetical protein ZEAMMB73_119802                  99.8    2e-20   
gb|EMT05890.1|  Putative glycosyltransferase 3                          100   2e-20   
ref|XP_002874911.1|  hypothetical protein ARALYDRAFT_490316           99.0    2e-20   
ref|XP_010258249.1|  PREDICTED: putative glycosyltransferase 5        99.0    2e-20   
gb|ACF06190.1|  xylosyl transferase                                   94.7    2e-20   
ref|NP_001268156.1|  alpha-1,6-xylosyltransferase                     98.6    2e-20   
emb|CDY19235.1|  BnaC05g14360D                                        98.6    2e-20   
ref|XP_010666578.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2     98.2    3e-20   
ref|XP_001772519.1|  predicted protein                                97.8    3e-20   
ref|XP_011090963.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...  98.2    3e-20   
ref|XP_003533377.1|  PREDICTED: putative glycosyltransferase 2-li...  97.8    3e-20   
gb|AFU82535.1|  alpha-1,6-xylosyltransferase                          95.5    4e-20   
emb|CDX90935.1|  BnaA03g26150D                                        97.8    4e-20   
ref|XP_002967572.1|  glycosyltransferase, CAZy family GT34-like p...  97.8    4e-20   
gb|ABK24302.1|  unknown                                               97.8    4e-20   
emb|CDY50378.1|  BnaCnng19100D                                        98.2    4e-20   
ref|XP_010089891.1|  Putative glycosyltransferase 5                   97.8    4e-20   
emb|CDY18017.1|  BnaC03g30890D                                        96.7    4e-20   
ref|XP_001755467.1|  predicted protein                                97.4    4e-20   
ref|XP_006416577.1|  hypothetical protein EUTSA_v10007657mg           97.8    4e-20   
ref|XP_010318819.1|  PREDICTED: putative glycosyltransferase 5        97.8    4e-20   
ref|XP_006365321.1|  PREDICTED: putative glycosyltransferase 5-li...  97.8    4e-20   
gb|EYU23497.1|  hypothetical protein MIMGU_mgv1a006132mg              97.8    5e-20   
ref|XP_009790055.1|  PREDICTED: putative glycosyltransferase 5        97.8    5e-20   
ref|XP_004136173.1|  PREDICTED: xyloglucan 6-xylosyltransferase-like  97.1    5e-20   
ref|XP_008654833.1|  PREDICTED: xyloglucan 6-xylosyltransferase-like  97.4    5e-20   
ref|XP_006651308.1|  PREDICTED: xyloglucan 6-xylosyltransferase-like  96.7    5e-20   
ref|XP_007224307.1|  hypothetical protein PRUPE_ppa019851mg           97.4    5e-20   
gb|EYU43946.1|  hypothetical protein MIMGU_mgv1a027073mg              97.4    5e-20   
ref|XP_008790864.1|  PREDICTED: putative glycosyltransferase 2        97.4    6e-20   
ref|XP_001767288.1|  predicted protein                                96.3    6e-20   
ref|XP_008438884.1|  PREDICTED: putative glycosyltransferase 2        97.4    6e-20   
ref|XP_008386651.1|  PREDICTED: putative glycosyltransferase 2        97.1    6e-20   
ref|XP_004134208.1|  PREDICTED: putative glycosyltransferase 2-like   97.4    6e-20   
emb|CAI11450.1|  alpha-1,6-xylosyltransferase                         97.1    7e-20   
ref|XP_006348817.1|  PREDICTED: putative glycosyltransferase 3-like   97.4    7e-20   
emb|CAJ57380.1|  alpha-1,6-xylosyltransferase                         97.1    7e-20   
ref|XP_008235045.1|  PREDICTED: putative glycosyltransferase 2        97.1    7e-20   
ref|XP_009617169.1|  PREDICTED: putative glycosyltransferase 5        97.1    7e-20   
ref|XP_001776727.1|  predicted protein                                97.1    7e-20   
gb|EMT25995.1|  hypothetical protein F775_42861                       95.5    7e-20   
ref|XP_004239475.1|  PREDICTED: putative glycosyltransferase 3        97.1    7e-20   
ref|XP_010938345.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...  97.1    8e-20   
ref|XP_011072798.1|  PREDICTED: putative glycosyltransferase 5        97.4    8e-20   
ref|XP_009144556.1|  PREDICTED: putative glycosyltransferase 2        97.1    8e-20   
ref|XP_001777149.1|  predicted protein                                96.7    9e-20   
ref|XP_008795804.1|  PREDICTED: putative glycosyltransferase 2        96.7    9e-20   
emb|CAI11458.1|  putative glycosyltransferase                         96.7    1e-19   
ref|XP_002442801.1|  hypothetical protein SORBIDRAFT_08g003090        96.7    1e-19   
emb|CDY22055.1|  BnaA09g00840D                                        96.7    1e-19   
ref|XP_002455150.1|  hypothetical protein SORBIDRAFT_03g005110        96.7    1e-19   
ref|XP_009111280.1|  PREDICTED: putative glycosyltransferase 2        96.7    1e-19   
ref|XP_009416128.1|  PREDICTED: putative glycosyltransferase 2        96.3    1e-19   
emb|CAJ57381.1|  alpha-1,6-xylosyltransferase                         95.9    1e-19   
ref|XP_009134428.1|  PREDICTED: putative glycosyltransferase 2        96.7    1e-19   
ref|XP_011087267.1|  PREDICTED: putative glycosyltransferase 5        96.3    2e-19   
gb|KJB41948.1|  hypothetical protein B456_007G128800                  95.9    2e-19   
ref|XP_007138911.1|  hypothetical protein PHAVU_009G248100g           95.5    2e-19   
ref|XP_009104763.1|  PREDICTED: putative glycosyltransferase 5        95.5    3e-19   
emb|CAI11457.1|  putative glycosyltransferase                         95.5    3e-19   
ref|XP_004290777.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2     95.1    3e-19   
ref|XP_001771886.1|  predicted protein                                94.4    4e-19   
ref|XP_003558085.1|  PREDICTED: xyloglucan 6-xylosyltransferase 1...  95.1    4e-19   
ref|XP_003609672.1|  Xyloglucan 6-xylosyltransferase                  95.1    4e-19   
ref|NP_001288054.1|  calmodulin binding transcription activator 1     94.7    6e-19   
ref|XP_004987030.1|  PREDICTED: xyloglucan 6-xylosyltransferase-like  94.4    6e-19   
ref|XP_004980166.1|  PREDICTED: putative glycosyltransferase 5-like   95.1    6e-19   
gb|AFW63176.1|  hypothetical protein ZEAMMB73_999507                  93.6    6e-19   
ref|XP_004508217.1|  PREDICTED: putative glycosyltransferase 2-like   94.4    7e-19   
ref|XP_004978367.1|  PREDICTED: putative glycosyltransferase 5-like   94.7    9e-19   
gb|ABC87290.1|  putative galactosyl transferase                       93.2    9e-19   
ref|XP_002314448.2|  glycosyltransferase 2 family protein             93.6    1e-18   
ref|XP_004977544.1|  PREDICTED: putative glycosyltransferase 5-like   94.0    1e-18   
ref|XP_008678871.1|  PREDICTED: LOW QUALITY PROTEIN: putative gly...  93.2    1e-18   
ref|XP_008451599.1|  PREDICTED: xyloglucan 6-xylosyltransferase       93.2    1e-18   
ref|XP_009352257.1|  PREDICTED: putative glycosyltransferase 2        93.6    1e-18   
ref|XP_008367147.1|  PREDICTED: putative glycosyltransferase 2        93.6    2e-18   
ref|XP_008360279.1|  PREDICTED: putative glycosyltransferase 2        93.6    2e-18   
ref|XP_002990826.1|  xyloglucan xylosyltransferase-like protein       92.8    2e-18   
ref|XP_006479923.1|  PREDICTED: putative glycosyltransferase 2-li...  92.8    3e-18   
ref|XP_006479922.1|  PREDICTED: putative glycosyltransferase 2-li...  92.8    3e-18   
ref|XP_006444290.1|  hypothetical protein CICLE_v10020012mg           92.8    3e-18   
ref|XP_002441834.1|  hypothetical protein SORBIDRAFT_08g003080        92.8    4e-18   
ref|XP_004980167.1|  PREDICTED: putative glycosyltransferase 5-like   92.4    4e-18   
ref|XP_006479921.1|  PREDICTED: putative glycosyltransferase 2-li...  92.4    4e-18   
ref|XP_004296837.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...  92.0    5e-18   
ref|XP_002974473.1|  xyloglucan xylosyltransferase-like protein       91.7    6e-18   
ref|XP_004987032.1|  PREDICTED: xyloglucan 6-xylosyltransferase-like  91.3    7e-18   
ref|XP_011000519.1|  PREDICTED: xyloglucan 6-xylosyltransferase 2...  91.3    8e-18   
gb|EPS64541.1|  hypothetical protein M569_10236                       89.7    2e-17   
ref|XP_001769838.1|  predicted protein                                89.7    2e-17   
ref|XP_002987473.1|  glycosyltransferase-like protein                 88.6    2e-17   
ref|XP_008662468.1|  PREDICTED: putative glycosyltransferase 3        90.1    2e-17   
ref|XP_008662460.1|  PREDICTED: putative glycosyltransferase 3        90.1    2e-17   
ref|XP_002980077.1|  glycosyltransferase-like protein                 87.4    5e-17   
emb|CDX76657.1|  BnaC08g32430D                                        85.9    6e-17   
gb|KEH19400.1|  xyloglucan xylosyltransferase                         83.2    9e-15   
ref|XP_001764909.1|  predicted protein                                82.4    1e-14   
ref|XP_001756042.1|  predicted protein                                82.0    2e-14   
ref|XP_001775066.1|  predicted protein                                81.6    2e-14   
ref|XP_001755939.1|  predicted protein                                81.6    2e-14   
ref|XP_001755245.1|  predicted protein                                80.1    5e-14   
ref|XP_001768129.1|  predicted protein                                80.1    7e-14   
gb|AEW08173.1|  hypothetical protein 2_1874_01                        75.1    1e-13   
ref|XP_001773763.1|  predicted protein                                79.0    1e-13   
gb|EMS48021.1|  Putative glycosyltransferase 3                        77.8    2e-13   
emb|CBI15187.3|  unnamed protein product                              70.1    5e-11   
emb|CAJ91142.1|  glycosyltransferase                                  65.1    2e-10   
ref|XP_002966412.1|  glycosyltransferase CAZy family GT34-like pr...  67.4    8e-10   
ref|XP_002978152.1|  glycosyltransferase CAZy family GT34-like pr...  67.4    8e-10   
gb|KEH31957.1|  galactosyl transferase GMA12/MNN10 family protein     61.6    4e-09   
ref|XP_008352151.1|  PREDICTED: putative uncharacterized protein ...  64.3    1e-08   
gb|AIA92435.1|  Glyco_transf_34                                       58.2    1e-07   
emb|CBI36830.3|  unnamed protein product                              60.8    2e-07   
gb|AEW08650.1|  hypothetical protein CL1035Contig1_03                 55.8    3e-07   
emb|CDY65940.1|  BnaUnng01300D                                        58.5    5e-07   
emb|CDX97271.1|  BnaA02g20620D                                        58.5    5e-07   
ref|XP_009609259.1|  PREDICTED: putative glycosyltransferase 3        55.5    4e-06   
emb|CDY70090.1|  BnaCnng66640D                                        55.8    6e-06   



>ref|XP_009624871.1| PREDICTED: putative glycosyltransferase 7 [Nicotiana tomentosiformis]
Length=456

 Score =   292 bits (747),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 135/175 (77%), Positives = 149/175 (85%), Gaps = 2/175 (1%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            D WG  LR TFKDKIF ESDDQSGL YL+LKE+EKWG+KIYVE  YYFEGYWVEIVG LD
Sbjct  283  DKWGEILRSTFKDKIFQESDDQSGLAYLLLKEKEKWGDKIYVEGQYYFEGYWVEIVGTLD  342

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
            NITD YLGIEK      LRRRH EKVSESY + W+EHL++AG GR  WRRPFITHFTGCQ
Sbjct  343  NITDKYLGIEKVVPS--LRRRHGEKVSESYGKVWEEHLKDAGYGRYSWRRPFITHFTGCQ  400

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            PCSGDHN+MYSGETC DAM KALNFADNQVLR YG+MH+DLLD++SV P+P+DFP
Sbjct  401  PCSGDHNQMYSGETCFDAMQKALNFADNQVLRKYGYMHKDLLDSSSVFPVPFDFP  455



>ref|XP_006363813.1| PREDICTED: putative glycosyltransferase 7-like isoform X2 [Solanum 
tuberosum]
Length=423

 Score =   290 bits (742),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 135/175 (77%), Positives = 150/175 (86%), Gaps = 2/175 (1%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            D WG  LR TFKDKIF ESDDQSGL YL+LKE+EKWGNKIYVE  YYFEGYWVEIVG  D
Sbjct  250  DKWGEILRTTFKDKIFQESDDQSGLAYLLLKEKEKWGNKIYVEGGYYFEGYWVEIVGTYD  309

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
            NITD YL IEK+ A  +LRRRHAE+VSESYA  W+EHL+ AG GR  WRRPFITHFTGCQ
Sbjct  310  NITDRYLAIEKSEA--RLRRRHAERVSESYASVWEEHLKEAGYGRYSWRRPFITHFTGCQ  367

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            PCSGDHN+MYSGETC DAM KALNFADNQVLR YG+MH+DLLD++SV P+P++FP
Sbjct  368  PCSGDHNQMYSGETCFDAMQKALNFADNQVLRKYGYMHKDLLDSSSVFPVPFNFP  422



>ref|XP_006363812.1| PREDICTED: putative glycosyltransferase 7-like isoform X1 [Solanum 
tuberosum]
Length=455

 Score =   291 bits (744),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 135/175 (77%), Positives = 150/175 (86%), Gaps = 2/175 (1%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            D WG  LR TFKDKIF ESDDQSGL YL+LKE+EKWGNKIYVE  YYFEGYWVEIVG  D
Sbjct  282  DKWGEILRTTFKDKIFQESDDQSGLAYLLLKEKEKWGNKIYVEGGYYFEGYWVEIVGTYD  341

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
            NITD YL IEK+ A  +LRRRHAE+VSESYA  W+EHL+ AG GR  WRRPFITHFTGCQ
Sbjct  342  NITDRYLAIEKSEA--RLRRRHAERVSESYASVWEEHLKEAGYGRYSWRRPFITHFTGCQ  399

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            PCSGDHN+MYSGETC DAM KALNFADNQVLR YG+MH+DLLD++SV P+P++FP
Sbjct  400  PCSGDHNQMYSGETCFDAMQKALNFADNQVLRKYGYMHKDLLDSSSVFPVPFNFP  454



>ref|XP_009761597.1| PREDICTED: putative glycosyltransferase 7 [Nicotiana sylvestris]
Length=456

 Score =   291 bits (744),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 135/175 (77%), Positives = 149/175 (85%), Gaps = 2/175 (1%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            D WG  LR TFKDKIF ESDDQSGL YL+LKE+EKWG+KIYVE  YYFEGYWVEIVG LD
Sbjct  283  DKWGEILRSTFKDKIFQESDDQSGLAYLLLKEKEKWGDKIYVEGQYYFEGYWVEIVGTLD  342

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
            NITD YLGIEK      LRRRH EKVSESY + W+EHL++AG GR  WRRPFITHFTGCQ
Sbjct  343  NITDKYLGIEKGVPS--LRRRHGEKVSESYGKVWEEHLKDAGYGRYSWRRPFITHFTGCQ  400

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            PCSGDHN+MYSGETC DAM KALNFADNQVLR YG+MH+DLLD++SV P+P+DFP
Sbjct  401  PCSGDHNQMYSGETCFDAMQKALNFADNQVLRKYGYMHKDLLDSSSVFPVPFDFP  455



>ref|XP_004231937.1| PREDICTED: putative glycosyltransferase 7 [Solanum lycopersicum]
Length=455

 Score =   287 bits (734),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 133/175 (76%), Positives = 148/175 (85%), Gaps = 2/175 (1%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            D WG  L  TFKDKIF ESDDQSGL YL+LKE+EKWGNKIYVE  YYFEGYWVEIVG  D
Sbjct  282  DKWGEILHTTFKDKIFQESDDQSGLAYLLLKEKEKWGNKIYVEGGYYFEGYWVEIVGTYD  341

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
            NITD YL IEK+    +LRRRHAE+VSESYA  W+EHL+ AG GR  WRRPFITHFTGCQ
Sbjct  342  NITDRYLAIEKSEG--RLRRRHAERVSESYASVWEEHLKEAGYGRYSWRRPFITHFTGCQ  399

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            PCSGDHN+MYSGETC DAM KALNFADNQVLR YG+MH+DLLD++SV P+P++FP
Sbjct  400  PCSGDHNQMYSGETCFDAMQKALNFADNQVLRKYGYMHKDLLDSSSVFPVPFNFP  454



>gb|EYU44510.1| hypothetical protein MIMGU_mgv1a018855mg [Erythranthe guttata]
Length=438

 Score =   274 bits (701),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 144/175 (82%), Gaps = 0/175 (0%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            D WG  L  TFKDKIFPESDDQSGL+YL+LKE+EKWGNKIYVES+YYFEGYW+EI+G  D
Sbjct  261  DKWGEILSATFKDKIFPESDDQSGLVYLLLKEKEKWGNKIYVESEYYFEGYWMEIIGTFD  320

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
            NIT+ Y   EK AA   LRRRH EKVSE YA  W+++L+ AGQGR  WRRPFITHFTGCQ
Sbjct  321  NITERYTETEKPAAAAALRRRHGEKVSEGYATVWEDYLKEAGQGRGSWRRPFITHFTGCQ  380

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            PCSG HN+MYSG+TC DAM +AL FADNQVLRNYGF+H D+ D  +V P+P+D+P
Sbjct  381  PCSGAHNQMYSGQTCVDAMQRALTFADNQVLRNYGFVHPDIGDPTTVNPIPFDYP  435



>ref|XP_011099399.1| PREDICTED: glycosyltransferase 6-like [Sesamum indicum]
Length=462

 Score =   275 bits (703),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 145/175 (83%), Gaps = 2/175 (1%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            + WG  L   FKDKIFPESDDQSGL+YLILKE+EKWGNKIYVE +YYFEGYW+EIVG  D
Sbjct  289  EKWGEILSTMFKDKIFPESDDQSGLVYLILKEKEKWGNKIYVEGEYYFEGYWMEIVGTFD  348

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
            NIT+ Y  IEK      LRRRHAEKVSESYA  W+E+L++AG GR  WRRPFITHFTGCQ
Sbjct  349  NITERYTQIEKEVPA--LRRRHAEKVSESYARVWEEYLKDAGYGRGSWRRPFITHFTGCQ  406

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            PCSGDHN+MYSG+TC DAM KAL FADNQVLRNYGF+H DLLD ++V  LP+D+P
Sbjct  407  PCSGDHNQMYSGQTCFDAMQKALIFADNQVLRNYGFVHPDLLDPSTVNLLPFDYP  461



>ref|XP_011073681.1| PREDICTED: glycosyltransferase 6 [Sesamum indicum]
Length=466

 Score =   273 bits (698),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 145/175 (83%), Gaps = 2/175 (1%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            D WG  LR TFKDKIFPESDDQSGL+YL+LKE+EKWG KIYVES+YYFEGYW+EIVGK D
Sbjct  293  DKWGEILRTTFKDKIFPESDDQSGLVYLLLKEKEKWGEKIYVESEYYFEGYWMEIVGKFD  352

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
            NIT  Y+ +EK      LRRRHAEKVS SY    +E+L++ G GR  WRRPFITHFTGCQ
Sbjct  353  NITRKYMEMEKEVGA--LRRRHAEKVSGSYGRLREEYLKDVGYGRESWRRPFITHFTGCQ  410

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            PCSGDHN+MYSG+TC DAM KAL FADNQVLRNYGF+H DLLD ++V PLP+D+P
Sbjct  411  PCSGDHNQMYSGQTCFDAMQKALTFADNQVLRNYGFVHPDLLDPSTVDPLPFDYP  465



>ref|XP_010646814.1| PREDICTED: LOW QUALITY PROTEIN: putative glycosyltransferase 
7 [Vitis vinifera]
Length=403

 Score =   269 bits (688),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 123/175 (70%), Positives = 146/175 (83%), Gaps = 2/175 (1%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            D WG TL  TFKDK+FPESDDQSGL+YL++KE++KW  KIY+ES YYFEGYW EIVG LD
Sbjct  230  DKWGKTLTSTFKDKMFPESDDQSGLVYLLVKEKDKWAEKIYLESQYYFEGYWEEIVGTLD  289

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
            NIT  YL IEK      LRRRHAEKVSESYAE+ + +L+ AG GR  WRRPFITHFTGCQ
Sbjct  290  NITSKYLEIEKGV--NTLRRRHAEKVSESYAEQREPYLKKAGNGRYSWRRPFITHFTGCQ  347

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            PCSG HN+MY+GE+C ++M KALNFADNQVLRN+GF+H DLLD+++V PLP+D+P
Sbjct  348  PCSGKHNQMYAGESCWNSMQKALNFADNQVLRNFGFVHPDLLDSSTVTPLPFDYP  402



>emb|CAN80825.1| hypothetical protein VITISV_015452 [Vitis vinifera]
Length=446

 Score =   268 bits (686),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 123/175 (70%), Positives = 146/175 (83%), Gaps = 2/175 (1%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            D WG TL  TFKDK+FPESDDQSGL+YL++KE++KW  KIY+ES YYFEGYW EIVG LD
Sbjct  273  DKWGKTLTSTFKDKMFPESDDQSGLVYLLVKEKDKWAEKIYLESQYYFEGYWEEIVGTLD  332

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
            NIT  YL IEK      LRRRHAEKVSESYAE+ + +L+ AG GR  WRRPFITHFTGCQ
Sbjct  333  NITSKYLEIEKGV--NTLRRRHAEKVSESYAEQREPYLKKAGNGRYSWRRPFITHFTGCQ  390

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            PCSG HN+MY+GE+C ++M KALNFADNQVLRN+GF+H DLLD+++V PLP+D+P
Sbjct  391  PCSGKHNQMYAGESCWNSMQKALNFADNQVLRNFGFVHPDLLDSSTVTPLPFDYP  445



>gb|EYU41378.1| hypothetical protein MIMGU_mgv1a006348mg [Erythranthe guttata]
Length=447

 Score =   268 bits (686),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 147/175 (84%), Gaps = 2/175 (1%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            D WG   + TFKDKIFPESDDQSGL+YL+LK+++KWG+KIY+ES YYFEGYW+EIVG  +
Sbjct  273  DKWGEIQKSTFKDKIFPESDDQSGLVYLLLKDKDKWGDKIYLESGYYFEGYWMEIVGNFE  332

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
            NIT+ Y  +E  AA  +LRRRHAEKVSE Y   W+EHL+ AG GR  WRRPFITHFTGCQ
Sbjct  333  NITERYKQVE--AAEGRLRRRHAEKVSEGYVPVWEEHLKEAGYGRGSWRRPFITHFTGCQ  390

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            PCSGDHN+MYSG+TC DAM KAL FADNQVLR+YG++H DLLD ++V+PLP+D+P
Sbjct  391  PCSGDHNQMYSGQTCFDAMQKALIFADNQVLRSYGYVHPDLLDPSTVLPLPFDYP  445



>ref|XP_009777954.1| PREDICTED: putative glycosyltransferase 7 isoform X2 [Nicotiana 
sylvestris]
Length=412

 Score =   261 bits (666),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 148/179 (83%), Gaps = 7/179 (4%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            D WG  L+ TFKDK FP+SDDQSGL YL+LKE++KWG+KIY+ES+YYF+GYWV+IVG+L+
Sbjct  240  DKWGQILQSTFKDKNFPQSDDQSGLSYLLLKEKDKWGDKIYLESEYYFQGYWVDIVGQLN  299

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
            NITD YLGIEK      LRRRHAEKVSE Y + W+E+L      +  WRRPFITHFTGC+
Sbjct  300  NITDKYLGIEKKMPS--LRRRHAEKVSERYGKLWEEYLI-----KDKWRRPFITHFTGCE  352

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN*TS  152
            PCSGDHN +YS ETC +AM KALNFADNQVLR YGF+H+DLLD++SV PLP+DFP+ +S
Sbjct  353  PCSGDHNPIYSWETCYNAMQKALNFADNQVLRKYGFVHKDLLDSSSVSPLPFDFPSNSS  411



>ref|XP_009777953.1| PREDICTED: putative glycosyltransferase 7 isoform X1 [Nicotiana 
sylvestris]
Length=431

 Score =   260 bits (665),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 148/179 (83%), Gaps = 7/179 (4%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            D WG  L+ TFKDK FP+SDDQSGL YL+LKE++KWG+KIY+ES+YYF+GYWV+IVG+L+
Sbjct  259  DKWGQILQSTFKDKNFPQSDDQSGLSYLLLKEKDKWGDKIYLESEYYFQGYWVDIVGQLN  318

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
            NITD YLGIEK      LRRRHAEKVSE Y + W+E+L      +  WRRPFITHFTGC+
Sbjct  319  NITDKYLGIEKKMPS--LRRRHAEKVSERYGKLWEEYLI-----KDKWRRPFITHFTGCE  371

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN*TS  152
            PCSGDHN +YS ETC +AM KALNFADNQVLR YGF+H+DLLD++SV PLP+DFP+ +S
Sbjct  372  PCSGDHNPIYSWETCYNAMQKALNFADNQVLRKYGFVHKDLLDSSSVSPLPFDFPSNSS  430



>ref|XP_009618872.1| PREDICTED: putative glycosyltransferase 7 [Nicotiana tomentosiformis]
Length=443

 Score =   259 bits (662),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/176 (69%), Positives = 145/176 (82%), Gaps = 7/176 (4%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            D WG TL+ TF DK FP+SDDQSGL YL+LKE++KWG+KIY+ES+YYF+GYWV+I+G+LD
Sbjct  271  DKWGQTLQSTFNDKNFPQSDDQSGLSYLLLKEKDKWGDKIYLESEYYFQGYWVDIIGQLD  330

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
            NITD YLGIEK      LRRRHAEKVSE Y + WKE+L      +  WRRPFITHFTGC+
Sbjct  331  NITDKYLGIEKKMPS--LRRRHAEKVSERYGKLWKEYLI-----KDKWRRPFITHFTGCE  383

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  161
            PCSGDHN +YS ETC +AM K LNFADNQVLRNYGF+H+DLLD++SV PL +DFP+
Sbjct  384  PCSGDHNPIYSWETCYNAMQKTLNFADNQVLRNYGFVHKDLLDSSSVSPLSFDFPS  439



>emb|CDP02616.1| unnamed protein product [Coffea canephora]
Length=448

 Score =   258 bits (658),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 149/175 (85%), Gaps = 2/175 (1%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            D WG   R TFKDK FPESDDQ+GL YLILKE+EKWGNKIY+E +YYFEGYW+EIVG L+
Sbjct  267  DKWGVIQRTTFKDKTFPESDDQTGLAYLILKEREKWGNKIYMEDEYYFEGYWMEIVGTLE  326

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
            NITD Y GIEK     +LRRRHAE+V ESY + W+EHL++AG GR  WRRPF+THFTGCQ
Sbjct  327  NITDAYTGIEKRER--RLRRRHAERVGESYGKVWEEHLKDAGYGRGSWRRPFMTHFTGCQ  384

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            PCSGDHN+MYSG++C DAM  ALNFADNQVLR YGF+HRDLLDT++V+PLP+D+P
Sbjct  385  PCSGDHNQMYSGQSCWDAMQIALNFADNQVLRRYGFVHRDLLDTSTVLPLPFDYP  439



>gb|ACE60602.1| putative galactomannan galactosyl transferase [Coffea arabica]
Length=448

 Score =   256 bits (655),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 148/175 (85%), Gaps = 2/175 (1%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            D WG   R TFKDK FPESDDQ+GL YLILKE+EKWGNKIY+E +YYFEGYW+EIVG L+
Sbjct  267  DKWGVIQRTTFKDKTFPESDDQTGLAYLILKEREKWGNKIYMEDEYYFEGYWMEIVGTLE  326

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
            NITD Y GIEK     +LRRRHAE+V ESY + W+EHL++AG GR  WRRPF+THFTGCQ
Sbjct  327  NITDAYTGIEKRER--RLRRRHAERVGESYGKVWEEHLKDAGYGRGSWRRPFMTHFTGCQ  384

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            PCSGDHN+MYSG++C DAM  ALNFADNQVLR YGF+HRDLLDT++V PLP+D+P
Sbjct  385  PCSGDHNQMYSGQSCWDAMQIALNFADNQVLRRYGFVHRDLLDTSTVPPLPFDYP  439



>ref|XP_010273069.1| PREDICTED: putative glycosyltransferase 7 [Nelumbo nucifera]
Length=460

 Score =   256 bits (655),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 143/175 (82%), Gaps = 2/175 (1%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            D WG T R T  DK+FPE+DDQSGL+YL+L+E+EKW +KIY+E +YYFEGYW+EIVG L+
Sbjct  287  DKWGKTQRSTLSDKLFPEADDQSGLVYLLLEEKEKWADKIYLEGEYYFEGYWLEIVGTLN  346

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
            NITD Y+G+EK   G  LRRRHAEKV E Y+   +  L+ AG GR  WRRPFITHFTGCQ
Sbjct  347  NITDKYVGMEKEIRG--LRRRHAEKVMEHYSLVREPFLKAAGNGRGSWRRPFITHFTGCQ  404

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            PCSG++N+MYSG++C   M KALNFADNQVLR++GFMHRDL D++SV PLP+D+P
Sbjct  405  PCSGEYNQMYSGDSCWQGMEKALNFADNQVLRSFGFMHRDLQDSSSVSPLPFDYP  459



>gb|EPS69883.1| hypothetical protein M569_04879, partial [Genlisea aurea]
Length=420

 Score =   251 bits (642),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 140/175 (80%), Gaps = 2/175 (1%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            D WG   R  F DK FPESDDQ+GLIYL+LKE +KWG KIYVES+YYFEGYW+EIVG+LD
Sbjct  248  DKWGEIQRSIFADKAFPESDDQAGLIYLLLKENKKWGPKIYVESEYYFEGYWLEIVGELD  307

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
             I   YL I++  A   LRRRHAEK+S+SYA  W++HL++ G GR   RRPF+THFTGCQ
Sbjct  308  RIAAEYLKIQR--AVPALRRRHAEKLSKSYAAAWEKHLKDKGYGRGSLRRPFVTHFTGCQ  365

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            PCSG+HN MY  ++CAD + KAL FAD+QVLRNYG++HRD LD ++VVPLP+D+P
Sbjct  366  PCSGEHNPMYPEKSCADGLQKALTFADDQVLRNYGYLHRDPLDPSTVVPLPFDYP  420



>ref|XP_004141854.1| PREDICTED: galactomannan galactosyltransferase 1-like [Cucumis 
sativus]
 ref|XP_004167675.1| PREDICTED: galactomannan galactosyltransferase 1-like [Cucumis 
sativus]
 gb|KGN48624.1| hypothetical protein Csa_6G495780 [Cucumis sativus]
Length=444

 Score =   247 bits (630),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 139/175 (79%), Gaps = 3/175 (2%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            + WG  L+ T  DK+FPESDDQ+GL+YL+ KE+EKWGNKIY+E +YYFEGYW EIV   D
Sbjct  272  EKWGQVLKSTIPDKLFPESDDQTGLVYLLYKEKEKWGNKIYLEGEYYFEGYWEEIVTTFD  331

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
            NIT+ Y+ +E+   G++LRRRHAEKVSE Y E  +++L+ AG G+  WRRPFITHFTGCQ
Sbjct  332  NITERYMEMER--GGQELRRRHAEKVSEQYGEFREKYLKEAGNGKGSWRRPFITHFTGCQ  389

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            PCSGDHN+MYSG +C D M KALNFADNQVLR YGFMH D  D+ SV  +PYD+P
Sbjct  390  PCSGDHNQMYSGGSCWDGMRKALNFADNQVLRKYGFMHPDAFDS-SVSEVPYDYP  443



>ref|XP_010274411.1| PREDICTED: galactomannan galactosyltransferase 1-like [Nelumbo 
nucifera]
Length=467

 Score =   245 bits (626),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 112/176 (64%), Positives = 145/176 (82%), Gaps = 2/176 (1%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            D WG T +   KDK++ ESDDQSGL+YL+L+++EKW +KIYVES YYFEGYW+EIV +L+
Sbjct  292  DKWGKTQKSVLKDKVYAESDDQSGLVYLLLEQKEKWADKIYVESQYYFEGYWLEIVERLE  351

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
            NI+D Y+GIE T+AGE LRRRHAEKV+  YA+  + +L+ AG G   WRRPF+THFTGCQ
Sbjct  352  NISDRYVGIE-TSAGE-LRRRHAEKVNGYYAQLREPYLKEAGFGWGSWRRPFVTHFTGCQ  409

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  161
            PC+G+HN +YSGE+C   M KALNFADNQVLR +GF+H D+LD++SV PLP+D+P+
Sbjct  410  PCNGNHNRIYSGESCWKGMEKALNFADNQVLRTFGFVHGDMLDSSSVSPLPFDYPS  465



>ref|XP_010106924.1| Galactomannan galactosyltransferase 1 [Morus notabilis]
 gb|EXC12640.1| Galactomannan galactosyltransferase 1 [Morus notabilis]
Length=459

 Score =   244 bits (623),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 121/175 (69%), Positives = 136/175 (78%), Gaps = 3/175 (2%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            + WG+ LR TF DK FPESDDQ+GL YLI KE+EKW ++IY+ES+YYFEGYW EIV  LD
Sbjct  287  EKWGSILRSTFADKAFPESDDQTGLAYLIYKEKEKWADRIYLESEYYFEGYWEEIVRTLD  346

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
            NIT+ YL IEK    EKLRRRHAEKVSE Y    +EHL  AG G   WRRPFITHFTGCQ
Sbjct  347  NITERYLEIEKK--DEKLRRRHAEKVSEQYGAFREEHLGAAGYGLGSWRRPFITHFTGCQ  404

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            PCSG+HN+MYSGE+C D M KALNFADNQVLR YGFMH  LLD  SV  +P+D P
Sbjct  405  PCSGNHNQMYSGESCWDGMTKALNFADNQVLRTYGFMHPHLLD-PSVNAVPFDHP  458



>ref|XP_008440417.1| PREDICTED: galactomannan galactosyltransferase 1-like [Cucumis 
melo]
Length=445

 Score =   242 bits (618),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 137/175 (78%), Gaps = 3/175 (2%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            + WG  L+ T  DK+FPESDDQ+GL+YL+ KE+EKWGNKIY+E +YYFEGYW EIV   D
Sbjct  273  EKWGQVLKSTIPDKLFPESDDQTGLVYLLYKEKEKWGNKIYLEGEYYFEGYWEEIVTTFD  332

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
            NITD Y  +E+   G++LRRRHAEKVSE Y    +++L+ AG G+  WRRPFITHFTGCQ
Sbjct  333  NITDKYREMER--GGQELRRRHAEKVSEQYGVFREKYLKEAGNGKGSWRRPFITHFTGCQ  390

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            PCSGDHN+MYSG +C D M KALNFADNQVLR YGF+H D +D  SV  +PYD+P
Sbjct  391  PCSGDHNQMYSGGSCWDGMRKALNFADNQVLRKYGFVHPDAMD-PSVSEVPYDYP  444



>gb|ADL36661.1| CAMTA domain class transcription factor [Malus domestica]
Length=449

 Score =   241 bits (614),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 115/177 (65%), Positives = 137/177 (77%), Gaps = 3/177 (2%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            + WG TLR TFKDK FPESDDQ+GL YLI +E+EKWG+KIY+ES+YYFEGYW EIVG LD
Sbjct  271  EKWGETLRSTFKDKAFPESDDQTGLAYLIYREKEKWGDKIYLESEYYFEGYWAEIVGTLD  330

Query  508  NITDMYLGIEK--TAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTG  335
             I   Y  IE+   A   +LRRRHAEKVSE Y    +E+LR AG G+  WRRPF+THFTG
Sbjct  331  KIEARYDEIERGEEANAVRLRRRHAEKVSEQYGAYREEYLREAGYGKGSWRRPFVTHFTG  390

Query  334  CQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            CQPCSG HNEMYSGE+C D M KALNFADNQVLR YG++H    ++A+  P+P+D+P
Sbjct  391  CQPCSGMHNEMYSGESCWDGMRKALNFADNQVLRKYGYVHPSAGESAA-TPVPFDYP  446



>ref|XP_007205195.1| hypothetical protein PRUPE_ppa005681mg [Prunus persica]
 gb|EMJ06394.1| hypothetical protein PRUPE_ppa005681mg [Prunus persica]
Length=448

 Score =   240 bits (613),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 116/178 (65%), Positives = 133/178 (75%), Gaps = 3/178 (2%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            + WG TLR TFKDK FPESDDQ+GL YLI KE+EKWG KIY+ES+YYFEGYW EIVG LD
Sbjct  271  EKWGETLRSTFKDKAFPESDDQTGLAYLIYKEKEKWGKKIYMESEYYFEGYWAEIVGTLD  330

Query  508  NITDMYLGIEKTAA--GEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTG  335
             I D Y  IE+       +LRRRHAEKVSE Y E  +E+L  AG GR  WRRPFITHFTG
Sbjct  331  KIEDRYAEIERGEEDNAVRLRRRHAEKVSEQYGEFREEYLSEAGNGRGSWRRPFITHFTG  390

Query  334  CQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  161
            CQPCSG HNEMY   +C D M KALNFADNQVLR YG++H   +D A V  +P+D+P+
Sbjct  391  CQPCSGRHNEMYKANSCWDGMEKALNFADNQVLRKYGYVHPSTMDRA-VSTVPFDYPS  447



>ref|XP_009362595.1| PREDICTED: LOW QUALITY PROTEIN: galactomannan galactosyltransferase 
1-like [Pyrus x bretschneideri]
Length=495

 Score =   241 bits (616),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 116/177 (66%), Positives = 136/177 (77%), Gaps = 3/177 (2%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            + WG TLR TFKDK FPESDDQ+GL YLI KE+EKWG+KIY+ES+YYFEGYW EIVG LD
Sbjct  317  EKWGETLRSTFKDKAFPESDDQTGLAYLIYKEKEKWGDKIYLESEYYFEGYWAEIVGTLD  376

Query  508  NITDMYLGIEKTAA--GEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTG  335
             I   Y  IE+       +LRRRHAEKVSE Y    +E+LR AG G+  WRRPF+THFTG
Sbjct  377  KIEARYDEIERGEEDNAVRLRRRHAEKVSEQYGAYREEYLREAGYGKGSWRRPFVTHFTG  436

Query  334  CQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            CQPCSG HNEMYSGE+C D M KALNFADNQVLR YG++H    D+A+  P+P+D+P
Sbjct  437  CQPCSGMHNEMYSGESCWDGMRKALNFADNQVLRKYGYVHASTGDSAA-TPVPFDYP  492



>gb|ADL36663.1| CAMTA domain class transcription factor [Malus domestica]
Length=441

 Score =   239 bits (610),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/177 (64%), Positives = 135/177 (76%), Gaps = 3/177 (2%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            + WG TLR TFKDK FPESDDQ+GL YLI KE++KW +KIY+ES+YYFEGYW EIVG LD
Sbjct  263  EKWGETLRSTFKDKAFPESDDQTGLAYLIYKERDKWADKIYLESEYYFEGYWAEIVGTLD  322

Query  508  NITDMYLGIEKTA--AGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTG  335
             I   Y  IE+    +  +LRRRHAEKVSE Y    +E+LR AG G+  WRRPF+THFTG
Sbjct  323  KIEARYAEIERGEEDSAMRLRRRHAEKVSEQYGVFREEYLREAGYGKGSWRRPFVTHFTG  382

Query  334  CQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            CQPCSG HNEMYSGE+C D M KALNFADNQVLR YG++H    D A+  P+P+D+P
Sbjct  383  CQPCSGAHNEMYSGESCWDGMRKALNFADNQVLRKYGYVHPSTEDRAA-TPVPFDYP  438



>ref|XP_008347885.1| PREDICTED: galactomannan galactosyltransferase 1-like [Malus 
domestica]
Length=449

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/177 (64%), Positives = 136/177 (77%), Gaps = 3/177 (2%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            + WG TLR TFKDK FPESDDQ+GL YLI +E+EKWG+KIY+ES+YYFEGYW EIVG LD
Sbjct  271  EKWGETLRSTFKDKAFPESDDQTGLAYLIYREKEKWGDKIYLESEYYFEGYWAEIVGTLD  330

Query  508  NITDMYLGIEKTAA--GEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTG  335
             I   Y  IE+       +LRRRHAEKVSE Y    +E+LR AG G+  WRRPF+THFTG
Sbjct  331  KIEARYDEIERGEEDNAVRLRRRHAEKVSEQYGAYREEYLREAGYGKGSWRRPFVTHFTG  390

Query  334  CQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            CQPCSG HNEMYSGE+C D M KALNFADNQVLR YG++H    ++A+  P+P+D+P
Sbjct  391  CQPCSGMHNEMYSGESCWDGMRKALNFADNQVLRKYGYVHPSAGESAA-TPVPFDYP  446



>ref|XP_008362135.1| PREDICTED: galactomannan galactosyltransferase 1-like [Malus 
domestica]
Length=504

 Score =   239 bits (611),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 114/177 (64%), Positives = 135/177 (76%), Gaps = 3/177 (2%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            + WG TLR TFKDK FPESDDQ+GL YLI KE++KW +KIY+ES+YYFEGYW EIVG LD
Sbjct  326  EKWGETLRSTFKDKAFPESDDQTGLAYLIYKERDKWADKIYLESEYYFEGYWAEIVGTLD  385

Query  508  NITDMYLGIEKTA--AGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTG  335
             I   Y  IE+    +  +LRRRHAEKVSE Y    +E+LR AG G+  WRRPF+THFTG
Sbjct  386  KIEARYAEIERGEEDSAMRLRRRHAEKVSEQYGVFREEYLREAGYGKGSWRRPFVTHFTG  445

Query  334  CQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            CQPCSG HNEMYSGE+C D M KALNFADNQVLR YG++H    D A+  P+P+D+P
Sbjct  446  CQPCSGAHNEMYSGESCWDGMRKALNFADNQVLRKYGYVHPSTEDRAA-TPVPFDYP  501



>ref|XP_008237711.1| PREDICTED: galactomannan galactosyltransferase 1-like [Prunus 
mume]
 ref|XP_008237720.1| PREDICTED: galactomannan galactosyltransferase 1-like [Prunus 
mume]
Length=448

 Score =   238 bits (607),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 115/178 (65%), Positives = 132/178 (74%), Gaps = 3/178 (2%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            + WG TLR TFKDK FPESDDQ+GL YLI KE+EKWG KIY+ES+YYFEGYW EIVG LD
Sbjct  271  EKWGETLRSTFKDKAFPESDDQTGLAYLIYKEKEKWGKKIYLESEYYFEGYWAEIVGTLD  330

Query  508  NITDMYLGIEKTAA--GEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTG  335
             I D Y  IE+       +LRRRHAEKVSE Y    +E+L  AG GR  WRRPFITHFTG
Sbjct  331  KIEDRYAEIERGEEDNAVRLRRRHAEKVSEQYGAFREEYLSEAGYGRGSWRRPFITHFTG  390

Query  334  CQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  161
            CQPCSG HNEMY   +C D M KALNFADNQVLR YG++H   +D A V  +P+D+P+
Sbjct  391  CQPCSGRHNEMYKANSCWDGMEKALNFADNQVLRKYGYVHPSTMDRA-VSTVPFDYPS  447



>gb|KHG22205.1| Putative glycosyltransferase 7 -like protein [Gossypium arboreum]
Length=452

 Score =   238 bits (607),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 110/173 (64%), Positives = 138/173 (80%), Gaps = 2/173 (1%)
 Frame = -3

Query  682  WGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNI  503
            WG   R TFKDK+FPESDDQ+ LIYL+ K +EK+ + IY+E ++YFEGYWVEI G+ +N 
Sbjct  274  WGEIQRSTFKDKLFPESDDQTALIYLLYKHKEKYYDHIYLEGEFYFEGYWVEIFGRYENT  333

Query  502  TDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPC  323
            T+MYL IE+ AA  +LRRRHAEKVSE Y    +E+L+ AG G+  WRRP ITHFTGCQPC
Sbjct  334  TEMYLEIERGAA--ELRRRHAEKVSEHYGAFREEYLKGAGNGKGSWRRPLITHFTGCQPC  391

Query  322  SGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            +GDHN+MY GE+C + M KALNFADNQVLR YGF+H DLLD+++V  LP+D+P
Sbjct  392  NGDHNKMYDGESCWNGMVKALNFADNQVLRKYGFIHPDLLDSSTVSELPFDYP  444



>gb|KJB18050.1| hypothetical protein B456_003G031400 [Gossypium raimondii]
Length=450

 Score =   238 bits (606),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 109/173 (63%), Positives = 138/173 (80%), Gaps = 2/173 (1%)
 Frame = -3

Query  682  WGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNI  503
            WG   R TFKDK+FPESDDQ+ LIYL+ K +EK+ + IY+E ++YFEGYWVEI G+ +N 
Sbjct  274  WGEIQRSTFKDKLFPESDDQTALIYLLYKHKEKYYDHIYLEGEFYFEGYWVEIFGRYENT  333

Query  502  TDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPC  323
            T+MYL IE+ AA  +LRRRHAEKVSE Y    +E+L++AG G+  WRRP ITHFTGCQPC
Sbjct  334  TEMYLAIERGAA--ELRRRHAEKVSEQYGAFREEYLKSAGNGKGSWRRPLITHFTGCQPC  391

Query  322  SGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            +GDHN+MY GE+C + M KALNFADNQVLR YGF+H DLLD++ V  +P+D+P
Sbjct  392  NGDHNKMYDGESCWNGMVKALNFADNQVLRKYGFIHPDLLDSSIVSEVPFDYP  444



>ref|XP_004288265.1| PREDICTED: galactomannan galactosyltransferase 1-like [Fragaria 
vesca subsp. vesca]
Length=457

 Score =   237 bits (605),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 115/180 (64%), Positives = 136/180 (76%), Gaps = 6/180 (3%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            + WG TLR TFKDK FPESDDQ+GL YLI KE EKW ++IY+ESDYYFEGYW EIVG L+
Sbjct  276  EKWGETLRATFKDKAFPESDDQTGLAYLIYKENEKWADRIYLESDYYFEGYWAEIVGNLE  335

Query  508  NITDMYLGIEKTAAGE---KLRRRHAEKVSESYAEKWKEHLRNAGQ--GRSGWRRPFITH  344
            NIT+ Y  IEK    E   +LRRRHAEKVSE Y    ++ L++AG   G   WRRPF+TH
Sbjct  336  NITEKYTEIEKRRGDEDVARLRRRHAEKVSEQYGAFREKFLKDAGSGYGVGSWRRPFVTH  395

Query  343  FTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            FTGCQPCSG HN MYSG +C D M KALNFADNQVLR YGF+H   +D+ S+ PLP+++P
Sbjct  396  FTGCQPCSGAHNLMYSGTSCWDGMQKALNFADNQVLRKYGFVHASAVDS-SIQPLPFNYP  454



>gb|KHG22229.1| Putative glycosyltransferase 7 -like protein [Gossypium arboreum]
Length=456

 Score =   236 bits (603),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 137/175 (78%), Gaps = 2/175 (1%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            + WG   R TFKDK+FPESDDQS ++YL+  E+EK+ + IY+E ++YFEGYWVEIVG  +
Sbjct  278  EKWGQIQRSTFKDKLFPESDDQSAMVYLLYTEKEKYYDHIYLEGEFYFEGYWVEIVGGYE  337

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
            N T+ YL IE+ A   KLRRRHAEKVSE YA   +E L+ AG G+  WRRP ITHFTGCQ
Sbjct  338  NTTERYLEIERGAP--KLRRRHAEKVSEQYAAFREEFLKEAGNGKGSWRRPLITHFTGCQ  395

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            PCSGDHN+MY+GE+C + M KALNFADNQVLR YGF+H DL D+++V  +P+D+P
Sbjct  396  PCSGDHNQMYAGESCWNGMVKALNFADNQVLRKYGFVHSDLHDSSTVTEIPFDYP  450



>gb|KJB46680.1| hypothetical protein B456_008G0841002 [Gossypium raimondii]
Length=424

 Score =   235 bits (599),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 136/175 (78%), Gaps = 2/175 (1%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            + WG   R TFKDK+FPESDDQS L+YL+  E+EK+ + IY+E ++YFEGYWVEIVG  +
Sbjct  246  EKWGQIQRLTFKDKLFPESDDQSALVYLLYTEKEKYYDHIYLEGEFYFEGYWVEIVGGYE  305

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
            N T+ YL IE+ A   KLRRRHAEKVSE YA   +E L+ AG G+  WRRP ITHFTGCQ
Sbjct  306  NTTERYLEIERGAP--KLRRRHAEKVSEQYAAFREEFLKEAGNGKGSWRRPLITHFTGCQ  363

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            PCSGDHN MY+GE+C + M KALNFADNQVLR YGF+H DL D+++V  +P+D+P
Sbjct  364  PCSGDHNLMYAGESCWNGMVKALNFADNQVLRKYGFVHSDLHDSSTVTEIPFDYP  418



>ref|XP_003539263.1| PREDICTED: galactomannan galactosyltransferase 1-like isoformX1 
[Glycine max]
 ref|XP_006590622.1| PREDICTED: galactomannan galactosyltransferase 1-like isoform 
X2 [Glycine max]
Length=452

 Score =   235 bits (599),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 137/175 (78%), Gaps = 3/175 (2%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            + WG TLR TFKDK FPESDDQ+GL YLI  E++KW ++IY+ES+YYFEGYW EI+G   
Sbjct  276  EKWGQTLRSTFKDKFFPESDDQTGLAYLIAIEKDKWADRIYLESEYYFEGYWEEILGTFQ  335

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
            NIT+ Y  +EK  +  +LRRRHAEKVSE+Y E  +E+L++AG G+  WRRPFITHFTGCQ
Sbjct  336  NITEKYNEMEKGVS--RLRRRHAEKVSETYGEMREEYLKDAGNGKGSWRRPFITHFTGCQ  393

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            PCSG +N MYS + C + M KALNFADNQV+R +G+M  DLLD A + P+P+D+P
Sbjct  394  PCSGKYNAMYSADDCWNGMQKALNFADNQVMRKFGYMRPDLLDNA-ISPVPFDYP  447



>ref|XP_007047569.1| Galactosyl transferase GMA12/MNN10 family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007047570.1| Galactosyl transferase GMA12/MNN10 family protein isoform 1 [Theobroma 
cacao]
 gb|EOX91726.1| Galactosyl transferase GMA12/MNN10 family protein isoform 1 [Theobroma 
cacao]
 gb|EOX91727.1| Galactosyl transferase GMA12/MNN10 family protein isoform 1 [Theobroma 
cacao]
Length=455

 Score =   235 bits (599),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 111/173 (64%), Positives = 134/173 (77%), Gaps = 2/173 (1%)
 Frame = -3

Query  682  WGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNI  503
            WG   R TFKDK+FPESDDQS LIYL+ KE+EK+ + IY+E ++Y EGYWVEIVG  +N 
Sbjct  279  WGQIQRSTFKDKLFPESDDQSALIYLLYKEKEKYYDHIYLEGEFYLEGYWVEIVGGYENT  338

Query  502  TDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPC  323
            T+ YL IE+     KLRRRHAEKVSE YA   +E L+ AG G+  WRRP ITHFTGCQPC
Sbjct  339  TERYLEIERGVP--KLRRRHAEKVSEQYAAFREEFLKEAGNGKGSWRRPLITHFTGCQPC  396

Query  322  SGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            SGDHN+MY+GETC + M KALNFADNQVLR YGF+  DL D+++V  +PYD+P
Sbjct  397  SGDHNQMYAGETCWNGMVKALNFADNQVLRKYGFVRPDLRDSSTVTEVPYDYP  449



>gb|KJB46678.1| hypothetical protein B456_008G0841002 [Gossypium raimondii]
 gb|KJB46679.1| hypothetical protein B456_008G0841002 [Gossypium raimondii]
 gb|KJB46681.1| hypothetical protein B456_008G0841002 [Gossypium raimondii]
 gb|KJB46682.1| hypothetical protein B456_008G0841002 [Gossypium raimondii]
Length=456

 Score =   234 bits (598),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 136/175 (78%), Gaps = 2/175 (1%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            + WG   R TFKDK+FPESDDQS L+YL+  E+EK+ + IY+E ++YFEGYWVEIVG  +
Sbjct  278  EKWGQIQRLTFKDKLFPESDDQSALVYLLYTEKEKYYDHIYLEGEFYFEGYWVEIVGGYE  337

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
            N T+ YL IE+ A   KLRRRHAEKVSE YA   +E L+ AG G+  WRRP ITHFTGCQ
Sbjct  338  NTTERYLEIERGAP--KLRRRHAEKVSEQYAAFREEFLKEAGNGKGSWRRPLITHFTGCQ  395

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            PCSGDHN MY+GE+C + M KALNFADNQVLR YGF+H DL D+++V  +P+D+P
Sbjct  396  PCSGDHNLMYAGESCWNGMVKALNFADNQVLRKYGFVHSDLHDSSTVTEIPFDYP  450



>emb|CDP02619.1| unnamed protein product [Coffea canephora]
Length=469

 Score =   234 bits (596),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/173 (63%), Positives = 131/173 (76%), Gaps = 3/173 (2%)
 Frame = -3

Query  682  WGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNI  503
            WG TLR TFKDK+FPESDDQS L+YL+LKE+ KWG+ +YVE++Y   GYW  +VG++DNI
Sbjct  290  WGQTLRSTFKDKMFPESDDQSALVYLLLKEKRKWGDMMYVENEYSLHGYWAAVVGRIDNI  349

Query  502  TDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPC  323
            T  Y  IE+     KLRRRHAE V E Y + W+EHL +AG  + GWRRPFITHFTGCQPC
Sbjct  350  TGRYEKIERQEV--KLRRRHAEAVGERYGKLWEEHLEDAGDRKGGWRRPFITHFTGCQPC  407

Query  322  SGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            SGDHN  Y G+ C   M +ALNFADNQVLRN+GF+H DL +  SV PL +DFP
Sbjct  408  SGDHNPSYVGKDCWVGMERALNFADNQVLRNFGFVHPDLRN-GSVSPLAFDFP  459



>ref|XP_006426098.1| hypothetical protein CICLE_v10025585mg [Citrus clementina]
 gb|ESR39338.1| hypothetical protein CICLE_v10025585mg [Citrus clementina]
Length=452

 Score =   233 bits (593),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 111/174 (64%), Positives = 136/174 (78%), Gaps = 2/174 (1%)
 Frame = -3

Query  682  WGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNI  503
            WG   R TFKDKIFPESDDQ+ LIYL+  E++K+ + IY+E ++YFEGYW+EIV   DNI
Sbjct  276  WGQVQRSTFKDKIFPESDDQAALIYLLYTEKDKYYDNIYLEGEFYFEGYWLEIVPTYDNI  335

Query  502  TDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPC  323
            T  Y+ IE+     +  RRHAEKVSESYA + +++L+ AG GR  WRRPFITHFTGCQPC
Sbjct  336  TGRYMEIERRVRTLR--RRHAEKVSESYAAQREQYLKEAGNGRGSWRRPFITHFTGCQPC  393

Query  322  SGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  161
            SGDHN+MYSGETC   M KALNFADNQVLR YGF+H DL D++ V P+P+DFP+
Sbjct  394  SGDHNQMYSGETCWSGMVKALNFADNQVLRKYGFVHPDLRDSSLVSPVPFDFPD  447



>ref|XP_006350640.1| PREDICTED: putative glycosyltransferase 7-like [Solanum tuberosum]
Length=411

 Score =   231 bits (589),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 111/176 (63%), Positives = 137/176 (78%), Gaps = 6/176 (3%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            + WG  LR TFKDK FP+SDDQSGL YL+LKE++KWG KIY+ES+YYF+GYWV+I+  LD
Sbjct  240  NKWGEILRTTFKDKKFPQSDDQSGLSYLLLKEKDKWGEKIYIESEYYFQGYWVDIIETLD  299

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
            NIT+ Y  IEK      LRRRHAEKV  S  + W+E+L    +     RRPF+THFTGC+
Sbjct  300  NITNKYFEIEKKIP--ILRRRHAEKVV-SEIKVWEEYLI---KDNYSIRRPFVTHFTGCE  353

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  161
            PCSGD+N +YS ETC DAM KALNFADNQVLR YGF+H +LLD+++V PLP+DFP+
Sbjct  354  PCSGDYNPIYSWETCYDAMQKALNFADNQVLRKYGFLHNNLLDSSTVFPLPFDFPS  409



>ref|XP_006466460.1| PREDICTED: putative glycosyltransferase 7-like [Citrus sinensis]
Length=452

 Score =   232 bits (592),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 111/174 (64%), Positives = 136/174 (78%), Gaps = 2/174 (1%)
 Frame = -3

Query  682  WGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNI  503
            WG   R TFKDKIFPESDDQ+ LIYL+  E++K+ + IY+E ++YFEGYW+EIV   DNI
Sbjct  276  WGQIQRSTFKDKIFPESDDQAALIYLLYTEKDKYYDNIYLEGEFYFEGYWLEIVPTYDNI  335

Query  502  TDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPC  323
            T  Y+ IE+     +  RRHAEKVSESYA + +++L+ AG GR  WRRPFITHFTGCQPC
Sbjct  336  TGRYMEIERRVRTLR--RRHAEKVSESYAAQREQYLKEAGNGRGSWRRPFITHFTGCQPC  393

Query  322  SGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  161
            SGDHN+MYSGETC   M KALNFADNQVLR YGF+H DL D++ V P+P+DFP+
Sbjct  394  SGDHNQMYSGETCWSGMVKALNFADNQVLRKYGFVHPDLRDSSLVSPVPFDFPD  447



>ref|XP_007156700.1| hypothetical protein PHAVU_002G009900g [Phaseolus vulgaris]
 gb|ESW28694.1| hypothetical protein PHAVU_002G009900g [Phaseolus vulgaris]
Length=450

 Score =   232 bits (591),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 116/176 (66%), Positives = 135/176 (77%), Gaps = 6/176 (3%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            + WG TLR TFKDK FPESDDQ+GL YLI  E+EKW +KIY+ESDYYFEGYW EIVG L 
Sbjct  280  EKWGKTLRSTFKDKFFPESDDQTGLAYLIAIEKEKWADKIYLESDYYFEGYWKEIVGTLQ  339

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
            NI+D Y  +E+     +LRRRHAEKVSESY    +E L++AG    GWRRPFITHFTGCQ
Sbjct  340  NISDKYKKMEEGV--HRLRRRHAEKVSESYGGIREEDLKDAG---FGWRRPFITHFTGCQ  394

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  161
            PCSG +N MYS + C + MHKALNFADNQVLRNYGF+  DLL   SV  LP+D+P+
Sbjct  395  PCSGKYNAMYSADDCWNGMHKALNFADNQVLRNYGFLRPDLL-LNSVSTLPFDYPH  449



>ref|XP_003611556.1| Galactomannan galactosyltransferase [Medicago truncatula]
 gb|AES94514.1| galactosyl transferase GMA12/MNN10 family protein [Medicago truncatula]
Length=446

 Score =   228 bits (582),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 133/175 (76%), Gaps = 3/175 (2%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            + WG TLR TFKDK FPESDDQ+GL YLI  E+EKWG+KIY+E +YYFEGYW EIV    
Sbjct  273  EEWGKTLRSTFKDKFFPESDDQTGLAYLIAIEKEKWGDKIYLEGEYYFEGYWEEIVETFS  332

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
            NI+  Y  IEK     KLRRR+AEKVSE+Y    +E+L++AG G+  WRRPF+THFTGCQ
Sbjct  333  NISKKYEDIEKVEP--KLRRRYAEKVSEAYGVIREEYLKDAGYGKGSWRRPFVTHFTGCQ  390

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            PCSG +NEMY+ + C + M KALNFADNQV+R +GF+H+DL D   V  LP+D+P
Sbjct  391  PCSGKYNEMYTADACWNGMKKALNFADNQVMRKFGFVHKDLGDNG-VSSLPFDYP  444



>ref|XP_004234713.2| PREDICTED: glycosyltransferase 6-like [Solanum lycopersicum]
Length=446

 Score =   228 bits (582),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 137/176 (78%), Gaps = 6/176 (3%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            + WG  LR TFKDK FP+SDDQSGL YL+LKE++KWG+KIY+ES+YYF+GYWV+I+  LD
Sbjct  275  NRWGEILRTTFKDKNFPQSDDQSGLSYLLLKEKDKWGDKIYIESEYYFQGYWVDIIDTLD  334

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
            NIT+ Y  IEK      LRRRHAEKV  S  + W+E+L          RRPF+THFTGC+
Sbjct  335  NITNKYFEIEKKIP--ILRRRHAEKVV-SEIKVWEEYLIKDSYSI---RRPFVTHFTGCE  388

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  161
            PCSGD+N +YS ETC +AM KALNFADNQVLR YGF+H +LLD++SV PLP+D+P+
Sbjct  389  PCSGDYNPIYSWETCYNAMQKALNFADNQVLRKYGFVHNNLLDSSSVRPLPFDYPS  444



>gb|KDP32091.1| hypothetical protein JCGZ_12552 [Jatropha curcas]
Length=453

 Score =   228 bits (581),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 130/175 (74%), Gaps = 3/175 (2%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            + WG   R  FKDK+FP SDDQS LIYL+ K++    +KIY+E +YYFEGYW EI+   D
Sbjct  277  EKWGQIQRSLFKDKLFPGSDDQSALIYLLYKDKSL-MDKIYLEGEYYFEGYWSEILPTYD  335

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
            NITD Y  IEK     KLRRRHAEKVSE YA   + HLR AG G+  WRRPFITHFTGCQ
Sbjct  336  NITDKYTEIEK--EDPKLRRRHAEKVSEQYAAFREPHLREAGNGKGSWRRPFITHFTGCQ  393

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            PCSGDHN+MY G++C   M KALNFADNQVLR YGF+H DLLD+ +VV  P+D+P
Sbjct  394  PCSGDHNKMYEGDSCWKGMVKALNFADNQVLRKYGFVHPDLLDSKTVVETPFDYP  448



>ref|XP_003517354.1| PREDICTED: galactomannan galactosyltransferase 1-like [Glycine 
max]
Length=449

 Score =   227 bits (578),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 132/175 (75%), Gaps = 6/175 (3%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            + WG TLR TFKDK FPESDDQ+GL YLI  E++KW  +IY+ES+YYFEGYW EI G   
Sbjct  279  EKWGQTLRSTFKDKFFPESDDQTGLAYLIAMEKDKWAERIYLESEYYFEGYWEEIQGTFK  338

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
            NIT+ Y  +EK    ++LRRRHAEKVSE+Y E  +E+L++AG  +  WRRPFITHFTGCQ
Sbjct  339  NITEKYKEMEKGV--QRLRRRHAEKVSETYGEMREEYLKDAGNAKGSWRRPFITHFTGCQ  396

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            PCSG +N MYS   C +AMH ALNFADNQV+R +G+    LLD A V PLP+D+P
Sbjct  397  PCSGKYNAMYSAHDCWNAMHNALNFADNQVMRKFGY---SLLDNA-VSPLPFDYP  447



>emb|CAI79403.1| galactomannan galactosyltransferase [Senna occidentalis]
Length=449

 Score =   226 bits (577),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 131/175 (75%), Gaps = 3/175 (2%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            + WG  LR TFKDK FPESDDQ+GL YLI  E+EKW ++IY+ES+YYFEGYW EIV   +
Sbjct  277  EKWGEKLRTTFKDKAFPESDDQTGLAYLIAVEKEKWADRIYLESEYYFEGYWKEIVETYE  336

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
            NITD Y  +E+      LRRRHAEKVSESY    + ++  AG GR  WRRPFITHFTGCQ
Sbjct  337  NITDKYHEVERKV--RSLRRRHAEKVSESYGAVREPYVMVAGSGRGSWRRPFITHFTGCQ  394

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            PCSG+HN MYS + C + M+KAL FADNQVLR +G++H DL D  SV P+P+D+P
Sbjct  395  PCSGNHNAMYSPDACWNGMNKALIFADNQVLRKFGYVHPDLQDN-SVSPIPFDYP  448



>gb|KJB43940.1| hypothetical protein B456_007G224800 [Gossypium raimondii]
Length=456

 Score =   226 bits (576),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/178 (58%), Positives = 138/178 (78%), Gaps = 6/178 (3%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            + WG   R  FKDK++PESDDQS LIYL+ KE+EK+ + IY+E ++YF+GYWV+++G  D
Sbjct  274  EKWGQIQRSMFKDKLYPESDDQSALIYLLYKEKEKYYDHIYLEKEFYFQGYWVDLIGVYD  333

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
            N T+ YL +E+  A  +LRRRHAEKVSE YA   +E L+  G+    W+RPFITHFTGC+
Sbjct  334  NTTERYLQMERKVA--RLRRRHAEKVSEQYAAFREEFLKETGK----WKRPFITHFTGCE  387

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN*T  155
            PCSG+HN+ Y GETC + M KALNFADNQ+LRNYGF+H DLLD+++V  +P+D+PN T
Sbjct  388  PCSGNHNQKYDGETCWEGMVKALNFADNQILRNYGFLHSDLLDSSTVTEVPFDYPNPT  445



>gb|KDO78929.1| hypothetical protein CISIN_1g045999mg [Citrus sinensis]
Length=438

 Score =   225 bits (574),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/174 (61%), Positives = 129/174 (74%), Gaps = 16/174 (9%)
 Frame = -3

Query  682  WGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNI  503
            WG   R TFKDKIFPESDDQ+ LIYL+  E++K+ + IY+E ++YFEGYW+EIV  +   
Sbjct  276  WGQIQRSTFKDKIFPESDDQAALIYLLYTEKDKYYDNIYLEGEFYFEGYWLEIVPTV---  332

Query  502  TDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPC  323
                           LRRRHAEKVSESYA + +++L+ AG GR  WRRPFITHFTGCQPC
Sbjct  333  -------------RTLRRRHAEKVSESYAAQREQYLKEAGNGRGSWRRPFITHFTGCQPC  379

Query  322  SGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  161
            SGDHN+MYSGETC   M KALNFADNQVLR YGF+H DL D++ V P+P+DFP+
Sbjct  380  SGDHNQMYSGETCWSGMVKALNFADNQVLRKYGFVHPDLRDSSLVSPVPFDFPD  433



>ref|XP_002310890.2| alpha galactosyltransferase family protein [Populus trichocarpa]
 gb|EEE91340.2| alpha galactosyltransferase family protein [Populus trichocarpa]
Length=457

 Score =   226 bits (575),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 130/176 (74%), Gaps = 3/176 (2%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            + WG   R  FKDK+FPESDDQSGL YL+ K++   G KIY+E +YYFEGYW +I+   D
Sbjct  281  EKWGEIQRSVFKDKLFPESDDQSGLTYLLYKDKSLTG-KIYLEGEYYFEGYWADILPTYD  339

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
            NIT+ Y  +EK     KLRRRHAEKVSE Y    + HLR AG G+  WRRPFITHFTGCQ
Sbjct  340  NITEKYTELEKEDG--KLRRRHAEKVSEQYGVFREPHLREAGNGKGSWRRPFITHFTGCQ  397

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  161
            PCSGDHN+MY GETC + M KALNFADNQVLR YGF+H DLLD+ +V    +D+P+
Sbjct  398  PCSGDHNQMYEGETCWNGMVKALNFADNQVLRKYGFVHPDLLDSNTVTETSFDYPD  453



>ref|XP_011007841.1| PREDICTED: putative glycosyltransferase 7 [Populus euphratica]
 ref|XP_011007842.1| PREDICTED: putative glycosyltransferase 7 [Populus euphratica]
Length=458

 Score =   225 bits (573),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 107/174 (61%), Positives = 131/174 (75%), Gaps = 3/174 (2%)
 Frame = -3

Query  682  WGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNI  503
            WG   R  FKDK+FPESDDQSGLIY++ +++    +KIY+E +YYFEGYW +IV   DNI
Sbjct  284  WGPIQRSVFKDKLFPESDDQSGLIYMLYQDKGL-MDKIYLEGEYYFEGYWADIVPTYDNI  342

Query  502  TDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPC  323
            T+ Y  +EK     KLRRRHAEKVSE Y    + HL+ AG G+  WRRPFITHFTGCQPC
Sbjct  343  TEKYTELEKEDG--KLRRRHAEKVSEQYGVFREPHLKEAGNGKGSWRRPFITHFTGCQPC  400

Query  322  SGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  161
            SGDHN++Y GETC + M KALNFADNQVLR YGF+H DLLD+ +V   P+D+P+
Sbjct  401  SGDHNQIYHGETCWNGMVKALNFADNQVLRKYGFVHPDLLDSGTVTETPFDYPD  454



>ref|XP_002320005.2| alpha galactosyltransferase family protein [Populus trichocarpa]
 gb|EEE98320.2| alpha galactosyltransferase family protein [Populus trichocarpa]
Length=458

 Score =   224 bits (572),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 107/174 (61%), Positives = 131/174 (75%), Gaps = 3/174 (2%)
 Frame = -3

Query  682  WGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNI  503
            WG   R  FKDK+FPESDDQSGLIY++ +++    +KIY+E +YYFEGYW +IV   DNI
Sbjct  284  WGPIQRSVFKDKLFPESDDQSGLIYMLYQDKGL-MDKIYLEGEYYFEGYWADIVPTYDNI  342

Query  502  TDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPC  323
            T+ Y  +EK     KLRRRHAEKVSE Y    + HL+ AG G+  WRRPFITHFTGCQPC
Sbjct  343  TEKYTELEKEDG--KLRRRHAEKVSEQYGVFREPHLKEAGNGKGSWRRPFITHFTGCQPC  400

Query  322  SGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  161
            SGDHN++Y GETC + M KALNFADNQVLR YGF+H DLLD+ +V   P+D+P+
Sbjct  401  SGDHNQIYHGETCWNGMVKALNFADNQVLRKYGFVHPDLLDSGTVTETPFDYPD  454



>ref|XP_011031309.1| PREDICTED: putative glycosyltransferase 7 [Populus euphratica]
 ref|XP_011016265.1| PREDICTED: putative glycosyltransferase 7 [Populus euphratica]
Length=457

 Score =   224 bits (570),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 127/174 (73%), Gaps = 3/174 (2%)
 Frame = -3

Query  682  WGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNI  503
            WG   R  FKDK+FPESDDQSGL YL+ K++     KIY+E +YYFEGYW +I+   DNI
Sbjct  283  WGEIQRSVFKDKLFPESDDQSGLTYLLYKDKSL-TEKIYLEGEYYFEGYWADILPTYDNI  341

Query  502  TDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPC  323
            T+ Y  +EK     KLRRRHAEKVSE Y    + HLR AG G+  WRRPFITHFTGCQPC
Sbjct  342  TEKYTELEKEDG--KLRRRHAEKVSEQYGVFREPHLREAGNGKGSWRRPFITHFTGCQPC  399

Query  322  SGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  161
            SGDHN+MY GETC   M KALNFADNQVLR YGF+H DLLD+ +V    +D+P+
Sbjct  400  SGDHNQMYEGETCWTGMVKALNFADNQVLRKYGFVHPDLLDSNTVTETSFDYPD  453



>ref|XP_006857127.1| hypothetical protein AMTR_s00065p00144450 [Amborella trichopoda]
 gb|ERN18594.1| hypothetical protein AMTR_s00065p00144450 [Amborella trichopoda]
Length=478

 Score =   224 bits (570),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/172 (59%), Positives = 129/172 (75%), Gaps = 2/172 (1%)
 Frame = -3

Query  679  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  500
            G T      D++F  SDDQS L+YL+L E++KWG+KI++E+ YYFEGYWVEI+G  +NIT
Sbjct  305  GKTQTSVLSDRLFSASDDQSALVYLLLTERDKWGDKIFLENSYYFEGYWVEIIGTYENIT  364

Query  499  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  320
              Y  +EK  A   LRRR  EK++  + E  + +L+ AG GR  WRRPF+THFTGCQPCS
Sbjct  365  RRYEDMEK--AQPILRRRKPEKLAMKFGELREPYLKEAGNGRFSWRRPFVTHFTGCQPCS  422

Query  319  GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            GDHN++YSGE C   M +ALNFADNQVLRN+GF+H DL D+ASV PLP+DFP
Sbjct  423  GDHNKIYSGENCWKGMERALNFADNQVLRNFGFVHEDLSDSASVKPLPFDFP  474



>gb|KHN36310.1| Galactomannan galactosyltransferase 1 [Glycine soja]
Length=417

 Score =   222 bits (566),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/172 (62%), Positives = 130/172 (76%), Gaps = 6/172 (3%)
 Frame = -3

Query  679  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  500
              TLR TFKDK FPESDDQ+GL YLI  E++KW  +IY+ES+YYFEGYW EI G   NIT
Sbjct  250  AGTLRSTFKDKFFPESDDQTGLAYLIAMEKDKWAERIYLESEYYFEGYWEEIQGTFKNIT  309

Query  499  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  320
            + Y  +EK    ++LRRRHAEKVSE+Y E  +E+L++AG  +  WRRPFITHFTGCQPCS
Sbjct  310  EKYKEMEKGV--QRLRRRHAEKVSETYGEMREEYLKDAGNAKGSWRRPFITHFTGCQPCS  367

Query  319  GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            G +N MYS   C++AMH ALNFADNQV+R +G+    LLD A V PLP+D+P
Sbjct  368  GKYNAMYSPHDCSNAMHNALNFADNQVMRKFGY---SLLDNA-VSPLPFDYP  415



>ref|XP_002525290.1| transferase, putative [Ricinus communis]
 gb|EEF37118.1| transferase, putative [Ricinus communis]
Length=446

 Score =   222 bits (566),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 104/174 (60%), Positives = 132/174 (76%), Gaps = 3/174 (2%)
 Frame = -3

Query  682  WGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNI  503
            WG+  R  FKDK+FP+SDDQ+ LIY++ K++    +KIY+E +YYFEGYW+EIV   DNI
Sbjct  272  WGHIQRSLFKDKLFPDSDDQTALIYMLYKDKSL-TDKIYLEGEYYFEGYWLEIVPTYDNI  330

Query  502  TDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPC  323
            T+ Y  IE+     KLRRRHAEKVSE Y    + HL+ AG G+  WRRPFITHFTGCQPC
Sbjct  331  TEKYTEIERQDV--KLRRRHAEKVSEQYGAFREPHLKAAGNGKGSWRRPFITHFTGCQPC  388

Query  322  SGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  161
            SG+HN+MY G+ C D M +ALNFADNQVLR YGF+H DLL++ +VV  P+D+P+
Sbjct  389  SGEHNKMYEGDACWDGMVRALNFADNQVLRKYGFVHPDLLNSNTVVETPFDYPD  442



>ref|XP_004511818.1| PREDICTED: galactomannan galactosyltransferase 1-like [Cicer 
arietinum]
Length=458

 Score =   223 bits (567),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 132/175 (75%), Gaps = 3/175 (2%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            + WG+ LR TFKDK FPESDDQ+GL YLI  E+EKW ++IY+E +YYFEGYW EIVG  +
Sbjct  285  EEWGHKLRSTFKDKFFPESDDQTGLAYLIAIEKEKWADRIYLEGEYYFEGYWEEIVGTFE  344

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
            NI+  Y  IEK     +LRRRHAEKVSESY    +E+LR AG G+  WRRPF+THFTGCQ
Sbjct  345  NISKKYDEIEKGV--RRLRRRHAEKVSESYGAVREEYLREAGYGKGSWRRPFVTHFTGCQ  402

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            PCSG +NEMY+ + C + M +AL+FADNQV+R YG++H DL +   V  +P+D+P
Sbjct  403  PCSGKYNEMYTADACWNGMRRALHFADNQVIRKYGYVHPDLGNNL-VTSIPFDYP  456



>ref|XP_011099400.1| PREDICTED: glycosyltransferase 6-like [Sesamum indicum]
Length=430

 Score =   221 bits (564),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 105/174 (60%), Positives = 129/174 (74%), Gaps = 3/174 (2%)
 Frame = -3

Query  682  WGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNI  503
            WG  L  TFKDK+FPESDDQS LIYL+LKE+ KWG+ IYVE++Y   GYW+EIV K   I
Sbjct  254  WGQILISTFKDKLFPESDDQSALIYLLLKERRKWGDMIYVENEYSLHGYWLEIVKKFARI  313

Query  502  TDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGR-SGWRRPFITHFTGCQP  326
               Y+ IEK     +LRRRHAE V ESYA + + HL   G+ + SGWRRPFITHFTGCQP
Sbjct  314  AKKYVEIEKRVP--RLRRRHAEAVRESYAAELERHLAGGGERQDSGWRRPFITHFTGCQP  371

Query  325  CSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            CSG+HN  Y G++C   M +ALNFADNQVLR+YGF+H D+ + + V PLP+D+P
Sbjct  372  CSGEHNPAYEGDSCWVGMERALNFADNQVLRSYGFVHPDIANGSYVRPLPFDYP  425



>ref|XP_009394361.1| PREDICTED: galactomannan galactosyltransferase 1-like [Musa acuminata 
subsp. malaccensis]
Length=451

 Score =   221 bits (563),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/179 (58%), Positives = 134/179 (75%), Gaps = 6/179 (3%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            D WG   +  FKDK+F ESDDQS L+YL+LK +++WG+KI++ESDYYFEGYWVEIVG+L+
Sbjct  274  DRWGQLQKAEFKDKLFNESDDQSALVYLLLKHKDQWGDKIFLESDYYFEGYWVEIVGRLE  333

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLR---NAGQGRSGWRRPFITHFT  338
            N+T  Y  +E+   G  LRRRHAE  + +Y      HL     A  G +GWRRPF+THFT
Sbjct  334  NMTAKYAAVERQVQG--LRRRHAEVANGAYGRLRDRHLSGEDGAVSGPNGWRRPFMTHFT  391

Query  337  GCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  161
            GCQPCSGDHN+MYSGE+C + M +AL+FAD+QVLR+YGF H D L +  V PLP+D+P+
Sbjct  392  GCQPCSGDHNKMYSGESCWEGMQRALHFADDQVLRDYGFRHADPL-SGDVEPLPFDYPS  449



>ref|XP_010109205.1| Galactomannan galactosyltransferase 1 [Morus notabilis]
 gb|EXC21327.1| Galactomannan galactosyltransferase 1 [Morus notabilis]
Length=433

 Score =   218 bits (554),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/175 (60%), Positives = 132/175 (75%), Gaps = 8/175 (5%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            + WG T +  FKDK++PESDDQSGLIYL+LKE EKWG+KIY+ES+Y FEGYW+ +VG LD
Sbjct  264  EKWGKTQKLVFKDKLYPESDDQSGLIYLLLKENEKWGDKIYLESEYNFEGYWLGMVGGLD  323

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
            NIT  Y  IEK      LRRRHAEK+SE Y+E       N  +G    +RPF+ HFTGC+
Sbjct  324  NITKGYTEIEKKVG--VLRRRHAEKMSEYYSEI----RENYSKGVE--KRPFVIHFTGCE  375

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            PC+GDHN +Y+ E C + M KALNFADNQVLR++GF+H DLL+++ V PLP+DFP
Sbjct  376  PCTGDHNPVYTWEACWNGMQKALNFADNQVLRSFGFVHPDLLNSSLVSPLPFDFP  430



>ref|XP_004231939.1| PREDICTED: glycosyltransferase 6-like [Solanum lycopersicum]
Length=443

 Score =   216 bits (550),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 102/174 (59%), Positives = 121/174 (70%), Gaps = 2/174 (1%)
 Frame = -3

Query  685  HWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDN  506
             WG  LR TFKDK FPESDDQS L YLILK ++KW +KI+  +DY   GYW+ IV + +N
Sbjct  264  QWGKILRTTFKDKTFPESDDQSALSYLILKGEQKWRSKIHAITDYSLHGYWLGIVNRFEN  323

Query  505  ITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQP  326
            IT  Y+ IE+     KLRRRHAE VS SYA  W+  L      + GWRRPFITHFTGCQP
Sbjct  324  ITANYMKIERDVP--KLRRRHAEAVSHSYAAAWEPLLAEGADEKGGWRRPFITHFTGCQP  381

Query  325  CSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            CSGDH   Y G++C   M +ALNFADNQVLRN+GFMH D+   + V PL +DFP
Sbjct  382  CSGDHATEYVGDSCWVGMERALNFADNQVLRNFGFMHDDIKSNSPVSPLNFDFP  435



>emb|CAI11452.1| alpha-6-galactosyltransferase [Solanum tuberosum]
Length=443

 Score =   215 bits (548),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/174 (59%), Positives = 121/174 (70%), Gaps = 2/174 (1%)
 Frame = -3

Query  685  HWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDN  506
             WG  LR TFKDK FPESDDQS L YLILK + KW +KI+  +DY   GYW+ IV + D 
Sbjct  264  QWGKILRTTFKDKTFPESDDQSALSYLILKGERKWRSKIHAITDYSLHGYWLGIVNRFDK  323

Query  505  ITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQP  326
            IT+ Y  IE+     KLRRRHAE VS+SYAE  +  L     G+ GWRRPFITHFTGCQP
Sbjct  324  ITENYTKIERDVP--KLRRRHAEAVSDSYAEAREPLLAEGADGKGGWRRPFITHFTGCQP  381

Query  325  CSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            CSGDH   Y G++C   M +ALNFADNQVLRN+GFMH D+   + V PL +DFP
Sbjct  382  CSGDHAAEYVGDSCWVGMERALNFADNQVLRNFGFMHDDIKSNSPVSPLNFDFP  435



>ref|XP_006404757.1| hypothetical protein EUTSA_v10000162mg [Eutrema salsugineum]
 gb|ESQ46210.1| hypothetical protein EUTSA_v10000162mg [Eutrema salsugineum]
Length=449

 Score =   215 bits (548),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 131/175 (75%), Gaps = 3/175 (2%)
 Frame = -3

Query  682  WGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNI  503
            WG   R  FKDK+FPESDDQ+ LIYL+ K +E++  KIY+E +YYFEGYW+EIV  L N+
Sbjct  274  WGQIQRSIFKDKLFPESDDQTALIYLLFKHREEYYPKIYLEGEYYFEGYWLEIVPGLANV  333

Query  502  TDMYLGIEKTAAGEKLRRRHAEKVSESY-AEKWKEHLRNAGQGRSGWRRPFITHFTGCQP  326
            TD YL +E+  A   LRRRHAEKVSE Y A + +  LR    G+   RRPF+THFTGCQP
Sbjct  334  TDRYLEMEREDA--TLRRRHAEKVSERYGAFREERFLRGERGGKGSLRRPFVTHFTGCQP  391

Query  325  CSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  161
            CSGDHN+MY G+TC + M KA+NFADNQV+R YGF+H DL  T+ + P+P+D+P+
Sbjct  392  CSGDHNKMYDGDTCWNGMIKAINFADNQVMRRYGFVHSDLGKTSPLQPVPFDYPD  446



>emb|CDY49440.1| BnaA09g42270D [Brassica napus]
Length=448

 Score =   215 bits (547),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 130/175 (74%), Gaps = 3/175 (2%)
 Frame = -3

Query  682  WGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNI  503
            WG   R  FKDK+FPESDDQ+ LIYL+ K +E +  KIY+E +YYFEGYW+EIV  L NI
Sbjct  273  WGEIQRSIFKDKLFPESDDQTALIYLLFKHKEVYYPKIYLEGEYYFEGYWLEIVPGLANI  332

Query  502  TDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEH-LRNAGQGRSGWRRPFITHFTGCQP  326
            T+ YL +E+  A   LRRRHAEKVSE YA   +E  LR    G+   RRPF+THFTGCQP
Sbjct  333  TERYLEMEREDA--TLRRRHAEKVSERYAAFREERFLRGESGGKGSKRRPFVTHFTGCQP  390

Query  325  CSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  161
            CSGDHN MY+G+TC + M KA+NFADNQV+R YGF+H DL  T+ + P+P+D+P+
Sbjct  391  CSGDHNTMYNGDTCWNGMIKAINFADNQVMRRYGFVHSDLGKTSPLQPVPFDYPD  445



>ref|XP_009117319.1| PREDICTED: putative glycosyltransferase 7 [Brassica rapa]
Length=448

 Score =   215 bits (547),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 130/175 (74%), Gaps = 3/175 (2%)
 Frame = -3

Query  682  WGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNI  503
            WG   R  FKDK+FPESDDQ+ LIYL+ K +E +  KIY+E +YYFEGYW+EIV  L NI
Sbjct  273  WGEIQRSIFKDKLFPESDDQTALIYLLFKHKEVYYPKIYLEGEYYFEGYWLEIVPGLANI  332

Query  502  TDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEH-LRNAGQGRSGWRRPFITHFTGCQP  326
            T+ YL +E+  A   LRRRHAEKVSE YA   +E  LR    G+   RRPF+THFTGCQP
Sbjct  333  TERYLEMEREDA--TLRRRHAEKVSERYAAFREERFLRGESGGKGSKRRPFVTHFTGCQP  390

Query  325  CSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  161
            CSGDHN MY+G+TC + M KA+NFADNQV+R YGF+H DL  T+ + P+P+D+P+
Sbjct  391  CSGDHNTMYNGDTCWNGMIKAINFADNQVMRRYGFVHSDLGKTSPLQPVPFDYPD  445



>ref|XP_010531308.1| PREDICTED: putative glycosyltransferase 7 [Tarenaya hassleriana]
Length=449

 Score =   214 bits (546),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/177 (58%), Positives = 132/177 (75%), Gaps = 3/177 (2%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            + WG   R  FKDK+FPESDDQ+ LIYL+ K +E + +KIY+E  YYFEGYW+EIV  LD
Sbjct  272  EKWGEIQRSIFKDKLFPESDDQTALIYLLYKHREVYYDKIYLEGAYYFEGYWLEIVSGLD  331

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESY-AEKWKEHLRNAGQGRSGWRRPFITHFTGC  332
            N+T+ YL +E+  A    RRRHAEKVSE Y A + +  L+    G+   RRPFITHFTGC
Sbjct  332  NVTERYLEMERQDA--TCRRRHAEKVSERYGAFREERFLKGVAGGKGSVRRPFITHFTGC  389

Query  331  QPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  161
            QPCSGDHN MY+G+TC + M +ALNFADNQV+R+YGF+H DL  T+ + P+P+D+P+
Sbjct  390  QPCSGDHNRMYNGDTCWNGMIRALNFADNQVMRSYGFVHSDLRKTSPLQPVPFDYPD  446



>emb|CDX76887.1| BnaC08g34730D [Brassica napus]
Length=448

 Score =   214 bits (546),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 129/175 (74%), Gaps = 3/175 (2%)
 Frame = -3

Query  682  WGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNI  503
            WG   R  FKDK+FPESDDQ+ LIYL+ K +E +  KIY+E +YYFEGYW+EIV  L NI
Sbjct  273  WGEIQRSIFKDKLFPESDDQTALIYLLFKHKEVYYPKIYLEGEYYFEGYWLEIVPGLANI  332

Query  502  TDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEH-LRNAGQGRSGWRRPFITHFTGCQP  326
            T+ YL +E+  A   LRRRHAEKVSE YA   +E  LR    G+   RRPF+THFTGCQP
Sbjct  333  TERYLEMEREDA--TLRRRHAEKVSERYAAFREERFLRGESGGKGSKRRPFVTHFTGCQP  390

Query  325  CSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  161
            CSGDHN MY G+TC + M KA+NFADNQV+R YGF+H DL  T+ + P+P+D+P+
Sbjct  391  CSGDHNTMYDGDTCWNGMIKAINFADNQVMRRYGFVHSDLGKTSPLQPVPFDYPD  445



>ref|XP_006363811.1| PREDICTED: putative glycosyltransferase 7-like [Solanum tuberosum]
Length=443

 Score =   214 bits (545),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 103/174 (59%), Positives = 121/174 (70%), Gaps = 2/174 (1%)
 Frame = -3

Query  685  HWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDN  506
             WG  LR TFKDK FPESDDQS L YLILK + KW +KI+  +DY   GYW+ IV + D 
Sbjct  264  QWGKILRTTFKDKTFPESDDQSALSYLILKGERKWRSKIHAITDYSLHGYWLGIVNRFDK  323

Query  505  ITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQP  326
            IT+ Y  IE+     KLRRRHAE VS+SYAE  +  L     G+ GWRRPFITHFTGCQP
Sbjct  324  ITENYTKIERDVP--KLRRRHAEAVSDSYAEAREPLLAEGEDGKGGWRRPFITHFTGCQP  381

Query  325  CSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            CSGDH   Y G++C   M +ALNFADNQVLRN+GFMH D+   + V PL +DFP
Sbjct  382  CSGDHAAEYVGDSCWVGMERALNFADNQVLRNFGFMHDDIKSNSPVSPLNFDFP  435



>ref|XP_002880469.1| galactosyl transferase GMA12/MNN10 family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH56728.1| galactosyl transferase GMA12/MNN10 family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=434

 Score =   213 bits (542),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 130/175 (74%), Gaps = 3/175 (2%)
 Frame = -3

Query  682  WGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNI  503
            WG   R  FKDK+FPESDDQ+ LIYL+ K +E +  KIY+E D+YFEGYW+EIV  L N+
Sbjct  259  WGQIQRSIFKDKLFPESDDQTALIYLLYKHREVYYPKIYLEGDFYFEGYWLEIVPGLTNV  318

Query  502  TDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEH-LRNAGQGRSGWRRPFITHFTGCQP  326
            T+ YL +E+  A   LRRRHAEKVSE YA   +E  L+    G+   RRPF+THFTGCQP
Sbjct  319  TERYLEMEREDA--TLRRRHAEKVSERYAAFREERFLKGERGGKGSKRRPFVTHFTGCQP  376

Query  325  CSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  161
            CSGDHN+MY G+TC + M KA+NFADNQV+R YGF+H DL  T+ + PLP+D+P+
Sbjct  377  CSGDHNKMYDGDTCWNGMIKAINFADNQVMRKYGFVHSDLGKTSPLQPLPFDYPD  431



>ref|XP_009607432.1| PREDICTED: glycosyltransferase 6-like [Nicotiana tomentosiformis]
Length=443

 Score =   213 bits (542),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/174 (58%), Positives = 122/174 (70%), Gaps = 2/174 (1%)
 Frame = -3

Query  685  HWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDN  506
             WG  LR TFKDKIFPESDDQS L Y+I+K +EKW +KI+  +DY   GYW+ IV + DN
Sbjct  264  QWGKILRSTFKDKIFPESDDQSALSYIIMKGEEKWRSKIHAITDYSLHGYWLGIVDRFDN  323

Query  505  ITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQP  326
            IT  Y+ I++     KLRRRHAE VSESYA   +  +   G  + GWRRPFITHFTGCQP
Sbjct  324  ITGNYVKIDRDVP--KLRRRHAEAVSESYAAAREPLVAEGGDWKGGWRRPFITHFTGCQP  381

Query  325  CSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            CSGDH   Y G+ C   M +ALNFADNQVLRN+GFMH D+   + V P+ +DFP
Sbjct  382  CSGDHAAEYVGDKCWVGMERALNFADNQVLRNFGFMHNDIKSNSPVSPVNFDFP  435



>ref|XP_010417049.1| PREDICTED: putative glycosyltransferase 7 [Camelina sativa]
Length=466

 Score =   213 bits (543),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/175 (58%), Positives = 129/175 (74%), Gaps = 3/175 (2%)
 Frame = -3

Query  682  WGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNI  503
            WG   R  FKDK+FPESDDQ+ LIYL+ K +E +  KIY+E DYYFEGYW+EIV    N+
Sbjct  291  WGQIQRSIFKDKLFPESDDQTALIYLLYKHREVYYPKIYLEGDYYFEGYWLEIVPGFANV  350

Query  502  TDMYLGIEKTAAGEKLRRRHAEKVSESYAE-KWKEHLRNAGQGRSGWRRPFITHFTGCQP  326
            T+ YL +E+  A   LRRRHAEKVSE YA  + K  L+    G+   RRPF+THFTGCQP
Sbjct  351  TERYLEMEREDAA--LRRRHAEKVSEGYAAFREKRFLKGERGGKGSKRRPFVTHFTGCQP  408

Query  325  CSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  161
            CSGDHN+MY G+TC + M KA+NFADNQV+R YGF+H DL  T+ + P+P+D+P+
Sbjct  409  CSGDHNKMYDGDTCWNGMIKAINFADNQVMRKYGFVHSDLGKTSPLQPVPFDYPD  463



>emb|CDP02617.1| unnamed protein product [Coffea canephora]
Length=444

 Score =   212 bits (539),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 102/175 (58%), Positives = 126/175 (72%), Gaps = 3/175 (2%)
 Frame = -3

Query  685  HWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDN  506
            +W  TL  T  DK+ P +D+QS L+YL+L+E++KWG+ IY+E+ YY  GYWVEIVG+L++
Sbjct  264  YWSETLMSTLSDKVIPGADEQSSLVYLLLREKKKWGDMIYLENQYYLHGYWVEIVGRLND  323

Query  505  ITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQ-GRSGWRRPFITHFTGCQ  329
            I   YL  E  A    LRRR AE VSES    W++ LR+AG  G SGWRRPFITHFTGCQ
Sbjct  324  IIKKYLDTE--AKVPVLRRRVAEVVSESLDGVWEKCLRDAGGFGNSGWRRPFITHFTGCQ  381

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            PC+G  +  Y G  C  AM KALNFADNQVLR YGFMH DL + +SV P+P+DFP
Sbjct  382  PCTGKRDPAYKGNACWVAMEKALNFADNQVLRRYGFMHPDLGNGSSVFPVPFDFP  436



>ref|XP_010429224.1| PREDICTED: putative glycosyltransferase 7 [Camelina sativa]
Length=455

 Score =   212 bits (539),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 129/175 (74%), Gaps = 3/175 (2%)
 Frame = -3

Query  682  WGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNI  503
            WG   R  FKDK+FPESDDQ+ LIYL+ K +E +  KIY+E D+YFEGYW+EIV    N+
Sbjct  280  WGQIQRSIFKDKLFPESDDQTALIYLLYKHREVYYPKIYLEGDFYFEGYWLEIVPGFANV  339

Query  502  TDMYLGIEKTAAGEKLRRRHAEKVSESYAE-KWKEHLRNAGQGRSGWRRPFITHFTGCQP  326
            T+ YL +E+  A   LRRRHAEKVSE YA  + K  L+    G+   RRPF+THFTGCQP
Sbjct  340  TERYLEMEREDA--TLRRRHAEKVSERYAAFREKRFLKGERGGKGSKRRPFVTHFTGCQP  397

Query  325  CSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  161
            CSGDHN+MY G+TC + M KA+NFADNQV+R YGF+H DL  T+ + P+P+D+P+
Sbjct  398  CSGDHNKMYDGDTCWNGMIKAINFADNQVMRKYGFVHSDLGKTSPLQPVPFDYPD  452



>ref|XP_010472288.1| PREDICTED: putative glycosyltransferase 7 [Camelina sativa]
Length=455

 Score =   212 bits (539),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 129/175 (74%), Gaps = 3/175 (2%)
 Frame = -3

Query  682  WGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNI  503
            WG   R  FKDK+FPESDDQ+ LIYL+ K +E +  KIY+E D+YFEGYW+EIV    N+
Sbjct  280  WGQIQRSIFKDKLFPESDDQTALIYLLYKHREVYYPKIYLEGDFYFEGYWLEIVPGFANV  339

Query  502  TDMYLGIEKTAAGEKLRRRHAEKVSESYAE-KWKEHLRNAGQGRSGWRRPFITHFTGCQP  326
            T+ YL +E+  A   LRRRHAEKVSE YA  + K  L+    G+   RRPF+THFTGCQP
Sbjct  340  TERYLEMEREDA--TLRRRHAEKVSEGYAAFREKRFLKGERGGKGSKRRPFVTHFTGCQP  397

Query  325  CSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  161
            CSGDHN+MY G+TC + M KA+NFADNQV+R YGF+H DL  T+ + P+P+D+P+
Sbjct  398  CSGDHNKMYDGDTCWNGMIKAINFADNQVMRKYGFVHSDLGKTSPLQPVPFDYPD  452



>ref|NP_565544.1| putative glycosyltransferase 7 [Arabidopsis thaliana]
 sp|O81007.1|GT7_ARATH RecName: Full=Putative glycosyltransferase 7; Short=AtGT7 [Arabidopsis 
thaliana]
 gb|AAC32437.1| Expressed protein [Arabidopsis thaliana]
 emb|CAC01675.1| putative golgi glycosyltransferase [Arabidopsis thaliana]
 gb|AAK59529.1| unknown protein [Arabidopsis thaliana]
 gb|AAL15201.1| unknown protein [Arabidopsis thaliana]
 gb|AEC07370.1| putative glycosyltransferase 7 [Arabidopsis thaliana]
 gb|AHL38845.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=449

 Score =   211 bits (538),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 130/175 (74%), Gaps = 3/175 (2%)
 Frame = -3

Query  682  WGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNI  503
            WG   R  FKDK+FPESDDQ+ L+YL+ K +E +  KIY+E D+YFEGYW+EIV  L N+
Sbjct  274  WGQIQRSIFKDKLFPESDDQTALLYLLYKHREVYYPKIYLEGDFYFEGYWLEIVPGLSNV  333

Query  502  TDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEH-LRNAGQGRSGWRRPFITHFTGCQP  326
            T+ YL +E+  A   LRRRHAEKVSE YA   +E  L+    G+   RRPF+THFTGCQP
Sbjct  334  TERYLEMEREDA--TLRRRHAEKVSERYAAFREERFLKGERGGKGSKRRPFVTHFTGCQP  391

Query  325  CSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  161
            CSGDHN+MY G+TC + M KA+NFADNQV+R YGF+H DL  T+ + P+P+D+P+
Sbjct  392  CSGDHNKMYDGDTCWNGMIKAINFADNQVMRKYGFVHSDLGKTSPLQPVPFDYPD  446



>ref|XP_006294199.1| hypothetical protein CARUB_v10023195mg [Capsella rubella]
 gb|EOA27097.1| hypothetical protein CARUB_v10023195mg [Capsella rubella]
Length=452

 Score =   211 bits (537),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 102/175 (58%), Positives = 130/175 (74%), Gaps = 3/175 (2%)
 Frame = -3

Query  682  WGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNI  503
            WG   R  FKDK+FPESDDQ+ LIYL+ K +E++  KIY+E DYYFEGYW+EIV  L N+
Sbjct  277  WGQIQRSIFKDKLFPESDDQTALIYLLYKHREEYYPKIYLEGDYYFEGYWLEIVPGLANV  336

Query  502  TDMYLGIEKTAAGEKLRRRHAEKVSESYAE-KWKEHLRNAGQGRSGWRRPFITHFTGCQP  326
            T+ YL +E+  A   LRRRHAEKVSE YA  + K  L+    G+   RRPF+THFTGCQP
Sbjct  337  TERYLEMEREDA--TLRRRHAEKVSERYAAFREKRFLKGERGGKGSKRRPFVTHFTGCQP  394

Query  325  CSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  161
            CSGDHN+MY G+TC + M KA+NFADNQV+R YGF+H DL  T+ +  +P+D+P+
Sbjct  395  CSGDHNKMYDGDTCWNGMIKAINFADNQVMRKYGFVHSDLGKTSPLQHVPFDYPD  449



>ref|NP_001105164.1| alpha-6-galactosyltransferase [Zea mays]
 emb|CAI11455.1| alpha-6-galactosyltransferase [Zea mays]
 gb|ACF82483.1| unknown [Zea mays]
 gb|AFW63649.1| hypothetical protein ZEAMMB73_992521 [Zea mays]
Length=444

 Score =   209 bits (533),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 124/177 (70%), Gaps = 4/177 (2%)
 Frame = -3

Query  685  HWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDN  506
            HWG  L+ TFKDK+F ESDDQS L+Y++L+E  +W +K+++ES YYFEGYW+EIVG+L N
Sbjct  263  HWGAVLKSTFKDKVFDESDDQSALVYMLLQEGSRWRDKVFLESGYYFEGYWMEIVGRLAN  322

Query  505  ITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAG---QGRSGWRRPFITHFTG  335
            +T+ Y  +E+      LRRRHAE+    YA      L  AG    G  GWRRPF+THFTG
Sbjct  323  MTERYEAMERRPGAAALRRRHAEREHAEYAVARNAALGGAGLAETGVHGWRRPFVTHFTG  382

Query  334  CQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            CQPCSG  NE YSG++C   M +ALNFAD+QVLR YGF H   L +  V PLP+D+P
Sbjct  383  CQPCSGQRNEHYSGDSCDQGMRRALNFADDQVLRAYGFRHASSL-SDDVQPLPFDYP  438



>gb|ACH58908.1| galactosyl transferase [Coffea canephora]
Length=444

 Score =   209 bits (532),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 100/175 (57%), Positives = 125/175 (71%), Gaps = 3/175 (2%)
 Frame = -3

Query  685  HWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDN  506
            +W  TL  T  DK+ P +D+QS L+YL+L+E++KWG+  Y+E+ YY  GYWV IVG+L++
Sbjct  264  YWSETLMSTLSDKVIPGADEQSSLVYLLLREKKKWGDMTYLENQYYLHGYWVAIVGRLND  323

Query  505  ITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQ-GRSGWRRPFITHFTGCQ  329
            I   YL  E  A    LRRR AE VSES    W+++LR+AG  G SGWRRPFITHFTGCQ
Sbjct  324  IIKKYLDTE--AKVPVLRRRVAEVVSESLDGVWEKYLRDAGGFGNSGWRRPFITHFTGCQ  381

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            PC+G  +  Y G  C  AM KALNFADNQVLR YGFMH DL + +SV P+P+DFP
Sbjct  382  PCTGKRDPAYKGNACWVAMEKALNFADNQVLRRYGFMHPDLGNGSSVSPVPFDFP  436



>emb|CAI11453.1| alpha-6-galactosyltransferase [Nicotiana benthamiana]
Length=443

 Score =   209 bits (531),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 120/173 (69%), Gaps = 2/173 (1%)
 Frame = -3

Query  682  WGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNI  503
            WG  LR TFKDK FPESDDQS L Y+I+K +EKW +KI+  +DY   GYW+ IV + DNI
Sbjct  265  WGKILRSTFKDKTFPESDDQSALSYVIMKGEEKWRSKIHAITDYSLHGYWLGIVDRFDNI  324

Query  502  TDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPC  323
            T  Y  I++     KLRRRHAE VSESYA   +  +   G  + GWRRPFITHFTGCQPC
Sbjct  325  TGNYEKIDRDVP--KLRRRHAESVSESYAAAREPLVAEGGDWKGGWRRPFITHFTGCQPC  382

Query  322  SGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            SGDH   Y G+ C   M +ALNFADNQVLRN+GFMH D+   + V P+ +DFP
Sbjct  383  SGDHVSEYVGDKCWVGMERALNFADNQVLRNFGFMHVDIKSNSPVTPVNFDFP  435



>ref|XP_009761596.1| PREDICTED: glycosyltransferase 6-like [Nicotiana sylvestris]
Length=443

 Score =   207 bits (528),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/174 (57%), Positives = 119/174 (68%), Gaps = 2/174 (1%)
 Frame = -3

Query  685  HWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDN  506
             WG  LR TFKDK FPESDDQS L Y+I+K +EKW  KI+  +DY   GYW+ IV + DN
Sbjct  264  QWGKILRTTFKDKTFPESDDQSALSYIIMKGEEKWRRKIHAITDYSLHGYWLGIVDRFDN  323

Query  505  ITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQP  326
            IT  Y+ I++     KLRRRHAE VSESYA   +  +      + GWRRPFITHFTGCQP
Sbjct  324  ITGNYVKIDRDVP--KLRRRHAEAVSESYAAAREPLVAEGSDWKGGWRRPFITHFTGCQP  381

Query  325  CSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            CSGDH   Y G+ C   M +ALNFADNQVLRN+GFMH D+   + V P+ +DFP
Sbjct  382  CSGDHAAEYVGDKCWVGMERALNFADNQVLRNFGFMHDDIKSNSPVSPVNFDFP  435



>gb|KHN20359.1| Galactomannan galactosyltransferase 1 [Glycine soja]
Length=268

 Score =   201 bits (512),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 96/176 (55%), Positives = 129/176 (73%), Gaps = 8/176 (5%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            + WG TL+ TFKDK+ P+SDDQ+ L YLI  E+ KW +KI++ES+YYF+GYW+EI     
Sbjct  99   EKWGETLKSTFKDKVLPDSDDQTALAYLIAVEK-KWADKIFLESEYYFQGYWLEISKTYY  157

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
            N+++ Y  +E+   G  LRRRHAEKVSESY    +E+L + G+    W+RPFITHFTGCQ
Sbjct  158  NVSERYDEVERKVKG--LRRRHAEKVSESYGLMREEYLNDVGE----WKRPFITHFTGCQ  211

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  161
            PC+G HN  Y    C ++M +ALNFADNQVLR YG+M +DLL+ A + P+P+D+PN
Sbjct  212  PCNGHHNPAYDAMDCWNSMERALNFADNQVLRVYGYMRKDLLNKA-ISPIPFDYPN  266



>ref|XP_002513422.1| transferase, putative [Ricinus communis]
 gb|EEF48825.1| transferase, putative [Ricinus communis]
Length=424

 Score =   204 bits (520),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/170 (55%), Positives = 125/170 (74%), Gaps = 5/170 (3%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            + WG   R  FKDK+ PE+DDQ+ LIYL+LKE+EKWG+KIY+E +Y  + YW+++V   D
Sbjct  258  ESWGQIQRSKFKDKMIPEADDQAALIYLLLKEKEKWGDKIYIEEEYDLQKYWLDVVDAYD  317

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
            NIT  YL I++      LRRRHAEKVSE Y   W+++L+     +   RRP ITHFTGC+
Sbjct  318  NITRGYLEIKREVPS--LRRRHAEKVSEKYGASWEQYLKAKSSFQ---RRPLITHFTGCE  372

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPL  179
            PCSG+HN  YS ++C + M KALNFADNQVL NYGF+H++L+D++SV PL
Sbjct  373  PCSGNHNPAYSWDSCFNGMRKALNFADNQVLLNYGFLHQNLVDSSSVSPL  422



>ref|XP_009345079.1| PREDICTED: putative glycosyltransferase 7 [Pyrus x bretschneideri]
Length=442

 Score =   205 bits (521),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/176 (53%), Positives = 127/176 (72%), Gaps = 2/176 (1%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            + WG   +   KDK +P SDDQS L+YL++KE+ +W  KIY+ES+YY  GYW+ IV  LD
Sbjct  268  EKWGKIQKSLIKDKAYPGSDDQSALVYLLIKEKSRWAAKIYLESEYYLHGYWLGIVDGLD  327

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
             I+  Y+ I++    + LRRRHAEKVS  Y +  ++++R  G  R   RRPF+THFTGC+
Sbjct  328  GISKGYMEIDREV--DLLRRRHAEKVSLFYGQMREKYMRERGIWRENKRRPFVTHFTGCE  385

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  161
            PCSG+HN MY+ E C + M KALNFADNQVLR +GF+H DLL+++ V PLP+DFP+
Sbjct  386  PCSGEHNGMYTWEACWNGMQKALNFADNQVLRRFGFVHPDLLNSSLVSPLPFDFPD  441



>ref|XP_010432039.1| PREDICTED: glycosyltransferase 6 [Camelina sativa]
Length=429

 Score =   204 bits (518),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 128/175 (73%), Gaps = 3/175 (2%)
 Frame = -3

Query  682  WGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNI  503
            WG   R  FKDK+FPESDDQ+ LIYL+ K +E +  KIY+E++YYF+GYW+ +VG   N+
Sbjct  254  WGPIQRSIFKDKLFPESDDQTALIYLLYKHKELYYPKIYLEAEYYFQGYWIGVVGGFANV  313

Query  502  TDMYLGIEKTAAGEKLRRRHAEKVSESY-AEKWKEHLRNAGQGRSGWRRPFITHFTGCQP  326
            T+ YL +E+    + LRRRHAEKVSE Y A + +  L+    GR   RR F+THFTGCQP
Sbjct  314  TERYLEMERQ--DDTLRRRHAEKVSERYGAFREERFLKGEFGGRGSRRRAFVTHFTGCQP  371

Query  325  CSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  161
            CSGDHN +Y G+TC + M +ALNFADNQV+R YG++H DL  T+ + PLP+D+PN
Sbjct  372  CSGDHNPIYHGDTCWNEMIRALNFADNQVMRVYGYVHSDLSKTSPLQPLPFDYPN  426



>ref|XP_010437192.1| PREDICTED: glycosyltransferase 6-like [Camelina sativa]
Length=429

 Score =   204 bits (518),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 128/175 (73%), Gaps = 3/175 (2%)
 Frame = -3

Query  682  WGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNI  503
            WG   R  FKDK+FPESDDQ+ LIYL+ K +E +  KIY+E++YYF+GYW+ +VG   N+
Sbjct  254  WGPIQRSIFKDKLFPESDDQTALIYLLYKHKELYYPKIYLEAEYYFQGYWIGVVGGFANV  313

Query  502  TDMYLGIEKTAAGEKLRRRHAEKVSESY-AEKWKEHLRNAGQGRSGWRRPFITHFTGCQP  326
            T+ YL +E+    + LRRRHAEKVSE Y A + +  L+    GR   RR F+THFTGCQP
Sbjct  314  TERYLEMERQ--DDTLRRRHAEKVSERYGAFREERFLKGEFGGRDSRRRAFVTHFTGCQP  371

Query  325  CSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  161
            CSGDHN +Y G+TC + M +ALNFADNQV+R YG++H DL  T+ + PLP+D+PN
Sbjct  372  CSGDHNPIYHGDTCWNEMIRALNFADNQVMRVYGYVHSDLSKTSPLQPLPFDYPN  426



>emb|CAD98924.1| galactomannan galactosyltransferase [Lotus japonicus]
Length=437

 Score =   203 bits (517),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 98/173 (57%), Positives = 122/173 (71%), Gaps = 7/173 (4%)
 Frame = -3

Query  682  WGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNI  503
            WG  L  TFKDK+ P+SDDQ+ L YLI   ++KW  KIY+E DYYFEGYWVE+    +N+
Sbjct  270  WGEKLMATFKDKVIPDSDDQTALAYLIAMGEDKWTEKIYLEKDYYFEGYWVELAKMYENV  329

Query  502  TDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPC  323
            +  Y  +E+   G  LRRRHAEKVSE Y E  +EH++  GQ    WRRPFITHFTGCQPC
Sbjct  330  SVRYDEVERRVGG--LRRRHAEKVSERYGEMREEHVKYFGQ----WRRPFITHFTGCQPC  383

Query  322  SGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            +G HN  Y+ + C + M +ALNFADNQVLR YG++ R L D A V P+PYD+P
Sbjct  384  NGHHNPAYAADDCWNGMDRALNFADNQVLRTYGYVRRSLNDKA-VTPIPYDYP  435



>ref|XP_008806204.1| PREDICTED: galactomannan galactosyltransferase 1-like [Phoenix 
dactylifera]
Length=469

 Score =   204 bits (519),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 127/176 (72%), Gaps = 5/176 (3%)
 Frame = -3

Query  685  HWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDN  506
             WG  L+  FK K+F ESDDQS L++++++E++ W +KI++E  +YFEGYW+EI+G+L+ 
Sbjct  295  QWGQRLKNEFKGKVFAESDDQSALVHILIRERDLWADKIFLEDSFYFEGYWLEIIGRLEK  354

Query  505  ITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAG--QGRSGWRRPFITHFTGC  332
            +++MYL +E+      LRRRHAEKV+  Y       L   G   G +GWRRPF+THFTGC
Sbjct  355  MSEMYLALERNVP--PLRRRHAEKVAAVYGRMRDGELERQGAETGPAGWRRPFMTHFTGC  412

Query  331  QPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            QPCSGDHN+ YSGE C   M +ALNFAD+QV+R YGF H + L++  V PLP+D+P
Sbjct  413  QPCSGDHNKKYSGENCYQGMLRALNFADDQVMRVYGFKHTE-LESYGVTPLPFDYP  467



>ref|XP_008392336.1| PREDICTED: putative glycosyltransferase 7 [Malus domestica]
Length=442

 Score =   203 bits (517),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 96/175 (55%), Positives = 126/175 (72%), Gaps = 2/175 (1%)
 Frame = -3

Query  685  HWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDN  506
            +WG   +   KDK +P SDDQS LIYL++KE+ KW +KIY+ES Y   GYW+ IV  LD 
Sbjct  269  NWGKIQKSLIKDKAYPGSDDQSALIYLLIKEKSKWADKIYLESXYNLHGYWLGIVDGLDG  328

Query  505  ITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQP  326
            I+  YL I++    + LRRRHAEKVS  Y +  ++++R  G  R   RRPF+THFTGC+P
Sbjct  329  ISKGYLEIDREV--DLLRRRHAEKVSLFYGQMREKYMRXRGIWRENKRRPFVTHFTGCEP  386

Query  325  CSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  161
            CSG+HN MY+ E C + M KALNFADNQVLR +GF+H DLL+++ V PLP+DFP+
Sbjct  387  CSGEHNGMYTWEACWNGMQKALNFADNQVLRRFGFVHPDLLNSSWVSPLPFDFPD  441



>ref|XP_008363062.1| PREDICTED: glycosyltransferase 6-like [Malus domestica]
Length=442

 Score =   203 bits (517),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 96/175 (55%), Positives = 126/175 (72%), Gaps = 2/175 (1%)
 Frame = -3

Query  685  HWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDN  506
            +WG   +   KDK +P SDDQS LIYL++KE+ KW +KIY+ES Y   GYW+ IV  LD 
Sbjct  269  NWGKIQKSLIKDKAYPGSDDQSALIYLLIKEKSKWADKIYLESXYNLHGYWLGIVDGLDG  328

Query  505  ITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQP  326
            I+  YL I++    + LRRRHAEKVS  Y +  ++++R  G  R   RRPF+THFTGC+P
Sbjct  329  ISKGYLEIDREV--DLLRRRHAEKVSLFYGQMREKYMRXRGIWRENKRRPFVTHFTGCEP  386

Query  325  CSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  161
            CSG+HN MY+ E C + M KALNFADNQVLR +GF+H DLL+++ V PLP+DFP+
Sbjct  387  CSGEHNGMYTWEACWNGMQKALNFADNQVLRRFGFVHPDLLNSSWVSPLPFDFPD  441



>gb|KDP25125.1| hypothetical protein JCGZ_22660 [Jatropha curcas]
Length=432

 Score =   202 bits (515),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/170 (55%), Positives = 125/170 (74%), Gaps = 5/170 (3%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            D WG   R TFKDK+ PE+DDQ+ L+YL+LKE+EKWG+KIY+E DY  + YW+E V   D
Sbjct  266  DKWGQIQRSTFKDKMIPEADDQAALVYLLLKEKEKWGDKIYIEEDYDLQTYWLEAVQDYD  325

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
             IT  Y+ IE+  +   LRR+HAEKVSESY    +++++     R   +RP ITHFTGC+
Sbjct  326  KITQDYMEIERKVSS--LRRKHAEKVSESYGASREQYIKVKNNFR---KRPLITHFTGCE  380

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPL  179
            PC+G+HN +YS E C + + +ALNFADNQVL+NYGF+H++LLD +SV PL
Sbjct  381  PCTGNHNPVYSWEDCLNGIQRALNFADNQVLQNYGFLHQNLLDFSSVSPL  430



>ref|XP_004294205.1| PREDICTED: galactomannan galactosyltransferase 1-like [Fragaria 
vesca subsp. vesca]
Length=434

 Score =   202 bits (515),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 127/175 (73%), Gaps = 3/175 (2%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            + WG   R   KDK++P SDDQS LIYL+LK+++KWG+K+Y+ESD  F+ YW+ +V  LD
Sbjct  262  EKWGEIQRSMLKDKLYPGSDDQSALIYLLLKQKQKWGDKVYLESDN-FQSYWLGVVDGLD  320

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
            NIT  Y  +++     KLRRRH EKVSE Y E  ++++++ G  R   RRPF+THFTGC+
Sbjct  321  NITKGYTEVDREMG--KLRRRHGEKVSELYGEMREQYMKDKGMWRENVRRPFVTHFTGCE  378

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            PCSGD N  Y+ E C   M KALN+ADNQVLR YGF+H DLL+++ V PLP+D+P
Sbjct  379  PCSGDCNPDYTWEDCWKGMQKALNYADNQVLRKYGFVHPDLLNSSLVTPLPFDYP  433



>ref|XP_006411860.1| hypothetical protein EUTSA_v10027092mg, partial [Eutrema salsugineum]
 gb|ESQ53313.1| hypothetical protein EUTSA_v10027092mg, partial [Eutrema salsugineum]
Length=440

 Score =   202 bits (513),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 126/175 (72%), Gaps = 3/175 (2%)
 Frame = -3

Query  682  WGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNI  503
            WG   R  FKDK+FPESDDQ+ LIYL+ K +E +  KIY+E +YY +GYW+ +VG L N+
Sbjct  265  WGPIQRSIFKDKLFPESDDQTALIYLLYKHKEVYYPKIYLEGEYYLQGYWIGVVGGLANV  324

Query  502  TDMYLGIEKTAAGEKLRRRHAEKVSESY-AEKWKEHLRNAGQGRSGWRRPFITHFTGCQP  326
            T+ YL +E+  A   LRRRHAEKVSE Y A + +  LR    GR   RR F+THFTGCQP
Sbjct  325  TERYLEMERDDA--TLRRRHAEKVSERYGAFREERFLRGEFGGRGSRRRAFVTHFTGCQP  382

Query  325  CSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  161
            CSGDHN +Y G+TC   M +ALNFADNQV+R YG++H DL  T+ + P+P+D+P+
Sbjct  383  CSGDHNPIYDGDTCWKEMIRALNFADNQVMRTYGYVHSDLSKTSPLQPVPFDYPD  437



>ref|NP_001281283.1| putative glycosyltransferase 7 [Malus domestica]
 gb|ADL36662.1| CAMTA domain class transcription factor [Malus domestica]
Length=442

 Score =   202 bits (513),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/176 (53%), Positives = 126/176 (72%), Gaps = 2/176 (1%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            + WG   +   KDK +P SDDQS LIYL++KE+ +W  KIY+ES+Y   GYW+ IV  LD
Sbjct  268  EKWGKIQKSLIKDKAYPGSDDQSALIYLLIKEKSRWAAKIYLESEYNLHGYWLGIVDGLD  327

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
             I+  Y+ +++    + LRRRHAEKVS  Y +  ++++R  G  R   RRPF+THFTGC+
Sbjct  328  GISKGYMEVDREV--DLLRRRHAEKVSLFYGQMREKYMRERGIWRENKRRPFVTHFTGCE  385

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  161
            PCSG+HN MY+ E C + M KALNFADNQVLR +GF+H DLL+++ V PLP+DFP+
Sbjct  386  PCSGEHNGMYTWEACWNGMQKALNFADNQVLRRFGFVHPDLLNSSLVSPLPFDFPD  441



>ref|XP_003525869.1| PREDICTED: galactomannan galactosyltransferase 1-like [Glycine 
max]
Length=428

 Score =   201 bits (511),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 127/174 (73%), Gaps = 8/174 (5%)
 Frame = -3

Query  682  WGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNI  503
            WG TL+ TFKDK+ P+SDDQ+ L YLI  E  KW +KI++ES+YYF+GYW+EI     N+
Sbjct  261  WGETLKSTFKDKVLPDSDDQTALAYLIAVEN-KWADKIFLESEYYFQGYWLEISKTYYNV  319

Query  502  TDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPC  323
            ++ Y  +E+   G  LRRRHAEKVSESY    +E+L + G+    W+RPFITHFTGCQPC
Sbjct  320  SERYDEVERKVKG--LRRRHAEKVSESYGLMREEYLNDVGE----WKRPFITHFTGCQPC  373

Query  322  SGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  161
            +G HN  Y    C ++M +ALNFADNQVLR YG+M +DLL+ A + P+P+D+PN
Sbjct  374  NGHHNPAYDAMDCWNSMERALNFADNQVLRVYGYMRKDLLNKA-ISPIPFDYPN  426



>ref|XP_010028081.1| PREDICTED: putative glycosyltransferase 7 [Eucalyptus grandis]
 gb|KCW54740.1| hypothetical protein EUGRSUZ_I00693 [Eucalyptus grandis]
Length=460

 Score =   201 bits (512),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 98/175 (56%), Positives = 128/175 (73%), Gaps = 8/175 (5%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            + WG+ LR TF DK+FP+SDDQS LIYL+L +++++G+KIYVE++YYFEGYW  IVG L 
Sbjct  276  ERWGHVLRSTFADKLFPDSDDQSALIYLLLTQKDRYGDKIYVENEYYFEGYWEGIVGTLP  335

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
            NIT  Y  +++      LRRRHAEK S  YA +  E      +       PF+THFTGCQ
Sbjct  336  NITREYEDMDRQGP-PALRRRHAEKASRHYAARRAEAGAARKR-------PFVTHFTGCQ  387

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            PCSG+HN+MYSGE+C + M KALNFADNQVLR YG++  DL+D+A V P+P+D+P
Sbjct  388  PCSGNHNQMYSGESCWNGMVKALNFADNQVLRRYGYVRPDLMDSAVVKPIPFDYP  442



>ref|XP_010446636.1| PREDICTED: LOW QUALITY PROTEIN: glycosyltransferase 6 [Camelina 
sativa]
Length=428

 Score =   201 bits (510),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 130/175 (74%), Gaps = 4/175 (2%)
 Frame = -3

Query  682  WGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNI  503
            WG  ++R+ KDK+FPESDDQ+ LIYL+ K +E +  KIY+E++YYF+GYW+ +VG   N+
Sbjct  254  WG-PIQRSXKDKLFPESDDQTALIYLLYKHKELYYPKIYLEAEYYFQGYWIGVVGGFANV  312

Query  502  TDMYLGIEKTAAGEKLRRRHAEKVSESY-AEKWKEHLRNAGQGRSGWRRPFITHFTGCQP  326
            T+ YL +E+    + LRRRHAEKVSE Y A + +  L+    GR   RR F+THFTGCQP
Sbjct  313  TERYLEMER--QDDTLRRRHAEKVSERYGAFREERFLKGEFGGRGSRRRAFVTHFTGCQP  370

Query  325  CSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  161
            CSGDHN +Y G+TC D M +ALNFADNQV+R YG++H DL  T+ + PLP+D+PN
Sbjct  371  CSGDHNPIYRGDTCWDEMIRALNFADNQVMRVYGYVHSDLSMTSPLQPLPFDYPN  425



>ref|XP_009361779.1| PREDICTED: glycosyltransferase 6-like [Pyrus x bretschneideri]
Length=442

 Score =   201 bits (511),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 126/175 (72%), Gaps = 2/175 (1%)
 Frame = -3

Query  685  HWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDN  506
            +WG   +   KDK +P SDDQS LIYL++KE+ KW +KIY+ES+Y   GYW+ IV  LD 
Sbjct  269  NWGKIQKSLIKDKAYPGSDDQSALIYLLIKEKAKWADKIYLESEYNLHGYWLGIVDGLDG  328

Query  505  ITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQP  326
            I+  Y+ I++    + LRRRHAEKVS  Y +  ++++R  G  R   RRPF+THFTGC+P
Sbjct  329  ISKGYMEIDREV--DLLRRRHAEKVSLFYGQMREKYMREKGIWRENKRRPFVTHFTGCEP  386

Query  325  CSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  161
            CSG+HN MY+ E C + M KALNFADNQVL  +GF+H DLL+++ V PLP+DFP+
Sbjct  387  CSGEHNGMYTWEACWNGMQKALNFADNQVLIRFGFLHPDLLNSSWVSPLPFDFPD  441



>ref|XP_008226081.1| PREDICTED: putative glycosyltransferase 7 [Prunus mume]
Length=439

 Score =   199 bits (507),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/175 (52%), Positives = 126/175 (72%), Gaps = 2/175 (1%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            + WG   +   KDK +P SDDQS LIYL++KE+++W +KIY+ES+Y   GYW+ IV  LD
Sbjct  266  EKWGKAQKSLIKDKAYPGSDDQSALIYLLIKEKDRWADKIYLESEYNLHGYWLGIVDGLD  325

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
             I+  Y+ I++    + LRRRHAEK+S  Y    ++H+++ G  +   RRPF+THFTGC+
Sbjct  326  KISKGYMEIDREV--DLLRRRHAEKMSLFYGAMREKHMKDRGFWKENVRRPFVTHFTGCE  383

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            PCSG+HN MY+ E C + M KALNFADNQVL  +GF+H DLL+++ V PLP+DFP
Sbjct  384  PCSGEHNSMYTWEACWNGMQKALNFADNQVLSRFGFVHPDLLNSSLVSPLPFDFP  438



>ref|NP_680773.1| glycosyltransferase 6 [Arabidopsis thaliana]
 sp|Q9SZG1.1|GT6_ARATH RecName: Full=Glycosyltransferase 6; Short=AtGT6 [Arabidopsis 
thaliana]
 emb|CAB38308.1| putative protein [Arabidopsis thaliana]
 emb|CAB80434.1| putative protein [Arabidopsis thaliana]
 gb|ABH04623.1| At4g37690 [Arabidopsis thaliana]
 gb|AEE86828.1| glycosyltransferase 6 [Arabidopsis thaliana]
 gb|AHL38658.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=432

 Score =   199 bits (506),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/175 (55%), Positives = 125/175 (71%), Gaps = 3/175 (2%)
 Frame = -3

Query  682  WGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNI  503
            WG   R  FKDK+FPESDDQ+ LIYL+ K +E +  KIY+E++YY +GYW+ + G   N+
Sbjct  257  WGPIQRSIFKDKLFPESDDQTALIYLLYKHKELYYPKIYLEAEYYLQGYWIGVFGDFANV  316

Query  502  TDMYLGIEKTAAGEKLRRRHAEKVSESY-AEKWKEHLRNAGQGRSGWRRPFITHFTGCQP  326
            T+ YL +E+    + LRRRHAEKVSE Y A + +  L+    GR   RR FITHFTGCQP
Sbjct  317  TERYLEMER--EDDTLRRRHAEKVSERYGAFREERFLKGEFGGRGSRRRAFITHFTGCQP  374

Query  325  CSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  161
            CSGDHN  Y G+TC + M +ALNFADNQV+R YG++H DL  T+ + PLP+D+PN
Sbjct  375  CSGDHNPSYDGDTCWNEMIRALNFADNQVMRVYGYVHSDLSKTSPLQPLPFDYPN  429



>ref|XP_007211970.1| hypothetical protein PRUPE_ppa006622mg [Prunus persica]
 gb|EMJ13169.1| hypothetical protein PRUPE_ppa006622mg [Prunus persica]
Length=402

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 126/175 (72%), Gaps = 2/175 (1%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            + WG   +   KDK +P SDDQS LIYL++KE+++W ++IY+ES+Y   GYW+ IV  LD
Sbjct  229  EKWGKAQKSLIKDKAYPGSDDQSALIYLLIKEKDRWADRIYLESEYNLHGYWLGIVDGLD  288

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
             I+  Y+ I++    + LRRRHAEK+S  Y    ++H+++ G  +   RRPF+THFTGC+
Sbjct  289  KISKGYMEIDREV--DLLRRRHAEKMSLFYGAMREKHMKDRGFWKENVRRPFVTHFTGCE  346

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            PCSG+HN MY+ E C + M KALNFADNQVL  +GF+H DLL+++ V PLP+DFP
Sbjct  347  PCSGEHNSMYTWEACWNGMQKALNFADNQVLSRFGFVHPDLLNSSLVSPLPFDFP  401



>ref|XP_010939020.1| PREDICTED: LOW QUALITY PROTEIN: galactomannan galactosyltransferase 
1-like [Elaeis guineensis]
Length=470

 Score =   199 bits (507),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 94/177 (53%), Positives = 126/177 (71%), Gaps = 5/177 (3%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            + WG+ L+  FKDK+F ESDDQS L++L+  E+++W +K+++E  +YFEGYW+EIVG+  
Sbjct  294  EQWGHRLKNEFKDKLFVESDDQSALVHLLNAERDRWADKVFLEDAFYFEGYWIEIVGRFG  353

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAG--QGRSGWRRPFITHFTG  335
            N+T+ YL +E+      LRRRHAEKV+  Y       L   G   G +GWRRPF+THFTG
Sbjct  354  NMTEKYLAMERKVP--PLRRRHAEKVAGVYGRMRDGELEREGAETGPTGWRRPFMTHFTG  411

Query  334  CQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            CQPCSGDHN+ YSGE C + M +ALNFAD+QV R+YGF H + L    V PLP+D+P
Sbjct  412  CQPCSGDHNKKYSGENCYEGMLRALNFADDQVSRDYGFRHTE-LGGYDVKPLPFDYP  467



>ref|XP_009138524.1| PREDICTED: glycosyltransferase 6 [Brassica rapa]
Length=438

 Score =   197 bits (502),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 98/178 (55%), Positives = 128/178 (72%), Gaps = 4/178 (2%)
 Frame = -3

Query  682  WGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKL-DN  506
            WG   R  FKDK+FPESDDQ+ LIYL+ K +E +  KIY+E++YYF+GYW+ +VG    N
Sbjct  262  WGPIQRSIFKDKLFPESDDQTALIYLLYKHKEVYYPKIYLEAEYYFQGYWIGVVGGFFAN  321

Query  505  ITDMYLGIEKTAAGEKLRRRHAEKVSESY-AEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
            +T+ YL +E+  A   LRRRHAEKVSE Y A + +  L+    GR   RR F+THFTGCQ
Sbjct  322  VTERYLEMEREDA--TLRRRHAEKVSERYGAFREERFLKGEFGGRGSRRRAFVTHFTGCQ  379

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN*T  155
            PCSGDHN  Y G+TC + M +ALNFADNQV+R YG++H DL  T+ + PLP+D+P+ T
Sbjct  380  PCSGDHNPSYDGDTCWNEMIRALNFADNQVMRAYGYVHTDLSKTSPLQPLPFDYPDET  437



>emb|CDY29577.1| BnaA03g54220D [Brassica napus]
Length=438

 Score =   197 bits (502),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 98/178 (55%), Positives = 128/178 (72%), Gaps = 4/178 (2%)
 Frame = -3

Query  682  WGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKL-DN  506
            WG   R  FKDK+FPESDDQ+ LIYL+ K +E +  KIY+E++YYF+GYW+ +VG    N
Sbjct  262  WGPIQRSIFKDKLFPESDDQTALIYLLYKHKEVYYPKIYLEAEYYFQGYWIGVVGGFFAN  321

Query  505  ITDMYLGIEKTAAGEKLRRRHAEKVSESY-AEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
            +T+ YL +E+  A   LRRRHAEKVSE Y A + +  L+    GR   RR F+THFTGCQ
Sbjct  322  VTERYLEMEREDA--TLRRRHAEKVSERYGAFREERFLKGEFGGRGSRRRAFVTHFTGCQ  379

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN*T  155
            PCSGDHN  Y G+TC + M +ALNFADNQV+R YG++H DL  T+ + PLP+D+P+ T
Sbjct  380  PCSGDHNPSYDGDTCWNEMIRALNFADNQVMRAYGYVHTDLSKTSPLQPLPFDYPDET  437



>emb|CAI11454.1| alpha-6-galactosyltransferase [Medicago truncatula]
 gb|AES90738.2| galactosyl transferase GMA12/MNN10 family protein [Medicago truncatula]
Length=438

 Score =   197 bits (502),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 98/175 (56%), Positives = 123/175 (70%), Gaps = 7/175 (4%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            + WG  LR TFK K+ P+SDDQ+ L YLI   ++KW  KIY+E++YYFEGYW+EI    D
Sbjct  267  EKWGERLRATFKTKVVPDSDDQTALAYLIAMGEDKWTKKIYMENEYYFEGYWMEISKMYD  326

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
             +   Y  IEK   G  LRRRHAEKVSE Y E  +E+++N G  R    RPFITHFTGCQ
Sbjct  327  KMGKKYDEIEKRVEG--LRRRHAEKVSERYGEMREEYVKNLGDMR----RPFITHFTGCQ  380

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            PC+G HN MY+ + C + M +ALNFADNQVLR +GF+H +LLD  SV PLP+ +P
Sbjct  381  PCNGHHNPMYAADDCWNGMERALNFADNQVLRKFGFIHPNLLD-KSVSPLPFGYP  434



>ref|XP_003608541.1| Alpha-6-galactosyltransferase [Medicago truncatula]
Length=462

 Score =   197 bits (502),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 98/175 (56%), Positives = 123/175 (70%), Gaps = 7/175 (4%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            + WG  LR TFK K+ P+SDDQ+ L YLI   ++KW  KIY+E++YYFEGYW+EI    D
Sbjct  267  EKWGERLRATFKTKVVPDSDDQTALAYLIAMGEDKWTKKIYMENEYYFEGYWMEISKMYD  326

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
             +   Y  IEK   G  LRRRHAEKVSE Y E  +E+++N G  R    RPFITHFTGCQ
Sbjct  327  KMGKKYDEIEKRVEG--LRRRHAEKVSERYGEMREEYVKNLGDMR----RPFITHFTGCQ  380

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            PC+G HN MY+ + C + M +ALNFADNQVLR +GF+H +LLD  SV PLP+ +P
Sbjct  381  PCNGHHNPMYAADDCWNGMERALNFADNQVLRKFGFIHPNLLD-KSVSPLPFGYP  434



>gb|KFK30380.1| hypothetical protein AALP_AA7G253700 [Arabis alpina]
Length=439

 Score =   196 bits (498),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 125/175 (71%), Gaps = 3/175 (2%)
 Frame = -3

Query  682  WGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNI  503
            WG   R  FKDK+FPESDDQ+ LIYL+ K ++ + +KIY+E +YY +GYW+ +V    N+
Sbjct  264  WGEIQRSVFKDKLFPESDDQTALIYLLYKHKDVYYDKIYLEGEYYLQGYWIGVVDGFGNV  323

Query  502  TDMYLGIEKTAAGEKLRRRHAEKVSESY-AEKWKEHLRNAGQGRSGWRRPFITHFTGCQP  326
            T+ YL +E+     +LRRRHAEKVSE Y A + +  L+    GR   RR F+THFTGCQP
Sbjct  324  TERYLEMEREDV--RLRRRHAEKVSEGYGAFREERFLKGEFGGRGSRRRAFVTHFTGCQP  381

Query  325  CSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  161
            CSGDHN +Y G+ C + M +ALNF DNQV+R YG++H DL  T+ +VPLP+D+P+
Sbjct  382  CSGDHNPIYDGDKCWNEMIRALNFGDNQVMRVYGYVHSDLSKTSPLVPLPFDYPD  436



>gb|EAY87343.1| hypothetical protein OsI_08746 [Oryza sativa Indica Group]
 gb|EAZ24444.1| hypothetical protein OsJ_08194 [Oryza sativa Japonica Group]
Length=422

 Score =   195 bits (495),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 97/181 (54%), Positives = 123/181 (68%), Gaps = 6/181 (3%)
 Frame = -3

Query  685  HWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDN  506
            HWG  L  TFKDK+F ESDDQS L+Y++L+    W +K+Y+ESDYYFEGYW+EI G+L N
Sbjct  245  HWGAVLTSTFKDKVFNESDDQSALVYMLLQSGSPWRDKVYLESDYYFEGYWLEIAGRLGN  304

Query  505  ITDMYLGIEKTAAGEKLRRRHAEK---VSESYAEKWKEHLRNAGQGRSGWRRPFITHFTG  335
            IT+ Y  +E+ AA   LRRRHAE       +  +        A  G SGWRRPF+THFTG
Sbjct  305  ITERYEAMERGAA--PLRRRHAEAEHASYAAARDAALAGAGLAESGVSGWRRPFVTHFTG  362

Query  334  CQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN*T  155
            CQPCSG  NE Y+G++C + + +AL+FAD+QVLR YGF H   L  A V PLP+D P  T
Sbjct  363  CQPCSGHRNEHYTGKSCDEGIRRALSFADDQVLRAYGFRHAGPLSDA-VSPLPFDHPTQT  421

Query  154  S  152
            +
Sbjct  422  A  422



>emb|CDX72649.1| BnaC07g46710D [Brassica napus]
Length=438

 Score =   195 bits (496),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 97/178 (54%), Positives = 127/178 (71%), Gaps = 4/178 (2%)
 Frame = -3

Query  682  WGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKL-DN  506
            WG   R  FKDK+FPESDDQ+ LIYL+ K +E +  KIY+E++YYF+GYW+ +VG    N
Sbjct  262  WGPIQRSIFKDKLFPESDDQTALIYLLYKHKEVYYPKIYLEAEYYFQGYWIGVVGGFFAN  321

Query  505  ITDMYLGIEKTAAGEKLRRRHAEKVSESY-AEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
            +T+ YL +E+  A   LRRRHAEKVSE Y A + +  L+    GR   RR F+THFTGCQ
Sbjct  322  VTERYLEMEREDA--TLRRRHAEKVSERYGAFREERFLKGEFGGRGSRRRAFVTHFTGCQ  379

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN*T  155
            PCSGDHN  Y G+TC + M +ALNFADNQV+R YG++H DL  T+ + PLP+ +P+ T
Sbjct  380  PCSGDHNPSYDGDTCWNEMIRALNFADNQVMRAYGYVHSDLSKTSPLQPLPFGYPDET  437



>ref|NP_001047970.1| Os02g0723200 [Oryza sativa Japonica Group]
 dbj|BAD13026.1| putative alpha galactosyltransferase [Oryza sativa Japonica Group]
 dbj|BAF09884.1| Os02g0723200 [Oryza sativa Japonica Group]
 dbj|BAG98296.1| unnamed protein product [Oryza sativa Japonica Group]
Length=447

 Score =   195 bits (496),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 97/181 (54%), Positives = 123/181 (68%), Gaps = 6/181 (3%)
 Frame = -3

Query  685  HWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDN  506
            HWG  L  TFKDK+F ESDDQS L+Y++L+    W +K+Y+ESDYYFEGYW+EI G+L N
Sbjct  270  HWGAVLTSTFKDKVFNESDDQSALVYMLLQSGSPWRDKVYLESDYYFEGYWLEIAGRLGN  329

Query  505  ITDMYLGIEKTAAGEKLRRRHAEK---VSESYAEKWKEHLRNAGQGRSGWRRPFITHFTG  335
            IT+ Y  +E+ AA   LRRRHAE       +  +        A  G SGWRRPF+THFTG
Sbjct  330  ITERYEAMERGAA--PLRRRHAEAEHASYAAARDAALAGAGLAESGVSGWRRPFVTHFTG  387

Query  334  CQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN*T  155
            CQPCSG  NE Y+G++C + + +AL+FAD+QVLR YGF H   L  A V PLP+D P  T
Sbjct  388  CQPCSGHRNEHYTGKSCDEGIRRALSFADDQVLRAYGFRHAGPLSDA-VSPLPFDHPTQT  446

Query  154  S  152
            +
Sbjct  447  A  447



>ref|XP_002868971.1| galactosyl transferase GMA12/MNN10 family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH45230.1| galactosyl transferase GMA12/MNN10 family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=436

 Score =   194 bits (492),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 123/175 (70%), Gaps = 3/175 (2%)
 Frame = -3

Query  682  WGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNI  503
            WG   R  FKDK+FPESDDQ+ LIYL+ K +E +  KIY+E +YY +GYW+ +V    N+
Sbjct  261  WGPIQRSIFKDKLFPESDDQTALIYLLYKHKELYYPKIYLEGEYYLQGYWIGVVDGFANV  320

Query  502  TDMYLGIEKTAAGEKLRRRHAEKVSESY-AEKWKEHLRNAGQGRSGWRRPFITHFTGCQP  326
            T+ YL +E+    + LRRRHAEKVSE Y A + +  L+    GR   RR F+THFTGCQP
Sbjct  321  TERYLEMER--EDDTLRRRHAEKVSERYGAFREERFLKGEFGGRGSRRRAFVTHFTGCQP  378

Query  325  CSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  161
            CSGDHN  Y G+TC + + +ALNFADNQV+R YG +H DL  T+ + PLP+D+PN
Sbjct  379  CSGDHNPSYDGDTCWNEIIRALNFADNQVMRVYGHVHSDLSKTSPLQPLPFDYPN  433



>emb|CAB52246.1| alpha galactosyltransferase [Trigonella foenum-graecum]
Length=438

 Score =   193 bits (491),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 96/175 (55%), Positives = 123/175 (70%), Gaps = 7/175 (4%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            + WG  LR TFK K+  +SDDQ+ L YLI   ++KW  KIY+E++YYFEGYW+EI    D
Sbjct  267  EKWGERLRETFKTKVVRDSDDQTALAYLIAMGEDKWTKKIYMENEYYFEGYWLEISKMYD  326

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
             + + Y  IEK   G  LRRRHAEKVSE Y E  +E+++N G  R    RPFITHFTGCQ
Sbjct  327  KMGERYDEIEKRVEG--LRRRHAEKVSERYGEMREEYVKNLGDMR----RPFITHFTGCQ  380

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            PC+G HN +Y+ + C + M +ALNFADNQVLR +GF+H +LLD  SV PLP+ +P
Sbjct  381  PCNGHHNPIYAADDCWNGMERALNFADNQVLRKFGFIHPNLLD-KSVSPLPFGYP  434



>ref|XP_009394626.1| PREDICTED: galactomannan galactosyltransferase 1-like [Musa acuminata 
subsp. malaccensis]
Length=429

 Score =   193 bits (490),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 93/179 (52%), Positives = 125/179 (70%), Gaps = 6/179 (3%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            D WG  L    KDK+F  SDDQS L+YL+LK +++WG+K+++ESDY  E YWV IV +L+
Sbjct  252  DRWGQVLAAELKDKLFNVSDDQSALVYLLLKHRDQWGDKVFLESDYDLEAYWVAIVDRLE  311

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRN---AGQGRSGWRRPFITHFT  338
            N+T  Y  +E+   G  LRRRHAE VS  Y    +E L     A  G +GW RPF+THFT
Sbjct  312  NMTAKYAEVERRVDG--LRRRHAEVVSGGYGRLREEQLATEEGAVSGPNGWHRPFMTHFT  369

Query  337  GCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  161
            GCQPC+G HN+MY+ ++C + M +AL+FAD+QVLR+YGF H D L +  V PLP+D+P+
Sbjct  370  GCQPCNGAHNKMYTWKSCWEGMQRALHFADDQVLRDYGFRHADPL-SGDVEPLPFDYPS  427



>ref|XP_002454367.1| hypothetical protein SORBIDRAFT_04g029500 [Sorghum bicolor]
 gb|EES07343.1| hypothetical protein SORBIDRAFT_04g029500 [Sorghum bicolor]
Length=443

 Score =   193 bits (490),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 93/179 (52%), Positives = 123/179 (69%), Gaps = 7/179 (4%)
 Frame = -3

Query  682  WGNTLRRTFKDKIFPESDDQSGLIYLILKEQE---KWGNKIYVESDYYFEGYWVEIVGKL  512
            WG+ L+ TFKDK+F ESDDQS L+Y++L++++    W +K+++ESDYYFEGYW EIVG+L
Sbjct  260  WGSVLKSTFKDKVFDESDDQSALVYMLLQKEKGSRPWRDKVFLESDYYFEGYWAEIVGRL  319

Query  511  DNITDMYLGIEKTAAGEKLRRRHAEK---VSESYAEKWKEHLRNAGQGRSGWRRPFITHF  341
             N+T+ Y  +E+      LRRRHAE+      +  +        A  G  GWRRPF+THF
Sbjct  320  GNMTERYEAMERRPGAAALRRRHAEREHAEYAAARDAALAGAGLAETGVHGWRRPFVTHF  379

Query  340  TGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            TGCQPCSG  NE YSG++C   M +ALNFAD+QVLR YGF H   L +  V PLP+D+P
Sbjct  380  TGCQPCSGQRNEHYSGDSCDQGMRRALNFADDQVLRAYGFRHAGPL-SDDVEPLPFDYP  437



>gb|ACF33173.1| putative galactomannan galactosyl transferase [Coffea canephora]
Length=447

 Score =   192 bits (489),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 94/176 (53%), Positives = 120/176 (68%), Gaps = 8/176 (5%)
 Frame = -3

Query  682  WGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNI  503
            W  TL  T  DK+FP +D+QS L+YL+L E++KWG+KIY+E+ Y    YWV +VGKLD  
Sbjct  264  WSETLMSTLSDKMFPGADEQSSLVYLLLTEKKKWGDKIYLENQYDLSSYWVGVVGKLDKF  323

Query  502  TDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRN--AGQGRSGWRRPFITHFTGCQ  329
            T      EK      LRRR AE V ES  E W+++L N  A +G+    RPFITHFTGCQ
Sbjct  324  TRTEADAEKNLP--LLRRRRAEVVGESVGEVWEKYLENNTASEGK----RPFITHFTGCQ  377

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  161
            PCSG+H+  Y G TC DAM + LN+ADNQVLRN GF+HRD+   + V+PL +DFP+
Sbjct  378  PCSGNHDPSYVGNTCWDAMERTLNYADNQVLRNLGFVHRDISRGSYVLPLAFDFPS  433



>ref|XP_009362594.1| PREDICTED: glycosyltransferase 6-like [Pyrus x bretschneideri]
Length=422

 Score =   192 bits (487),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/170 (55%), Positives = 120/170 (71%), Gaps = 8/170 (5%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            ++WG  L   FKDK FP  DDQS LIYL+  ++E+WG K Y+E +YY E YW+ +VGK D
Sbjct  261  ENWGRILTSVFKDKPFPLPDDQSALIYLLFTDEERWGKKTYLEWEYYLEAYWIGVVGKYD  320

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
            N T+ Y   E+  +G  LRRRHAEKV+E Y  K + +++    GR   RRPF+THFTGCQ
Sbjct  321  NFTESYAETERNDSG--LRRRHAEKVNEWYGAKRETYIK----GRV--RRPFVTHFTGCQ  372

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPL  179
            PCSG+HN  Y+G++C D M++ALNFADNQVLRNYGF+H DL  +   V L
Sbjct  373  PCSGEHNPQYTGDSCWDEMNRALNFADNQVLRNYGFVHPDLSSSTVSVLL  422



>emb|CDP02618.1| unnamed protein product [Coffea canephora]
Length=447

 Score =   192 bits (488),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 118/176 (67%), Gaps = 8/176 (5%)
 Frame = -3

Query  682  WGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNI  503
            W  TL  T  DK+FP +D+QS L+YL+L E++KWG+KIY+E+ Y    YWV +VGKLD  
Sbjct  264  WSETLMSTLSDKMFPGADEQSSLVYLLLTEKKKWGDKIYLENQYDLSSYWVGVVGKLDKF  323

Query  502  TDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRN--AGQGRSGWRRPFITHFTGCQ  329
            T      EK      LRRR AE VSES  E W+++L N  A +G+    RPFITHFTGCQ
Sbjct  324  TRTEADAEKNLP--LLRRRRAEVVSESVGEVWEKYLENNTASEGK----RPFITHFTGCQ  377

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFPN  161
            PCSG H+  Y G TC DAM + LN+ADNQVLRN GF HRD+   + V PL +DFP+
Sbjct  378  PCSGSHDPSYVGNTCWDAMERTLNYADNQVLRNLGFAHRDISHGSYVSPLAFDFPS  433



>gb|EAY81250.1| hypothetical protein OsI_36429 [Oryza sativa Indica Group]
Length=483

 Score =   192 bits (489),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 95/180 (53%), Positives = 126/180 (70%), Gaps = 8/180 (4%)
 Frame = -3

Query  682  WGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNI  503
            WG+ L  T + K   ESDDQS L+YL+ + +EKWG K Y+E  Y+F+GYWVE+V +LD+I
Sbjct  302  WGSVLHDTLRGKSDKESDDQSALVYLLSEHEEKWGAKTYLEKGYFFQGYWVEVVDRLDDI  361

Query  502  TDMYLGIEK--TAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQG-----RSGWRRPFITH  344
               Y   E+  +AA   LRRRHAE+  E YA      +R A  G     +SGWRRPF+TH
Sbjct  362  AARYEAAERRPSAAAAHLRRRHAEREHERYAAARNAAVRGAVPGPAGGGQSGWRRPFVTH  421

Query  343  FTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            FTGCQPC G+ N++YS ++CAD M++ALNFAD+QVLRNYG+ H+D L +  V PLP+D+P
Sbjct  422  FTGCQPCGGEPNKIYSKKSCADGMNRALNFADDQVLRNYGYRHKDPL-SDEVRPLPFDYP  480



>ref|NP_001068066.1| Os11g0546500 [Oryza sativa Japonica Group]
 gb|ABA94224.1| Glycosyltransferase 6, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF28429.1| Os11g0546500 [Oryza sativa Japonica Group]
Length=483

 Score =   192 bits (489),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 95/180 (53%), Positives = 126/180 (70%), Gaps = 8/180 (4%)
 Frame = -3

Query  682  WGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNI  503
            WG+ L  T + K   ESDDQS L+YL+ + +EKWG K Y+E  Y+F+GYWVE+V +LD+I
Sbjct  302  WGSVLHDTLRGKSDKESDDQSALVYLLSEHEEKWGAKTYLEKGYFFQGYWVEVVDRLDDI  361

Query  502  TDMYLGIEK--TAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQG-----RSGWRRPFITH  344
               Y   E+  +AA   LRRRHAE+  E YA      +R A  G     +SGWRRPF+TH
Sbjct  362  AARYEAAERRPSAAAAHLRRRHAEREHERYAAARNAAVRGAVPGPAGGGQSGWRRPFVTH  421

Query  343  FTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            FTGCQPC G+ N++YS ++CAD M++ALNFAD+QVLRNYG+ H+D L +  V PLP+D+P
Sbjct  422  FTGCQPCGGEPNKIYSKKSCADGMNRALNFADDQVLRNYGYRHKDPL-SDEVRPLPFDYP  480



>ref|XP_006663513.1| PREDICTED: putative glycosyltransferase 7-like [Oryza brachyantha]
Length=332

 Score =   187 bits (475),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 95/180 (53%), Positives = 123/180 (68%), Gaps = 8/180 (4%)
 Frame = -3

Query  682  WGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNI  503
            WGN L  T + K   ESDDQS L+YL+ + +EKWG+K  +E  YYF+GYWVEIV +LD I
Sbjct  151  WGNVLHDTLQGKSDHESDDQSALVYLLSEHEEKWGSKTILELGYYFQGYWVEIVDRLDGI  210

Query  502  TDMYLGIEKT--AAGEKLRRRHAEKVSESYAEKWKEHLRNA-----GQGRSGWRRPFITH  344
               Y   E+   AA + LRRRHAE+    YAE     +R+A     G G++GWRRP +TH
Sbjct  211  AARYESAERRPGAAAKALRRRHAEREHLRYAEARNAAMRSAIPGPAGGGQTGWRRPVMTH  270

Query  343  FTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            FTG QPC G  N++YS ++CAD M++ALNFAD+QVLR YGF H+D L +  V PLP+D+P
Sbjct  271  FTGGQPCGGKPNKIYSKKSCADGMNRALNFADDQVLRAYGFRHKDPL-SDEVRPLPFDYP  329



>ref|XP_010679659.1| PREDICTED: putative glycosyltransferase 7 [Beta vulgaris subsp. 
vulgaris]
Length=431

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 93/170 (55%), Positives = 121/170 (71%), Gaps = 4/170 (2%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            + WG+ L+  F DK++PESDDQ+G+ YL++KE E W +KIY+E DYYFEGYWVEIVG  +
Sbjct  264  EKWGDILKSVFTDKLYPESDDQTGIAYLMVKEGENWKDKIYLEKDYYFEGYWVEIVGNYE  323

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
            N+T  Y  IEK       RRRHAEK  E Y  +W+ +L    +     +RPFITHFTGC+
Sbjct  324  NVTAHYSKIEKKERRL--RRRHAEKAGEDYRAQWEYNLERENEKLM--KRPFITHFTGCE  379

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPL  179
            PCSG HNEMY+ E+C   M+KALNFADNQVLRN+G+   +L +++ V PL
Sbjct  380  PCSGKHNEMYNLESCFKGMNKALNFADNQVLRNFGYFRPNLDNSSWVQPL  429



>sp|Q564G7.1|GMGT1_CYATE RecName: Full=Galactomannan galactosyltransferase 1 [Cyamopsis 
tetragonoloba]
 emb|CAI79402.1| galactomannan galactosyltransferase [Cyamopsis tetragonoloba]
Length=435

 Score =   188 bits (478),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 93/176 (53%), Positives = 123/176 (70%), Gaps = 10/176 (6%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKE-QEKWGNKIYVESDYYFEGYWVEIVGKL  512
            + WG  LR TFKDK+ P+SDDQ+ L YLI  + ++ W  KI++ES+YYFEGYW+EIV   
Sbjct  267  EKWGERLRETFKDKVLPDSDDQTALAYLIATDNKDTWREKIFLESEYYFEGYWLEIVKTY  326

Query  511  DNITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGC  332
            +NI++ Y  +E+   G  LRRRHAEKVSE Y    +E+L++        RRPFITHFTGC
Sbjct  327  ENISERYDEVERKVEG--LRRRHAEKVSEKYGAMREEYLKDNK------RRPFITHFTGC  378

Query  331  QPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            QPC+G HN  Y+   C + M +ALNFADNQ+LR YG+  ++LLD  SV PLP+ +P
Sbjct  379  QPCNGHHNPAYNANDCWNGMERALNFADNQILRTYGYHRQNLLD-KSVSPLPFGYP  433



>dbj|BAK05879.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=427

 Score =   182 bits (461),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 93/180 (52%), Positives = 117/180 (65%), Gaps = 6/180 (3%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            + WG  L  TF+DK+F ESDDQS L+Y++      W  K+++E+ YYF+GYWVEIVG+L 
Sbjct  243  ERWGAVLTSTFRDKLFNESDDQSALVYMLQHRGSPWREKVFLENGYYFQGYWVEIVGRLG  302

Query  508  NITDMYLGIEKTA-AGEKLRRRHAEKVS-ESYAEK---WKEHLRNAGQGRSGWRRPFITH  344
             I   Y  IE+ A A   LRRRHA     E YA+           A  G  GWRRPF+TH
Sbjct  303  GIAARYEAIERRAPAVALLRRRHAASWEHEGYAQAREAALAGAGLAESGVKGWRRPFVTH  362

Query  343  FTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            FTGCQPCSG+ N  YSG++C D M +ALNFAD+QVLR+YGF H   L +  V PLP+D+P
Sbjct  363  FTGCQPCSGNRNRDYSGDSCDDGMRRALNFADDQVLRDYGFRHAGPL-SDDVRPLPFDYP  421



>tpg|DAA64594.1| TPA_inf: putative galacto(gluco)mannan alpha-1,6-galactosyltransferase, 
partial [Pinus taeda]
Length=173

 Score =   174 bits (441),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 117/175 (67%), Gaps = 11/175 (6%)
 Frame = -3

Query  664  RTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLG  485
            +   D+ F  SDDQS L+YL+LKE++KW ++I++E  YY  GYW++IVG  +NIT+ Y  
Sbjct  1    KVLYDRAFNSSDDQSALVYLLLKEKDKWADRIFIEHKYYLNGYWLDIVGTYENITEKYEA  60

Query  484  IEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSG-------WRRPFITHFTGCQP  326
            +EK      L +RHAEK++  YAE  + H+R+     S         RRPF+THFTGCQP
Sbjct  61   MEK--ENPMLNKRHAEKMNRDYAEMREHHMRDNKNFYSDNDDIMVRRRRPFVTHFTGCQP  118

Query  325  CSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPL-PYDFP  164
            CSGDHN++Y GE C   M +ALNFAD+QVL+NYGF H D L ++ V P+  + FP
Sbjct  119  CSGDHNKIYKGENCWKGMERALNFADDQVLKNYGFRH-DNLQSSHVNPIQSFYFP  172



>ref|XP_007208181.1| hypothetical protein PRUPE_ppa017391mg, partial [Prunus persica]
 gb|EMJ09380.1| hypothetical protein PRUPE_ppa017391mg, partial [Prunus persica]
Length=366

 Score =   178 bits (451),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 88/169 (52%), Positives = 119/169 (70%), Gaps = 9/169 (5%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            + WG  L   FKDK+F  SDDQS LIYL+   +EKWG+K Y+E +Y  EGYW+ +VGK D
Sbjct  205  ERWGQILTSVFKDKLFSVSDDQSSLIYLLFTNKEKWGDKTYLEGEYNLEGYWLALVGKYD  264

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
             + + Y+ +E+      LRRRHAEKV++ YA + +++L    QG    RRPF+THFTGCQ
Sbjct  265  TLAESYIKMERNEG--VLRRRHAEKVNDWYAAEREKYL----QGHE--RRPFVTHFTGCQ  316

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDT-ASVV  185
            PCSG+HN  YS ++C + M +ALN+ADNQVL+NYGF+H +L  +  SVV
Sbjct  317  PCSGEHNPQYSADSCWNEMKRALNYADNQVLKNYGFVHPELSSSEVSVV  365



>ref|XP_003608540.1| Galactomannan galactosyltransferase [Medicago truncatula]
 gb|AES90737.1| galactosyl transferase GMA12/MNN10 family protein [Medicago truncatula]
Length=422

 Score =   179 bits (454),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 90/173 (52%), Positives = 116/173 (67%), Gaps = 9/173 (5%)
 Frame = -3

Query  682  WGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNI  503
            WG  L   FKDK FP  DDQS LIYL+ +++ KWG K ++E  Y  EGYW+  +GKL+ I
Sbjct  257  WGKILTSIFKDKPFPLPDDQSSLIYLLSRQRRKWGAKTFLEEGYDLEGYWIATMGKLEGI  316

Query  502  TDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPC  323
             + Y  IEK A    LRRRH+EKVS  Y E  + +L+ +       RRPF+ HFTGCQPC
Sbjct  317  QNKYDEIEKKA--RVLRRRHSEKVSVWYGEMREPYLKWSE------RRPFVKHFTGCQPC  368

Query  322  SGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            SGDHN  Y G+ C   M +ALNFADNQVLRNYGF+ ++L+ T+SV  +P+ +P
Sbjct  369  SGDHNPSYKGDVCWKEMERALNFADNQVLRNYGFVRKNLM-TSSVYEVPFGYP  420



>ref|XP_008238162.1| PREDICTED: glycosyltransferase 6-like [Prunus mume]
Length=417

 Score =   179 bits (453),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 89/169 (53%), Positives = 119/169 (70%), Gaps = 9/169 (5%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            + WG  L   FKDK+F  SDDQS LIYL+   +EKWG+K Y+E +Y  EGYW+ +VGK D
Sbjct  256  ERWGQILTSVFKDKLFSVSDDQSSLIYLLFTNKEKWGDKTYLEGEYNLEGYWLALVGKYD  315

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
             +T  Y+ +E+      LRRRHAEKV++ Y  + +++L    QGR   RRPF+THFTGCQ
Sbjct  316  TLTASYIKMERNEG--VLRRRHAEKVNDWYDAEREKYL----QGRE--RRPFVTHFTGCQ  367

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDT-ASVV  185
            PCSG+HN  YS ++C + M +ALN+ADNQVL+NYGF+H +L  +  SVV
Sbjct  368  PCSGEHNPQYSADSCWNEMKRALNYADNQVLKNYGFVHPELSSSEVSVV  416



>ref|XP_004953741.1| PREDICTED: galactomannan galactosyltransferase 1-like [Setaria 
italica]
Length=429

 Score =   177 bits (448),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 94/176 (53%), Positives = 120/176 (68%), Gaps = 4/176 (2%)
 Frame = -3

Query  682  WGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNI  503
            WG  L+ TFKDK+F ESDDQS L+Y++L+    W  K+++ESDYYFEGYW+EIVG+L N+
Sbjct  251  WGTVLKSTFKDKVFDESDDQSALVYMLLQSGSPWREKVFLESDYYFEGYWLEIVGRLGNV  310

Query  502  TDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRS---GWRRPFITHFTGC  332
            T+ Y  +E+      LRRR AE    ++A      L  AG   +   GWRRPF+THFTGC
Sbjct  311  TERYEAMERRPGSAALRRRRAEAEHVAHAAARNAALAGAGLAEAGVRGWRRPFVTHFTGC  370

Query  331  QPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            QPCSG  NE YSG +C + M +ALNFAD+QVLR YGF H   L +  V PLP+D+P
Sbjct  371  QPCSGHRNEHYSGASCDEGMRRALNFADDQVLRAYGFRHAGPL-SDDVQPLPFDYP  425



>ref|XP_008363070.1| PREDICTED: LOW QUALITY PROTEIN: galactomannan galactosyltransferase 
1-like, partial [Malus domestica]
Length=383

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/163 (52%), Positives = 108/163 (66%), Gaps = 3/163 (2%)
 Frame = -3

Query  658  FKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIE  479
             K K    SDDQ GLIYL++ +QE W NK YVE DYY  GYW+ IV  LD IT  Y+ IE
Sbjct  219  IKGKQISNSDDQXGLIYLLITQQEGWANKTYVEGDYYQHGYWL-IVDGLDTITKRYMEIE  277

Query  478  KTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMY  299
            +    + LRRRHAEKVS+ Y     +H+++ G      RRPF THFT CQPC+G H+  Y
Sbjct  278  REV--DMLRRRHAEKVSQFYGTMRDQHVKDKGYWXDDLRRPFTTHFTXCQPCNGQHSSAY  335

Query  298  SGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYD  170
            + E C + M + LNFADNQVLR + F+H DLL+++ V PLP+D
Sbjct  336  TWEACWNGMQRGLNFADNQVLRRFAFVHPDLLNSSFVSPLPFD  378



>gb|AFW64907.1| glycosyltransferase 6 [Zea mays]
Length=479

 Score =   175 bits (444),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 90/188 (48%), Positives = 119/188 (63%), Gaps = 16/188 (9%)
 Frame = -3

Query  682  WGNTLRRTFKDKIFPESDDQSGLIYLILK--EQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            WG TLR   + K   ESDDQS L+YL+ +  E+E+W N  ++ES YYF+GYW EIV +LD
Sbjct  290  WGKTLREELEGKPNDESDDQSALVYLLSRHLERERWANATFLESGYYFQGYWAEIVDRLD  349

Query  508  NITDMYLGIEKTAAGEK--LRRRHAEKVSESYAEKWKEHLRN-----------AGQGRSG  368
             +   Y  +E+  AG +  LRRRHAE+    YA   ++ +R             G G+ G
Sbjct  350  GVATRYEAVERGRAGGRAGLRRRHAEREHLLYAAARRQAVRQQRGTGGGVPGPDGGGQKG  409

Query  367  WRRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASV  188
            WRRPF+THFTGCQPC G  N MY+   CA+ + +AL FAD+QVLR+YGF H   L + SV
Sbjct  410  WRRPFVTHFTGCQPCGGAPNRMYTRRRCAEGIRRALAFADDQVLRSYGFRHAAPL-SDSV  468

Query  187  VPLPYDFP  164
             PLP+D+P
Sbjct  469  TPLPFDYP  476



>ref|XP_003570475.1| PREDICTED: galactomannan galactosyltransferase 1-like [Brachypodium 
distachyon]
Length=417

 Score =   174 bits (440),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 87/173 (50%), Positives = 112/173 (65%), Gaps = 7/173 (4%)
 Frame = -3

Query  682  WGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNI  503
            WG  L +TFKDK F ESDDQS L+YL+ ++   W  K+++E +YYFEGYW+EIV +L NI
Sbjct  249  WGALLTKTFKDKAFNESDDQSALVYLLQQDGSPWRQKVFLEHEYYFEGYWLEIVPRLGNI  308

Query  502  TDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPC  323
            +     +E+ AA E  +RR   +      +      R A     GWRRPF+THFTGCQPC
Sbjct  309  SKRCEAMERQAAPEMRKRRAEREARRGRGD------RAAASRVEGWRRPFVTHFTGCQPC  362

Query  322  SGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            SG  NE YSGE+C + M +ALNFAD+QVLR YGF H   L +  V PLP+ +P
Sbjct  363  SGHRNEDYSGESCDEGMRRALNFADDQVLRAYGFRHAGPL-SDDVTPLPFGYP  414



>ref|XP_002449648.1| hypothetical protein SORBIDRAFT_05g020910 [Sorghum bicolor]
 gb|EES08636.1| hypothetical protein SORBIDRAFT_05g020910 [Sorghum bicolor]
Length=449

 Score =   174 bits (440),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 115/190 (61%), Gaps = 29/190 (15%)
 Frame = -3

Query  685  HWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDN  506
             WG TLR T   K   +SDDQS L YL+L  +E+WG+K Y+  DYYF+GY+ EIVGKLD 
Sbjct  266  RWGKTLRDTLSKKSDDQSDDQSALAYLLLMNRERWGDKTYLGIDYYFQGYFAEIVGKLDA  325

Query  505  ITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNA---------------GQGRS  371
            I   Y+ +E+      LRRRHAE+          EHLR A               G G+S
Sbjct  326  IAARYVAVERKGE-PALRRRHAER----------EHLRYAAARNAAVRAVVPGPDGGGQS  374

Query  370  GWRRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLL-DTA  194
            GWRRPF+THFTGC PC G  N++YS E C D M +AL FAD+QVLR YGF H   L DT 
Sbjct  375  GWRRPFVTHFTGCNPCGGKRNKIYSREICEDGMRRALGFADDQVLRAYGFRHAAPLNDTV  434

Query  193  SVVPLPYDFP  164
             V  LP+D+P
Sbjct  435  RV--LPFDYP  442



>ref|NP_001152534.1| glycosyltransferase 6 [Zea mays]
 gb|ACG48084.1| glycosyltransferase 6 [Zea mays]
Length=473

 Score =   174 bits (440),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 90/188 (48%), Positives = 118/188 (63%), Gaps = 16/188 (9%)
 Frame = -3

Query  682  WGNTLRRTFKDKIFPESDDQSGLIYLILK--EQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            WG TLR   + K   ESDDQS L+YL+ +  E+E+W N  ++ES YYF+G W EIV +LD
Sbjct  284  WGKTLREELEGKPNDESDDQSALVYLLSRHLERERWANATFLESGYYFQGXWAEIVDRLD  343

Query  508  NITDMYLGIEKTAAGEK--LRRRHAEKVSESYAEKWKEHLRN-----------AGQGRSG  368
             +   Y  +E+  AG +  LRRRHAE+    YA   +E +R             G G+ G
Sbjct  344  GVATRYEAVERGRAGGRAGLRRRHAEREHLLYAAARREXVRQQRGTGGGVPGPDGGGQKG  403

Query  367  WRRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASV  188
            WRRPF+THFTGCQPC G  N MY+   CA+ + +AL FAD+QVLR+YGF H   L + SV
Sbjct  404  WRRPFVTHFTGCQPCGGAPNRMYTRRRCAEGIRRALAFADDQVLRSYGFRHAAPL-SDSV  462

Query  187  VPLPYDFP  164
             PLP+D+P
Sbjct  463  TPLPFDYP  470



>ref|XP_003575986.2| PREDICTED: galactomannan galactosyltransferase 1-like [Brachypodium 
distachyon]
Length=479

 Score =   172 bits (437),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 90/191 (47%), Positives = 114/191 (60%), Gaps = 12/191 (6%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            D WG  L    K K   +SDDQS L+YL++K + KWG K Y++ DY+F+GYW EIV +LD
Sbjct  291  DEWGKILMDNLKWKSSNDSDDQSALVYLLMKNRRKWGRKTYLDHDYFFQGYWAEIVDRLD  350

Query  508  NITDMYLGIEKTAA----GEKLRRRHAEKVSESYAEKWKEHLRNA-----GQGRSGWRRP  356
             +   YL  E+ AA       LRRRHAE     YA      +  A     G G++GWRRP
Sbjct  351  GVAVRYLAAERRAARPGTSALLRRRHAEAEHALYAAARNAVVGRAVPGPAGGGQTGWRRP  410

Query  355  FITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLP  176
            FITHF GCQPC G  N ++   +CA+ + +ALNFAD+QVLR YGF H   L    V PLP
Sbjct  411  FITHFAGCQPCGGTPNVIFPNGSCAEGVRRALNFADDQVLRAYGFRHAGPLSDV-VQPLP  469

Query  175  YDFPN*TSPIR  143
            + +P   SP R
Sbjct  470  FGYPR--SPAR  478



>gb|ADE76992.1| unknown [Picea sitchensis]
Length=477

 Score =   172 bits (436),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 87/181 (48%), Positives = 120/181 (66%), Gaps = 11/181 (6%)
 Frame = -3

Query  679  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  500
            G  L +   D+ F  SDDQS L+YL++KE++KW ++IY+E  YY  GYWV+IVG  +NIT
Sbjct  300  GKLLSKVLSDRAFNASDDQSALVYLLIKEKDKWADRIYIEHSYYLNGYWVDIVGTYENIT  359

Query  499  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSG-------WRRPFITHF  341
            + Y  +EK      L +RHAEK++  YAE  + ++R+     S         RRPF+THF
Sbjct  360  EKYEAMEKE--NPMLNKRHAEKMNRDYAEMREHYIRSDKNFYSDNDDIMVRRRRPFVTHF  417

Query  340  TGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPL-PYDFP  164
            TGCQPCSGDHN++Y GE C   M +ALNFAD+QVL++YGF H D L ++ V P+  + FP
Sbjct  418  TGCQPCSGDHNKIYKGENCWKGMERALNFADDQVLKHYGFRH-DNLQSSHVNPIQSFYFP  476

Query  163  N  161
            +
Sbjct  477  S  477



>gb|EMS46901.1| Galactomannan galactosyltransferase 1 [Triticum urartu]
Length=316

 Score =   165 bits (418),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 87/179 (49%), Positives = 105/179 (59%), Gaps = 12/179 (7%)
 Frame = -3

Query  685  HWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDN  506
             WG TL+ T  DK   ESDDQS L YL+LK  +KWG + Y+E+ YYF+GYW EIV KLD 
Sbjct  138  RWGKTLKATLSDKPDAESDDQSALAYLLLKNPKKWGARTYLENQYYFQGYWAEIVDKLDG  197

Query  505  ITDMYLGIEKTAAGEKLRRRHAE----------KVSESYAEKWKEHLRNAGQGRSGWRRP  356
            + + Y   E+   G  LRRRHAE            +    +         GQ  S WRRP
Sbjct  198  VAERYRAAERRF-GPALRRRHAEGEHALYAAARNAALRKKDGGVPGPDGGGQKASAWRRP  256

Query  355  FITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPL  179
            F+THFTGC PC G  NE+YS E+CA+ M +ALN AD+QVLR YGF H   L    V PL
Sbjct  257  FVTHFTGCNPCGGRANEIYSNESCAEGMRRALNLADDQVLRAYGFRHAGPLKD-DVRPL  314



>ref|XP_008679453.1| PREDICTED: galactomannan galactosyltransferase 1-like [Zea mays]
 gb|AFW64905.1| hypothetical protein ZEAMMB73_022035 [Zea mays]
Length=441

 Score =   167 bits (424),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 91/189 (48%), Positives = 110/189 (58%), Gaps = 27/189 (14%)
 Frame = -3

Query  685  HWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDN  506
             WG TLR T   K   +SDDQS L YL+L  +E+WG K Y+  DYYF+GY+ EIV KLD 
Sbjct  258  RWGKTLRDTLSKKFDDQSDDQSALAYLLLTNRERWGKKTYLGIDYYFQGYFAEIVDKLDG  317

Query  505  ITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNA---------------GQGRS  371
            +   Y   E+      LRRRHAE+          EHLR A               G G+S
Sbjct  318  VAARYEAAERKG-DPALRRRHAER----------EHLRYAAARNAAVRAVVPGPDGGGQS  366

Query  370  GWRRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTAS  191
            GWRRPF+THFTGC PC G  N +Y+ E C D M +AL FAD+QVLR YGF H   L+  S
Sbjct  367  GWRRPFVTHFTGCNPCGGKRNSIYTREICEDGMRRALGFADDQVLRAYGFRHAAPLND-S  425

Query  190  VVPLPYDFP  164
            V  LP+D+P
Sbjct  426  VRALPFDYP  434



>gb|ABK25085.1| unknown [Picea sitchensis]
Length=479

 Score =   166 bits (420),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/170 (48%), Positives = 112/170 (66%), Gaps = 4/170 (2%)
 Frame = -3

Query  679  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  500
               L     D+   ESDDQS LIYL++KE++KW  KIY+E++Y+F+GYW++IVG  +NIT
Sbjct  314  AKILSDVLPDRALTESDDQSALIYLMIKEKKKWAGKIYIENEYFFQGYWLDIVGSFENIT  373

Query  499  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  320
             +Y  +E  A    LRRR+AEK +  YA K    L+    G    RRPF+THFTGCQPCS
Sbjct  374  KIYDAME--AKHPDLRRRYAEKSARLYAGKRDRSLKEIWAGILQ-RRPFVTHFTGCQPCS  430

Query  319  GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYD  170
            G+HN +Y  E C + M ++L+FAD+QVLR YGF  R  L +  V P+ ++
Sbjct  431  GNHNPIYKAEDCWNGMARSLDFADDQVLRIYGF-RRHQLQSVVVSPIHFN  479



>ref|XP_004980586.1| PREDICTED: galactomannan galactosyltransferase 1-like [Setaria 
italica]
Length=450

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 89/192 (46%), Positives = 112/192 (58%), Gaps = 21/192 (11%)
 Frame = -3

Query  682  WGNTLRRTFKDKIFPE-SDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDN  506
            WG  +R    DK      DDQS L+YL+L   E+ G K ++E++Y+F+GYW+EIV +LD 
Sbjct  269  WGKVVRDALADKGDDAWCDDQSALVYLLLHNWERLGKKAFIETEYFFQGYWLEIVDRLDG  328

Query  505  ITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQG----------RSGWRRP  356
            +   Y  +E+ A    LRRRHAE+    YA       RNA               GWRRP
Sbjct  329  VAARYEAVERRAPA--LRRRHAEREHLRYAAA-----RNAAVSGAVPGPAGGGEKGWRRP  381

Query  355  FITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLP  176
             ITHF GCQPCSG  N MYS E+C D M + L FADNQVLR YGF H   L+  SV PLP
Sbjct  382  LITHFVGCQPCSGGRNPMYSRESCEDGMRRTLGFADNQVLRAYGFRHAAPLND-SVRPLP  440

Query  175  YDFPN*TSPIRQ  140
            +D+P   +P R+
Sbjct  441  FDYP--AAPARR  450



>ref|XP_004980585.1| PREDICTED: galactomannan galactosyltransferase 1-like [Setaria 
italica]
Length=312

 Score =   162 bits (410),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 108/178 (61%), Gaps = 6/178 (3%)
 Frame = -3

Query  682  WGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNI  503
            WG  ++    D+    + DQS L YL++  +E+WG K Y+ +DYYF+GY+ EIVGKL  +
Sbjct  131  WGKKVKGALTDRDSDVACDQSALAYLLITGRERWGEKTYLGTDYYFQGYFAEIVGKLAGV  190

Query  502  TDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNA-----GQGRSGWRRPFITHFT  338
               Y   E+ A    LRRRHAE+    YA      +R A     G G+SGWRRP ITHFT
Sbjct  191  AARYKAAERGAGHAGLRRRHAEREHLRYAAARNAAVRAAVPGPDGGGQSGWRRPLITHFT  250

Query  337  GCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            GC PC G  N MYS E C   M +AL FAD+QVLR YGF H   L+  +V+ LP+D+P
Sbjct  251  GCNPCGGRRNPMYSRELCEGGMRRALGFADDQVLRAYGFRHAGPLND-TVLQLPFDYP  307



>ref|XP_008795673.1| PREDICTED: glycosyltransferase 6-like [Phoenix dactylifera]
Length=516

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 115/174 (66%), Gaps = 5/174 (3%)
 Frame = -3

Query  682  WGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNI  503
            W   L      K   +SDDQS L++L++K+ ++WGNK+Y+E+ Y   GYW  I+G+LDNI
Sbjct  345  WTKLLHSEISGKDSGDSDDQSALVHLLVKDIKRWGNKVYLENSYDLHGYWEAIIGRLDNI  404

Query  502  TDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHL-RNAGQGRS--GWRRPFITHFTGC  332
            T+ Y  +EK    ++LRRRHAEK +  +    + +L R  G G +    RRPF+THFTGC
Sbjct  405  TERYKRLEKKE--KELRRRHAEKDTVGFGGTREWYLDREVGMGPAERKKRRPFVTHFTGC  462

Query  331  QPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYD  170
            QPCS  HN  Y+ E+C + MH+ALNFAD QVLR YGF   D+ + +SV PLP+D
Sbjct  463  QPCSAGHNPAYTWESCYEGMHRALNFADGQVLRAYGFGRPDINNISSVQPLPFD  516



>ref|XP_008679454.1| PREDICTED: galactomannan galactosyltransferase 1-like [Zea mays]
 gb|AFW64906.1| hypothetical protein ZEAMMB73_279475 [Zea mays]
Length=458

 Score =   164 bits (416),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 87/178 (49%), Positives = 109/178 (61%), Gaps = 8/178 (4%)
 Frame = -3

Query  682  WGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNI  503
            WG  LR T  DK    + DQS L+YL+L   E+ G K +VE++Y+F+GYW E+V +LD +
Sbjct  277  WGEVLRATLSDKDSDVACDQSALVYLLLNNWERPGKKTFVETEYFFQGYWKEVVDRLDGV  336

Query  502  TDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRS-----GWRRPFITHFT  338
               Y  +E+ + G  LRRRHAE+    YA      LR    G +     GWRRP ITHF 
Sbjct  337  AARYEAVERRSPG--LRRRHAEQEHLRYAGARNAALRGVVPGPAGGGEVGWRRPLITHFV  394

Query  337  GCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            GCQPCSG  N MYS E+C D M  AL FAD+QVLR YGF H   L+  SV  LP+D+P
Sbjct  395  GCQPCSGGRNPMYSRESCDDGMRHALGFADDQVLRAYGFRHAAPLND-SVRGLPFDYP  451



>ref|XP_004980588.1| PREDICTED: galactomannan galactosyltransferase 1-like, partial 
[Setaria italica]
Length=367

 Score =   161 bits (407),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 84/182 (46%), Positives = 109/182 (60%), Gaps = 10/182 (5%)
 Frame = -3

Query  682  WGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNI  503
            WG TLR   + K   ESDDQS L+YL+ K   +WGN+  +E+ YYF+GYW EIV +LD +
Sbjct  183  WGKTLREELEGKPNDESDDQSALVYLLSKHPARWGNRTLLETGYYFQGYWAEIVDRLDGV  242

Query  502  TDMYLGIEKTAAGEKLRRR--HAEKVSESYAEKWKEHLRN-------AGQGRSGWRRPFI  350
               Y  +E+   G     R  HAE+    YA      +         AG G+ GWRRPF+
Sbjct  243  AKRYEAVERGGRGGSSGLRRRHAEREHLRYAAARDAAVGRSGTVPGPAGGGQKGWRRPFV  302

Query  349  THFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYD  170
            THFTGCQPC G  +  Y+   CA+ + +AL FAD+QVLR YGF H   L + SVVPLP+D
Sbjct  303  THFTGCQPCGGAPDRKYTRRRCAEGIRRALAFADDQVLRAYGFRHAAPL-SDSVVPLPFD  361

Query  169  FP  164
            +P
Sbjct  362  YP  363



>gb|AHC98115.1| putative galacto(gluco)mannan alpha-1,6-galactosyltransferase 
[Pinus radiata]
Length=480

 Score =   162 bits (411),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 79/172 (46%), Positives = 114/172 (66%), Gaps = 4/172 (2%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            D +   L     D+   ESDDQS L+YL++KE++KWG KIY+E++YYF+G+W++IVG  +
Sbjct  311  DSFAKILSDVLPDRPVTESDDQSALVYLMIKEKKKWGGKIYIENEYYFQGFWLDIVGTFE  370

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
            NI+  Y  +E  A   +L RR+AEK +  YA K + +L+    G    RRPF+THF GCQ
Sbjct  371  NISKRYEAME--AEHTELSRRYAEKSARLYAVKRERYLKEIWAGLFE-RRPFVTHFAGCQ  427

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPY  173
            PCSG+HN +Y  E C + + ++L+FAD+QVLR YGF  R  L +  V P+ +
Sbjct  428  PCSGNHNPIYKAEDCQNGLQRSLDFADDQVLRIYGF-RRQQLQSVLVNPIHF  478



>dbj|BAJ96459.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=474

 Score =   162 bits (409),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 101/165 (61%), Gaps = 10/165 (6%)
 Frame = -3

Query  682  WGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNI  503
            WG TL  T  DK   ESDDQS L YL+LK ++KWG + Y+E DYYF+GYW EIV KLD +
Sbjct  300  WGKTLMATLSDKPDAESDDQSALAYLLLKNRKKWGARTYLEHDYYFQGYWAEIVDKLDGV  359

Query  502  TDMYLGIEKTAAGEKLRRRHAE---------KVSESYAEKWKEHLRNAGQGRSGWRRPFI  350
               Y    +   G  LRRRHAE         + +    +       + G  R+ WRRPF+
Sbjct  360  AARYR-AAERRFGPALRRRHAEGEHALYAAARSAALRKKDGGVPGPDGGGQRASWRRPFV  418

Query  349  THFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMH  215
            THFTGC PC G  NE+YS ETCAD M +ALN AD+QVLR YGF H
Sbjct  419  THFTGCNPCGGKPNEIYSNETCADGMRRALNLADDQVLRVYGFRH  463



>tpg|DAA64590.1| TPA_inf: putative galacto(gluco)mannan alpha-1,6-galactosyltransferase 
[Pinus taeda]
Length=480

 Score =   161 bits (407),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 78/172 (45%), Positives = 114/172 (66%), Gaps = 4/172 (2%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            + +   L     D+   ESDDQS L+YL++KE++KWG KIY+E++YYF+G+W++IVG  +
Sbjct  311  ESFAKILSDVLPDRPVTESDDQSALVYLMIKEKKKWGGKIYIENEYYFQGFWLDIVGTFE  370

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
            NI+  Y  +E  A   +L RR+AEK +  YA K + +L+    G    RRPF+THF GCQ
Sbjct  371  NISKRYEAME--AEHTELSRRYAEKSARLYAVKRERYLKEIWAGLFE-RRPFVTHFAGCQ  427

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPY  173
            PCSG+HN +Y  E C + + ++L+FAD+QVLR YGF  R  L +  V P+ +
Sbjct  428  PCSGNHNPIYKAEDCQNGLQRSLDFADDQVLRIYGF-RRQQLQSVLVNPIHF  478



>ref|XP_009406736.1| PREDICTED: galactomannan galactosyltransferase 1-like [Musa acuminata 
subsp. malaccensis]
Length=486

 Score =   160 bits (405),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 82/182 (45%), Positives = 111/182 (61%), Gaps = 11/182 (6%)
 Frame = -3

Query  682  WGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNI  503
            WG  L    + K+   +DDQS L++L+ KEQ +W +K+++ES Y   GYW  IVG+L+++
Sbjct  300  WGRILDAEIRGKLTSFADDQSALVHLLAKEQRRWRDKVHLESAYDLHGYWEPIVGRLEDV  359

Query  502  TDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHL------RNAGQGRSGW---RRPFI  350
               Y  +E+  A   LRRRHAEK + SY E    +L               W   RR F+
Sbjct  360  AAAYAEMERRDA--VLRRRHAEKEAGSYGETRSRYLDAAAGGGGEKGSGKRWPRKRRSFV  417

Query  349  THFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYD  170
            THFTGCQPC GDHN  Y+ + C D M +ALNFAD+QVLR YGF H +L D+AS+  LP+ 
Sbjct  418  THFTGCQPCGGDHNPAYTWQGCVDGMARALNFADDQVLRAYGFGHTNLNDSASIRSLPFG  477

Query  169  FP  164
            +P
Sbjct  478  YP  479



>gb|EMT11268.1| Putative glycosyltransferase 7 [Aegilops tauschii]
Length=265

 Score =   154 bits (388),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 80/166 (48%), Positives = 97/166 (58%), Gaps = 11/166 (7%)
 Frame = -3

Query  682  WGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNI  503
            WG TL+ T  DK   ESDDQS L YL+LK  +KWG + Y+E +YYF+GYW EIV +LD +
Sbjct  88   WGKTLKATLSDKPDAESDDQSALAYLLLKNPKKWGARTYLEHEYYFQGYWAEIVDRLDGV  147

Query  502  TDMYLGIEKTAAGEKLRRRHAE----------KVSESYAEKWKEHLRNAGQGRSGWRRPF  353
                    +   G  LRRRHAE            +              GQ  S WRRPF
Sbjct  148  A-ARYRAAERRFGPALRRRHAEGEHALYAAARNAALRKKAGGVPGPDGGGQKASYWRRPF  206

Query  352  ITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMH  215
            +THFTGC PC G  NE+YS E+CA+ M +ALN AD+QVLR YGF H
Sbjct  207  VTHFTGCNPCGGRPNEIYSNESCAEGMRRALNLADDQVLRAYGFPH  252



>ref|XP_002450906.1| hypothetical protein SORBIDRAFT_05g020930 [Sorghum bicolor]
 gb|EES09894.1| hypothetical protein SORBIDRAFT_05g020930 [Sorghum bicolor]
Length=443

 Score =   154 bits (389),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 87/186 (47%), Positives = 114/186 (61%), Gaps = 14/186 (8%)
 Frame = -3

Query  682  WGNTLRRTFKDKIFPESDDQSGLIYLILK--EQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            WG TLR   + K   ESDDQS L+YL+ +  E+ +W N  ++ES YYF+GYW EIV +LD
Sbjct  256  WGKTLREELEGKPNDESDDQSALVYLLSRHPERARWSNATFLESGYYFQGYWAEIVDRLD  315

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQG-----------RSGWR  362
             +   Y  +E+   G  LRRRHAE+    YA   +E +R                + GWR
Sbjct  316  GVAARYEAVERGGVGRGLRRRHAEREHLLYAAARREAVRRRDGSGGGVPGPDGGGQKGWR  375

Query  361  RPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVP  182
            RPF+THFTGCQPC G  N MY+ + CA+ + +AL FAD+QVLR YGF H   L + SV P
Sbjct  376  RPFVTHFTGCQPCGGAPNRMYTRKRCAEGIRRALAFADDQVLRAYGFRHAAPL-SDSVAP  434

Query  181  LPYDFP  164
            LP+D+P
Sbjct  435  LPFDYP  440



>ref|XP_008784727.1| PREDICTED: putative glycosyltransferase 7 [Phoenix dactylifera]
Length=436

 Score =   152 bits (385),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 113/187 (60%), Gaps = 25/187 (13%)
 Frame = -3

Query  682  WGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNI  503
            WG  L    K K  PESDDQS L++L++ E+++WG+++Y+E+DY   GYW  ++G+L+  
Sbjct  250  WGRILASKIKGKAAPESDDQSALLHLLVYEKDRWGDRVYLENDYDLHGYWAAVLGRLEKS  309

Query  502  TDMYLGI-------------EKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWR  362
            T+ YL +             + T A  ++R R+ ++  E+ A++W++  R         R
Sbjct  310  TEDYLAMERREPPLRRRHAEKSTGAHGEMRGRYLDR--EAAADEWEQRRR---------R  358

Query  361  RPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVP  182
             PF+THFTGCQPC G HN  YS E+C  AM +AL+ AD+QVLR YGF   D      V P
Sbjct  359  LPFVTHFTGCQPCGGGHNPAYSRESCLAAMQRALDLADDQVLRAYGFRRVDGCG-GHVRP  417

Query  181  LPYDFPN  161
            LPYDFP+
Sbjct  418  LPYDFPS  424



>ref|XP_004980587.1| PREDICTED: galactomannan galactosyltransferase 1-like [Setaria 
italica]
Length=447

 Score =   152 bits (385),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 101/166 (61%), Gaps = 18/166 (11%)
 Frame = -3

Query  631  DDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEKLR  452
            DDQS L+YL+L   E+ G K ++E+DY+   YW+++V +LD +T  Y  +E+      LR
Sbjct  286  DDQSALVYLLLYNWERLGKKAFIETDYFLMAYWLDVVDRLDGVTARYEAVERRMPW--LR  343

Query  451  RRHAEKVSESYAEKWKEHLRNAGQGR----------SGWRRPFITHFTGCQPCSGDHNEM  302
            RRHAE+    YA       RNA               GWRRP ITHF GCQPC+G+ N M
Sbjct  344  RRHAEREHMRYAAA-----RNAAVSGAVPGPAGGGYKGWRRPLITHFVGCQPCNGERNPM  398

Query  301  YSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            YS E+C D M +AL FAD+QVLR YGF H   L+  SV PLP+D+P
Sbjct  399  YSRESCDDGMRRALGFADDQVLRAYGFRHAAPLND-SVRPLPFDYP  443



>ref|XP_010943187.1| PREDICTED: galactomannan galactosyltransferase 1-like [Elaeis 
guineensis]
Length=537

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 82/176 (47%), Positives = 114/176 (65%), Gaps = 5/176 (3%)
 Frame = -3

Query  682  WGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNI  503
            W   L      K   +SDDQS L++L++K+ ++WGNK+Y+E+ Y   GYW  I+G+LDNI
Sbjct  359  WTKILLSEISGKDSGDSDDQSALVHLLVKDTKRWGNKVYLENSYDLHGYWEAIMGRLDNI  418

Query  502  TDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRN---AGQGRSGWRRPFITHFTGC  332
            T+ Y   +     ++LRRRHAEK + ++ E    HL +    G      RRPF+THFTGC
Sbjct  419  TERY--KKLEKKEKELRRRHAEKDTVAFGETRLRHLDHEVGVGPQEKKKRRPFVTHFTGC  476

Query  331  QPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            QPC G +N  Y+ E+C + MH+ALNFAD+QVLR YGF   D+ D +SV  LP+D+P
Sbjct  477  QPCGGGYNPTYTWESCYEGMHRALNFADDQVLRAYGFGRPDINDISSVQQLPFDYP  532



>ref|XP_010919073.1| PREDICTED: galactomannan galactosyltransferase 1-like [Elaeis 
guineensis]
Length=436

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 78/177 (44%), Positives = 110/177 (62%), Gaps = 7/177 (4%)
 Frame = -3

Query  682  WGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNI  503
            WG TL    K K  P++DDQS L++L++ E+++W +++Y+E+DY   GYW  ++G+L+N 
Sbjct  258  WGRTLASEIKGKTTPDADDQSALLHLLVYEKDRWADRVYLENDYDLHGYWAAVMGRLENS  317

Query  502  TDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQG----RSGWRRPFITHFTG  335
            T+ YL +E+     +  RRHAEK + ++ E     L     G    R   RRPF+ HFTG
Sbjct  318  TEDYLAMERREPPLR--RRHAEKFTRAHGEMRGRCLDREVAGDEWERRRRRRPFVAHFTG  375

Query  334  CQPCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYDFP  164
            CQPC G HN  Y+ E+C  A+ +AL+ AD+QVLR YGF  R       V PLPYDFP
Sbjct  376  CQPCGGGHNPAYTWESCFAAIQRALDLADDQVLRAYGF-GRVNGSGGYVRPLPYDFP  431



>emb|CBI25835.3| unnamed protein product [Vitis vinifera]
Length=267

 Score =   129 bits (324),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 55/79 (70%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = -3

Query  427  ESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCADAMHKALNFAD  248
            ESYAE+ + +L+ AG GR  WRRPFITHFTGCQPCSG HN+MY+GE+C ++M KALNFAD
Sbjct  149  ESYAEQREPYLKKAGNGRYSWRRPFITHFTGCQPCSGKHNQMYAGESCWNSMQKALNFAD  208

Query  247  NQVLRNYGFMHRDLLDTAS  191
            NQVLRN+GF+H DLLD+++
Sbjct  209  NQVLRNFGFVHPDLLDSST  227



>ref|XP_009379786.1| PREDICTED: putative glycosyltransferase 5 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009379787.1| PREDICTED: putative glycosyltransferase 5 [Musa acuminata subsp. 
malaccensis]
Length=466

 Score =   112 bits (279),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 60/161 (37%), Positives = 83/161 (52%), Gaps = 37/161 (23%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            D  G  L  + K +   E+DDQS LIYL+L +Q+KWGNK+++E+ YY  GYW  +V + +
Sbjct  313  DEAGKILTASLKGRPAFEADDQSALIYLLLSQQDKWGNKVFIENSYYLHGYWAGLVDRYE  372

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
             + + Y                                 + G G   W  PF+THF GC+
Sbjct  373  EMMEKY---------------------------------HPGLGDERW--PFVTHFVGCK  397

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  206
            PC G + + Y  E C  +M +A NFADNQ+LR YGF HR L
Sbjct  398  PC-GSYGD-YPVERCLGSMERAFNFADNQILRIYGFAHRGL  436



>ref|XP_004987031.1| PREDICTED: xyloglucan 6-xylosyltransferase-like [Setaria italica]
Length=437

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 61/165 (37%), Positives = 84/165 (51%), Gaps = 34/165 (21%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            D +G  L +   D+   E+DDQS L+YL++ ++ +WG K ++ES Y   G+WVEIV    
Sbjct  277  DRYGKVLGKALSDRASYEADDQSALVYLLVTQRGRWGGKTFLESSYSLHGFWVEIV----  332

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
               D Y         E++RRRH      +  E+W                P +THF GC+
Sbjct  333  ---DRY---------EEMRRRH-RTTPVAGGERW----------------PLVTHFVGCK  363

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTA  194
            PC G +   Y    C   M +ALNFAD+Q+LR YGF H  L  TA
Sbjct  364  PCGGQYAS-YDAARCRHGMERALNFADDQILRLYGFEHESLNTTA  407



>ref|XP_001761988.1| predicted protein [Physcomitrella patens]
 gb|EDQ73092.1| predicted protein [Physcomitrella patens]
Length=362

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 83/161 (52%), Gaps = 34/161 (21%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            D  G  L +   D+   E+DDQSGL+YL++ ++E+WG+K+Y+ES YYF+GYW  +  K +
Sbjct  208  DDVGKFLSKALPDRGKGEADDQSGLVYLMITDRERWGSKVYLESSYYFQGYWKVLTEKFE  267

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
            ++   Y                                +    G   W  PF+THF GC+
Sbjct  268  DMMAKY--------------------------------KPGIYGDDRW--PFVTHFCGCE  293

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  206
             C G  N  Y+ + C   M +A+NFADNQVL  YGF+H+ L
Sbjct  294  FCCGAINPEYTVDRCLTQMERAVNFADNQVLERYGFIHKSL  334



>ref|XP_010907157.1| PREDICTED: putative glycosyltransferase 5 [Elaeis guineensis]
Length=452

 Score =   108 bits (271),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 60/158 (38%), Positives = 81/158 (51%), Gaps = 37/158 (23%)
 Frame = -3

Query  679  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  500
            G  L    K +   E+DDQS LIYL+L +QE+WGNK+Y+E+ YY  G+W  +V + + + 
Sbjct  302  GRILTANLKGRPAFEADDQSALIYLLLSQQERWGNKVYIENSYYLHGFWAGLVERYEEMM  361

Query  499  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  320
            + Y                                 + G G   W  PF+THF GC+PC 
Sbjct  362  EKY---------------------------------HPGLGDERW--PFVTHFVGCKPC-  385

Query  319  GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  206
            G + + Y  E C  +M +A NFADNQVLR YGF HR L
Sbjct  386  GSYGD-YPVEKCLGSMERAFNFADNQVLRLYGFGHRGL  422



>ref|XP_009385087.1| PREDICTED: putative glycosyltransferase 5 [Musa acuminata subsp. 
malaccensis]
Length=459

 Score =   108 bits (271),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 62/161 (39%), Positives = 82/161 (51%), Gaps = 37/161 (23%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            D  G  L    K +   E+DDQS LIYL+L +Q+KWG+K+Y+E+ YY  GYW  +V +  
Sbjct  304  DEAGKILTANLKGRPAFEADDQSALIYLLLSQQDKWGDKVYIENSYYLHGYWAGLVDR--  361

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
                                         Y E  ++H  + G G   W  PF+THF GC+
Sbjct  362  -----------------------------YEEMMEKH--HPGLGDERW--PFVTHFVGCK  388

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  206
            PC G + + Y  E C  +M +A NFADNQVLR YGF H  L
Sbjct  389  PC-GSYGD-YPVERCLSSMERAFNFADNQVLRMYGFAHGSL  427



>ref|XP_010678459.1| PREDICTED: putative glycosyltransferase 5 [Beta vulgaris subsp. 
vulgaris]
Length=436

 Score =   108 bits (270),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 61/162 (38%), Positives = 83/162 (51%), Gaps = 37/162 (23%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            D  G  L    K +   E+DDQS LIYL++ ++EKW NK+YVE+ YY  G+W+ +V K +
Sbjct  278  DEAGKLLTANLKGRPAFEADDQSALIYLLISQKEKWMNKVYVENSYYLHGFWLGLVDKYE  337

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
             + + Y                                 + G G   W  PF+THF GC+
Sbjct  338  EMAEKY---------------------------------HPGLGDERW--PFVTHFVGCK  362

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLL  203
            PC G + + Y  E C  +M +A NFADNQVL+ YGF HR LL
Sbjct  363  PC-GSYGD-YPVEKCLKSMERAFNFADNQVLKLYGFRHRGLL  402



>ref|XP_001765298.1| predicted protein [Physcomitrella patens]
 gb|EDQ70026.1| predicted protein, partial [Physcomitrella patens]
Length=311

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/164 (35%), Positives = 90/164 (55%), Gaps = 35/164 (21%)
 Frame = -3

Query  679  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  500
            G  L +   D+   E+DDQSGL+YL++ ++E+WG+K+++ES YYF+GYW  +  K +++ 
Sbjct  182  GKFLTKALPDRGDSEADDQSGLVYLMVTDRERWGSKVFLESSYYFQGYWKVLTEKFEDM-  240

Query  499  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  320
                 +EK   G+             Y +                R PF+THF GC+ C 
Sbjct  241  -----MEKYQPGK-------------YGDD---------------RWPFVTHFCGCEFCC  267

Query  319  GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASV  188
            G  N  Y+ + C   M +A+NFADNQV+  YGF+H+ +L +A V
Sbjct  268  GAINPEYTVDRCLTQMERAVNFADNQVIGRYGFIHK-MLKSAEV  310



>ref|XP_009420521.1| PREDICTED: putative glycosyltransferase 5 [Musa acuminata subsp. 
malaccensis]
Length=456

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 61/161 (38%), Positives = 81/161 (50%), Gaps = 37/161 (23%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            D  G  L    + +   E+DDQS LIYL+L +Q++WG+KIY+E+ YY  GYW  +V + +
Sbjct  301  DEAGKILTANLQGRPAFEADDQSALIYLVLSQQDRWGDKIYIENSYYLHGYWAGLVDRYE  360

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
             + D                              K H    G G   W  PF+THF GC+
Sbjct  361  EMMD------------------------------KHH---PGLGDERW--PFVTHFVGCK  385

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  206
            PC G + + Y  E C  +M +A NFADNQVLR YGF H  L
Sbjct  386  PC-GSYGD-YPVERCLSSMERAFNFADNQVLRMYGFAHGKL  424



>ref|XP_010912249.1| PREDICTED: putative glycosyltransferase 5 [Elaeis guineensis]
Length=451

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 58/158 (37%), Positives = 81/158 (51%), Gaps = 37/158 (23%)
 Frame = -3

Query  679  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  500
            G  L    K +   E+DDQS LIYL+L +Q++WG+K+Y+E+ Y+  G+W  +V + + + 
Sbjct  300  GRILTANLKGRPAFEADDQSALIYLLLSQQDRWGDKVYIENSYFLHGFWTGLVDRYEEMI  359

Query  499  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  320
            D Y                                 + G G   W  PF+THF GC+PC 
Sbjct  360  DKY---------------------------------HPGLGDERW--PFVTHFVGCKPC-  383

Query  319  GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  206
            G + + Y  E C  +M +A NFADNQVLR YGF HR L
Sbjct  384  GSYGD-YPVEKCLGSMERAFNFADNQVLRLYGFGHRGL  420



>ref|XP_006399253.1| hypothetical protein EUTSA_v10013509mg [Eutrema salsugineum]
 gb|ESQ40706.1| hypothetical protein EUTSA_v10013509mg [Eutrema salsugineum]
Length=454

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/159 (39%), Positives = 81/159 (51%), Gaps = 37/159 (23%)
 Frame = -3

Query  679  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  500
            G  L    K +   E+DDQS LIYL+L ++EKW  K+YVE+ YY  G+W  +V K + + 
Sbjct  298  GKILTANLKGRPAFEADDQSALIYLLLSQKEKWMEKVYVENQYYLHGFWEGLVDKYEEMI  357

Query  499  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  320
            D Y                                 + G G   W  PF+THF GC+PC 
Sbjct  358  DKY---------------------------------HPGLGDERW--PFVTHFVGCKPC-  381

Query  319  GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLL  203
            G + + Y+ E C  +M +A NFADNQVLR YGF HR LL
Sbjct  382  GSYAD-YAVERCLKSMERAYNFADNQVLRLYGFGHRGLL  419



>ref|XP_008783986.1| PREDICTED: LOW QUALITY PROTEIN: putative glycosyltransferase 
5 [Phoenix dactylifera]
Length=452

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 58/158 (37%), Positives = 81/158 (51%), Gaps = 37/158 (23%)
 Frame = -3

Query  679  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  500
            G  L    K +   E+DDQS LIYL+L +Q++WG+++Y+E+ YY  G+W  +V + + + 
Sbjct  301  GRILTANLKGRPAFEADDQSALIYLLLSQQDRWGDRVYIENSYYLHGFWTGLVERYEEMM  360

Query  499  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  320
            D Y                                 + G G   W  PF+THF GC+PC 
Sbjct  361  DKY---------------------------------HPGLGDERW--PFVTHFVGCKPC-  384

Query  319  GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  206
            G + + Y  E C  +M +A NFADNQVLR YGF HR L
Sbjct  385  GSYGD-YPVEKCLGSMERAFNFADNQVLRLYGFGHRGL  421



>ref|XP_011075649.1| PREDICTED: putative glycosyltransferase 5 [Sesamum indicum]
Length=443

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 62/162 (38%), Positives = 85/162 (52%), Gaps = 37/162 (23%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            D  G  L    K +   E+DDQS LIYL++  +++W +K+++E+ YY  GYWV +V    
Sbjct  284  DEAGKILTANLKGRPTFEADDQSALIYLLISRKDEWMDKVFLENSYYLHGYWVGLV----  339

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
               D Y                     E Y E++     + G G   W  PF+THF GC+
Sbjct  340  ---DRY---------------------EEYIERY-----HPGLGDERW--PFVTHFVGCK  368

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLL  203
            PC G  +  YS E C  +M KA NFADNQ+L++YGF HR LL
Sbjct  369  PCGGYGD--YSLERCLQSMEKAFNFADNQLLKSYGFSHRGLL  408



>ref|XP_009393375.1| PREDICTED: putative glycosyltransferase 5 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009393376.1| PREDICTED: putative glycosyltransferase 5 [Musa acuminata subsp. 
malaccensis]
Length=466

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 59/161 (37%), Positives = 82/161 (51%), Gaps = 37/161 (23%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            D  G  L    K +   E+DDQS LIYL+L +Q++WG+KIY+E+ YY  GYW  +V + +
Sbjct  311  DEAGKMLTANLKGRPAFEADDQSALIYLLLSQQDRWGDKIYIENSYYLHGYWAGLVDRYE  370

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
             + + Y                                 + G G   W  PF+THF GC+
Sbjct  371  EMMEKY---------------------------------HPGLGDERW--PFVTHFVGCK  395

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  206
            PC G + + Y  + C  +M +A NFADNQVLR YGF H +L
Sbjct  396  PC-GSYGD-YPVKRCLRSMERAFNFADNQVLRMYGFAHGNL  434



>ref|XP_008453679.1| PREDICTED: putative glycosyltransferase 3 [Cucumis melo]
Length=190

 Score =   103 bits (256),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 81/161 (50%), Gaps = 37/161 (23%)
 Frame = -3

Query  679  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  500
            G  L    K +   E+DDQS LIYL+L ++++W +K+++E+ YY  GYW  +V K + + 
Sbjct  32   GKILTANLKGRPAFEADDQSALIYLLLSQKDQWMDKVFLENSYYLHGYWAGLVDKYEEMI  91

Query  499  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  320
            + Y                                 + G G   W  PF+THF GC+PC 
Sbjct  92   EKY---------------------------------HPGLGDERW--PFVTHFVGCKPC-  115

Query  319  GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDT  197
            G + + Y  E C  +M +A NFADNQVL+ YGF HR LL  
Sbjct  116  GSYGD-YPVERCLSSMERAFNFADNQVLKLYGFRHRGLLSP  155



>ref|NP_001047014.1| Os02g0529600 [Oryza sativa Japonica Group]
 dbj|BAD25434.1| putative galactomannan galactosyltransferase [Oryza sativa Japonica 
Group]
 dbj|BAF08928.1| Os02g0529600 [Oryza sativa Japonica Group]
 dbj|BAG94866.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC73308.1| hypothetical protein OsI_07488 [Oryza sativa Indica Group]
 gb|EEE57116.1| hypothetical protein OsJ_06989 [Oryza sativa Japonica Group]
Length=480

 Score =   106 bits (264),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 59/161 (37%), Positives = 81/161 (50%), Gaps = 37/161 (23%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            D  G  L    K +   E+DDQS LIYL+L ++EKW NK+++E+ YY  G+W  +V    
Sbjct  325  DEAGKILTANLKGRPAFEADDQSALIYLLLSQKEKWMNKVFIENSYYLHGFWAGLV----  380

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
                                           +K++E + N   G    R PF+THF GC+
Sbjct  381  -------------------------------DKYEEMMENHHPGLGDERWPFVTHFVGCK  409

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  206
            PC G + + Y  E C  +M +A NFADNQVLR YGF H+ L
Sbjct  410  PC-GSYGD-YPVERCLRSMERAFNFADNQVLRLYGFAHKGL  448



>ref|XP_008788330.1| PREDICTED: putative glycosyltransferase 5 [Phoenix dactylifera]
Length=454

 Score =   105 bits (263),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 58/158 (37%), Positives = 81/158 (51%), Gaps = 37/158 (23%)
 Frame = -3

Query  679  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  500
            G  L    K +   E+DDQS LIYL+L +Q++WG+K+Y+E+ YY  G+W  +V + + + 
Sbjct  303  GRILTANLKGRPAFEADDQSALIYLLLSQQDRWGDKVYIENSYYLHGFWAGLVERYEEMM  362

Query  499  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  320
            + Y                                 + G G   W  PF+THF GC+PC 
Sbjct  363  EKY---------------------------------HPGLGDERW--PFVTHFVGCKPC-  386

Query  319  GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  206
            G + + Y  E C  +M +A NFADNQVLR YGF HR L
Sbjct  387  GSYGD-YPVEKCLGSMERAFNFADNQVLRLYGFGHRGL  423



>gb|ACN27080.1| unknown [Zea mays]
Length=228

 Score =   103 bits (256),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 81/161 (50%), Gaps = 37/161 (23%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            D  G  L    K +   E+DDQS LIYL+L +++KW +K+++E+ YY  G+W  +V    
Sbjct  73   DQAGKVLTANLKGRPAFEADDQSALIYLLLSQKDKWMDKVFIENSYYLHGFWAGLV----  128

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
                                           +K++E + N   G    R PF+THF GC+
Sbjct  129  -------------------------------DKYEEMMENHHPGLGDERWPFVTHFVGCK  157

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  206
            PC G + + Y  E C  +M +A NFADNQVLR YGF H+ L
Sbjct  158  PC-GSYGD-YPVERCLRSMERAFNFADNQVLRLYGFSHKGL  196



>ref|XP_006838788.1| hypothetical protein AMTR_s00002p00259350 [Amborella trichopoda]
 gb|ERN01357.1| hypothetical protein AMTR_s00002p00259350 [Amborella trichopoda]
Length=439

 Score =   105 bits (261),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 58/164 (35%), Positives = 82/164 (50%), Gaps = 41/164 (25%)
 Frame = -3

Query  679  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  500
            G  L RT + +   E+DDQS ++YL++ ++EKWG+K+Y+ES YY  GYW  +V       
Sbjct  283  GKLLTRTLRGRPEFEADDQSAMVYLLITQREKWGDKVYLESAYYLHGYWGILV-------  335

Query  499  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  320
                                        ++++E + N   G    R P +THF GC+PC 
Sbjct  336  ----------------------------DRYEEMIENYHPGLGDHRWPLVTHFVGCKPCG  367

Query  319  --GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTA  194
              GD    YS E C   M +A NF DNQ+L+ YGFMH+ L   A
Sbjct  368  KFGD----YSVEKCLKQMDRAFNFGDNQILQMYGFMHKSLSSRA  407



>ref|XP_008453680.1| PREDICTED: putative glycosyltransferase 3 [Cucumis melo]
Length=197

 Score =   102 bits (254),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 56/161 (35%), Positives = 81/161 (50%), Gaps = 37/161 (23%)
 Frame = -3

Query  679  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  500
            G  L    K +   E+DDQS LIYL+L ++++W +K+++E+ YY  GYW  +V + + + 
Sbjct  39   GKILTANLKGRPAFEADDQSALIYLLLSQKDQWMDKVFLENSYYLHGYWAGLVDRYEEMI  98

Query  499  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  320
            + Y                                 + G G   W  PF+THF GC+PC 
Sbjct  99   EKY---------------------------------HPGLGDERW--PFVTHFVGCKPC-  122

Query  319  GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDT  197
            G + + Y  E C  +M +A NFADNQVL+ YGF HR LL  
Sbjct  123  GSYGD-YPVERCLSSMERAFNFADNQVLKLYGFRHRGLLSP  162



>gb|KHN48702.1| Putative glycosyltransferase 3 [Glycine soja]
Length=251

 Score =   103 bits (256),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 57/159 (36%), Positives = 81/159 (51%), Gaps = 37/159 (23%)
 Frame = -3

Query  679  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  500
            G  L    K +   E+DDQS LIYL+L ++EKW +K+++E+ +Y  GYW  +V + + + 
Sbjct  95   GKILTANLKGRPAFEADDQSALIYLLLSKKEKWMDKVFLENSFYLHGYWAGLVDRYEEMI  154

Query  499  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  320
            + Y                                 + G G   W  PF+THF GC+PC 
Sbjct  155  EKY---------------------------------HPGLGDERW--PFVTHFVGCKPC-  178

Query  319  GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLL  203
            G + + Y  E C  +M +A NFADNQVL+ YGF HR LL
Sbjct  179  GSYGD-YPVERCLSSMERAFNFADNQVLKLYGFRHRGLL  216



>ref|XP_002990216.1| glycosyltransferase CAZy family GT34-like protein [Selaginella 
moellendorffii]
 ref|XP_002992472.1| glycosyltransferase CAZy family GT34-like protein [Selaginella 
moellendorffii]
 gb|EFJ06410.1| glycosyltransferase CAZy family GT34-like protein [Selaginella 
moellendorffii]
 gb|EFJ08776.1| glycosyltransferase CAZy family GT34-like protein [Selaginella 
moellendorffii]
Length=455

 Score =   105 bits (261),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 59/153 (39%), Positives = 77/153 (50%), Gaps = 36/153 (24%)
 Frame = -3

Query  637  ESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNITDMYLGIEKTAAGEK  458
            ESDDQ   IYL+  ++  WG+K+Y+E+ Y+  GYW +IV K                   
Sbjct  329  ESDDQGAFIYLLNADRNTWGSKVYLENSYFLNGYWKDIVDKY------------------  370

Query  457  LRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCSGDHNEMYSGETCAD  278
                      E Y E       + G G   W  PF+THFTGCQ CSG  N +Y+ E C  
Sbjct  371  ----------EGYVES-----SHPGFGDDRW--PFVTHFTGCQICSGKINNVYTAEECTA  413

Query  277  AMHKALNFADNQVLRNYGFMHRDLLDTASVVPL  179
             M +AL  ADNQVL +YG+ H  L  TA +VP+
Sbjct  414  QMSRALTLADNQVLHSYGYAHPSLA-TAEIVPV  445



>ref|XP_004952632.1| PREDICTED: putative glycosyltransferase 5-like [Setaria italica]
Length=475

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/161 (36%), Positives = 81/161 (50%), Gaps = 37/161 (23%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            D  G  L    K +   E+DDQS LIYL+L ++EKW +K+++E+ YY  G+W  +V    
Sbjct  320  DQAGKVLTANLKGRPAFEADDQSALIYLLLSQKEKWMDKVFIENSYYLHGFWAGLV----  375

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
                                           +K++E + N   G    R PF+THF GC+
Sbjct  376  -------------------------------DKYEEMMENHHPGLGDERWPFVTHFVGCK  404

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  206
            PC G + + Y  E C  +M +A NFADNQVLR YGF H+ L
Sbjct  405  PC-GSYGD-YPVERCLKSMERAFNFADNQVLRLYGFSHKGL  443



>gb|EMT32015.1| Xyloglucan 6-xylosyltransferase [Aegilops tauschii]
Length=170

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/165 (34%), Positives = 82/165 (50%), Gaps = 36/165 (22%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            + +G        ++   E+DDQS L+YL+  E+ +WG+K+++ES Y+  G+W EIVG+  
Sbjct  9    ERYGRVFAEALSNRAAWEADDQSALVYLLATERGRWGDKVFLESSYHLHGFWEEIVGRY-  67

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
                           E++R R            W+      G G   W  P +THF GC+
Sbjct  68   ---------------EEMRSR------------WR-----PGLGDHRW--PLVTHFVGCK  93

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTA  194
            PC G+    Y    C + M +ALNFAD+Q+L  YGF H  L  TA
Sbjct  94   PC-GEPGATYEAAACREGMERALNFADDQILGLYGFQHESLGTTA  137



>gb|KCW44805.1| hypothetical protein EUGRSUZ_L01630 [Eucalyptus grandis]
Length=169

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 77/160 (48%), Gaps = 41/160 (26%)
 Frame = -3

Query  679  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  500
            G  L R  KD+   E+DDQS ++YL+  +++KWG K+Y+ES YY  GYW  +V       
Sbjct  12   GKILTRELKDRPVFEADDQSAMVYLLATQRDKWGEKVYLESAYYLHGYWGILV-------  64

Query  499  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  320
                                        ++++E + N   G    R P +THF GC+PC 
Sbjct  65   ----------------------------DRYEEMIENYHPGLGDHRWPLVTHFVGCKPCG  96

Query  319  --GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  206
              GD    Y  E C   M +A NF DNQ+L+ YGF H+ L
Sbjct  97   KFGD----YPVERCLKQMDRAFNFGDNQILQMYGFTHKSL  132



>ref|XP_010258549.1| PREDICTED: putative glycosyltransferase 5 isoform X2 [Nelumbo 
nucifera]
Length=457

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/164 (35%), Positives = 82/164 (50%), Gaps = 37/164 (23%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            D  G  L    K +   E+DDQS LIYL++ ++E+W NK+++E+ YY  GYW  +V + +
Sbjct  296  DEAGKILTANLKGRPAFEADDQSALIYLLMSKKEEWMNKVFIENSYYLHGYWAGLVDRYE  355

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
             + + Y                                 + G G   W  PF+THF GC+
Sbjct  356  EMIEKY---------------------------------HPGLGDERW--PFVTHFVGCK  380

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDT  197
            PC G + + Y  E C  +M +A NFADNQVL+ YGF HR LL  
Sbjct  381  PC-GSYGD-YPVERCLKSMERAFNFADNQVLKLYGFRHRGLLSP  422



>gb|KFK25153.1| hypothetical protein AALP_AA8G072800 [Arabis alpina]
Length=454

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 61/159 (38%), Positives = 81/159 (51%), Gaps = 37/159 (23%)
 Frame = -3

Query  679  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  500
            G  L    K +   E+DDQS LIYL+L ++EKW  K+YVE+ YY  G+W  +V K + + 
Sbjct  301  GKILTANLKGRPAFEADDQSALIYLLLSQKEKWMEKVYVENQYYLHGFWEGLVDKYEEMI  360

Query  499  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  320
            + Y                                 + G G   W  PFITHF GC+PC 
Sbjct  361  EKY---------------------------------HPGLGDERW--PFITHFVGCKPC-  384

Query  319  GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLL  203
            G + + Y+ E C  +M +A NFADNQVL+ YGF HR LL
Sbjct  385  GSYAD-YAVERCLKSMERAFNFADNQVLKLYGFGHRGLL  422



>ref|XP_006647332.1| PREDICTED: putative glycosyltransferase 5-like [Oryza brachyantha]
Length=481

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/161 (36%), Positives = 81/161 (50%), Gaps = 37/161 (23%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            D  G  L    K +   E+DDQS LIYL+L ++EKW +K+++E+ YY  G+W  +V    
Sbjct  326  DEAGKILTANLKGRPAFEADDQSALIYLLLSQKEKWMDKVFIENSYYLHGFWAGLV----  381

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
                                           +K++E + N   G    R PF+THF GC+
Sbjct  382  -------------------------------DKYEEMMENHHPGLGDERWPFVTHFVGCK  410

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  206
            PC G + + Y  E C  +M +A NFADNQVLR YGF H+ L
Sbjct  411  PC-GSYGD-YPVERCLKSMERAFNFADNQVLRLYGFAHKGL  449



>ref|XP_010040898.1| PREDICTED: xyloglucan 6-xylosyltransferase 2, partial [Eucalyptus 
grandis]
Length=179

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 77/160 (48%), Gaps = 41/160 (26%)
 Frame = -3

Query  679  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  500
            G  L R  KD+   E+DDQS ++YL+  +++KWG K+Y+ES YY  GYW  +V       
Sbjct  22   GKILTRELKDRPVFEADDQSAMVYLLATQRDKWGEKVYLESAYYLHGYWGILV-------  74

Query  499  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  320
                                        ++++E + N   G    R P +THF GC+PC 
Sbjct  75   ----------------------------DRYEEMIENYHPGLGDHRWPLVTHFVGCKPCG  106

Query  319  --GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  206
              GD    Y  E C   M +A NF DNQ+L+ YGF H+ L
Sbjct  107  KFGD----YPVERCLKQMDRAFNFGDNQILQMYGFTHKSL  142



>ref|XP_010258542.1| PREDICTED: putative glycosyltransferase 5 isoform X1 [Nelumbo 
nucifera]
Length=461

 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/164 (35%), Positives = 82/164 (50%), Gaps = 37/164 (23%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            D  G  L    K +   E+DDQS LIYL++ ++E+W NK+++E+ YY  GYW  +V + +
Sbjct  296  DEAGKILTANLKGRPAFEADDQSALIYLLMSKKEEWMNKVFIENSYYLHGYWAGLVDRYE  355

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
             + + Y                                 + G G   W  PF+THF GC+
Sbjct  356  EMIEKY---------------------------------HPGLGDERW--PFVTHFVGCK  380

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDT  197
            PC G + + Y  E C  +M +A NFADNQVL+ YGF HR LL  
Sbjct  381  PC-GSYGD-YPVERCLKSMERAFNFADNQVLKLYGFRHRGLLSP  422



>ref|XP_010943718.1| PREDICTED: putative glycosyltransferase 5 [Elaeis guineensis]
Length=453

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 59/158 (37%), Positives = 81/158 (51%), Gaps = 37/158 (23%)
 Frame = -3

Query  679  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  500
            G  L    K +   E+DDQS LIYL++ +Q++W +K+Y+E+ Y+  G+WV +V K + + 
Sbjct  302  GRILTANLKGRPAFEADDQSALIYLLISQQDRWSDKVYIENSYFLHGFWVGLVDKYEEMM  361

Query  499  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  320
            D                              K H    G G   W  PF+THF GC+PC 
Sbjct  362  D------------------------------KHH---PGLGDERW--PFVTHFVGCKPC-  385

Query  319  GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  206
            G + + Y  E C  +M +A NFADNQVLR YGF HR L
Sbjct  386  GSYGD-YPVERCLGSMERAFNFADNQVLRLYGFGHRGL  422



>gb|KEH31956.1| xyloglucan xylosyltransferase [Medicago truncatula]
Length=448

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/159 (36%), Positives = 81/159 (51%), Gaps = 37/159 (23%)
 Frame = -3

Query  679  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  500
            G  L    K +   E+DDQS LIYL+L ++EKW +K+++E+ YY  GYW  +V + + + 
Sbjct  292  GKILTANLKGRPAFEADDQSALIYLLLSKKEKWMDKVFLENSYYLHGYWAGLVDRYEEMI  351

Query  499  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  320
            + Y                                 + G G   W  PF+THF GC+PC 
Sbjct  352  EKY---------------------------------HPGLGDERW--PFVTHFVGCKPC-  375

Query  319  GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLL  203
            G + + Y  E C  +M +A NFADNQVL+ YGF HR LL
Sbjct  376  GSYGD-YPVERCLSSMERAFNFADNQVLKLYGFRHRGLL  413



>ref|XP_010030248.1| PREDICTED: putative glycosyltransferase 5 [Eucalyptus grandis]
 gb|KCW83656.1| hypothetical protein EUGRSUZ_B00540 [Eucalyptus grandis]
Length=449

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/162 (36%), Positives = 83/162 (51%), Gaps = 37/162 (23%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            D  G  L    K +   E+DDQS LIYL++ +++KW +K++VE+ YY  GYW+ +V + +
Sbjct  292  DEAGKILTANLKGRPAFEADDQSALIYLLISQKDKWMDKVFVENSYYLHGYWLGLVERYE  351

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
             + + Y                                 + G G   W  PF+THF GC+
Sbjct  352  EMIEKY---------------------------------HPGLGDERW--PFVTHFVGCK  376

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLL  203
            PC G + + Y  E C  +M +A NFADNQVL+ YGF HR LL
Sbjct  377  PC-GSYGD-YPVEKCLGSMERAFNFADNQVLKLYGFRHRGLL  416



>dbj|BAO02547.1| (1-6)-alpha-D-xylosyltransferase ortholog, partial [Nicotiana 
alata]
Length=303

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/163 (36%), Positives = 80/163 (49%), Gaps = 41/163 (25%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            D  G  L R  K +   E+DDQS +IY++  ++EKWG+K+Y+ES YY  GYW  +V    
Sbjct  142  DEAGAVLTRELKGRPVFEADDQSAMIYILATQKEKWGDKVYLESAYYLHGYWGILV----  197

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
                                           +K++E + N   G    R P +THF GC+
Sbjct  198  -------------------------------DKYEEMIENYHPGLGDHRWPLVTHFVGCK  226

Query  328  PCS--GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  206
            PC+  GD    YS E C   M +A NF DNQ+L+ YGF H+ L
Sbjct  227  PCAKFGD----YSVERCLKQMDRAFNFGDNQILQMYGFTHKSL  265



>dbj|BAK00169.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=441

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 61/160 (38%), Positives = 81/160 (51%), Gaps = 37/160 (23%)
 Frame = -3

Query  679  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  500
            G  L  +   +   E+DDQS LI+L+L E+E+W  K+YVE++YY  G+W  +V K     
Sbjct  290  GKVLTASLTGRPAFEADDQSALIHLLLTEKERWMEKVYVENEYYLHGFWAGLVDK-----  344

Query  499  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  320
                                      Y E  ++H  + G G   W  PFITHF GC+PC 
Sbjct  345  --------------------------YEEMMEKH--HPGLGDERW--PFITHFVGCKPC-  373

Query  319  GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLD  200
            G + + Y  E C   M +A NFADNQVLR YGF HR L +
Sbjct  374  GSYGD-YPVEQCLTGMERAFNFADNQVLRLYGFRHRSLTN  412



>ref|XP_010498276.1| PREDICTED: putative glycosyltransferase 5 [Camelina sativa]
Length=456

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 59/164 (36%), Positives = 84/164 (51%), Gaps = 37/164 (23%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            D  G  L    K +   E+DDQS LIY++L +++KW +K+YVE+ YY  G+W  +V K +
Sbjct  300  DEAGKVLTAYLKGRPAFEADDQSALIYILLSQKDKWIDKVYVENQYYLHGFWEGLVDKYE  359

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
             + + Y                                 + G G   W  PF+THF GC+
Sbjct  360  EMVEKY---------------------------------HPGLGDERW--PFVTHFVGCK  384

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDT  197
            PC G + + Y+ + C  +M +A NFADNQVL+ YGF HR LL T
Sbjct  385  PC-GSYAD-YAVDRCFKSMERAFNFADNQVLKLYGFSHRGLLST  426



>ref|XP_011047184.1| PREDICTED: putative glycosyltransferase 5 [Populus euphratica]
Length=453

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 61/176 (35%), Positives = 86/176 (49%), Gaps = 44/176 (25%)
 Frame = -3

Query  679  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  500
            G  L    K +   E+DDQS LIYL+L ++++W +K+Y+E+ YY  GYW  +V + + + 
Sbjct  297  GKILTANLKGRPAFEADDQSALIYLLLSQKDQWMDKVYIENQYYLHGYWAGLVDRYEEMM  356

Query  499  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  320
            + Y                                 + G G   W  PF+THF GC+PC 
Sbjct  357  EKY---------------------------------HPGLGDERW--PFVTHFVGCKPC-  380

Query  319  GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTA-------SVVPLPY  173
            G + + Y  E C  +M +A NFADNQVL+ YGF HR LL          +V PL Y
Sbjct  381  GSYGD-YPVEQCMRSMERAFNFADNQVLKLYGFGHRGLLSPKIKRIRNETVTPLEY  435



>ref|XP_002514720.1| Xyloglucan 6-xylosyltransferase, putative [Ricinus communis]
 gb|EEF47826.1| Xyloglucan 6-xylosyltransferase, putative [Ricinus communis]
Length=454

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 61/176 (35%), Positives = 86/176 (49%), Gaps = 44/176 (25%)
 Frame = -3

Query  679  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  500
            G  L    K +   E+DDQS LIYL+L ++++W +K+Y+E+ YY  GYW  +V + + + 
Sbjct  301  GKILTANLKGRPAFEADDQSALIYLLLSQKDQWMDKVYIENQYYLHGYWAGLVDRYEEMM  360

Query  499  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  320
            + Y                                 + G G   W  PF+THF GC+PC 
Sbjct  361  EKY---------------------------------HPGLGDERW--PFVTHFVGCKPC-  384

Query  319  GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTA-------SVVPLPY  173
            G + + Y  E C  +M +A NFADNQVL+ YGF HR LL          +V PL Y
Sbjct  385  GSYGD-YPVERCLKSMERAFNFADNQVLKLYGFGHRGLLSPKIKRIRNETVTPLEY  439



>emb|CDX85826.1| BnaC06g23080D [Brassica napus]
 emb|CDX68187.1| BnaA07g22270D [Brassica napus]
Length=223

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 61/179 (34%), Positives = 86/179 (48%), Gaps = 44/179 (25%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            D  G  L    K +   E+DDQS LIYL+L +++ W  K++VE+ YY  G+W  +V K +
Sbjct  64   DEAGKVLTAYLKGRPAFEADDQSALIYLLLSQKDTWMEKVFVENQYYLHGFWEGLVDKYE  123

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
             + + Y                                 + G G   W  PF+THF GC+
Sbjct  124  EMMEKY---------------------------------HPGLGDERW--PFVTHFVGCK  148

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTA-------SVVPLPY  173
            PC G + + Y+ E C  +M +A NFADNQVL+ YGF HR LL          +V PL +
Sbjct  149  PC-GSYAD-YAVERCLKSMERAFNFADNQVLKLYGFGHRGLLSPKIKRIRNETVTPLEF  205



>gb|KJB28609.1| hypothetical protein B456_005G060400 [Gossypium raimondii]
Length=447

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 57/160 (36%), Positives = 79/160 (49%), Gaps = 41/160 (26%)
 Frame = -3

Query  679  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  500
            G  L R  KD+   E+DDQS ++YL++KE+ KWG K+Y+E+ YY  GYW  +V       
Sbjct  289  GKILTRELKDRPVFEADDQSAIVYLLVKERAKWGEKVYLENAYYLHGYWGILV-------  341

Query  499  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  320
                                        ++++E + N   G    R P +THF GC+PC 
Sbjct  342  ----------------------------DRYEEMIENYHPGLGDHRWPLVTHFVGCKPCG  373

Query  319  --GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  206
              GD    YS E C   M +A NF DNQ+L+ YGF H+ L
Sbjct  374  KFGD----YSVERCLRQMDRAFNFGDNQILQMYGFTHKSL  409



>ref|XP_008239899.1| PREDICTED: putative glycosyltransferase 5 [Prunus mume]
 ref|XP_008239903.1| PREDICTED: putative glycosyltransferase 5 [Prunus mume]
Length=459

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 58/159 (36%), Positives = 81/159 (51%), Gaps = 37/159 (23%)
 Frame = -3

Query  679  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  500
            G  L    K +   E+DDQS LIYL+L ++++W +K+YVE+ YY  GYW  +V + + + 
Sbjct  302  GKILTANLKGRPAFEADDQSALIYLLLSQKDQWMDKVYVENSYYLHGYWAGLVDRYEEMI  361

Query  499  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  320
            + Y                                 + G G   W  PF+THF GC+PC 
Sbjct  362  EKY---------------------------------HPGLGDERW--PFVTHFVGCKPC-  385

Query  319  GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLL  203
            G + + Y  E C  +M +A NFADNQVL+ YGF HR LL
Sbjct  386  GSYGD-YPVERCLGSMERAFNFADNQVLKLYGFRHRGLL  423



>ref|XP_010098280.1| Xyloglucan 6-xylosyltransferase [Morus notabilis]
 gb|EXB74784.1| Xyloglucan 6-xylosyltransferase [Morus notabilis]
Length=463

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 58/163 (36%), Positives = 79/163 (48%), Gaps = 41/163 (25%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            D  G  L R  K +   E+DDQS ++YL++KE++KWG K+Y+ES YY  GYW  +V + +
Sbjct  298  DEAGKILTRELKGRPVFEADDQSAMVYLLMKERDKWGEKVYLESAYYLHGYWGILVDRYE  357

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
             + D Y                                 + G G   W  P +THF GC+
Sbjct  358  EMIDNY---------------------------------HPGLGDHRW--PLVTHFVGCK  382

Query  328  PCS--GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  206
            PC   GD    Y  E C   M +A NF DNQ+L+ YGF H+ L
Sbjct  383  PCGKFGD----YPVERCLKQMDRAFNFGDNQILQMYGFTHKSL  421



>ref|XP_008374566.1| PREDICTED: putative glycosyltransferase 5 [Malus domestica]
Length=458

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 58/159 (36%), Positives = 80/159 (50%), Gaps = 37/159 (23%)
 Frame = -3

Query  679  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  500
            G  L    K +   E+DDQS LIYL+L ++++W  K+YVE+ YY  GYW  +V + + + 
Sbjct  301  GKILTANLKGRPAFEADDQSALIYLLLSQKDQWMEKVYVENSYYLHGYWAGLVDRYEEMI  360

Query  499  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  320
            + Y                                 + G G   W  PF+THF GC+PC 
Sbjct  361  EKY---------------------------------HPGLGDERW--PFVTHFVGCKPC-  384

Query  319  GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLL  203
            G + + Y  E C  +M +A NFADNQVL+ YGF HR LL
Sbjct  385  GSYGD-YPVERCLSSMERAFNFADNQVLKLYGFRHRGLL  422



>ref|XP_009338860.1| PREDICTED: putative glycosyltransferase 5 [Pyrus x bretschneideri]
Length=460

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 58/159 (36%), Positives = 80/159 (50%), Gaps = 37/159 (23%)
 Frame = -3

Query  679  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  500
            G  L    K +   E+DDQS LIYL+L ++++W  K+YVE+ YY  GYW  +V + + + 
Sbjct  303  GKILTANLKGRPAFEADDQSALIYLLLSQKDQWMEKVYVENSYYLHGYWAGLVDRYEEMI  362

Query  499  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  320
            + Y                                 + G G   W  PF+THF GC+PC 
Sbjct  363  EKY---------------------------------HPGLGDERW--PFVTHFVGCKPC-  386

Query  319  GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLL  203
            G + + Y  E C  +M +A NFADNQVL+ YGF HR LL
Sbjct  387  GSYGD-YPVERCLSSMERAFNFADNQVLKLYGFRHRGLL  424



>ref|XP_007209124.1| hypothetical protein PRUPE_ppa005479mg [Prunus persica]
 gb|EMJ10323.1| hypothetical protein PRUPE_ppa005479mg [Prunus persica]
Length=459

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 58/159 (36%), Positives = 80/159 (50%), Gaps = 37/159 (23%)
 Frame = -3

Query  679  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  500
            G  L    K +   E+DDQS LIYL+L ++++W  K+YVE+ YY  GYW  +V + + + 
Sbjct  302  GKILTANLKGRPAFEADDQSALIYLLLSQKDQWMEKVYVENSYYLHGYWAGLVDRYEEMI  361

Query  499  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  320
            + Y                                 + G G   W  PF+THF GC+PC 
Sbjct  362  EKY---------------------------------HPGLGDERW--PFVTHFVGCKPC-  385

Query  319  GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLL  203
            G + + Y  E C  +M +A NFADNQVL+ YGF HR LL
Sbjct  386  GSYGD-YPVERCLSSMERAFNFADNQVLKLYGFRHRGLL  423



>ref|XP_009339134.1| PREDICTED: putative glycosyltransferase 5 [Pyrus x bretschneideri]
Length=460

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 58/159 (36%), Positives = 80/159 (50%), Gaps = 37/159 (23%)
 Frame = -3

Query  679  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  500
            G  L    K +   E+DDQS LIYL+L ++++W  K+YVE+ YY  GYW  +V + + + 
Sbjct  303  GKILTANLKGRPAFEADDQSALIYLLLSQKDQWMEKVYVENSYYLHGYWAGLVDRYEEMI  362

Query  499  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  320
            + Y                                 + G G   W  PF+THF GC+PC 
Sbjct  363  EKY---------------------------------HPGLGDERW--PFVTHFVGCKPC-  386

Query  319  GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLL  203
            G + + Y  E C  +M +A NFADNQVL+ YGF HR LL
Sbjct  387  GSYGD-YPVERCLSSMERAFNFADNQVLKLYGFRHRGLL  424



>ref|XP_004508717.1| PREDICTED: putative glycosyltransferase 5-like [Cicer arietinum]
Length=446

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 61/176 (35%), Positives = 85/176 (48%), Gaps = 44/176 (25%)
 Frame = -3

Query  679  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  500
            G  L    K +   E+DDQS LIYL+L ++EKW  K+++E+ YY  GYW  +V + + + 
Sbjct  290  GKVLTANLKGRPAFEADDQSALIYLLLSKKEKWMGKVFLENSYYLHGYWAGLVDRYEEMI  349

Query  499  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  320
            + Y                                 + G G   W  PF+THF GC+PC 
Sbjct  350  EKY---------------------------------HPGLGDERW--PFVTHFVGCKPC-  373

Query  319  GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTA-------SVVPLPY  173
            G + + Y  E C  +M +A NFADNQVL+ YGF HR LL          +V PL +
Sbjct  374  GSYGD-YPVERCLSSMERAFNFADNQVLKLYGFRHRGLLSPKIKRIRNETVTPLEF  428



>gb|KHN43518.1| Xyloglucan 6-xylosyltransferase [Glycine soja]
Length=430

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 58/163 (36%), Positives = 78/163 (48%), Gaps = 41/163 (25%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            D  G  L R  KD+   E+DDQS ++YL+ KE+EKWG K+Y+E+ YY  GYW  +V    
Sbjct  272  DEAGKVLTRELKDRPVFEADDQSAMVYLLAKEREKWGGKVYLENGYYLHGYWGILV----  327

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
                                           ++++E + N   G    R P +THF GC+
Sbjct  328  -------------------------------DRYEEMIENYHPGFGDHRWPLVTHFVGCK  356

Query  328  PCS--GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  206
            PC   GD    Y  E C   M +A NF DNQ+L  YGF H+ L
Sbjct  357  PCGKFGD----YPVERCLKQMDRAFNFGDNQILHIYGFTHKSL  395



>gb|EMT32465.1| Putative glycosyltransferase 3 [Aegilops tauschii]
Length=445

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 61/158 (39%), Positives = 79/158 (50%), Gaps = 37/158 (23%)
 Frame = -3

Query  679  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  500
            G  L  +   +   E+DDQS LI+L+L E+E+W  K+YVE+ YY  G+W  +V K     
Sbjct  294  GKVLTASLTGRPAFEADDQSALIHLLLTEKERWMEKVYVENQYYLHGFWAGLVDK-----  348

Query  499  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  320
                                      Y E  ++H  + G G   W  PFITHF GC+PC 
Sbjct  349  --------------------------YEEMMEKH--HPGLGDERW--PFITHFVGCKPC-  377

Query  319  GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  206
            G + + Y  E C   M +A NFADNQVLR YGF HR L
Sbjct  378  GSYGD-YPVEQCLTGMERAFNFADNQVLRLYGFRHRSL  414



>ref|XP_006374450.1| hypothetical protein POPTR_0015s07290g [Populus trichocarpa]
 gb|ERP52247.1| hypothetical protein POPTR_0015s07290g [Populus trichocarpa]
Length=453

 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 61/176 (35%), Positives = 85/176 (48%), Gaps = 44/176 (25%)
 Frame = -3

Query  679  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  500
            G  L    K +   E+DDQS LIYL+L ++ +W +K+Y+E+ YY  GYW  +V + + + 
Sbjct  297  GKILTANLKGRPAFEADDQSALIYLLLSQKAQWMDKVYIENQYYLHGYWAGLVDRYEEMM  356

Query  499  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  320
            + Y                                 + G G   W  PF+THF GC+PC 
Sbjct  357  EKY---------------------------------HPGLGDERW--PFVTHFVGCKPC-  380

Query  319  GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTA-------SVVPLPY  173
            G + + Y  E C  +M +A NFADNQVL+ YGF HR LL          +V PL Y
Sbjct  381  GSYGD-YPVEQCMRSMERAFNFADNQVLKLYGFGHRGLLSPKIKRIRNETVTPLEY  435



>ref|XP_006494985.1| PREDICTED: putative glycosyltransferase 3-like [Citrus sinensis]
Length=458

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 57/162 (35%), Positives = 84/162 (52%), Gaps = 37/162 (23%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            D  G  +    K +   E+DDQS LIYL+L +++KW +K+++ES++Y  GYWV +V + +
Sbjct  301  DEAGKIMTAYLKGRPAFEADDQSALIYLLLTQKDKWIDKVFIESEFYLHGYWVGLVDRYE  360

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
             + + Y                                 + G G   W  PF+THF GC+
Sbjct  361  EMMEKY---------------------------------HPGLGDERW--PFVTHFVGCK  385

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLL  203
            PC G + + Y  E C  +M +A NFADNQV++ YGF HR LL
Sbjct  386  PC-GSYGD-YPVERCLKSMERAFNFADNQVIKLYGFGHRGLL  425



>ref|XP_006440652.1| hypothetical protein CICLE_v10020086mg [Citrus clementina]
 gb|ESR53892.1| hypothetical protein CICLE_v10020086mg [Citrus clementina]
 gb|KDO55481.1| hypothetical protein CISIN_1g012705mg [Citrus sinensis]
Length=458

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 57/162 (35%), Positives = 84/162 (52%), Gaps = 37/162 (23%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            D  G  +    K +   E+DDQS LIYL+L +++KW +K+++ES++Y  GYWV +V + +
Sbjct  301  DEAGKIMTAYLKGRPAFEADDQSALIYLLLTQKDKWIDKVFIESEFYLHGYWVGLVDRYE  360

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
             + + Y                                 + G G   W  PF+THF GC+
Sbjct  361  EMMEKY---------------------------------HPGLGDERW--PFVTHFVGCK  385

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLL  203
            PC G + + Y  E C  +M +A NFADNQV++ YGF HR LL
Sbjct  386  PC-GSYGD-YPVERCLKSMERAFNFADNQVIKLYGFGHRGLL  425



>gb|EYU45549.1| hypothetical protein MIMGU_mgv1a027105mg [Erythranthe guttata]
Length=460

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 54/158 (34%), Positives = 79/158 (50%), Gaps = 36/158 (23%)
 Frame = -3

Query  679  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  500
            G  L R  KD+   E+DDQS ++Y++  ++EKWG+K+Y+E+ Y+  GYW  +V K + + 
Sbjct  305  GEILTRELKDRPVFEADDQSAMVYILATQKEKWGDKVYLENWYFLHGYWGILVDKFEEMI  364

Query  499  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  320
            + Y                                 + G G   W  P +THF GC+PC 
Sbjct  365  ENY---------------------------------HPGLGDHRW--PLVTHFVGCKPC-  388

Query  319  GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  206
            G   + YS E C   M +A NF DNQ+L+ YGF H+ L
Sbjct  389  GKFKDYYSVEKCLKQMDRAFNFGDNQILQMYGFTHKSL  426



>dbj|BAK03947.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=478

 Score =   103 bits (258),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 57/158 (36%), Positives = 80/158 (51%), Gaps = 37/158 (23%)
 Frame = -3

Query  679  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  500
            G  L    K +   E+DDQS LIYL+L ++EKW +K+Y+E+ YY  G+W  +V       
Sbjct  326  GKILTAYLKGRPAFEADDQSALIYLLLSQKEKWMDKVYIENSYYLHGFWAGLV-------  378

Query  499  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  320
                                        +K++E + N   G    R PF+THF GC+PC 
Sbjct  379  ----------------------------DKYEEMMENHHPGLGDERWPFVTHFVGCKPC-  409

Query  319  GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  206
            G + + Y  + C  +M +A NFADNQVLR YGF H+ L
Sbjct  410  GSYGD-YPVDRCLKSMERAFNFADNQVLRLYGFAHKGL  446



>gb|AFW71661.1| putative glycosyltransferase [Zea mays]
Length=478

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 81/161 (50%), Gaps = 37/161 (23%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            D  G  L    K +   E+DDQS LIYL+L +++KW +K+++E+ YY  G+W  +V    
Sbjct  323  DQAGKVLTANLKGRPAFEADDQSALIYLLLSQKDKWMDKVFIENSYYLHGFWAGLV----  378

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
                                           +K++E + N   G    R PF+THF GC+
Sbjct  379  -------------------------------DKYEEMMENHHPGLGDERWPFVTHFVGCK  407

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  206
            PC G + + Y  E C  +M +A NFADNQVLR YGF H+ L
Sbjct  408  PC-GSYGD-YPVERCLRSMERAFNFADNQVLRLYGFSHKGL  446



>ref|NP_001105849.1| putative glycosyltransferase [Zea mays]
 emb|CAJ57382.1| putative glycosyltransferase [Zea mays]
Length=478

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 81/161 (50%), Gaps = 37/161 (23%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            D  G  L    K +   E+DDQS LIYL+L +++KW +K+++E+ YY  G+W  +V    
Sbjct  323  DQAGKVLTANLKGRPAFEADDQSALIYLLLSQKDKWMDKVFIENSYYLHGFWAGLV----  378

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
                                           +K++E + N   G    R PF+THF GC+
Sbjct  379  -------------------------------DKYEEMMENHHPGLGDERWPFVTHFVGCK  407

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  206
            PC G + + Y  E C  +M +A NFADNQVLR YGF H+ L
Sbjct  408  PC-GSYGD-YPVERCLRSMERAFNFADNQVLRLYGFSHKGL  446



>gb|AFK30382.1| galactosyltransferase A [Triticum aestivum]
Length=478

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 57/158 (36%), Positives = 80/158 (51%), Gaps = 37/158 (23%)
 Frame = -3

Query  679  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  500
            G  L    K +   E+DDQS LIYL+L ++EKW +K+Y+E+ YY  G+W  +V       
Sbjct  326  GKILTAYLKGRPAFEADDQSALIYLLLSQKEKWMDKVYIENSYYLHGFWAGLV-------  378

Query  499  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  320
                                        +K++E + N   G    R PF+THF GC+PC 
Sbjct  379  ----------------------------DKYEEMMENHHPGLGDERWPFVTHFVGCKPC-  409

Query  319  GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  206
            G + + Y  + C  +M +A NFADNQVLR YGF H+ L
Sbjct  410  GSYGD-YPVDRCLKSMERAFNFADNQVLRLYGFAHKGL  446



>ref|XP_002453927.1| hypothetical protein SORBIDRAFT_04g021570 [Sorghum bicolor]
 gb|EES06903.1| hypothetical protein SORBIDRAFT_04g021570 [Sorghum bicolor]
Length=480

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 81/161 (50%), Gaps = 37/161 (23%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            D  G  L    K +   E+DDQS LIYL+L +++KW +K+++E+ YY  G+W  +V    
Sbjct  325  DQAGKVLTANLKGRPAFEADDQSALIYLLLSQKDKWMDKVFIENSYYLHGFWAGLV----  380

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
                                           +K++E + N   G    R PF+THF GC+
Sbjct  381  -------------------------------DKYEEMMENHHPGLGDERWPFVTHFVGCK  409

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  206
            PC G + + Y  E C  +M +A NFADNQVLR YGF H+ L
Sbjct  410  PC-GSYGD-YPVERCLRSMERAFNFADNQVLRLYGFSHKGL  448



>ref|XP_010497538.1| PREDICTED: putative glycosyltransferase 5, partial [Camelina 
sativa]
Length=182

 Score =   100 bits (248),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 60/179 (34%), Positives = 86/179 (48%), Gaps = 44/179 (25%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            D  G  L    K +   E+DDQS LIYL+L +++ W  K++VE+ YY  G+W  +V + +
Sbjct  34   DEAGKVLTAYLKGRPAFEADDQSALIYLLLSQKDTWMEKVFVENQYYLHGFWEGLVDRYE  93

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
             + + Y                                 + G G   W  PF+THF GC+
Sbjct  94   EMVEKY---------------------------------HPGLGDERW--PFVTHFVGCK  118

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTA-------SVVPLPY  173
            PC G + + Y+ E C  +M +A NFADNQVL+ YGF HR LL          +V PL +
Sbjct  119  PC-GSYAD-YAVERCLKSMERAFNFADNQVLKLYGFGHRGLLSPKIKRIRNETVTPLEF  175



>ref|XP_010477058.1| PREDICTED: putative glycosyltransferase 4 [Camelina sativa]
 ref|XP_010477059.1| PREDICTED: putative glycosyltransferase 4 [Camelina sativa]
 ref|XP_010477061.1| PREDICTED: putative glycosyltransferase 4 [Camelina sativa]
 ref|XP_010477062.1| PREDICTED: putative glycosyltransferase 4 [Camelina sativa]
 ref|XP_010477063.1| PREDICTED: putative glycosyltransferase 4 [Camelina sativa]
Length=456

 Score =   103 bits (256),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 59/162 (36%), Positives = 83/162 (51%), Gaps = 37/162 (23%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            D  G  L    K +   E+DDQS LIYL+L +++KW +K+YVE+ YY  G+W  +V K +
Sbjct  300  DEAGKVLTAYLKGRPAFEADDQSALIYLLLSQKDKWIDKVYVENQYYLHGFWEGLVDKYE  359

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
             + + Y                                 + G G   W  PF+THF GC+
Sbjct  360  EMVEKY---------------------------------HPGLGDERW--PFVTHFVGCK  384

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLL  203
            PC G + + Y+ + C  +M +A NFADNQVL+ YGF HR LL
Sbjct  385  PC-GSYAD-YAVDRCFKSMERAFNFADNQVLKLYGFSHRGLL  424



>ref|XP_001767750.1| predicted protein [Physcomitrella patens]
 gb|EDQ67501.1| predicted protein [Physcomitrella patens]
Length=406

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 57/158 (36%), Positives = 80/158 (51%), Gaps = 33/158 (21%)
 Frame = -3

Query  679  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  500
            G  L  T   +   E+DDQS L+YL+   +EKWG+K+++E  Y   GYWV +V +L+ + 
Sbjct  257  GKLLTATLAGRPEFEADDQSALVYLLAMNKEKWGSKVFLEHSYCLHGYWVMLVERLEEL-  315

Query  499  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  320
             M LG      GEK                            + +R PF+THF GC+PC 
Sbjct  316  -MELG---PRGGEK----------------------------NSFRWPFVTHFVGCKPCG  343

Query  319  GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  206
             D    Y+ + C   M +A NFADNQ+L +YGF H+ L
Sbjct  344  RDGTSHYATDRCLKHMERAFNFADNQILEHYGFHHQTL  381



>ref|XP_009764347.1| PREDICTED: putative glycosyltransferase 5 [Nicotiana sylvestris]
Length=455

 Score =   103 bits (256),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 58/162 (36%), Positives = 80/162 (49%), Gaps = 37/162 (23%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            D  G  L    KD+   E+DDQS LIYL + +++KW  K++VE+ YY  GYW  +V + +
Sbjct  300  DEAGKILTANLKDRPAFEADDQSALIYLFVSQKDKWMQKVFVENSYYLHGYWAGLVDRYE  359

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
             + + Y                                 + G G   W  PF+THF GC+
Sbjct  360  EMIEKY---------------------------------HPGLGDERW--PFVTHFVGCK  384

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLL  203
            PC G + + Y  E C  +M +A NFADNQVL  YGF H+ LL
Sbjct  385  PC-GSYGD-YPVERCLKSMERAFNFADNQVLNLYGFRHKGLL  424



>ref|XP_003554517.1| PREDICTED: putative glycosyltransferase 2-like [Glycine max]
Length=455

 Score =   103 bits (256),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 58/163 (36%), Positives = 78/163 (48%), Gaps = 41/163 (25%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            D  G  L R  KD+   E+DDQS ++YL+ KE+EKWG K+Y+E+ YY  GYW  +V    
Sbjct  297  DEAGKVLTRELKDRPVFEADDQSAMVYLLAKEREKWGGKVYLENGYYLHGYWGILV----  352

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
                                           ++++E + N   G    R P +THF GC+
Sbjct  353  -------------------------------DRYEEMIENYHPGFGDHRWPLVTHFVGCK  381

Query  328  PCS--GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  206
            PC   GD    Y  E C   M +A NF DNQ+L  YGF H+ L
Sbjct  382  PCGKFGD----YPVERCLKQMDRAFNFGDNQILHIYGFTHKSL  420



>gb|KJB50959.1| hypothetical protein B456_008G195000 [Gossypium raimondii]
Length=460

 Score =   103 bits (256),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 57/159 (36%), Positives = 82/159 (52%), Gaps = 37/159 (23%)
 Frame = -3

Query  679  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  500
            G  L    K +   E+DDQS LIYL+L ++++W +K+++E+ YY  GYW  +V + + + 
Sbjct  304  GRILTANLKGRPAFEADDQSALIYLLLSQKDQWMDKVFIENQYYLHGYWAGLVDRYEEMM  363

Query  499  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  320
            + Y                                 + G G   W  PF+THF GC+PC 
Sbjct  364  EKY---------------------------------HPGLGDERW--PFVTHFVGCKPC-  387

Query  319  GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLL  203
            G + + YS E C  +M +A NFADNQVL+ YGF HR LL
Sbjct  388  GSYGD-YSVERCLRSMQRAFNFADNQVLKLYGFRHRGLL  425



>ref|NP_001049886.1| Os03g0305800 [Oryza sativa Japonica Group]
 gb|ABF95525.1| Glycosyltransferase 5, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF11800.1| Os03g0305800 [Oryza sativa Japonica Group]
 gb|EAY89695.1| hypothetical protein OsI_11231 [Oryza sativa Indica Group]
 gb|EAZ26651.1| hypothetical protein OsJ_10555 [Oryza sativa Japonica Group]
 dbj|BAG97093.1| unnamed protein product [Oryza sativa Japonica Group]
Length=483

 Score =   103 bits (256),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 60/167 (36%), Positives = 87/167 (52%), Gaps = 36/167 (22%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            D +G     T  ++   E+DDQS L++L++ ++ +WG K+++E+ Y   G+W +IV    
Sbjct  313  DMYGKIFAETLTNRPPYEADDQSALVFLLVTQRHRWGAKVFLENSYNLHGFWADIV----  368

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
               D Y         E++RR            +W    R+ G G   W  P ITHF GC+
Sbjct  369  ---DRY---------EEMRR------------QW----RHPGLGDDRW--PLITHFVGCK  398

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASV  188
            PC GD +  Y GE C   M +A NFAD+Q+L  YGF H   LDT +V
Sbjct  399  PCGGD-DASYDGERCRRGMDRAFNFADDQILELYGFAHES-LDTMAV  443



>ref|XP_003558113.1| PREDICTED: xyloglucan 6-xylosyltransferase 2-like [Brachypodium 
distachyon]
Length=445

 Score =   102 bits (255),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 57/160 (36%), Positives = 79/160 (49%), Gaps = 41/160 (26%)
 Frame = -3

Query  679  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  500
            G  L +  KD+   E+DDQS ++Y++  ++EKWGNK+Y+E+ YY  GYW  +V       
Sbjct  289  GRVLTKHLKDRPVFEADDQSAMVYILATQREKWGNKVYLENGYYLHGYWGILV-------  341

Query  499  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  320
                                        ++++E L N   G    R P +THF GC+PCS
Sbjct  342  ----------------------------DRYEEMLENYKPGLGDHRWPLVTHFVGCKPCS  373

Query  319  --GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  206
              GD    Y  E C   M +A NF DNQVL+ YGF H+ L
Sbjct  374  KFGD----YPVERCLKQMDRAFNFGDNQVLQMYGFEHKSL  409



>gb|KDP31286.1| hypothetical protein JCGZ_11662 [Jatropha curcas]
Length=422

 Score =   102 bits (254),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 57/159 (36%), Positives = 81/159 (51%), Gaps = 37/159 (23%)
 Frame = -3

Query  679  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  500
            G  L    K +   E+DDQS LIYL+L ++++W +K+Y+E+ YY  GYW  +V + + + 
Sbjct  266  GRILTANLKGRPAFEADDQSALIYLLLSQKDQWMDKVYIENQYYLHGYWAGLVDRYEEMI  325

Query  499  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  320
            + Y                                 + G G   W  PF+THF GC+PC 
Sbjct  326  EKY---------------------------------HPGLGDERW--PFVTHFVGCKPC-  349

Query  319  GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLL  203
            G + + Y  E C  +M +A NFADNQVL+ YGF HR LL
Sbjct  350  GSYGD-YPVEQCLRSMERAFNFADNQVLKLYGFGHRGLL  387



>ref|XP_009600562.1| PREDICTED: xyloglucan 6-xylosyltransferase 2 [Nicotiana tomentosiformis]
Length=464

 Score =   103 bits (256),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 57/163 (35%), Positives = 80/163 (49%), Gaps = 41/163 (25%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            D  G  L R  K +   E+DDQS ++Y++  ++EKWG+K+Y+ES YY  GYW  +V    
Sbjct  303  DEAGAVLTRELKGRPVFEADDQSAMVYILATQKEKWGDKVYLESAYYLHGYWGILV----  358

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
                                           +K++E + N   G    R P +THF GC+
Sbjct  359  -------------------------------DKYEEMIENYHPGLGDHRWPLVTHFVGCK  387

Query  328  PCS--GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  206
            PC+  GD    YS E C   M +A NF DNQ+L+ YGF H+ L
Sbjct  388  PCAKFGD----YSVERCLKQMDRAFNFGDNQILQMYGFTHKSL  426



>emb|CDX96540.1| BnaA07g31510D [Brassica napus]
 emb|CDX73082.1| BnaC06g35300D [Brassica napus]
Length=222

 Score =   100 bits (249),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 59/179 (33%), Positives = 84/179 (47%), Gaps = 44/179 (25%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            D  G  L    K +   E+DDQS LIYL+L +++ W  K++VE+ YY  G+W  +V + +
Sbjct  64   DEAGKVLTAYLKGRPAFEADDQSALIYLLLSQKDTWMEKVFVENQYYLHGFWEGLVDRYE  123

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
             + + Y                                 + G G   W  PF+THF GC+
Sbjct  124  EMMEKY---------------------------------HPGLGDERW--PFVTHFVGCK  148

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTA-------SVVPLPY  173
            PC    +  Y+ E C  +M +A NFADNQVL+ YGF HR LL          +V PL +
Sbjct  149  PCGSYAD--YAVERCLKSMERAFNFADNQVLKLYGFGHRGLLSPKIKRIRNETVAPLEF  205



>ref|XP_008393187.1| PREDICTED: putative glycosyltransferase 5 [Malus domestica]
Length=460

 Score =   102 bits (255),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 58/159 (36%), Positives = 79/159 (50%), Gaps = 37/159 (23%)
 Frame = -3

Query  679  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  500
            G  L    K +   E+DDQS LIYL+L +++ W  K+YVE+ YY  GYW  +V + + + 
Sbjct  303  GKILTANLKGRPAFEADDQSALIYLLLSQKDXWMEKVYVENSYYLHGYWAGLVDRYEEMI  362

Query  499  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  320
            + Y                                 + G G   W  PF+THF GC+PC 
Sbjct  363  EKY---------------------------------HPGLGDERW--PFVTHFVGCKPC-  386

Query  319  GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLL  203
            G + + Y  E C  +M +A NFADNQVL+ YGF HR LL
Sbjct  387  GSYGD-YPVERCLSSMERAFNFADNQVLKLYGFRHRGLL  424



>ref|XP_009780568.1| PREDICTED: xyloglucan 6-xylosyltransferase 2-like [Nicotiana 
sylvestris]
Length=466

 Score =   103 bits (256),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 57/163 (35%), Positives = 80/163 (49%), Gaps = 41/163 (25%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            D  G  L R  K +   E+DDQS ++Y++  ++EKWG+K+Y+ES YY  GYW  +V    
Sbjct  305  DEAGAVLTRELKGRPVFEADDQSAMVYILATQKEKWGDKVYLESAYYLHGYWGILV----  360

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
                                           +K++E + N   G    R P +THF GC+
Sbjct  361  -------------------------------DKYEEMIENYHPGLGDHRWPLVTHFVGCK  389

Query  328  PCS--GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  206
            PC+  GD    YS E C   M +A NF DNQ+L+ YGF H+ L
Sbjct  390  PCAKFGD----YSVERCLKQMDRAFNFGDNQILQMYGFTHKSL  428



>ref|XP_010459505.1| PREDICTED: putative glycosyltransferase 4 [Camelina sativa]
 ref|XP_010459506.1| PREDICTED: putative glycosyltransferase 4 [Camelina sativa]
 ref|XP_010459508.1| PREDICTED: putative glycosyltransferase 4 [Camelina sativa]
 ref|XP_010459509.1| PREDICTED: putative glycosyltransferase 4 [Camelina sativa]
Length=472

 Score =   103 bits (256),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 59/162 (36%), Positives = 83/162 (51%), Gaps = 37/162 (23%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            D  G  L    K +   E+DDQS LIYL+L +++KW +K+YVE+ YY  G+W  +V K +
Sbjct  316  DEAGKVLTAYLKGRPAFEADDQSALIYLLLSQKDKWIDKVYVENQYYLHGFWEGLVDKYE  375

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
             + + Y                                 + G G   W  PF+THF GC+
Sbjct  376  EMVEKY---------------------------------HPGLGDERW--PFVTHFVGCK  400

Query  328  PCSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLL  203
            PC G + + Y+ + C  +M +A NFADNQVL+ YGF HR LL
Sbjct  401  PC-GSYAD-YAVDRCFKSMERAFNFADNQVLKLYGFSHRGLL  440



>gb|KHN18571.1| Putative glycosyltransferase 3 [Glycine soja]
Length=249

 Score =   100 bits (250),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 56/159 (35%), Positives = 80/159 (50%), Gaps = 37/159 (23%)
 Frame = -3

Query  679  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  500
            G  L    K +   E+DDQS LIYL+L ++EKW ++ ++E+ +Y  GYW  +V + + + 
Sbjct  93   GKILTANLKGRPAFEADDQSALIYLLLSKKEKWMDRTFLENSFYLHGYWAGLVDRYEEMI  152

Query  499  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  320
            + Y                                 + G G   W  PF+THF GC+PC 
Sbjct  153  EKY---------------------------------HPGLGDERW--PFVTHFVGCKPC-  176

Query  319  GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLL  203
            G + + Y  E C  +M +A NFADNQVL+ YGF HR LL
Sbjct  177  GSYGD-YPVERCLSSMERAFNFADNQVLKLYGFRHRGLL  214



>ref|XP_003524717.1| PREDICTED: putative glycosyltransferase 5-like [Glycine max]
Length=447

 Score =   102 bits (254),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 57/159 (36%), Positives = 81/159 (51%), Gaps = 37/159 (23%)
 Frame = -3

Query  679  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  500
            G  L    K +   E+DDQS LIYL+L ++EKW +K+++E+ +Y  GYW  +V + + + 
Sbjct  291  GKILTANLKGRPAFEADDQSALIYLLLSKKEKWMDKVFLENSFYLHGYWAGLVDRYEEMI  350

Query  499  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  320
            + Y                                 + G G   W  PF+THF GC+PC 
Sbjct  351  EKY---------------------------------HPGLGDERW--PFVTHFVGCKPC-  374

Query  319  GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLL  203
            G + + Y  E C  +M +A NFADNQVL+ YGF HR LL
Sbjct  375  GSYGD-YPVERCLSSMERAFNFADNQVLKLYGFRHRGLL  412



>gb|EMS58373.1| Putative glycosyltransferase 2 [Triticum urartu]
Length=378

 Score =   102 bits (253),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 57/160 (36%), Positives = 78/160 (49%), Gaps = 41/160 (26%)
 Frame = -3

Query  679  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  500
            G  L +  KD+   E+DDQS ++Y++  ++EKWGNK+Y+E+ YY  GYW  +V       
Sbjct  222  GKVLTKYLKDRPVFEADDQSAMVYILATQREKWGNKVYLENGYYLHGYWGILV-------  274

Query  499  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  320
                                        ++++E L N   G    R P +THF GC+PCS
Sbjct  275  ----------------------------DRYEEMLENYQPGLGDHRWPLVTHFVGCKPCS  306

Query  319  --GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  206
              GD    Y  E C   M +A NF DNQVL  YGF H+ L
Sbjct  307  KFGD----YPVERCLKQMDRAFNFGDNQVLHMYGFEHKSL  342



>ref|XP_010522780.1| PREDICTED: xyloglucan 6-xylosyltransferase 2 [Tarenaya hassleriana]
 ref|XP_010522781.1| PREDICTED: xyloglucan 6-xylosyltransferase 2 [Tarenaya hassleriana]
Length=463

 Score =   102 bits (255),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 57/160 (36%), Positives = 77/160 (48%), Gaps = 41/160 (26%)
 Frame = -3

Query  679  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  500
            G  L R  KD+   E+DDQS ++YL+  ++E WGNK+Y+ES YY  GYW  +V + + + 
Sbjct  304  GKLLTRELKDRPVFEADDQSAMVYLLATQRETWGNKVYLESAYYLHGYWGILVDRYEEMI  363

Query  499  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  320
            D Y                                 + G G   W  P +THF GC+PC 
Sbjct  364  DNY---------------------------------HPGLGDHRW--PLVTHFVGCKPCG  388

Query  319  --GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  206
              GD    Y  E C   M +A NF DNQ+L+ YGF H+ L
Sbjct  389  KFGD----YPVERCLKQMDRAFNFGDNQILQIYGFTHKSL  424



>ref|XP_004500012.1| PREDICTED: putative glycosyltransferase 5-like [Cicer arietinum]
Length=452

 Score =   102 bits (254),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 60/176 (34%), Positives = 86/176 (49%), Gaps = 44/176 (25%)
 Frame = -3

Query  679  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  500
            G  L    K +   E+DDQS LIYL+L +++KW +K+++E+ YY  GYW  +V + + + 
Sbjct  296  GKILTANLKGRPAFEADDQSALIYLLLSKKDKWMDKVFLENSYYLHGYWAGLVDRYEEMM  355

Query  499  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  320
            + Y                                 + G G   W  PF+THF GC+PC 
Sbjct  356  EKY---------------------------------HPGLGDERW--PFVTHFVGCKPC-  379

Query  319  GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTA-------SVVPLPY  173
            G + + Y  E C  +M +A NFADNQVL+ YGF HR LL          +V PL +
Sbjct  380  GSYGD-YPVERCLSSMERAFNFADNQVLKLYGFRHRGLLSPKIKRIRNETVTPLEF  434



>ref|XP_007050873.1| Alpha-1,6-xylosyltransferase isoform 1 [Theobroma cacao]
 gb|EOX95030.1| Alpha-1,6-xylosyltransferase isoform 1 [Theobroma cacao]
Length=455

 Score =   102 bits (255),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 78/160 (49%), Gaps = 41/160 (26%)
 Frame = -3

Query  679  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  500
            G  L R  KD+   E+DDQS ++YL+  ++EKWG+K+Y+ES YY  GYW  +V       
Sbjct  302  GKVLTRELKDRPVFEADDQSAMVYLLATQREKWGDKVYLESAYYLHGYWGILV-------  354

Query  499  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  320
                                        ++++E + N   G    R P +THF GC+PC 
Sbjct  355  ----------------------------DRYEEMIENYHPGLGDHRWPLVTHFVGCKPCG  386

Query  319  --GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  206
              GD    Y  E C   M +A NF DNQ+L+ YGF H+ L
Sbjct  387  KFGD----YPVERCLKQMDRAFNFGDNQILQIYGFTHKSL  422



>gb|KDP27794.1| hypothetical protein JCGZ_18874 [Jatropha curcas]
Length=463

 Score =   102 bits (255),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 56/163 (34%), Positives = 79/163 (48%), Gaps = 41/163 (25%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            D  G  L R  KD+   E+DDQS ++YL+  +++KWG+K+Y+ES YY  GYW  +V    
Sbjct  302  DEAGKVLTRELKDRPVFEADDQSAMVYLLATQRDKWGDKVYLESAYYLHGYWGILV----  357

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
                                           ++++E + N   G    R P +THF GC+
Sbjct  358  -------------------------------DRYEEMIENYHPGLGDHRWPLVTHFVGCK  386

Query  328  PCS--GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  206
            PC   GD    Y  E C   M +A NF DNQ+L+ YGF H+ L
Sbjct  387  PCGKFGD----YPVERCLKQMDRAFNFGDNQILQMYGFTHKSL  425



>ref|XP_002318600.2| hypothetical protein POPTR_0012s07020g [Populus trichocarpa]
 gb|EEE96820.2| hypothetical protein POPTR_0012s07020g [Populus trichocarpa]
Length=452

 Score =   102 bits (254),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 61/176 (35%), Positives = 85/176 (48%), Gaps = 44/176 (25%)
 Frame = -3

Query  679  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  500
            G  L    K +   E+DDQS LIYL+L ++++W +K+Y+E+ YY  GYW  +V + + + 
Sbjct  296  GKILTANLKGRPAFEADDQSALIYLLLSQKDQWMDKVYIENQYYLHGYWAGLVDRYEEMI  355

Query  499  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  320
            + Y                                 + G G   W  PF+THF GC+PC 
Sbjct  356  EKY---------------------------------HPGLGDERW--PFVTHFVGCKPC-  379

Query  319  GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTA-------SVVPLPY  173
            G + + Y  E C  +M +A NFADNQVL  YGF HR LL          +V PL Y
Sbjct  380  GSYGD-YPVERCLRSMERAFNFADNQVLNLYGFGHRGLLSPKIKRIRNETVTPLEY  434



>ref|XP_001781241.1| predicted protein [Physcomitrella patens]
 gb|EDQ53939.1| predicted protein, partial [Physcomitrella patens]
Length=309

 Score =   101 bits (251),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 56/158 (35%), Positives = 81/158 (51%), Gaps = 34/158 (22%)
 Frame = -3

Query  679  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  500
            G  L +   D+   E+DDQSG++YL++ ++E+WG+KI++E+ YYF+GYW  +  K     
Sbjct  181  GEFLTKALPDRGKGEADDQSGIVYLMITDRERWGSKIFLENSYYFQGYWRVLTDKF----  236

Query  499  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  320
                                    E    K+K  L     G   W  PF+THF GC+ C 
Sbjct  237  ------------------------EEMMAKYKPGL----YGDDRW--PFVTHFCGCEFCC  266

Query  319  GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  206
            G  N  Y+ + C   M +A+NFADNQV+  YGF H+ L
Sbjct  267  GSINPEYTRDQCLVHMERAINFADNQVIGRYGFRHKSL  304



>dbj|BAK06777.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=452

 Score =   102 bits (254),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 57/160 (36%), Positives = 78/160 (49%), Gaps = 41/160 (26%)
 Frame = -3

Query  679  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  500
            G  L +  KD+   E+DDQS ++Y++  ++EKWGNK+Y+E+ YY  GYW  +V       
Sbjct  295  GKVLTKYLKDRPVFEADDQSAMVYILATQREKWGNKVYLENGYYLHGYWGILV-------  347

Query  499  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  320
                                        ++++E L N   G    R P +THF GC+PCS
Sbjct  348  ----------------------------DRYEEMLENYQPGLGDHRWPLVTHFVGCKPCS  379

Query  319  --GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  206
              GD    Y  E C   M +A NF DNQVL  YGF H+ L
Sbjct  380  KFGD----YPVERCLKQMDRAFNFGDNQVLHMYGFEHKSL  415



>gb|EMT04084.1| Xyloglucan 6-xylosyltransferase [Aegilops tauschii]
Length=451

 Score =   102 bits (254),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 57/160 (36%), Positives = 78/160 (49%), Gaps = 41/160 (26%)
 Frame = -3

Query  679  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  500
            G  L +  KD+   E+DDQS ++Y++  ++EKWGNK+Y+E+ YY  GYW  +V       
Sbjct  295  GKVLTKYLKDRPVFEADDQSAMVYILATQREKWGNKVYLENGYYLHGYWGILV-------  347

Query  499  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  320
                                        ++++E L N   G    R P +THF GC+PCS
Sbjct  348  ----------------------------DRYEEMLENYQPGLGDHRWPLVTHFVGCKPCS  379

Query  319  --GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  206
              GD    Y  E C   M +A NF DNQVL  YGF H+ L
Sbjct  380  KFGD----YPVERCLKQMDRAFNFGDNQVLHMYGFEHKSL  415



>ref|XP_010468926.1| PREDICTED: xyloglucan 6-xylosyltransferase 1 [Camelina sativa]
Length=466

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/160 (36%), Positives = 78/160 (49%), Gaps = 41/160 (26%)
 Frame = -3

Query  679  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  500
            G  L R  KD+   E+DDQS ++YL+  E+E+WG K+Y+ES YY  GYW  +V       
Sbjct  306  GKVLTRELKDRPAFEADDQSAMVYLLATERERWGGKVYLESGYYLHGYWGILV-------  358

Query  499  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  320
                                        ++++E + N   G    R P +THF GC+PC 
Sbjct  359  ----------------------------DRYEEMIENHKPGFGDHRWPLVTHFVGCKPCG  390

Query  319  --GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  206
              GD    Y  E C   M +ALNF DNQ+L+ YGF H+ L
Sbjct  391  KFGD----YPVERCLRQMDRALNFGDNQILQMYGFTHKSL  426



>ref|XP_007035584.1| CAMTA domain class transcription factor [Theobroma cacao]
 gb|EOY06510.1| CAMTA domain class transcription factor [Theobroma cacao]
Length=441

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 78/160 (49%), Gaps = 41/160 (26%)
 Frame = -3

Query  679  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  500
            G  L R  K +   E+DDQS ++YL++KE+ KWG K+Y+E+ YY  GYW  +V       
Sbjct  283  GKVLTRELKGRPVFEADDQSAMVYLLVKERAKWGEKVYLENAYYLHGYWGILV-------  335

Query  499  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  320
                                        ++++E + N   G    R P +THF GC+PC 
Sbjct  336  ----------------------------DRYEEMIENYHPGLGDHRWPLVTHFVGCKPCG  367

Query  319  --GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  206
              GD    Y  E C   M +A NF DNQ+L+ YGFMH+ L
Sbjct  368  KFGD----YPVERCLRQMDRAFNFGDNQILQMYGFMHKSL  403



>ref|XP_007050874.1| Alpha-1,6-xylosyltransferase isoform 2 [Theobroma cacao]
 gb|EOX95031.1| Alpha-1,6-xylosyltransferase isoform 2 [Theobroma cacao]
Length=469

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 78/160 (49%), Gaps = 41/160 (26%)
 Frame = -3

Query  679  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  500
            G  L R  KD+   E+DDQS ++YL+  ++EKWG+K+Y+ES YY  GYW  +V       
Sbjct  302  GKVLTRELKDRPVFEADDQSAMVYLLATQREKWGDKVYLESAYYLHGYWGILV-------  354

Query  499  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  320
                                        ++++E + N   G    R P +THF GC+PC 
Sbjct  355  ----------------------------DRYEEMIENYHPGLGDHRWPLVTHFVGCKPCG  386

Query  319  --GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  206
              GD    Y  E C   M +A NF DNQ+L+ YGF H+ L
Sbjct  387  KFGD----YPVERCLKQMDRAFNFGDNQILQIYGFTHKSL  422



>ref|XP_010238722.1| PREDICTED: putative glycosyltransferase 5 [Brachypodium distachyon]
Length=458

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 59/170 (35%), Positives = 86/170 (51%), Gaps = 38/170 (22%)
 Frame = -3

Query  679  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  500
            G  L  +   +   E+DDQS LI+L+L ++++W +K+YVE  +Y  G+W  +V       
Sbjct  308  GKVLTASLTGRPAFEADDQSALIHLLLADKQRWMDKVYVEDKFYLHGFWAGLV-------  360

Query  499  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  320
                                    + Y E  ++H  + G G   W  PF+THF GC+PC 
Sbjct  361  ------------------------DRYEEMMEKH--HPGLGDERW--PFVTHFVGCKPC-  391

Query  319  GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVPLPYD  170
            G + + Y  + C  AM +A NFADNQVLR YGF HR L  +  V P+P +
Sbjct  392  GSYGD-YPKDVCLAAMERAFNFADNQVLRIYGFRHRSLA-SPKVKPVPVN  439



>ref|XP_008660215.1| PREDICTED: xyloglucan 6-xylosyltransferase-like isoform X1 [Zea 
mays]
 ref|XP_008660216.1| PREDICTED: xyloglucan 6-xylosyltransferase-like isoform X2 [Zea 
mays]
Length=440

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/164 (34%), Positives = 81/164 (49%), Gaps = 37/164 (23%)
 Frame = -3

Query  682  WGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNI  503
            +G  L +   D+   E+DDQS L+YL++ ++ +WG+K ++ES Y   G+W+ IV      
Sbjct  280  YGKVLGKALSDRPSYEADDQSALVYLLVTQRLRWGDKTFLESSYSLHGFWLGIV------  333

Query  502  TDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRR-PFITHFTGCQP  326
                                         ++++E  R+A   R G  R P +THF GC+P
Sbjct  334  -----------------------------DRYEEMQRDASTPRDGGERWPLVTHFVGCKP  364

Query  325  CSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTA  194
            C G +   Y    C   M +ALNFAD+Q+LR YGF H  L  TA
Sbjct  365  CGGQYAS-YEASRCRTGMERALNFADDQILRLYGFEHESLNTTA  407



>emb|CDX93965.1| BnaC04g21240D [Brassica napus]
Length=458

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 60/168 (36%), Positives = 81/168 (48%), Gaps = 42/168 (25%)
 Frame = -3

Query  679  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  500
            G  L R  KD+   E+DDQS ++YL+  E+EKWG K+Y+ES YY  GYW  +V       
Sbjct  300  GKVLTRELKDRPAFEADDQSAMVYLLATEREKWGGKVYLESGYYLHGYWGILV-------  352

Query  499  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  320
                                        ++++E + N   G    R P +THF GC+PC 
Sbjct  353  ----------------------------DRYEEMIENHKPGFGDHRWPLVTHFVGCKPCG  384

Query  319  --GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVP  182
              GD    Y  E C   M +A NF DNQ+L+ YGF H+  L + SV P
Sbjct  385  KFGD----YPVERCLRQMDRAFNFGDNQILQMYGFTHKS-LGSRSVKP  427



>gb|AFW88602.1| hypothetical protein ZEAMMB73_854435 [Zea mays]
Length=418

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/164 (34%), Positives = 81/164 (49%), Gaps = 37/164 (23%)
 Frame = -3

Query  682  WGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNI  503
            +G  L +   D+   E+DDQS L+YL++ ++ +WG+K ++ES Y   G+W+ IV      
Sbjct  258  YGKVLGKALSDRPSYEADDQSALVYLLVTQRLRWGDKTFLESSYSLHGFWLGIV------  311

Query  502  TDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRR-PFITHFTGCQP  326
                                         ++++E  R+A   R G  R P +THF GC+P
Sbjct  312  -----------------------------DRYEEMQRDASTPRDGGERWPLVTHFVGCKP  342

Query  325  CSGDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTA  194
            C G +   Y    C   M +ALNFAD+Q+LR YGF H  L  TA
Sbjct  343  CGGQYAS-YEASRCRTGMERALNFADDQILRLYGFEHESLNTTA  385



>gb|KJB19373.1| hypothetical protein B456_003G098400 [Gossypium raimondii]
Length=458

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/159 (36%), Positives = 80/159 (50%), Gaps = 37/159 (23%)
 Frame = -3

Query  679  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  500
            G  L    K +   E+DDQS LIYL+L ++E W +K+++E+ YY  GYW  +V + + + 
Sbjct  302  GKVLTANLKGRPAFEADDQSALIYLLLSQKEMWMDKVFLENQYYLHGYWAGLVDRYEEMM  361

Query  499  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  320
            + Y                                 + G G   W  PF+THF GC+PC 
Sbjct  362  EKY---------------------------------HPGLGDERW--PFVTHFVGCKPC-  385

Query  319  GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLL  203
            G + + Y  E C  +M +A NFADNQVL+ YGF HR LL
Sbjct  386  GSYGD-YPVERCLRSMQRAFNFADNQVLKLYGFRHRGLL  423



>gb|ACF82576.1| unknown [Zea mays]
Length=279

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/160 (34%), Positives = 79/160 (49%), Gaps = 41/160 (26%)
 Frame = -3

Query  679  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  500
            G  L ++ KD+   E+DDQS ++Y++  ++EKWG+K+Y+E+ YY  GYW  +V       
Sbjct  123  GKVLTKSLKDRPVFEADDQSAMVYILATQREKWGDKVYLENGYYLHGYWGILV-------  175

Query  499  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  320
                                        ++++E L N   G    R P +THF GC+PC 
Sbjct  176  ----------------------------DRYEEMLENYKPGLGDHRWPLVTHFVGCKPCG  207

Query  319  --GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  206
              GD    Y  E C   M +A NF DNQ+L+ YGF H+ L
Sbjct  208  KFGD----YPVERCLKNMDRAFNFGDNQILQMYGFTHKSL  243



>ref|XP_007155288.1| hypothetical protein PHAVU_003G188200g [Phaseolus vulgaris]
 gb|ESW27282.1| hypothetical protein PHAVU_003G188200g [Phaseolus vulgaris]
Length=445

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/159 (36%), Positives = 81/159 (51%), Gaps = 37/159 (23%)
 Frame = -3

Query  679  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  500
            G  L    K +   E+DDQS LIYL+L ++EKW +K+++E+ +Y  GYW  +V + + + 
Sbjct  289  GKILTANLKGRPAFEADDQSALIYLLLSKKEKWMDKVFLENSFYLHGYWAGLVDRYEEMI  348

Query  499  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  320
            + Y                                 + G G   W  PF+THF GC+PC 
Sbjct  349  EKY---------------------------------HPGLGDERW--PFVTHFVGCKPC-  372

Query  319  GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLL  203
            G + + Y  E C  +M +A NFADNQVL+ YGF HR LL
Sbjct  373  GSYGD-YPVERCLSSMERAYNFADNQVLKLYGFRHRGLL  410



>ref|XP_007163097.1| hypothetical protein PHAVU_001G206000g [Phaseolus vulgaris]
 ref|XP_007163098.1| hypothetical protein PHAVU_001G206000g [Phaseolus vulgaris]
 gb|ESW35091.1| hypothetical protein PHAVU_001G206000g [Phaseolus vulgaris]
 gb|ESW35092.1| hypothetical protein PHAVU_001G206000g [Phaseolus vulgaris]
Length=448

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/163 (35%), Positives = 79/163 (48%), Gaps = 41/163 (25%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            D  G  L R  KD+   E+DDQS ++YL+ +E++KWG+K+Y+E+ YY  GYW  +V    
Sbjct  296  DEAGKVLTRELKDRPVFEADDQSAMVYLLARERDKWGDKVYLENGYYLHGYWGILV----  351

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
                                           +K++E + N   G    R P +THF GC+
Sbjct  352  -------------------------------DKYEEMIENYHPGLGDHRWPLVTHFVGCK  380

Query  328  PCS--GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  206
            PC   GD    Y  E C   M +A NF DNQ+L+ YGF H  L
Sbjct  381  PCGKFGD----YPVERCLKQMDRAFNFGDNQILQIYGFTHTSL  419



>ref|XP_004494368.1| PREDICTED: putative glycosyltransferase 2-like [Cicer arietinum]
Length=467

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 58/163 (36%), Positives = 79/163 (48%), Gaps = 41/163 (25%)
 Frame = -3

Query  688  DHWGNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLD  509
            D  G  L +  KD+   E+DDQS ++YL+ KE+EKWG K+Y+E+ YY  GYW  +V    
Sbjct  306  DEAGKILTKELKDRPVFEADDQSAMVYLLAKEKEKWGGKVYLENGYYLHGYWGILV----  361

Query  508  NITDMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQ  329
                                           ++++E + N   G    R P +THF GC+
Sbjct  362  -------------------------------DRYEEMIENYHPGFGDHRWPLVTHFVGCK  390

Query  328  PCS--GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  206
            PC   GD    Y  E C   M +A NF DNQVL+ YGF H+ L
Sbjct  391  PCGKFGD----YPVERCLKQMDRAFNFGDNQVLQIYGFTHKSL  429



>ref|XP_010259619.1| PREDICTED: xyloglucan 6-xylosyltransferase 2 [Nelumbo nucifera]
Length=449

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 79/160 (49%), Gaps = 41/160 (26%)
 Frame = -3

Query  679  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  500
            G  L R  KD+   E+DDQS ++YL++ +++KWG+K+Y+ES YY  GYW  +V       
Sbjct  292  GKILTRELKDRPVFEADDQSAMVYLLVTQRDKWGDKVYLESAYYLHGYWGILV-------  344

Query  499  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  320
                                        ++++E + N   G    R P +THF GC+PC 
Sbjct  345  ----------------------------DRYEEMIENYHPGLGDHRWPLVTHFVGCKPCG  376

Query  319  --GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDL  206
              GD    Y  E C   M +A NF DNQ+L+ YGF H+ L
Sbjct  377  KFGD----YPVERCLKQMDRAFNFGDNQILQIYGFTHKSL  412



>ref|XP_009138722.1| PREDICTED: xyloglucan 6-xylosyltransferase-like [Brassica rapa]
Length=459

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 60/168 (36%), Positives = 81/168 (48%), Gaps = 42/168 (25%)
 Frame = -3

Query  679  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  500
            G  L R  KD+   E+DDQS ++YL+  E+EKWG K+Y+ES YY  GYW  +V       
Sbjct  304  GKVLTRELKDRPAFEADDQSAMVYLLATEREKWGGKVYLESGYYLHGYWGILV-------  356

Query  499  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  320
                                        ++++E + N   G    R P +THF GC+PC 
Sbjct  357  ----------------------------DRYEEMIENHKPGFGDHRWPLVTHFVGCKPCG  388

Query  319  --GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLLDTASVVP  182
              GD    Y  E C   M +A NF DNQ+L+ YGF H+  L + SV P
Sbjct  389  KFGD----YPVERCLRQMDRAFNFGDNQILQMYGFTHKS-LGSRSVKP  431



>ref|XP_010108713.1| Putative glycosyltransferase 3 [Morus notabilis]
 gb|EXC20024.1| Putative glycosyltransferase 3 [Morus notabilis]
Length=449

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/159 (35%), Positives = 81/159 (51%), Gaps = 37/159 (23%)
 Frame = -3

Query  679  GNTLRRTFKDKIFPESDDQSGLIYLILKEQEKWGNKIYVESDYYFEGYWVEIVGKLDNIT  500
            G  L    K +   E+DDQS LIYL++ ++++W NK+YVE+ Y+  GYW  +V + + + 
Sbjct  296  GKILTANLKGRPAFEADDQSALIYLLISKKDQWMNKVYVENSYFLHGYWAGLVDRYEEMM  355

Query  499  DMYLGIEKTAAGEKLRRRHAEKVSESYAEKWKEHLRNAGQGRSGWRRPFITHFTGCQPCS  320
            + Y                                 + G G   W  PF+THF GC+PC 
Sbjct  356  EKY---------------------------------HPGLGDERW--PFVTHFVGCKPC-  379

Query  319  GDHNEMYSGETCADAMHKALNFADNQVLRNYGFMHRDLL  203
            G + + Y+ + C  +M +A NFADNQVL  YGF HR LL
Sbjct  380  GSYGD-YAVDRCLKSMERAFNFADNQVLNLYGFSHRGLL  417



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1158382918520