BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF008H18

Length=757
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004142115.1|  PREDICTED: dicarboxylate transporter 1, chlo...    300   3e-94   Cucumis sativus [cucumbers]
ref|XP_004162089.1|  PREDICTED: dicarboxylate transporter 1, chlo...    300   3e-94   
ref|XP_011090364.1|  PREDICTED: dicarboxylate transporter 1, chlo...    293   1e-93   Sesamum indicum [beniseed]
ref|XP_009777235.1|  PREDICTED: dicarboxylate transporter 1, chlo...    298   1e-93   Nicotiana sylvestris
ref|XP_009609674.1|  PREDICTED: dicarboxylate transporter 1, chlo...    298   1e-93   Nicotiana tomentosiformis
ref|XP_004250945.1|  PREDICTED: dicarboxylate transporter 1, chlo...    295   1e-92   Solanum lycopersicum
emb|CBI16377.3|  unnamed protein product                                283   2e-92   Vitis vinifera
ref|XP_008449718.1|  PREDICTED: dicarboxylate transporter 1, chlo...    295   3e-92   Cucumis melo [Oriental melon]
ref|XP_006361749.1|  PREDICTED: dicarboxylate transporter 1, chlo...    293   1e-91   Solanum tuberosum [potatoes]
gb|KHN25240.1|  2-oxoglutarate/malate translocator, chloroplastic       283   3e-91   Glycine soja [wild soybean]
gb|KDP22090.1|  hypothetical protein JCGZ_25921                         291   4e-91   Jatropha curcas
ref|XP_011045437.1|  PREDICTED: dicarboxylate transporter 1, chlo...    291   4e-91   Populus euphratica
ref|XP_011006198.1|  PREDICTED: dicarboxylate transporter 1, chlo...    291   4e-91   Populus euphratica
ref|XP_002513507.1|  2-oxoglutarate/malate translocator, chloropl...    291   4e-91   Ricinus communis
ref|XP_007211882.1|  hypothetical protein PRUPE_ppa003549mg             291   6e-91   Prunus persica
ref|XP_002299910.2|  hypothetical protein POPTR_0001s26580g             290   9e-91   Populus trichocarpa [western balsam poplar]
ref|XP_007015046.1|  Dicarboxylate transporter 1 isoform 2              287   1e-90   
ref|XP_006850217.1|  hypothetical protein AMTR_s00022p00253280          278   1e-90   
gb|KJB35803.1|  hypothetical protein B456_006G129000                    289   2e-90   Gossypium raimondii
dbj|BAD91178.1|  putative plastidic 2-oxoglutarate/malate translo...    285   2e-90   Mesembryanthemum crystallinum
ref|XP_010931014.1|  PREDICTED: LOW QUALITY PROTEIN: dicarboxylat...    289   2e-90   
ref|XP_010536080.1|  PREDICTED: dicarboxylate transporter 1, chlo...    285   3e-90   
ref|XP_010673637.1|  PREDICTED: dicarboxylate transporter 1, chlo...    289   3e-90   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008227299.1|  PREDICTED: dicarboxylate transporter 1, chlo...    288   5e-90   Prunus mume [ume]
ref|XP_010031793.1|  PREDICTED: dicarboxylate transporter 1, chlo...    288   7e-90   
gb|KHG21220.1|  2-oxoglutarate/malate translocator, chloroplastic       288   8e-90   Gossypium arboreum [tree cotton]
gb|ABK24751.1|  unknown                                                 289   8e-90   Picea sitchensis
ref|XP_011025529.1|  PREDICTED: dicarboxylate transporter 1, chlo...    288   9e-90   Populus euphratica
ref|XP_011080429.1|  PREDICTED: dicarboxylate transporter 1, chlo...    285   1e-89   Sesamum indicum [beniseed]
ref|XP_007015045.1|  Dicarboxylate transporter 1 isoform 1              287   1e-89   
gb|KEH30210.1|  2-oxoglutarate/malate translocator                      287   1e-89   Medicago truncatula
ref|XP_003539493.1|  PREDICTED: dicarboxylate transporter 1, chlo...    287   1e-89   Glycine max [soybeans]
ref|XP_010257247.1|  PREDICTED: dicarboxylate transporter 1, chlo...    287   2e-89   Nelumbo nucifera [Indian lotus]
ref|XP_007132020.1|  hypothetical protein PHAVU_011G059900g             287   2e-89   Phaseolus vulgaris [French bean]
gb|EEC69380.1|  hypothetical protein OsI_38517                          278   2e-89   Oryza sativa Indica Group [Indian rice]
ref|XP_002282809.1|  PREDICTED: dicarboxylate transporter 1, chlo...    286   3e-89   Vitis vinifera
ref|XP_003537966.1|  PREDICTED: dicarboxylate transporter 1, chlo...    286   3e-89   Glycine max [soybeans]
ref|XP_008801951.1|  PREDICTED: dicarboxylate transporter 1, chlo...    286   4e-89   Phoenix dactylifera
ref|XP_010536081.1|  PREDICTED: dicarboxylate transporter 1, chlo...    286   6e-89   
ref|XP_009394734.1|  PREDICTED: dicarboxylate transporter 1, chlo...    285   6e-89   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU31365.1|  hypothetical protein MIMGU_mgv1a003738mg                285   7e-89   Erythranthe guttata [common monkey flower]
emb|CDP12268.1|  unnamed protein product                                285   2e-88   Coffea canephora [robusta coffee]
sp|Q41364.1|DIT1_SPIOL  RecName: Full=Dicarboxylate transporter 1...    285   2e-88   Spinacia oleracea
ref|XP_009348953.1|  PREDICTED: dicarboxylate transporter 1, chlo...    284   3e-88   Pyrus x bretschneideri [bai li]
ref|XP_009366121.1|  PREDICTED: dicarboxylate transporter 1, chlo...    284   3e-88   
ref|XP_006664065.1|  PREDICTED: dicarboxylate transporter 1, chlo...    275   5e-88   Oryza brachyantha
ref|XP_009411283.1|  PREDICTED: dicarboxylate transporter 1, chlo...    283   5e-88   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEE53308.1|  hypothetical protein OsJ_36283                          281   5e-88   Oryza sativa Japonica Group [Japonica rice]
gb|EYU46260.1|  hypothetical protein MIMGU_mgv1a003794mg                283   6e-88   Erythranthe guttata [common monkey flower]
emb|CAX65044.1|  plastidic 2-oxoglutarate/malate translocator           280   7e-88   Pisum sativum [garden pea]
ref|XP_008363620.1|  PREDICTED: dicarboxylate transporter 1, chlo...    283   1e-87   
ref|XP_010102341.1|  2-oxoglutarate/malate translocator                 282   2e-87   Morus notabilis
ref|XP_006446115.1|  hypothetical protein CICLE_v10014769mg             281   2e-87   Citrus clementina [clementine]
ref|XP_010453336.1|  PREDICTED: dicarboxylate transporter 1, chlo...    281   3e-87   Camelina sativa [gold-of-pleasure]
ref|NP_001066885.1|  Os12g0515400                                       281   3e-87   
ref|XP_010453335.1|  PREDICTED: dicarboxylate transporter 1, chlo...    281   3e-87   Camelina sativa [gold-of-pleasure]
ref|NP_001119216.1|  dicarboxylate transporter 1                        281   3e-87   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009375074.1|  PREDICTED: dicarboxylate transporter 1, chlo...    283   3e-87   
ref|XP_002873582.1|  hypothetical protein ARALYDRAFT_909232             281   3e-87   Arabidopsis lyrata subsp. lyrata
ref|XP_009343722.1|  PREDICTED: dicarboxylate transporter 1, chlo...    281   4e-87   Pyrus x bretschneideri [bai li]
ref|XP_006287403.1|  hypothetical protein CARUB_v10000609mg             281   4e-87   Capsella rubella
ref|XP_010419844.1|  PREDICTED: dicarboxylate transporter 1, chlo...    281   4e-87   Camelina sativa [gold-of-pleasure]
gb|ACR38538.1|  unknown                                                 273   4e-87   Zea mays [maize]
ref|XP_009121830.1|  PREDICTED: dicarboxylate transporter 1, chlo...    280   5e-87   Brassica rapa
gb|KFK25523.1|  hypothetical protein AALP_AA8G126300                    280   6e-87   Arabis alpina [alpine rockcress]
ref|NP_568283.2|  dicarboxylate transporter 1                           280   6e-87   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010492022.1|  PREDICTED: dicarboxylate transporter 1, chlo...    280   7e-87   Camelina sativa [gold-of-pleasure]
emb|CDY53969.1|  BnaA10g30010D                                          280   8e-87   Brassica napus [oilseed rape]
ref|XP_003575954.1|  PREDICTED: LOW QUALITY PROTEIN: dicarboxylat...    280   1e-86   
emb|CDX97208.1|  BnaC09g44170D                                          280   1e-86   
gb|AAK43871.1|AF370494_1  2-oxoglutarate/malate translocator prec...    275   1e-86   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002965332.1|  hypothetical protein SELMODRAFT_230600             275   1e-86   
ref|XP_002977176.1|  hypothetical protein SELMODRAFT_151685             274   3e-86   
ref|XP_006399771.1|  hypothetical protein EUTSA_v10013154mg             278   4e-86   Eutrema salsugineum [saltwater cress]
dbj|BAK00367.1|  predicted protein                                      278   5e-86   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006379073.1|  hypothetical protein POPTR_0009s05840g             265   1e-85   
ref|XP_004291789.1|  PREDICTED: dicarboxylate transporter 1, chlo...    276   2e-85   Fragaria vesca subsp. vesca
ref|NP_001105570.1|  LOC542560                                          274   2e-84   Zea mays [maize]
ref|XP_004507091.1|  PREDICTED: dicarboxylate transporter 1, chlo...    273   3e-84   Cicer arietinum [garbanzo]
ref|XP_001755334.1|  predicted protein                                  268   5e-84   
ref|XP_004964101.1|  PREDICTED: dicarboxylate transporter 1, chlo...    268   4e-82   
ref|XP_002442229.1|  hypothetical protein SORBIDRAFT_08g016630          268   4e-82   Sorghum bicolor [broomcorn]
gb|EPS73843.1|  hypothetical protein M569_00906                         261   1e-80   Genlisea aurea
gb|EMT21699.1|  2-oxoglutarate/malate translocator, chloroplastic       253   1e-77   
gb|KJB30127.1|  hypothetical protein B456_005G130700                    221   4e-69   Gossypium raimondii
ref|XP_005843613.1|  hypothetical protein CHLNCDRAFT_140201             221   2e-64   Chlorella variabilis
ref|XP_003057697.1|  divalent Anion:Na+ symporter family                218   2e-63   Micromonas pusilla CCMP1545
ref|XP_002507903.1|  divalent Anion:Na+ symporter family                219   3e-63   Micromonas commoda
ref|XP_007512423.1|  2-oxoglutarate/malate translocator                 213   7e-61   Bathycoccus prasinos
ref|XP_011397588.1|  Dicarboxylate transporter 1, chloroplastic         209   1e-60   Auxenochlorella protothecoides
ref|XP_003078785.1|  2-oxoglutarate/malate translocator (ISS)           211   3e-60   Ostreococcus tauri
gb|EMS55971.1|  2-oxoglutarate/malate translocator, chloroplastic       207   3e-60   Triticum urartu
ref|XP_005650106.1|  oxoglutarate:malate antiporter                     207   7e-60   Coccomyxa subellipsoidea C-169
gb|KJB72206.1|  hypothetical protein B456_011G165400                    197   2e-58   Gossypium raimondii
ref|XP_001700410.1|  oxoglutarate:malate antiporter                     197   2e-55   Chlamydomonas reinhardtii
ref|XP_001700411.1|  chloroplast oxoglutarate-malate translocator       197   5e-55   Chlamydomonas reinhardtii
ref|XP_002955862.1|  hypothetical protein VOLCADRAFT_106989             195   2e-54   Volvox carteri f. nagariensis
ref|XP_001417246.1|  DASS family transporter: 2-oxoglutarate/malate     191   4e-54   Ostreococcus lucimarinus CCE9901
emb|CAN74405.1|  hypothetical protein VITISV_043635                     175   2e-50   Vitis vinifera
ref|WP_036200998.1|  2-oxoglutarate translocator                        169   2e-45   
gb|KJB56606.1|  hypothetical protein B456_009G127300                    158   5e-45   Gossypium raimondii
ref|WP_003328331.1|  2-oxoglutarate translocator                        167   1e-44   Bacillus atrophaeus
ref|WP_036154823.1|  2-oxoglutarate translocator                        165   6e-44   Lysinibacillus odysseyi
gb|ABO87606.1|  chloroplast 2-oxoglutarate/malate translocator          155   6e-44   Pisum sativum [garden pea]
gb|AGK55800.1|  divalent anion:Na+ symporter (DASS) family transp...    165   7e-44   Bacillus sp. 1NLA3E
ref|WP_041581256.1|  2-oxoglutarate translocator                        165   8e-44   
ref|WP_025752426.1|  2-oxoglutarate translocator                        162   8e-43   Bacillus
ref|WP_014457694.1|  2-oxoglutarate translocator                        162   9e-43   Bacillus megaterium
ref|WP_028411930.1|  MULTISPECIES: 2-oxoglutarate translocator          162   9e-43   Bacillus
ref|WP_043977584.1|  2-oxoglutarate translocator                        162   1e-42   Bacillus megaterium
ref|WP_028409745.1|  2-oxoglutarate translocator                        162   1e-42   Bacillus
ref|WP_029319476.1|  2-oxoglutarate translocator                        162   1e-42   Bacillus
ref|WP_013059892.1|  2-oxoglutarate translocator                        162   1e-42   Bacillus
ref|WP_013085539.1|  2-oxoglutarate translocator                        162   1e-42   Bacillus megaterium
ref|WP_016765975.1|  2-oxoglutarate translocator                        162   1e-42   Bacillus megaterium
ref|WP_034648188.1|  2-oxoglutarate translocator                        162   1e-42   Bacillus megaterium
ref|WP_021268254.1|  transporter, DASS family                           160   2e-42   Bacteriovorax sp. BAL6_X
ref|WP_028402895.1|  2-oxoglutarate translocator                        160   4e-42   Bacillus panaciterrae
ref|WP_006637412.1|  sodium/sulfate symporter YflS                      160   5e-42   Bacillus sonorensis
gb|KDD74484.1|  sodium:sulfate symporter                                151   5e-42   Helicosporidium sp. ATCC 50920
ref|WP_026589611.1|  2-oxoglutarate translocator                        160   6e-42   Bacillus
ref|WP_033543815.1|  2-oxoglutarate translocator                        159   1e-41   Planococcus sp. CAU13
gb|ETP70180.1|  2-oxoglutarate translocator                             159   1e-41   Planomicrobium glaciei CHR43
ref|WP_036802812.1|  2-oxoglutarate translocator                        159   1e-41   
ref|WP_024715768.1|  2-oxoglutarate translocator                        158   2e-41   Bacillus tequilensis
ref|WP_013943547.1|  2-oxoglutarate translocator                        157   6e-41   Simkania negevensis
ref|WP_026349007.1|  C4-dicarboxylate ABC transporter                   157   6e-41   Psychrobacter lutiphocae
ref|WP_034710102.1|  2-oxoglutarate translocator                        156   1e-40   Chryseobacterium soli
ref|WP_037389590.1|  C4-dicarboxylate ABC transporter                   155   4e-40   Serratia symbiotica
ref|WP_026684112.1|  2-oxoglutarate translocator                        155   4e-40   Bacillus coagulans
gb|EFW11377.1|  putative transporter, divalent anion:Na+ symporte...    155   4e-40   Serratia symbiotica str. Tucson
ref|WP_026212968.1|  C4-dicarboxylate ABC transporter                   155   5e-40   
ref|WP_014113016.1|  2-oxoglutarate translocator                        154   1e-39   Bacillus
ref|WP_040262880.1|  C4-dicarboxylate ABC transporter                   154   1e-39   Serratia symbiotica
ref|WP_014097116.1|  2-oxoglutarate translocator                        153   1e-39   Bacillus coagulans
emb|CDS55553.1|  putative malate transporter YflS                       154   2e-39   Serratia symbiotica
gb|ETZ23288.1|  2-oxoglutarate translocator                             153   2e-39   Pedobacter sp. V48
ref|WP_040083848.1|  2-oxoglutarate translocator                        152   2e-39   Bacillus
ref|WP_014663179.1|  2-oxoglutarate translocator                        152   2e-39   Bacillus sp. JS
ref|WP_038464208.1|  2-oxoglutarate translocator                        152   3e-39   Candidatus Paracaedibacter acanthamoebae
ref|WP_003679629.1|  C4-dicarboxylate ABC transporter                   152   3e-39   Neisseria
ref|WP_015417012.1|  MULTISPECIES: 2-oxoglutarate/malate transporter    152   4e-39   Bacillales
ref|WP_003239908.1|  hypothetical protein                               152   4e-39   Bacillus subtilis
ref|WP_019257759.1|  2-oxoglutarate translocator                        152   4e-39   Bacillus
ref|WP_026853279.1|  2-oxoglutarate translocator                        152   4e-39   
ref|WP_003233725.1|  2-oxoglutarate translocator                        152   4e-39   Bacillales
ref|WP_034674881.1|  2-oxoglutarate translocator                        152   5e-39   Chryseobacterium formosense
gb|EFC51259.1|  transporter, DASS family                                152   5e-39   Neisseria subflava NJ9703
ref|WP_019713597.1|  2-oxoglutarate translocator                        152   6e-39   Bacillus subtilis
ref|WP_013390434.1|  MULTISPECIES: 2-oxoglutarate translocator          152   6e-39   Bacillus subtilis group
ref|WP_006343274.1|  2-oxoglutarate translocator                        151   6e-39   Chlamydia psittaci
ref|WP_039076181.1|  2-oxoglutarate translocator                        151   6e-39   Bacillus
ref|WP_031502137.1|  2-oxoglutarate translocator                        151   6e-39   Chryseobacterium
ref|NP_001062066.1|  Os08g0481800                                       146   6e-39   
ref|WP_014946075.1|  2-oxoglutarate translocator                        151   6e-39   Chlamydia psittaci
ref|WP_014946742.1|  2-oxoglutarate translocator                        151   6e-39   Chlamydia psittaci
ref|WP_014944315.1|  2-oxoglutarate translocator                        151   6e-39   
ref|WP_036491426.1|  C4-dicarboxylate ABC transporter                   151   7e-39   Neisseria
ref|WP_003746210.1|  C4-dicarboxylate ABC transporter                   151   7e-39   Neisseria
ref|WP_010787924.1|  2-oxoglutarate/malate translocator                 151   7e-39   Bacillus atrophaeus
ref|WP_010330322.1|  2-oxoglutarate translocator                        151   7e-39   Bacillus vallismortis
ref|WP_040998492.1|  2-oxoglutarate translocator                        151   8e-39   Chryseobacterium oranimense
ref|WP_034730448.1|  2-oxoglutarate translocator                        151   8e-39   Chryseobacterium sp. JM1
ref|WP_015383080.1|  MULTISPECIES: 2-oxoglutarate/malate transporter    151   8e-39   Bacillus
ref|WP_007408966.1|  MULTISPECIES: 2-oxoglutarate translocator          151   8e-39   Bacillus
ref|WP_024572847.1|  2-oxoglutarate translocator                        151   8e-39   Bacillus
ref|WP_013351349.1|  MULTISPECIES: 2-oxoglutarate translocator          151   8e-39   Bacillus subtilis group
ref|WP_020370215.1|  MULTISPECIES: sodium:sulfate symporter trans...    151   9e-39   Chlamydia ibidis
ref|WP_042634956.1|  2-oxoglutarate translocator                        151   9e-39   Bacillus amyloliquefaciens
ref|WP_026852457.1|  2-oxoglutarate translocator                        151   9e-39   Geothrix fermentans
ref|WP_034704428.1|  2-oxoglutarate translocator                        151   9e-39   Chryseobacterium luteum
ref|WP_041057032.1|  2-oxoglutarate translocator                        151   9e-39   Bacillus subtilis
ref|WP_034745423.1|  2-oxoglutarate translocator                        151   1e-38   Chryseobacterium vrystaatense
ref|WP_025644633.1|  MULTISPECIES: C4-dicarboxylate ABC transporter     151   1e-38   Psychrobacter
gb|KGA69105.1|  sulfate symporter transmembrane region family pro...    145   1e-38   Yersinia enterocolitica
gb|KIN32538.1|  hypothetical protein B4069_0846                         151   1e-38   Bacillus subtilis
ref|WP_003685739.1|  C4-dicarboxylate ABC transporter                   150   1e-38   Neisseria flavescens
ref|WP_029103488.1|  C4-dicarboxylate ABC transporter                   150   1e-38   Moraxella caprae
ref|WP_003714648.1|  C4-dicarboxylate ABC transporter                   150   1e-38   Neisseria lactamica
ref|XP_002525819.1|  2-oxoglutarate/malate translocator, chloropl...    148   1e-38   
ref|WP_003751723.1|  C4-dicarboxylate ABC transporter                   150   1e-38   Neisseria polysaccharea
ref|WP_044163592.1|  2-oxoglutarate translocator                        150   1e-38   Bacillus halotolerans
ref|WP_034727777.1|  2-oxoglutarate translocator                        150   2e-38   
gb|EQC49451.1|  transporter, DASS family                                150   2e-38   Bacteriovorax sp. BSW11_IV
ref|WP_013448646.1|  C4-dicarboxylate ABC transporter                   150   2e-38   Neisseria lactamica
ref|WP_011097177.1|  2-oxoglutarate translocator                        150   2e-38   Chlamydia abortus
ref|WP_025126065.1|  2-oxoglutarate translocator                        150   2e-38   Myroides odoratimimus
ref|WP_003766241.1|  C4-dicarboxylate ABC transporter                   150   2e-38   Neisseria sicca
ref|WP_006258443.1|  MULTISPECIES: 2-oxoglutarate translocator          150   2e-38   Myroides
ref|WP_003777396.1|  C4-dicarboxylate ABC transporter                   150   3e-38   Neisseria macacae
ref|XP_001753146.1|  predicted protein                                  149   3e-38   
ref|WP_032858509.1|  2-oxoglutarate translocator                        150   3e-38   Bacillus
ref|WP_019270868.1|  C4-dicarboxylate ABC transporter                   150   3e-38   
ref|WP_011457948.1|  2-oxoglutarate translocator                        149   3e-38   Chlamydia felis
ref|WP_043925701.1|  2-oxoglutarate translocator                        149   3e-38   Bacillus haynesii
ref|WP_003155645.1|  MULTISPECIES: 2-oxoglutarate translocator          149   3e-38   Bacillus
gb|AHN27693.1|  2-oxoglutarate/malate translocator                      149   3e-38   Snodgrassella alvi wkB2
ref|WP_039367064.1|  2-oxoglutarate translocator                        149   3e-38   Chryseobacterium
gb|EFE55095.1|  transporter, DASS family                                149   3e-38   Providencia rettgeri DSM 1131
ref|WP_025329952.1|  C4-dicarboxylate ABC transporter                   149   4e-38   Snodgrassella alvi
ref|WP_036957836.1|  C4-dicarboxylate ABC transporter                   149   4e-38   Providencia rettgeri
ref|WP_024120552.1|  2-oxoglutarate translocator                        149   4e-38   Bacillus
ref|WP_016687717.1|  C4-dicarboxylate ABC transporter                   149   4e-38   Neisseria sicca
ref|WP_025458100.1|  C4-dicarboxylate ABC transporter                   149   4e-38   Neisseria polysaccharea
gb|EAZ07383.1|  hypothetical protein OsI_29635                          147   4e-38   Oryza sativa Indica Group [Indian rice]
ref|WP_003709104.1|  C4-dicarboxylate ABC transporter                   149   4e-38   Neisseria lactamica
ref|WP_011197641.1|  2-oxoglutarate translocator                        149   4e-38   Bacillus
ref|WP_003179716.1|  MULTISPECIES: 2-oxoglutarate translocator          149   4e-38   Bacillus
ref|WP_026073362.1|  2-oxoglutarate translocator                        149   4e-38   
ref|WP_016199625.1|  anion transporter                                  149   4e-38   Elizabethkingia meningoseptica
ref|WP_004910038.1|  sodium:sulfate symporter                           149   6e-38   Providencia
ref|WP_019551967.1|  2-oxoglutarate translocator                        149   6e-38   Propionispira raffinosivorans
ref|WP_024568310.1|  2-oxoglutarate translocator                        149   7e-38   Elizabethkingia anophelis
ref|WP_031848249.1|  2-oxoglutarate translocator                        142   7e-38   
gb|EJO23151.1|  transporter, DASS family                                145   8e-38   Selenomonas sp. FOBRC6
ref|WP_029292431.1|  2-oxoglutarate translocator                        148   8e-38   Chryseobacterium hispalense
ref|WP_003740744.1|  C4-dicarboxylate ABC transporter                   149   8e-38   Neisseria
ref|WP_034687098.1|  2-oxoglutarate translocator                        148   8e-38   Chryseobacterium piperi
ref|WP_036674200.1|  2-oxoglutarate translocator                        148   8e-38   Pedobacter heparinus
ref|WP_003223030.1|  2-oxoglutarate translocator                        148   9e-38   Bacillus subtilis
gb|KFK28120.1|  hypothetical protein AALP_AA8G475200                    149   9e-38   Arabis alpina [alpine rockcress]
ref|WP_041906771.1|  MULTISPECIES: 2-oxoglutarate translocator          148   9e-38   Bacillus subtilis
ref|WP_021346170.1|  2-oxoglutarate translocator                        148   9e-38   Elizabethkingia anophelis
gb|ESV70337.1|  sulfate symporter transmembrane region family pro...    143   9e-38   Vibrio parahaemolyticus 10296
ref|WP_009087594.1|  MULTISPECIES: 2-oxoglutarate translocator          148   1e-37   Elizabethkingia
gb|ACU05461.1|  anion transporter                                       148   1e-37   Pedobacter heparinus DSM 2366
ref|WP_043498342.1|  2-oxoglutarate translocator                        148   1e-37   
ref|WP_019072567.1|  hypothetical protein                               148   1e-37   
ref|WP_003761818.1|  C4-dicarboxylate ABC transporter                   148   1e-37   Neisseria sicca
ref|WP_009311665.1|  C4-dicarboxylate ABC transporter                   148   1e-37   Neisseria
ref|WP_026878255.1|  C4-dicarboxylate ABC transporter                   148   1e-37   Ignatzschineria larvae
ref|WP_029378255.1|  2-oxoglutarate translocator                        148   1e-37   Staphylococcus xylosus
ref|WP_006344203.1|  2-oxoglutarate translocator                        147   1e-37   Chlamydia abortus
ref|WP_039409462.1|  C4-dicarboxylate ABC transporter                   148   1e-37   Morococcus cerebrosus
ref|WP_009173872.1|  C4-dicarboxylate ABC transporter                   148   1e-37   Neisseria sp. oral taxon 014
ref|WP_034699340.1|  2-oxoglutarate translocator                        147   1e-37   Chryseobacterium sp. CF365
ref|WP_042357669.1|  2-oxoglutarate translocator                        148   2e-37   Bacillus rubiinfantis
ref|XP_008373247.1|  PREDICTED: dicarboxylate transporter 2.1, ch...    144   2e-37   
ref|WP_011006564.1|  2-oxoglutarate translocator                        147   2e-37   Chlamydia caviae
ref|WP_004653955.1|  hypothetical protein                               147   2e-37   Acinetobacter sp. NIPH 809
ref|XP_001781877.1|  predicted protein                                  147   2e-37   
ref|XP_002866607.1|  DCT/DIT2.1                                         148   2e-37   Arabidopsis lyrata subsp. lyrata
ref|XP_006394170.1|  hypothetical protein EUTSA_v10003922mg             148   2e-37   Eutrema salsugineum [saltwater cress]
ref|WP_035157533.1|  2-oxoglutarate translocator                        147   2e-37   
ref|WP_020356279.1|  MULTISPECIES: sodium:sulfate symporter trans...    147   2e-37   Chlamydia
ref|WP_033565163.1|  2-oxoglutarate translocator                        147   2e-37   Sphingobacteriaceae bacterium DW12
ref|WP_020450525.1|  MULTISPECIES: 2-oxoglutarate/malate transpor...    147   2e-37   Bacillus subtilis group
ref|NP_201234.1|  dicarboxylate transport 2.1                           148   2e-37   Arabidopsis thaliana [mouse-ear cress]
ref|WP_039073282.1|  MULTISPECIES: 2-oxoglutarate translocator          147   2e-37   Bacillales
ref|WP_027378953.1|  2-oxoglutarate translocator                        147   2e-37   Chryseobacterium daeguense
ref|WP_031828590.1|  2-oxoglutarate translocator                        143   2e-37   
ref|WP_039069533.1|  2-oxoglutarate translocator                        147   2e-37   Staphylococcus xylosus
gb|EGZ49591.1|  DASS family divalent anion:sodium (Na+) symporter       147   2e-37   Neisseria wadsworthii 9715
ref|WP_026578902.1|  2-oxoglutarate translocator                        147   3e-37   Bacillus sp. SB47
ref|XP_009112126.1|  PREDICTED: dicarboxylate transporter 2.1, ch...    147   3e-37   Brassica rapa
dbj|BAP32937.1|  DASS family divalent anion:sodium (Na+) symporter      147   3e-37   Chryseobacterium sp. StRB126
ref|WP_040667392.1|  C4-dicarboxylate ABC transporter                   147   3e-37   
ref|WP_017723110.1|  2-oxoglutarate translocator                        147   3e-37   Staphylococcus xylosus
ref|WP_026822954.1|  C4-dicarboxylate ABC transporter                   147   3e-37   Arsenophonus nasoniae
emb|CDY18717.1|  BnaA09g06780D                                          147   3e-37   Brassica napus [oilseed rape]
ref|WP_038449155.1|  C4-dicarboxylate ABC transporter                   147   3e-37   Bdellovibrio bacteriovorus
dbj|BAD09285.1|  putative glutamate/malate translocator                 147   3e-37   Oryza sativa Japonica Group [Japonica rice]
emb|CDX81219.1|  BnaC09g06300D                                          147   3e-37   
gb|EHY93411.1|  putative di- and tricarboxylate transporter             146   3e-37   Staphylococcus saprophyticus subsp. saprophyticus KACC 16562
ref|WP_002986121.1|  MULTISPECIES: 2-oxoglutarate translocator          147   4e-37   Myroides odoratus
dbj|GAF58010.1|  LOW QUALITY PROTEIN: 2-oxoglutarate/malate trans...    147   4e-37   Psychrobacter sp. JCM 18902
ref|WP_010333359.1|  2-oxoglutarate translocator                        146   4e-37   Bacillus mojavensis
dbj|GAF61940.1|  LOW QUALITY PROTEIN: 2-oxoglutarate/malate trans...    146   4e-37   Psychrobacter sp. JCM 18903
ref|WP_037537679.1|  2-oxoglutarate translocator                        146   4e-37   Staphylococcus saprophyticus
emb|CBI34026.3|  unnamed protein product                                144   4e-37   Vitis vinifera
gb|EEP90394.1|  Di-and tricarboxylate transporter                       146   4e-37   Yersinia kristensenii ATCC 33638
dbj|BAJ99052.1|  predicted protein                                      147   4e-37   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|WP_035153832.1|  2-oxoglutarate translocator                        146   4e-37   
ref|WP_011817290.1|  2-oxoglutarate translocator                        146   4e-37   Yersinia enterocolitica
ref|WP_011302369.1|  2-oxoglutarate translocator                        146   5e-37   Staphylococcus saprophyticus
ref|WP_032820455.1|  2-oxoglutarate translocator                        146   5e-37   Yersinia kristensenii
dbj|BAK03702.1|  predicted protein                                      147   5e-37   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|WP_041577538.1|  C4-dicarboxylate ABC transporter                   146   5e-37   Bdellovibrio bacteriovorus
ref|WP_032115379.1|  C4-dicarboxylate ABC transporter                   146   5e-37   Arsenophonus endosymbiont of Nilaparvata lugens
gb|AFY01542.1|  2-oxoglutarate/malate translocator                      146   5e-37   
ref|WP_037407495.1|  C4-dicarboxylate ABC transporter                   146   5e-37   
ref|WP_037491895.1|  C4-dicarboxylate ABC transporter                   146   5e-37   
gb|KDN13937.1|  2-oxoglutarate/malate translocator                      146   5e-37   
ref|WP_038829541.1|  2-oxoglutarate translocator                        145   6e-37   
ref|WP_026778373.1|  C4-dicarboxylate ABC transporter                   146   6e-37   
gb|KDN11986.1|  2-oxoglutarate/malate translocator                      146   6e-37   
ref|WP_035168597.1|  2-oxoglutarate translocator                        146   6e-37   
ref|WP_037438221.1|  2-oxoglutarate translocator                        146   6e-37   
ref|WP_027374530.1|  MULTISPECIES: 2-oxoglutarate translocator          146   6e-37   
ref|WP_002977415.1|  2-oxoglutarate translocator                        146   6e-37   
ref|WP_003664641.1|  2-oxoglutarate translocator                        146   6e-37   
gb|KEQ31373.1|  2-oxoglutarate translocator                             146   6e-37   
ref|WP_003674937.1|  2-oxoglutarate translocator                        146   6e-37   
emb|CDY43805.1|  BnaA06g23410D                                          146   7e-37   
ref|WP_042722362.1|  2-oxoglutarate translocator                        146   7e-37   
ref|WP_038984636.1|  2-oxoglutarate translocator                        146   7e-37   
ref|XP_009150500.1|  PREDICTED: dicarboxylate transporter 2.1, ch...    146   7e-37   
ref|XP_001773473.1|  predicted protein                                  146   7e-37   
ref|WP_014870215.1|  C4-dicarboxylate ABC transporter                   146   7e-37   
ref|WP_027848041.1|  C4-dicarboxylate ABC transporter                   146   7e-37   
ref|XP_003574657.1|  PREDICTED: dicarboxylate transporter 2.1, ch...    146   8e-37   
ref|WP_011463766.1|  C4-dicarboxylate ABC transporter                   145   1e-36   
ref|WP_011164342.1|  C4-dicarboxylate ABC transporter                   145   1e-36   
ref|XP_010520855.1|  PREDICTED: dicarboxylate transporter 2.2, ch...    146   1e-36   
ref|WP_029093783.1|  C4-dicarboxylate ABC transporter                   145   1e-36   
ref|WP_011960208.1|  C4-dicarboxylate ABC transporter                   145   1e-36   
ref|WP_032911618.1|  2-oxoglutarate translocator                        145   1e-36   
gb|EEQ13623.1|  Di-and tricarboxylate transporter                       145   1e-36   
ref|WP_007840608.1|  MULTISPECIES: 2-oxoglutarate translocator          145   1e-36   
dbj|BAK44253.1|  dicarboxylate transporter                              145   1e-36   
gb|KFF75424.1|  2-oxoglutarate translocator                             145   1e-36   
ref|XP_007042895.1|  Dicarboxylate transport 2.1                        145   1e-36   
ref|WP_026017912.1|  2-oxoglutarate translocator                        145   1e-36   
ref|XP_011087921.1|  PREDICTED: dicarboxylate transporter 2.1, ch...    145   1e-36   
ref|WP_041690951.1|  2-oxoglutarate translocator                        145   1e-36   
ref|XP_006280257.1|  hypothetical protein CARUB_v10026173mg             145   1e-36   
ref|WP_042844193.1|  C4-dicarboxylate ABC transporter                   145   1e-36   
ref|WP_016425898.1|  divalent anion:Na+ symporter (DASS) family t...    145   1e-36   
gb|EYU18451.1|  hypothetical protein MIMGU_mgv1a003725mg                145   1e-36   
ref|XP_010461628.1|  PREDICTED: dicarboxylate transporter 2.1, ch...    145   1e-36   
ref|XP_010484204.1|  PREDICTED: dicarboxylate transporter 2.1, ch...    145   2e-36   
ref|WP_003793892.1|  C4-dicarboxylate ABC transporter                   145   2e-36   
ref|WP_010299206.1|  2-oxoglutarate translocator                        145   2e-36   
gb|AHM71810.1|  Putative malate transporter YflS                        144   2e-36   
gb|EEQ08137.1|  Di-and tricarboxylate transporter                       144   2e-36   
dbj|BAJ86680.1|  predicted protein                                      145   2e-36   
ref|WP_003001370.1|  2-oxoglutarate translocator                        144   2e-36   
ref|WP_008316631.1|  Putative malate transporter yflS                   145   2e-36   
gb|EEQ17570.1|  Di-and tricarboxylate transporter                       144   2e-36   
ref|WP_032907661.1|  2-oxoglutarate translocator                        144   2e-36   
ref|WP_003004083.1|  2-oxoglutarate translocator                        144   2e-36   
ref|WP_025519049.1|  2-oxoglutarate translocator                        141   2e-36   
ref|WP_042568990.1|  2-oxoglutarate translocator                        144   2e-36   
ref|WP_035624368.1|  2-oxoglutarate translocator                        144   2e-36   
emb|CDX84512.1|  BnaC03g49880D                                          145   2e-36   
gb|KJB32094.1|  hypothetical protein B456_005G223500                    145   2e-36   
ref|WP_010252888.1|  2-oxoglutarate translocator                        144   3e-36   
gb|EEQ10035.1|  Di-and tricarboxylate transporter                       144   3e-36   
ref|XP_006423815.1|  hypothetical protein CICLE_v10028114mg             145   3e-36   
ref|WP_029862733.1|  2-oxoglutarate translocator                        141   3e-36   
ref|WP_032896608.1|  2-oxoglutarate translocator                        144   3e-36   
emb|CDO97413.1|  unnamed protein product                                145   3e-36   
gb|EMT05116.1|  2-oxoglutarate/malate translocator, chloroplastic       139   3e-36   
ref|WP_042740292.1|  2-oxoglutarate translocator                        144   3e-36   
ref|WP_035649702.1|  2-oxoglutarate translocator                        144   3e-36   
ref|WP_034291122.1|  C4-dicarboxylate ABC transporter                   144   3e-36   
ref|XP_010520862.1|  PREDICTED: dicarboxylate transporter 2.1, ch...    145   3e-36   
gb|EMT28304.1|  2-oxoglutarate/malate translocator, chloroplastic       142   3e-36   
gb|EQL84551.1|  na+ symporter family protein                            143   3e-36   
ref|WP_037441920.1|  2-oxoglutarate translocator                        144   3e-36   
ref|WP_014243176.1|  2-oxoglutarate translocator                        144   3e-36   
ref|WP_004989532.1|  C4-dicarboxylate ABC transporter                   144   4e-36   
ref|WP_024954741.1|  C4-dicarboxylate ABC transporter                   144   4e-36   
ref|WP_034734426.1|  2-oxoglutarate translocator                        144   4e-36   
ref|XP_009366350.1|  PREDICTED: dicarboxylate transporter 2, chlo...    144   4e-36   
ref|WP_042806919.1|  2-oxoglutarate translocator                        144   4e-36   
ref|XP_006492620.1|  PREDICTED: dicarboxylate transporter 2.1, ch...    144   4e-36   
ref|WP_044435202.1|  C4-dicarboxylate ABC transporter                   144   4e-36   
ref|WP_032814826.1|  2-oxoglutarate translocator                        144   4e-36   
ref|WP_034697732.1|  C4-dicarboxylate ABC transporter                   144   4e-36   
ref|WP_021828414.1|  sodium:sulfate symporter                           144   4e-36   
ref|WP_005003913.1|  hypothetical protein                               144   4e-36   
ref|WP_010892100.1|  2-oxoglutarate translocator                        144   4e-36   
ref|XP_010272978.1|  PREDICTED: dicarboxylate transporter 2.1, ch...    144   4e-36   
ref|WP_010882858.1|  2-oxoglutarate translocator                        144   4e-36   
ref|XP_009774993.1|  PREDICTED: dicarboxylate transporter 2.1, ch...    144   4e-36   
ref|WP_039112231.1|  MULTISPECIES: 2-oxoglutarate translocator          144   4e-36   
ref|WP_025787668.1|  2-oxoglutarate translocator                        143   4e-36   
ref|XP_004973727.1|  PREDICTED: dicarboxylate transporter 2.1, ch...    144   5e-36   
ref|WP_041497571.1|  2-oxoglutarate translocator                        137   5e-36   
ref|WP_003668853.1|  2-oxoglutarate translocator                        144   5e-36   
ref|WP_005608367.1|  Anion transporter                                  144   5e-36   
ref|WP_041079305.1|  2-oxoglutarate translocator                        143   5e-36   
dbj|BAB58857.1|  2-oxoglutarate/malate translocator                     138   5e-36   
ref|WP_011463243.1|  C4-dicarboxylate ABC transporter                   144   5e-36   
ref|WP_043042510.1|  2-oxoglutarate translocator                        143   5e-36   
ref|WP_028858437.1|  C4-dicarboxylate ABC transporter                   144   5e-36   
ref|WP_016166360.1|  DASS family divalent anion:Na+ symporter           143   5e-36   
ref|WP_005498683.1|  2-oxoglutarate translocator                        143   5e-36   
ref|WP_031913365.1|  2-oxoglutarate translocator                        139   5e-36   
ref|WP_007393752.1|  C4-dicarboxylate ABC transporter                   143   6e-36   
ref|WP_027850678.1|  C4-dicarboxylate ABC transporter                   143   6e-36   
ref|WP_044740407.1|  C4-dicarboxylate ABC transporter                   143   6e-36   
emb|CAN78375.1|  hypothetical protein VITISV_000698                     144   6e-36   
ref|XP_010648147.1|  PREDICTED: dicarboxylate transporter 2.1, ch...    144   6e-36   
gb|KFM93314.1|  sulfate symporter transmembrane region family pro...    137   6e-36   
ref|WP_009440378.1|  putative 2-oxoglutarate/malate translocator        143   7e-36   
ref|XP_010266911.1|  PREDICTED: dicarboxylate transporter 2.1, ch...    144   7e-36   
ref|WP_025624265.1|  2-oxoglutarate translocator                        143   7e-36   
ref|WP_024010695.1|  sodium:sulfate symporter family protein            143   7e-36   
ref|XP_010546344.1|  PREDICTED: dicarboxylate transporter 2.1, ch...    143   7e-36   
gb|EHM73124.1|  sodium:sulfate symporter transmembrane region dom...    137   8e-36   
ref|XP_010444361.1|  PREDICTED: dicarboxylate transporter 2.1, ch...    143   8e-36   
ref|WP_021072000.1|  2-oxoglutarate translocator                        143   8e-36   
ref|WP_017531615.1|  MULTISPECIES: 2-oxoglutarate translocator          142   9e-36   
ref|XP_009380879.1|  PREDICTED: dicarboxylate transporter 2.1, ch...    143   9e-36   
gb|EIW19355.1|  anion transporter                                       142   1e-35   
ref|WP_040543388.1|  2-oxoglutarate translocator                        142   1e-35   
gb|EIW32183.1|  anion transporter                                       142   1e-35   
ref|WP_017498813.1|  2-oxoglutarate translocator                        142   1e-35   
ref|WP_043045708.1|  2-oxoglutarate translocator                        141   1e-35   
ref|WP_036979147.1|  C4-dicarboxylate ABC transporter                   142   1e-35   
gb|EEB47404.1|  transporter, DASS family                                142   1e-35   
ref|WP_006662021.1|  sodium:sulfate symporter                           142   1e-35   
ref|WP_025652429.1|  MULTISPECIES: C4-dicarboxylate ABC transporter     142   1e-35   
ref|WP_036424490.1|  C4-dicarboxylate ABC transporter                   142   1e-35   
ref|WP_025154360.1|  C4-dicarboxylate ABC transporter                   142   1e-35   
ref|WP_036951333.1|  C4-dicarboxylate ABC transporter                   142   1e-35   
ref|WP_008464830.1|  2-oxoglutarate translocator                        142   1e-35   
ref|WP_013712980.1|  2-oxoglutarate translocator                        142   1e-35   
ref|WP_039453323.1|  2-oxoglutarate translocator                        137   1e-35   
ref|WP_004236182.1|  MULTISPECIES: C4-dicarboxylate ABC transporter     142   1e-35   
ref|WP_011921621.1|  2-oxoglutarate translocator                        142   1e-35   
ref|WP_021813102.1|  2-oxoglutarate/malate translocator                 142   1e-35   
ref|WP_032098921.1|  C4-dicarboxylate ABC transporter                   142   1e-35   
ref|WP_035682018.1|  2-oxoglutarate translocator                        142   1e-35   
ref|WP_024010513.1|  sodium:sulfate symporter family protein            142   1e-35   
ref|WP_008915386.1|  sodium:sulfate symporter                           142   1e-35   
ref|WP_021756712.1|  sodium:sulfate symporter family protein            142   1e-35   
ref|WP_021757374.1|  sodium:sulfate symporter family protein            142   1e-35   
ref|WP_025636275.1|  2-oxoglutarate translocator                        142   1e-35   
ref|XP_003578268.1|  PREDICTED: dicarboxylate transporter 2.1, ch...    143   1e-35   
gb|EMS48906.1|  2-oxoglutarate/malate translocator, chloroplastic       139   1e-35   
ref|WP_036408506.1|  C4-dicarboxylate ABC transporter                   142   1e-35   
ref|WP_011274601.1|  2-oxoglutarate translocator                        142   1e-35   
ref|WP_020282672.1|  putative membrane transport protein                142   1e-35   
ref|XP_002988946.1|  hypothetical protein SELMODRAFT_129026             142   1e-35   
ref|WP_006317579.1|  C4-dicarboxylate ABC transporter                   142   1e-35   
ref|XP_009624586.1|  PREDICTED: dicarboxylate transporter 2.1, ch...    143   1e-35   
ref|WP_008510084.1|  2-oxoglutarate translocator                        142   2e-35   
ref|XP_002974927.1|  hypothetical protein SELMODRAFT_267817             142   2e-35   
ref|WP_026727582.1|  2-oxoglutarate translocator                        142   2e-35   
ref|XP_010108404.1|  2-oxoglutarate/malate translocator                 142   2e-35   
ref|WP_016656381.1|  DASS family divalent anion:Na+ symporter           142   2e-35   
emb|CDT06612.1|  putative malate transporter YflS                       142   2e-35   
gb|ACF88301.1|  unknown                                                 140   2e-35   
ref|WP_025527212.1|  2-oxoglutarate translocator                        142   2e-35   
ref|WP_040403551.1|  C4-dicarboxylate ABC transporter                   142   2e-35   
ref|WP_003689366.1|  C4-dicarboxylate ABC transporter                   142   2e-35   
gb|EQL92777.1|  na+ symporter family protein                            141   2e-35   
ref|WP_041145105.1|  permease                                           142   2e-35   
gb|EHS79657.1|  transporter, DASS family                                139   2e-35   
gb|EJU57800.1|  C4-dicarboxylate transporter                            142   2e-35   
ref|WP_002227055.1|  C4-dicarboxylate ABC transporter                   142   2e-35   
ref|WP_002212565.1|  C4-dicarboxylate ABC transporter                   142   2e-35   
ref|WP_029823578.1|  2-oxoglutarate translocator                        141   2e-35   
ref|XP_002445990.1|  hypothetical protein SORBIDRAFT_07g029170          142   2e-35   
ref|WP_031817067.1|  2-oxoglutarate translocator                        141   2e-35   
ref|WP_003705739.1|  C4-dicarboxylate ABC transporter                   142   2e-35   
ref|WP_023887808.1|  hypothetical protein                               142   2e-35   
gb|EQM44261.1|  na+ symporter family protein                            141   2e-35   
gb|EFO36829.1|  2-oxoglutarate/malate translocator                      141   2e-35   
gb|AGB12076.1|  putative translocator                                   141   2e-35   
ref|XP_010690536.1|  PREDICTED: dicarboxylate transporter 2, chlo...    142   2e-35   
ref|WP_025626594.1|  2-oxoglutarate translocator                        141   2e-35   
gb|KDM98741.1|  C4-dicarboxylate ABC transporter                        142   2e-35   
gb|EYO35213.1|  DASS family divalent anion:Na+ symporter                139   2e-35   
ref|WP_025626170.1|  2-oxoglutarate translocator                        141   2e-35   
ref|WP_038160926.1|  C4-dicarboxylate ABC transporter                   142   2e-35   
ref|WP_003697406.1|  C4-dicarboxylate ABC transporter                   142   2e-35   
ref|WP_025576307.1|  2-oxoglutarate translocator                        141   2e-35   
ref|XP_002323748.1|  putative oxoglutarate-malate-translocase fam...    142   2e-35   
gb|KDN02801.1|  C4-dicarboxylate ABC transporter                        142   2e-35   
ref|WP_031780455.1|  2-oxoglutarate translocator                        141   2e-35   
ref|WP_044270950.1|  C4-dicarboxylate ABC transporter                   142   2e-35   
ref|WP_003689216.1|  2-oxoglutarate translocator                        141   2e-35   
ref|WP_020438430.1|  C4-dicarboxylate ABC transporter                   142   2e-35   
gb|EEV23041.1|  transporter, DASS family                                142   2e-35   
gb|EFL78157.1|  citT di-and tricarboxylate transporter                  141   2e-35   
ref|WP_033908116.1|  2-oxoglutarate translocator                        141   3e-35   
ref|WP_031778702.1|  2-oxoglutarate translocator                        141   3e-35   
gb|KED43475.1|  2-oxoglutarate translocator                             141   3e-35   
ref|WP_025589928.1|  2-oxoglutarate translocator                        141   3e-35   
sp|Q8L7Z9.1|DIT2_SPIOL  RecName: Full=Dicarboxylate transporter 2...    142   3e-35   
ref|WP_022487530.1|  anion transporter                                  141   3e-35   
ref|WP_006323576.1|  C4-dicarboxylate ABC transporter                   141   3e-35   
ref|WP_029805577.1|  2-oxoglutarate translocator                        141   3e-35   
gb|AHY05660.1|  C4-dicarboxylate ABC transporter                        141   3e-35   
ref|WP_005612588.1|  Anion transporter                                  141   3e-35   
ref|WP_025554538.1|  2-oxoglutarate translocator                        141   3e-35   
ref|WP_031812541.1|  2-oxoglutarate translocator                        141   3e-35   
ref|WP_029825684.1|  2-oxoglutarate translocator                        141   3e-35   
ref|WP_031381798.1|  2-oxoglutarate translocator                        141   3e-35   
gb|KHF07152.1|  2-oxoglutarate translocator                             141   3e-35   
ref|WP_031846587.1|  2-oxoglutarate translocator                        141   3e-35   
ref|WP_025535261.1|  2-oxoglutarate translocator                        141   3e-35   
ref|WP_021448447.1|  na+ symporter family protein                       141   3e-35   
ref|WP_005454276.1|  2-oxoglutarate translocator                        141   3e-35   
ref|WP_036934758.1|  C4-dicarboxylate ABC transporter                   141   3e-35   
ref|WP_031841362.1|  2-oxoglutarate translocator                        141   3e-35   
ref|WP_025795900.1|  2-oxoglutarate translocator                        141   3e-35   
ref|WP_023582652.1|  sodium:sulfate symporter                           141   3e-35   
ref|WP_013811484.1|  MULTISPECIES: C4-dicarboxylate ABC transporter     141   3e-35   
ref|WP_029815021.1|  2-oxoglutarate translocator                        141   3e-35   
ref|WP_025604554.1|  2-oxoglutarate translocator                        141   3e-35   
ref|WP_017447632.1|  2-oxoglutarate translocator                        141   3e-35   
ref|WP_004950104.1|  C4-dicarboxylate ABC transporter                   141   3e-35   
ref|WP_043037281.1|  2-oxoglutarate translocator                        141   3e-35   
gb|EMD78885.1|  putative 2-oxoglutarate/malate translocator             141   3e-35   
ref|WP_041516879.1|  2-oxoglutarate translocator                        141   3e-35   



>ref|XP_004142115.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Cucumis 
sativus]
 gb|KGN54177.1| 2-oxoglutarate/malate translocator [Cucumis sativus]
Length=572

 Score =   300 bits (767),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 184/198 (93%), Positives = 194/198 (98%), Gaps = 0/198 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            LL+TVGLWVFG VLN+DAVTAAILGL++LLVTGVV+WKECL EAVAWDTLTWFAALIAMA
Sbjct  375  LLLTVGLWVFGGVLNVDAVTAAILGLSVLLVTGVVTWKECLGEAVAWDTLTWFAALIAMA  434

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLISWFS+TVVK VGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL
Sbjct  435  GYLNKYGLISWFSQTVVKFVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  494

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVSvvn  216
            SVASALGTPPY GA+VLSFLSN+MGGLTHYGIGSAPVFYGANYVPLA+WWGYGFLVSVVN
Sbjct  495  SVASALGTPPYFGAIVLSFLSNLMGGLTHYGIGSAPVFYGANYVPLAQWWGYGFLVSVVN  554

Query  215  iiiwlgvggiwWKAIGLW  162
            IIIWLG+GGIWWKAIGLW
Sbjct  555  IIIWLGIGGIWWKAIGLW  572



>ref|XP_004162089.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Cucumis 
sativus]
Length=572

 Score =   300 bits (767),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 184/198 (93%), Positives = 194/198 (98%), Gaps = 0/198 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            LL+TVGLWVFG VLN+DAVTAAILGL++LLVTGVV+WKECL EAVAWDTLTWFAALIAMA
Sbjct  375  LLLTVGLWVFGGVLNVDAVTAAILGLSVLLVTGVVTWKECLGEAVAWDTLTWFAALIAMA  434

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLISWFS+TVVK VGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL
Sbjct  435  GYLNKYGLISWFSQTVVKFVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  494

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVSvvn  216
            SVASALGTPPY GA+VLSFLSN+MGGLTHYGIGSAPVFYGANYVPLA+WWGYGFLVSVVN
Sbjct  495  SVASALGTPPYFGAIVLSFLSNLMGGLTHYGIGSAPVFYGANYVPLAQWWGYGFLVSVVN  554

Query  215  iiiwlgvggiwWKAIGLW  162
            IIIWLG+GGIWWKAIGLW
Sbjct  555  IIIWLGIGGIWWKAIGLW  572



>ref|XP_011090364.1| PREDICTED: dicarboxylate transporter 1, chloroplastic [Sesamum 
indicum]
Length=413

 Score =   293 bits (751),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 180/198 (91%), Positives = 196/198 (99%), Gaps = 0/198 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            LL+TVGLW+FGSVLN+DAVTAAILGL++LLVTGVV+WKECL+EAVAWDTLTWFAALIAMA
Sbjct  216  LLLTVGLWIFGSVLNVDAVTAAILGLSVLLVTGVVTWKECLAEAVAWDTLTWFAALIAMA  275

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLISWFS+TVVK VGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL
Sbjct  276  GYLNKYGLISWFSQTVVKFVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  335

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVSvvn  216
            SVASALGTPPYLGA+VLSFLSN+MGG+THYGIGSAPVFYGA YVPLAKWWGYGFL+S+VN
Sbjct  336  SVASALGTPPYLGAVVLSFLSNLMGGITHYGIGSAPVFYGAGYVPLAKWWGYGFLISIVN  395

Query  215  iiiwlgvggiwWKAIGLW  162
            ++IWLGVGG+WWKAIGLW
Sbjct  396  LVIWLGVGGVWWKAIGLW  413



>ref|XP_009777235.1| PREDICTED: dicarboxylate transporter 1, chloroplastic [Nicotiana 
sylvestris]
Length=561

 Score =   298 bits (762),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 182/198 (92%), Positives = 195/198 (98%), Gaps = 0/198 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            LL+TVGLW+FGS L +DAVTAAILGL++LL+TGVV+WKECL EAVAWDTLTWFAALIAMA
Sbjct  364  LLLTVGLWIFGSTLKVDAVTAAILGLSVLLITGVVTWKECLGEAVAWDTLTWFAALIAMA  423

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL
Sbjct  424  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  483

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVSvvn  216
            SVASALGTPPYLGALVLSFLSN+MGG+THYGIGSAPVFYGANYVPLAKWWGYGF++S+VN
Sbjct  484  SVASALGTPPYLGALVLSFLSNLMGGITHYGIGSAPVFYGANYVPLAKWWGYGFIISIVN  543

Query  215  iiiwlgvggiwWKAIGLW  162
            +IIWLGVGGIWWKAIGLW
Sbjct  544  LIIWLGVGGIWWKAIGLW  561



>ref|XP_009609674.1| PREDICTED: dicarboxylate transporter 1, chloroplastic [Nicotiana 
tomentosiformis]
Length=561

 Score =   298 bits (762),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 182/198 (92%), Positives = 195/198 (98%), Gaps = 0/198 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            LL+TVGLW+FGS L +DAVTAAILGL++LL+TGVV+WKECL EAVAWDTLTWFAALIAMA
Sbjct  364  LLLTVGLWIFGSTLKVDAVTAAILGLSVLLITGVVTWKECLGEAVAWDTLTWFAALIAMA  423

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL
Sbjct  424  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  483

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVSvvn  216
            SVASALGTPPYLGALVLSFLSN+MGG+THYGIGSAPVFYGANYVPLAKWWGYGF++S+VN
Sbjct  484  SVASALGTPPYLGALVLSFLSNLMGGITHYGIGSAPVFYGANYVPLAKWWGYGFVISIVN  543

Query  215  iiiwlgvggiwWKAIGLW  162
            +IIWLGVGGIWWKAIGLW
Sbjct  544  LIIWLGVGGIWWKAIGLW  561



>ref|XP_004250945.1| PREDICTED: dicarboxylate transporter 1, chloroplastic [Solanum 
lycopersicum]
Length=555

 Score =   295 bits (754),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 193/198 (97%), Gaps = 0/198 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            LL+TVGLWVFG  L +DAVTAAILGL++LLVTGVV+WKECL EAVAWDTLTWFAALIAMA
Sbjct  358  LLLTVGLWVFGGALKVDAVTAAILGLSVLLVTGVVTWKECLGEAVAWDTLTWFAALIAMA  417

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL
Sbjct  418  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  477

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVSvvn  216
            SVASALGTPPYLGALVLSFLSN+MGG+THYGIGSAPVFYGANYVPLAKWWGYGF+ SVVN
Sbjct  478  SVASALGTPPYLGALVLSFLSNLMGGITHYGIGSAPVFYGANYVPLAKWWGYGFVCSVVN  537

Query  215  iiiwlgvggiwWKAIGLW  162
            ++IWLGVGGIWWKAIGLW
Sbjct  538  LLIWLGVGGIWWKAIGLW  555



>emb|CBI16377.3| unnamed protein product [Vitis vinifera]
Length=212

 Score =   283 bits (724),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 175/198 (88%), Positives = 193/198 (97%), Gaps = 0/198 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            LL+TVGLW+FG VLN+DAVTAAILGL++LLVTGVV+WKECL+E+VAWDTLTWFAALIAMA
Sbjct  15   LLLTVGLWIFGGVLNVDAVTAAILGLSVLLVTGVVTWKECLAESVAWDTLTWFAALIAMA  74

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLISWFS+TVVK VGGLGLSWQLSF IL+LLYFYSHYFFASGAAHIGAMFTAFL
Sbjct  75   GYLNKYGLISWFSQTVVKFVGGLGLSWQLSFSILLLLYFYSHYFFASGAAHIGAMFTAFL  134

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVSvvn  216
            SVASALGTPPY GA+VL+FLSN+MGGLTHYGIGSAP+FYGANYV LAKWWGYGFL+S+VN
Sbjct  135  SVASALGTPPYFGAMVLAFLSNLMGGLTHYGIGSAPIFYGANYVSLAKWWGYGFLISIVN  194

Query  215  iiiwlgvggiwWKAIGLW  162
            I+IWLGVGG+WWKAIGLW
Sbjct  195  IVIWLGVGGVWWKAIGLW  212



>ref|XP_008449718.1| PREDICTED: dicarboxylate transporter 1, chloroplastic [Cucumis 
melo]
Length=573

 Score =   295 bits (754),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 185/198 (93%), Positives = 194/198 (98%), Gaps = 0/198 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            LL+TVGLWVFG VLN+DAVTAAILGL++LLVTGVV+WKECL EAVAWDTLTWFAALIAMA
Sbjct  376  LLLTVGLWVFGGVLNVDAVTAAILGLSVLLVTGVVTWKECLGEAVAWDTLTWFAALIAMA  435

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLISWFS+TVVK VGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL
Sbjct  436  GYLNKYGLISWFSQTVVKFVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  495

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVSvvn  216
            SVASALGTPPY GA+VLSFLSN+MGGLTHYGIGSAPVFYGANYVPLA+WWGYGFLVSVVN
Sbjct  496  SVASALGTPPYFGAIVLSFLSNLMGGLTHYGIGSAPVFYGANYVPLAQWWGYGFLVSVVN  555

Query  215  iiiwlgvggiwWKAIGLW  162
            IIIWLGVGGIWWKAIGLW
Sbjct  556  IIIWLGVGGIWWKAIGLW  573



>ref|XP_006361749.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Solanum 
tuberosum]
Length=554

 Score =   293 bits (749),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 192/198 (97%), Gaps = 0/198 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            LL+TVGLWVFG  L +DAVTAAILGL++LLVTGVV+WKECL EAVAWDTLTWFAALIAMA
Sbjct  357  LLLTVGLWVFGGALKVDAVTAAILGLSVLLVTGVVTWKECLGEAVAWDTLTWFAALIAMA  416

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLISWFSETVVKVVGGL LSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL
Sbjct  417  GYLNKYGLISWFSETVVKVVGGLSLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  476

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVSvvn  216
            SVASALGTPPYLGALVLSFLSN+MGG+THYGIGSAPVFYGANYVPLAKWWGYGF+ SVVN
Sbjct  477  SVASALGTPPYLGALVLSFLSNLMGGITHYGIGSAPVFYGANYVPLAKWWGYGFVCSVVN  536

Query  215  iiiwlgvggiwWKAIGLW  162
            +IIWLGVGGIWWKAIGLW
Sbjct  537  LIIWLGVGGIWWKAIGLW  554



>gb|KHN25240.1| 2-oxoglutarate/malate translocator, chloroplastic [Glycine soja]
Length=297

 Score =   283 bits (725),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            L +TVGLWVFG +LNIDAV+AAILGL++LLVTGVV+WKECL+E VAWDTLTWFAALIAMA
Sbjct  100  LFLTVGLWVFGGLLNIDAVSAAILGLSVLLVTGVVTWKECLAEGVAWDTLTWFAALIAMA  159

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLISWFS+TVVK VGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL
Sbjct  160  GYLNKYGLISWFSQTVVKFVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  219

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            SVA+ALGTPP+ GA+VLSFLSN+MGGLTHYGIGSAPVF+GANYVPLAKWWGYGFL+S
Sbjct  220  SVATALGTPPFFGAIVLSFLSNLMGGLTHYGIGSAPVFFGANYVPLAKWWGYGFLIS  276



>gb|KDP22090.1| hypothetical protein JCGZ_25921 [Jatropha curcas]
Length=571

 Score =   291 bits (746),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 162/177 (92%), Positives = 174/177 (98%), Gaps = 0/177 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            LL+TVGLWVFG +LN+DAVTAAILGL+ILLVTGVV+WKECL+EAVAWDTLTWFAALIAMA
Sbjct  374  LLLTVGLWVFGGMLNVDAVTAAILGLSILLVTGVVTWKECLAEAVAWDTLTWFAALIAMA  433

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLISWFS+TVVK VGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL
Sbjct  434  GYLNKYGLISWFSQTVVKFVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  493

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            SVASALGTPPY GA+VL+FLSN+MGGLTHYGIGSAPVFYGANYVPL+KWWGYGFL+S
Sbjct  494  SVASALGTPPYFGAMVLAFLSNLMGGLTHYGIGSAPVFYGANYVPLSKWWGYGFLIS  550



>ref|XP_011045437.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Populus 
euphratica]
Length=560

 Score =   291 bits (745),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 179/198 (90%), Positives = 194/198 (98%), Gaps = 0/198 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            LL+TVGLW+FG +LN+DAVTAAILGL++LLVTGVV+WKECL+EAVAWDTLTWFAALIAMA
Sbjct  363  LLLTVGLWIFGGMLNVDAVTAAILGLSVLLVTGVVTWKECLAEAVAWDTLTWFAALIAMA  422

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLISWFS+TVVK VGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL
Sbjct  423  GYLNKYGLISWFSQTVVKFVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  482

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVSvvn  216
            SVASALGTPPY GA+VL+FLSN+MGGLTHYGIGSAP+FYGANYVPLAKWWGYG L+SVVN
Sbjct  483  SVASALGTPPYFGAIVLAFLSNLMGGLTHYGIGSAPIFYGANYVPLAKWWGYGLLISVVN  542

Query  215  iiiwlgvggiwWKAIGLW  162
            IIIWLGVGG+WWKAIGLW
Sbjct  543  IIIWLGVGGVWWKAIGLW  560



>ref|XP_011006198.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Populus 
euphratica]
Length=560

 Score =   291 bits (745),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 179/198 (90%), Positives = 194/198 (98%), Gaps = 0/198 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            LL+TVGLW+FG +LN+DAVTAAILGL++LLVTGVV+WKECL+EAVAWDTLTWFAALIAMA
Sbjct  363  LLLTVGLWIFGGMLNVDAVTAAILGLSVLLVTGVVTWKECLAEAVAWDTLTWFAALIAMA  422

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLISWFS+TVVK VGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL
Sbjct  423  GYLNKYGLISWFSQTVVKFVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  482

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVSvvn  216
            SVASALGTPPY GA+VL+FLSN+MGGLTHYGIGSAP+FYGANYVPLAKWWGYG L+SVVN
Sbjct  483  SVASALGTPPYFGAIVLAFLSNLMGGLTHYGIGSAPIFYGANYVPLAKWWGYGLLISVVN  542

Query  215  iiiwlgvggiwWKAIGLW  162
            IIIWLGVGG+WWKAIGLW
Sbjct  543  IIIWLGVGGVWWKAIGLW  560



>ref|XP_002513507.1| 2-oxoglutarate/malate translocator, chloroplast precursor, putative 
[Ricinus communis]
 gb|EEF48910.1| 2-oxoglutarate/malate translocator, chloroplast precursor, putative 
[Ricinus communis]
Length=561

 Score =   291 bits (745),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 174/177 (98%), Gaps = 0/177 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            LL+TVGLW+FG +LN+DAVTAAILGL++LL+TGVV+WKECL+EAVAWDTLTWFAALIAMA
Sbjct  364  LLLTVGLWIFGGMLNVDAVTAAILGLSVLLITGVVTWKECLAEAVAWDTLTWFAALIAMA  423

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLISWFS+TVVK VGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL
Sbjct  424  GYLNKYGLISWFSQTVVKFVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  483

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            SVASALGTPPY GA+VL+FLSN+MGGLTHYGIGSAPVFYGANYVPLA+WWGYGFL+S
Sbjct  484  SVASALGTPPYFGAMVLAFLSNLMGGLTHYGIGSAPVFYGANYVPLAQWWGYGFLIS  540



>ref|XP_007211882.1| hypothetical protein PRUPE_ppa003549mg [Prunus persica]
 gb|EMJ13081.1| hypothetical protein PRUPE_ppa003549mg [Prunus persica]
Length=566

 Score =   291 bits (744),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 173/177 (98%), Gaps = 0/177 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            LL+TVGLW+FG VLN+DAVTAAILGL++LLVTGV++WKECL+E+VAWDTLTWFAALIAMA
Sbjct  369  LLLTVGLWIFGGVLNVDAVTAAILGLSVLLVTGVITWKECLAESVAWDTLTWFAALIAMA  428

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLISWFS+TVVK VGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL
Sbjct  429  GYLNKYGLISWFSQTVVKFVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  488

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            SVASALGTPPY GA+VL+FLSN+MGGLTHYGIGSAPVFYGANYVPL KWWGYGFLVS
Sbjct  489  SVASALGTPPYFGAMVLAFLSNLMGGLTHYGIGSAPVFYGANYVPLGKWWGYGFLVS  545



>ref|XP_002299910.2| hypothetical protein POPTR_0001s26580g [Populus trichocarpa]
 gb|EEE84715.2| hypothetical protein POPTR_0001s26580g [Populus trichocarpa]
Length=560

 Score =   290 bits (743),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 177/198 (89%), Positives = 194/198 (98%), Gaps = 0/198 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            L +TVGLW+FG +LN+DAVTAAILGL++LL+TGVV+WKECL+E+VAWDTLTWFAALIAMA
Sbjct  363  LFLTVGLWIFGGMLNVDAVTAAILGLSVLLITGVVTWKECLAESVAWDTLTWFAALIAMA  422

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLISWFS+TVVK VGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL
Sbjct  423  GYLNKYGLISWFSQTVVKFVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  482

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVSvvn  216
            SVASALGTPPY GA+VL+FLSN+MGGLTHYGIGSAP+FYGANYVPLAKWWGYGFL+SVVN
Sbjct  483  SVASALGTPPYFGAMVLAFLSNLMGGLTHYGIGSAPIFYGANYVPLAKWWGYGFLISVVN  542

Query  215  iiiwlgvggiwWKAIGLW  162
            IIIWLGVGG+WWKAIGLW
Sbjct  543  IIIWLGVGGVWWKAIGLW  560



>ref|XP_007015046.1| Dicarboxylate transporter 1 isoform 2 [Theobroma cacao]
 gb|EOY32665.1| Dicarboxylate transporter 1 isoform 2 [Theobroma cacao]
Length=462

 Score =   287 bits (734),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 181/198 (91%), Positives = 193/198 (97%), Gaps = 0/198 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            LL+TVGLW+FG +LN+DAVTAAILGL++LLVTGVV+WKECL+E+VAWDTLTWFAALIAMA
Sbjct  265  LLLTVGLWIFGGMLNVDAVTAAILGLSVLLVTGVVTWKECLAESVAWDTLTWFAALIAMA  324

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLISWFS TVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL
Sbjct  325  GYLNKYGLISWFSGTVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  384

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVSvvn  216
            SVA ALGTPPYLGALVLSFLSN+MGG+THYGIGSAPVFYGA YVPLA WWGYGFL+SVVN
Sbjct  385  SVAGALGTPPYLGALVLSFLSNLMGGITHYGIGSAPVFYGAGYVPLATWWGYGFLISVVN  444

Query  215  iiiwlgvggiwWKAIGLW  162
            IIIWLGVGGIWWKAIGLW
Sbjct  445  IIIWLGVGGIWWKAIGLW  462



>ref|XP_006850217.1| hypothetical protein AMTR_s00022p00253280 [Amborella trichopoda]
 gb|ERN11798.1| hypothetical protein AMTR_s00022p00253280 [Amborella trichopoda]
Length=201

 Score =   278 bits (711),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 173/194 (89%), Positives = 187/194 (96%), Gaps = 0/194 (0%)
 Frame = -3

Query  743  VGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGYLN  564
            VGLW+FG+++N+DAVTAAILGL+ILL++GVV+WKECLSE+VAWDTLTWFAALIAMA YLN
Sbjct  8    VGLWIFGAMINVDAVTAAILGLSILLISGVVTWKECLSESVAWDTLTWFAALIAMANYLN  67

Query  563  KYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVAS  384
            KYGLI+WFSETVVK VGGLGLSWQLSFGILVLLY+YSHYFFASGAAHIGAMFTAFLSVAS
Sbjct  68   KYGLITWFSETVVKFVGGLGLSWQLSFGILVLLYYYSHYFFASGAAHIGAMFTAFLSVAS  127

Query  383  ALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVSvvniiiw  204
            ALGTPP  GALVLSFLSN+MGGLTHYGIGSAPVFYGANYVPLAKWWGYGFL+SVVNI IW
Sbjct  128  ALGTPPLFGALVLSFLSNLMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLISVVNIAIW  187

Query  203  lgvggiwWKAIGLW  162
            LGVGG WWK IGLW
Sbjct  188  LGVGGFWWKTIGLW  201



>gb|KJB35803.1| hypothetical protein B456_006G129000 [Gossypium raimondii]
Length=559

 Score =   289 bits (740),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 181/198 (91%), Positives = 194/198 (98%), Gaps = 0/198 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            L +TVGLW+FG VLN+DAVTAAILGL++LLVTGVV+WKECL+E+VAWDTLTWFAALIAMA
Sbjct  362  LFLTVGLWIFGGVLNVDAVTAAILGLSVLLVTGVVTWKECLAESVAWDTLTWFAALIAMA  421

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLISWFS+TVVKVVGGLGLSWQ+SFGILVLLYFYSHYFFASGAAHIGAMFTAFL
Sbjct  422  GYLNKYGLISWFSQTVVKVVGGLGLSWQMSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  481

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVSvvn  216
            SVASALGTP YLGALVLSFLSN+MGG+THYGIGSAPVFYGA YVPLAKWWGYGFL+SVVN
Sbjct  482  SVASALGTPSYLGALVLSFLSNLMGGITHYGIGSAPVFYGAGYVPLAKWWGYGFLISVVN  541

Query  215  iiiwlgvggiwWKAIGLW  162
            IIIWLGVGGIWWKAIGLW
Sbjct  542  IIIWLGVGGIWWKAIGLW  559



>dbj|BAD91178.1| putative plastidic 2-oxoglutarate/malate translocator [Mesembryanthemum 
crystallinum]
Length=426

 Score =   285 bits (730),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 177/198 (89%), Positives = 192/198 (97%), Gaps = 0/198 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            LL+TVGLWVFG VLN+DAVTAAILGL+ILL+TGVV+WKECL+E+VAWDTLTWFAALIAMA
Sbjct  229  LLLTVGLWVFGGVLNVDAVTAAILGLSILLITGVVTWKECLAESVAWDTLTWFAALIAMA  288

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLI+WFSETVVK VGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL
Sbjct  289  GYLNKYGLIAWFSETVVKFVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  348

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVSvvn  216
            SVASALG PPY  A+VL+FLSN+MGGLTHYGIGSAPVFYGANYVPLA+WWGYGF++SVVN
Sbjct  349  SVASALGAPPYFAAVVLAFLSNLMGGLTHYGIGSAPVFYGANYVPLAQWWGYGFVISVVN  408

Query  215  iiiwlgvggiwWKAIGLW  162
            I+IWLGVGG WWKAIGLW
Sbjct  409  ILIWLGVGGFWWKAIGLW  426



>ref|XP_010931014.1| PREDICTED: LOW QUALITY PROTEIN: dicarboxylate transporter 1, 
chloroplastic [Elaeis guineensis]
Length=557

 Score =   289 bits (740),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 173/177 (98%), Gaps = 0/177 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            LL+TVGLW+FG  LN+DAVTAAILGL+ILL+TGVV+WKECL+EAVAWDTLTWFAALIAMA
Sbjct  360  LLLTVGLWIFGGTLNVDAVTAAILGLSILLITGVVTWKECLAEAVAWDTLTWFAALIAMA  419

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLISWFS+TVVK+VGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL
Sbjct  420  GYLNKYGLISWFSQTVVKIVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  479

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            SVASALGTPP  GA+VL+FLSN+MGGLTHYGIGSAPVFYGANYVPLAKWWGYGFL+S
Sbjct  480  SVASALGTPPLFGAMVLAFLSNLMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLMS  536



>ref|XP_010536080.1| PREDICTED: dicarboxylate transporter 1, chloroplastic isoform 
X1 [Tarenaya hassleriana]
Length=413

 Score =   285 bits (728),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            LL+TVGLWVFG  LN+DAVTAAILGL+ILLVTGVV+WKECL EAVAWDTLTWFAALIAMA
Sbjct  216  LLLTVGLWVFGGKLNVDAVTAAILGLSILLVTGVVTWKECLGEAVAWDTLTWFAALIAMA  275

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLI WFS+TVVK VGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL
Sbjct  276  GYLNKYGLIEWFSQTVVKFVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  335

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            SVASALGTPPY  A+VL+FLSN+MGGLTHYGIGSAPVFYGANYVPLAKWWGYGF++S
Sbjct  336  SVASALGTPPYFAAMVLAFLSNLMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFIIS  392



>ref|XP_010673637.1| PREDICTED: dicarboxylate transporter 1, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=560

 Score =   289 bits (739),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 180/198 (91%), Positives = 193/198 (97%), Gaps = 0/198 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            LL+TVGLWVFG VLNIDAVTAAILGL++LL+TGVV+WKECL+E+VAWDTLTWFAALIAMA
Sbjct  363  LLLTVGLWVFGGVLNIDAVTAAILGLSVLLITGVVTWKECLAESVAWDTLTWFAALIAMA  422

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLISWFS TVVKVVGGLGLSWQ+SFGILVLLYFYSHYFFASGAAHIGAMFTAFL
Sbjct  423  GYLNKYGLISWFSATVVKVVGGLGLSWQMSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  482

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVSvvn  216
            SVA ALGTPP+L A+VLSFLSN+MGGLTHYGIGSAPVFYGANYVPL +WWGYGFLVSVVN
Sbjct  483  SVAGALGTPPFLAAIVLSFLSNLMGGLTHYGIGSAPVFYGANYVPLPQWWGYGFLVSVVN  542

Query  215  iiiwlgvggiwWKAIGLW  162
            IIIWLGVGGIWWKA+GLW
Sbjct  543  IIIWLGVGGIWWKALGLW  560



>ref|XP_008227299.1| PREDICTED: dicarboxylate transporter 1, chloroplastic [Prunus 
mume]
Length=566

 Score =   288 bits (738),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 173/177 (98%), Gaps = 0/177 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            LL+TVGLW+FG VLN+DAVTAAILGL++LLVTGV++WKECL+E+VAWDTLTWFAALI+MA
Sbjct  369  LLLTVGLWIFGGVLNVDAVTAAILGLSVLLVTGVITWKECLAESVAWDTLTWFAALISMA  428

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLISWFS+TVVK VGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL
Sbjct  429  GYLNKYGLISWFSQTVVKFVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  488

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            SVASALGTPPY GA+VL+FLSN+MGGLTHYGIGSAPVFYGANYVPL KWWGYGF++S
Sbjct  489  SVASALGTPPYFGAMVLAFLSNLMGGLTHYGIGSAPVFYGANYVPLGKWWGYGFVIS  545



>ref|XP_010031793.1| PREDICTED: dicarboxylate transporter 1, chloroplastic [Eucalyptus 
grandis]
 gb|KCW51183.1| hypothetical protein EUGRSUZ_J00769 [Eucalyptus grandis]
Length=571

 Score =   288 bits (737),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 179/198 (90%), Positives = 192/198 (97%), Gaps = 0/198 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            LL+TVGLW+FG  LN+DAVTAAILGL++LL+TGVV+WKECL EAVAWDTLTWFAALIAMA
Sbjct  374  LLLTVGLWIFGGKLNVDAVTAAILGLSVLLITGVVTWKECLGEAVAWDTLTWFAALIAMA  433

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLISWFS+TVVK VGGLGLSWQ SFGILVLLYFYSHYFFASGAAHIGAMFTAFL
Sbjct  434  GYLNKYGLISWFSQTVVKFVGGLGLSWQASFGILVLLYFYSHYFFASGAAHIGAMFTAFL  493

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVSvvn  216
            SVASALGTPPY GA+VL+FLSN+MGGLTHYGIGSAPVFYGANYVPLA+WWGYGF+VSVVN
Sbjct  494  SVASALGTPPYFGAMVLAFLSNLMGGLTHYGIGSAPVFYGANYVPLAQWWGYGFIVSVVN  553

Query  215  iiiwlgvggiwWKAIGLW  162
            IIIWLGVGGIWWKAIGLW
Sbjct  554  IIIWLGVGGIWWKAIGLW  571



>gb|KHG21220.1| 2-oxoglutarate/malate translocator, chloroplastic [Gossypium 
arboreum]
Length=559

 Score =   288 bits (736),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 180/198 (91%), Positives = 193/198 (97%), Gaps = 0/198 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            L +TVGLW+FG  LN+DAVTAAILGL++LLVTGVV+WKECL+E+VAWDTLTWFAALIAMA
Sbjct  362  LFLTVGLWIFGGALNVDAVTAAILGLSVLLVTGVVTWKECLAESVAWDTLTWFAALIAMA  421

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLISWFS+TVVKVVGGLGLSWQ+SFGILVLLYFYSHYFFASGAAHIGAMFTAFL
Sbjct  422  GYLNKYGLISWFSQTVVKVVGGLGLSWQMSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  481

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVSvvn  216
            SVASALGTP YLGALVLSFLSN+MGG+THYGIGSAPVFYGA YVPLAKWWGYGFL+SVVN
Sbjct  482  SVASALGTPSYLGALVLSFLSNLMGGITHYGIGSAPVFYGAGYVPLAKWWGYGFLISVVN  541

Query  215  iiiwlgvggiwWKAIGLW  162
            IIIWLGVGGIWWKAIGLW
Sbjct  542  IIIWLGVGGIWWKAIGLW  559



>gb|ABK24751.1| unknown [Picea sitchensis]
Length=594

 Score =   289 bits (739),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            LL+TVGLW+FG +L +DAVTAAILGL++LL TGVV+WKECL+E+VAWDTLTWFAALIAMA
Sbjct  397  LLVTVGLWIFGGMLKVDAVTAAILGLSVLLCTGVVTWKECLAESVAWDTLTWFAALIAMA  456

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLISWFS+TVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL
Sbjct  457  GYLNKYGLISWFSQTVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  516

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            SVASALGTPP  GA+VLSFLSN+MGGLTHYGIGSAPVFYGANYVPLA+WWGYGFL+S
Sbjct  517  SVASALGTPPLFGAMVLSFLSNLMGGLTHYGIGSAPVFYGANYVPLAQWWGYGFLIS  573



>ref|XP_011025529.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Populus 
euphratica]
Length=565

 Score =   288 bits (736),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            L +TVGLW+FG +LN+DAVTAAILGL+ILLVTGVV+WKECL+EAVAWDTLTWFAALIAMA
Sbjct  368  LFLTVGLWIFGGMLNVDAVTAAILGLSILLVTGVVTWKECLAEAVAWDTLTWFAALIAMA  427

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLISWFS+TVVK VGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL
Sbjct  428  GYLNKYGLISWFSQTVVKFVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  487

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            SVASALGTPPY GA+VL+F SN+MGGLTHYGIGSAPVFYGANYVPLAKWWGYGF++S
Sbjct  488  SVASALGTPPYFGAMVLAFFSNLMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFIIS  544



>ref|XP_011080429.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Sesamum 
indicum]
Length=482

 Score =   285 bits (730),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 175/198 (88%), Positives = 194/198 (98%), Gaps = 0/198 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            LL+TVGLW+ GS+LN+DAV+AAILGLT+LLVTGVV+WKECL+E+VAWDTLTWFAALIAMA
Sbjct  285  LLLTVGLWISGSILNVDAVSAAILGLTVLLVTGVVTWKECLAESVAWDTLTWFAALIAMA  344

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLISWFS++VVK VGGLGLSWQLSFGILVLLYFY+HYFFASGAAHIGAMFTAFL
Sbjct  345  GYLNKYGLISWFSQSVVKFVGGLGLSWQLSFGILVLLYFYAHYFFASGAAHIGAMFTAFL  404

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVSvvn  216
            SVASALGTPPYLGA VLSF+SN+MGG+THYGIGSAPVFYGA YVPLAKWWGYGFL+S+VN
Sbjct  405  SVASALGTPPYLGACVLSFVSNLMGGITHYGIGSAPVFYGAGYVPLAKWWGYGFLISIVN  464

Query  215  iiiwlgvggiwWKAIGLW  162
            +IIWLGVGG+WWKAIGLW
Sbjct  465  LIIWLGVGGVWWKAIGLW  482



>ref|XP_007015045.1| Dicarboxylate transporter 1 isoform 1 [Theobroma cacao]
 gb|EOY32664.1| Dicarboxylate transporter 1 isoform 1 [Theobroma cacao]
Length=559

 Score =   287 bits (735),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 181/198 (91%), Positives = 193/198 (97%), Gaps = 0/198 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            LL+TVGLW+FG +LN+DAVTAAILGL++LLVTGVV+WKECL+E+VAWDTLTWFAALIAMA
Sbjct  362  LLLTVGLWIFGGMLNVDAVTAAILGLSVLLVTGVVTWKECLAESVAWDTLTWFAALIAMA  421

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLISWFS TVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL
Sbjct  422  GYLNKYGLISWFSGTVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  481

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVSvvn  216
            SVA ALGTPPYLGALVLSFLSN+MGG+THYGIGSAPVFYGA YVPLA WWGYGFL+SVVN
Sbjct  482  SVAGALGTPPYLGALVLSFLSNLMGGITHYGIGSAPVFYGAGYVPLATWWGYGFLISVVN  541

Query  215  iiiwlgvggiwWKAIGLW  162
            IIIWLGVGGIWWKAIGLW
Sbjct  542  IIIWLGVGGIWWKAIGLW  559



>gb|KEH30210.1| 2-oxoglutarate/malate translocator [Medicago truncatula]
Length=557

 Score =   287 bits (735),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 173/198 (87%), Positives = 191/198 (96%), Gaps = 0/198 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            L +TVGLWVFG +LNIDAVTAAILGL +LL++GVV+WKECL+E VAWDTLTWFAALIAMA
Sbjct  360  LFLTVGLWVFGGLLNIDAVTAAILGLAVLLISGVVTWKECLAEGVAWDTLTWFAALIAMA  419

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLISWFS+TVVK VGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL
Sbjct  420  GYLNKYGLISWFSQTVVKFVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  479

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVSvvn  216
            SVA+ALGTPP+ GA+VLSFLSN+MGGLTHYGIGSAPVF+GANYVPLAKWWGYGF++S+VN
Sbjct  480  SVATALGTPPFFGAMVLSFLSNLMGGLTHYGIGSAPVFFGANYVPLAKWWGYGFVISIVN  539

Query  215  iiiwlgvggiwWKAIGLW  162
            I+IWLG+G IWWKAIGLW
Sbjct  540  IVIWLGLGSIWWKAIGLW  557



>ref|XP_003539493.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Glycine 
max]
Length=553

 Score =   287 bits (734),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            L +TVGLWVFG +LNIDAV+AAILGL++LLVTGVV+WKECL+E VAWDTLTWFAALIAMA
Sbjct  356  LFLTVGLWVFGGLLNIDAVSAAILGLSVLLVTGVVTWKECLAEGVAWDTLTWFAALIAMA  415

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLISWFS+TVVK VGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL
Sbjct  416  GYLNKYGLISWFSQTVVKFVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  475

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            SVA+ALGTPP+ GA+VLSFLSN+MGGLTHYGIGSAPVF+GANYVPLAKWWGYGFL+S
Sbjct  476  SVATALGTPPFFGAIVLSFLSNLMGGLTHYGIGSAPVFFGANYVPLAKWWGYGFLIS  532



>ref|XP_010257247.1| PREDICTED: dicarboxylate transporter 1, chloroplastic [Nelumbo 
nucifera]
Length=571

 Score =   287 bits (735),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            L++TVGLW+FGS LN+DAVTAAILGL++LL+TGVV+WKECL+EAVAWDTLTWFAALIAMA
Sbjct  374  LVLTVGLWIFGSKLNVDAVTAAILGLSVLLITGVVTWKECLAEAVAWDTLTWFAALIAMA  433

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLI+WFS+TVVK VGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL
Sbjct  434  GYLNKYGLITWFSQTVVKFVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  493

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            SVASALGTPP+  A+VLSFLSN+MGGLTHYGIGSAPVFYGANYVPLA WWGYGFL+S
Sbjct  494  SVASALGTPPFFAAMVLSFLSNLMGGLTHYGIGSAPVFYGANYVPLATWWGYGFLIS  550



>ref|XP_007132020.1| hypothetical protein PHAVU_011G059900g [Phaseolus vulgaris]
 gb|ESW04014.1| hypothetical protein PHAVU_011G059900g [Phaseolus vulgaris]
Length=559

 Score =   287 bits (734),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            L +TVGLWVFG VLN+DAV+AAILGL++LLVTGVV+WKECL+E VAWDTLTWFAALIAMA
Sbjct  362  LFLTVGLWVFGGVLNVDAVSAAILGLSVLLVTGVVTWKECLAEGVAWDTLTWFAALIAMA  421

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLISWFS+TVVK VGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL
Sbjct  422  GYLNKYGLISWFSQTVVKFVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  481

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            SV++ALGTPP+ GA+VLSFLSN+MGGLTHYGIGSAPVF+GANYVPLAKWWGYGFL+S
Sbjct  482  SVSTALGTPPFFGAIVLSFLSNLMGGLTHYGIGSAPVFFGANYVPLAKWWGYGFLIS  538



>gb|EEC69380.1| hypothetical protein OsI_38517 [Oryza sativa Indica Group]
Length=297

 Score =   278 bits (712),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            L +TVGLW+FG +LN+DAV+AAILGL++LL++GVV+WKECL EAVAWDTLTWFAALIAMA
Sbjct  100  LFLTVGLWIFGGMLNVDAVSAAILGLSVLLISGVVTWKECLGEAVAWDTLTWFAALIAMA  159

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLISWFSETVVK VGGLGLSWQLSFG+LVLLYFYSHYFFASGAAHIGAMFTAFL
Sbjct  160  GYLNKYGLISWFSETVVKFVGGLGLSWQLSFGVLVLLYFYSHYFFASGAAHIGAMFTAFL  219

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            SV+SALGTPP + A+VLSFLSNIMGGLTHYGIGSAPVFYGA YVPLA+WWGYGF++S
Sbjct  220  SVSSALGTPPLIAAMVLSFLSNIMGGLTHYGIGSAPVFYGAGYVPLAQWWGYGFVIS  276



>ref|XP_002282809.1| PREDICTED: dicarboxylate transporter 1, chloroplastic [Vitis 
vinifera]
Length=559

 Score =   286 bits (733),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 175/198 (88%), Positives = 193/198 (97%), Gaps = 0/198 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            LL+TVGLW+FG VLN+DAVTAAILGL++LLVTGVV+WKECL+E+VAWDTLTWFAALIAMA
Sbjct  362  LLLTVGLWIFGGVLNVDAVTAAILGLSVLLVTGVVTWKECLAESVAWDTLTWFAALIAMA  421

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLISWFS+TVVK VGGLGLSWQLSF IL+LLYFYSHYFFASGAAHIGAMFTAFL
Sbjct  422  GYLNKYGLISWFSQTVVKFVGGLGLSWQLSFSILLLLYFYSHYFFASGAAHIGAMFTAFL  481

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVSvvn  216
            SVASALGTPPY GA+VL+FLSN+MGGLTHYGIGSAP+FYGANYV LAKWWGYGFL+S+VN
Sbjct  482  SVASALGTPPYFGAMVLAFLSNLMGGLTHYGIGSAPIFYGANYVSLAKWWGYGFLISIVN  541

Query  215  iiiwlgvggiwWKAIGLW  162
            I+IWLGVGG+WWKAIGLW
Sbjct  542  IVIWLGVGGVWWKAIGLW  559



>ref|XP_003537966.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Glycine 
max]
Length=560

 Score =   286 bits (733),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            L +TVGLWVFG +LN+DAV+AAILGL++LLVTGVV+WKECL+E VAWDTLTWFAALIAMA
Sbjct  363  LFLTVGLWVFGGLLNVDAVSAAILGLSVLLVTGVVTWKECLAEGVAWDTLTWFAALIAMA  422

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLISWFS+TVVK VGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL
Sbjct  423  GYLNKYGLISWFSQTVVKFVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  482

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            SVA+ALGTPP+ GA+VLSFLSN+MGGLTHYGIGSAPVF+GANYVPLAKWWGYGFL+S
Sbjct  483  SVATALGTPPFFGAIVLSFLSNLMGGLTHYGIGSAPVFFGANYVPLAKWWGYGFLIS  539



>ref|XP_008801951.1| PREDICTED: dicarboxylate transporter 1, chloroplastic [Phoenix 
dactylifera]
Length=558

 Score =   286 bits (731),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            LL+TVGLW+FG  LN+DAVTAAILGL+ILL+TGVV+WKECL+E VAWDTLTWFAALIAMA
Sbjct  361  LLLTVGLWIFGGRLNVDAVTAAILGLSILLITGVVTWKECLAEGVAWDTLTWFAALIAMA  420

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
             YLNKYGLISWFS+TVVK VGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL
Sbjct  421  SYLNKYGLISWFSQTVVKFVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  480

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            SVASALGTPP  GA+VLSFLSN+MGGLTHYGIGSAPVFYGANYVPLAKWWGYGFL+S
Sbjct  481  SVASALGTPPLFGAMVLSFLSNLMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLIS  537



>ref|XP_010536081.1| PREDICTED: dicarboxylate transporter 1, chloroplastic isoform 
X2 [Tarenaya hassleriana]
Length=560

 Score =   286 bits (731),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            LL+TVGLWVFG  LN+DAVTAAILGL+ILLVTGVV+WKECL EAVAWDTLTWFAALIAMA
Sbjct  363  LLLTVGLWVFGGKLNVDAVTAAILGLSILLVTGVVTWKECLGEAVAWDTLTWFAALIAMA  422

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLI WFS+TVVK VGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL
Sbjct  423  GYLNKYGLIEWFSQTVVKFVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  482

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            SVASALGTPPY  A+VL+FLSN+MGGLTHYGIGSAPVFYGANYVPLAKWWGYGF++S
Sbjct  483  SVASALGTPPYFAAMVLAFLSNLMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFIIS  539



>ref|XP_009394734.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=561

 Score =   285 bits (730),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 171/177 (97%), Gaps = 0/177 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            LL+TVGLW+FG VLN+DAVTAAI+GL+ILL+TGVV+WKECL+E+VAWDTLTWFAALIAMA
Sbjct  364  LLLTVGLWIFGGVLNVDAVTAAIVGLSILLITGVVTWKECLAESVAWDTLTWFAALIAMA  423

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLISWFS+TVVK VGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL
Sbjct  424  GYLNKYGLISWFSQTVVKFVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  483

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            SVASALGTPP   A+VLSFLSN+MGGLTHYGIGSAPVFYGANYVPLAKWW YGF++S
Sbjct  484  SVASALGTPPLFAAMVLSFLSNLMGGLTHYGIGSAPVFYGANYVPLAKWWSYGFVIS  540



>gb|EYU31365.1| hypothetical protein MIMGU_mgv1a003738mg [Erythranthe guttata]
Length=567

 Score =   285 bits (730),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 174/177 (98%), Gaps = 0/177 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            LL+TVGLW+FGS L++DAVTAAILGL++LL+TGVV+WKECL+E+VAWDTLTWFAALIAMA
Sbjct  370  LLLTVGLWIFGSALSVDAVTAAILGLSVLLITGVVTWKECLAESVAWDTLTWFAALIAMA  429

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLI+WFS++VVK VGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL
Sbjct  430  GYLNKYGLITWFSQSVVKFVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  489

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            SVASALGTPPYLGA+VL+FLSN+MGG+THYGIGSAPVFYGA YVPLAKWWGYGFL+S
Sbjct  490  SVASALGTPPYLGAVVLAFLSNLMGGITHYGIGSAPVFYGAGYVPLAKWWGYGFLIS  546



>emb|CDP12268.1| unnamed protein product [Coffea canephora]
Length=573

 Score =   285 bits (729),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 176/198 (89%), Positives = 193/198 (97%), Gaps = 0/198 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            L++TVGLW+FG  LN+DAV+AAILGL++LL+TGVV+WKECL+E+VAWDTLTWFAALIAMA
Sbjct  376  LVLTVGLWIFGGALNVDAVSAAILGLSVLLITGVVTWKECLAESVAWDTLTWFAALIAMA  435

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLISWFS+TVVK VGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL
Sbjct  436  GYLNKYGLISWFSQTVVKFVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  495

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVSvvn  216
            SVASALGTP YLGALVLSFLSN+MGGLTHYGIGSAPVFYGA YVPLA+WWGYGFL+SVVN
Sbjct  496  SVASALGTPSYLGALVLSFLSNLMGGLTHYGIGSAPVFYGAGYVPLAQWWGYGFLMSVVN  555

Query  215  iiiwlgvggiwWKAIGLW  162
            I+IWLGVGG+WWKAIGLW
Sbjct  556  ILIWLGVGGVWWKAIGLW  573



>sp|Q41364.1|DIT1_SPIOL RecName: Full=Dicarboxylate transporter 1, chloroplastic; Short=SODIT1; 
AltName: Full=2-oxoglutarate/malate translocator; 
Flags: Precursor [Spinacia oleracea]
 gb|AAA68148.1| 2-oxoglutarate/malate translocator [Spinacia oleracea]
Length=569

 Score =   285 bits (728),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 173/198 (87%), Positives = 192/198 (97%), Gaps = 0/198 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            LL+TVGLWVFG  L +DAVTAAILGL++LL+TGVV+WKECL+E+VAWDTLTWFAALIAMA
Sbjct  372  LLLTVGLWVFGGKLGVDAVTAAILGLSVLLITGVVTWKECLAESVAWDTLTWFAALIAMA  431

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLI+WFSE VVKVVGGLGLSWQ+SFG+LVLLYFYSHYFFASGAAHIGAMFTAFL
Sbjct  432  GYLNKYGLITWFSENVVKVVGGLGLSWQMSFGVLVLLYFYSHYFFASGAAHIGAMFTAFL  491

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVSvvn  216
            SVASALGTPP+L A+VLSFLSN+MGGLTHYGIGSAPVFYGANYVPL +WWGYGFL+S+VN
Sbjct  492  SVASALGTPPFLAAIVLSFLSNLMGGLTHYGIGSAPVFYGANYVPLPQWWGYGFLISIVN  551

Query  215  iiiwlgvggiwWKAIGLW  162
            +IIWLGVGG+WWKAIGLW
Sbjct  552  LIIWLGVGGLWWKAIGLW  569



>ref|XP_009348953.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Pyrus 
x bretschneideri]
Length=563

 Score =   284 bits (726),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            L +TVGLW+FG VL++DAVTAAILGL++LLVTGV++WKECL+E+VAWDTLTWFAALIAMA
Sbjct  366  LFLTVGLWIFGGVLSVDAVTAAILGLSVLLVTGVITWKECLAESVAWDTLTWFAALIAMA  425

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLISWFS+TVVK VGGLGLSWQ SFGILVLLYFYSHYFFASGAAHIGAMFTAFL
Sbjct  426  GYLNKYGLISWFSQTVVKFVGGLGLSWQASFGILVLLYFYSHYFFASGAAHIGAMFTAFL  485

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            SV++ALGTPPY GA+VL+FLSN+MGGLTHYGIGSAPVFYGANYVPLAKWWGYGFL+S
Sbjct  486  SVSTALGTPPYFGAMVLAFLSNLMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLIS  542



>ref|XP_009366121.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Pyrus 
x bretschneideri]
Length=588

 Score =   284 bits (727),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            L +TVGLW+FG VL++DAVTAAILGL++LLVTGV++WKECL+E+VAWDTLTWFAALIAMA
Sbjct  391  LFLTVGLWIFGGVLSVDAVTAAILGLSVLLVTGVITWKECLAESVAWDTLTWFAALIAMA  450

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLISWFS+TVVK VGGLGLSWQ SFGILVLLYFYSHYFFASGAAHIGAMFTAFL
Sbjct  451  GYLNKYGLISWFSQTVVKFVGGLGLSWQASFGILVLLYFYSHYFFASGAAHIGAMFTAFL  510

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            SV++ALGTPPY GA+VL+FLSN+MGGLTHYGIGSAPVFYGANYVPLAKWWGYGFL+S
Sbjct  511  SVSTALGTPPYFGAMVLAFLSNLMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLIS  567



>ref|XP_006664065.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Oryza 
brachyantha]
Length=297

 Score =   275 bits (703),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 170/198 (86%), Positives = 186/198 (94%), Gaps = 0/198 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            L +TVGLW+FG +LN+DAV+AAILGL++LL++GVV+WKECL EAVAWDTLTWFAALIAMA
Sbjct  100  LFLTVGLWIFGGMLNVDAVSAAILGLSVLLISGVVTWKECLGEAVAWDTLTWFAALIAMA  159

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLISWFSETVVK VGGLGLSWQLSFG+LVLLYFYSHYFFASGAAHIGAMFTAFL
Sbjct  160  GYLNKYGLISWFSETVVKFVGGLGLSWQLSFGVLVLLYFYSHYFFASGAAHIGAMFTAFL  219

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVSvvn  216
            SV+SALGTP    A+VLSFLSNIMGGLTHYGIGSAPVFYGA YVPLA+WWGYGF++SVVN
Sbjct  220  SVSSALGTPSLFAAMVLSFLSNIMGGLTHYGIGSAPVFYGAGYVPLAQWWGYGFVISVVN  279

Query  215  iiiwlgvggiwWKAIGLW  162
            IIIWLG GG WWK IGLW
Sbjct  280  IIIWLGAGGFWWKMIGLW  297



>ref|XP_009411283.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=562

 Score =   283 bits (725),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            LL+TVGLWVFG  LN+DAVTAAILGL++LL+TGVV+WKECL+E+VAWDTLTWFAALIAMA
Sbjct  365  LLLTVGLWVFGGTLNVDAVTAAILGLSVLLITGVVTWKECLAESVAWDTLTWFAALIAMA  424

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLISWFS+TVVK VGGLGLSWQLSFGILVLLYFYSHY FASGAAHIGAMFTAFL
Sbjct  425  GYLNKYGLISWFSQTVVKFVGGLGLSWQLSFGILVLLYFYSHYLFASGAAHIGAMFTAFL  484

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            SVASALGTPP   A+VLSFLSN+MGGLTHYGIGSAPVFYGANYVPL KWWGYGF+VS
Sbjct  485  SVASALGTPPLFAAMVLSFLSNLMGGLTHYGIGSAPVFYGANYVPLPKWWGYGFIVS  541



>gb|EEE53308.1| hypothetical protein OsJ_36283 [Oryza sativa Japonica Group]
Length=497

 Score =   281 bits (719),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            L +TVGLW+FG +LN+DAV+AAILGL++LL++GVV+WKECL EAVAWDTLTWFAALIAMA
Sbjct  300  LFLTVGLWIFGGMLNVDAVSAAILGLSVLLISGVVTWKECLGEAVAWDTLTWFAALIAMA  359

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLISWFSETVVK VGGLGLSWQLSFG+LVLLYFYSHYFFASGAAHIGAMFTAFL
Sbjct  360  GYLNKYGLISWFSETVVKFVGGLGLSWQLSFGVLVLLYFYSHYFFASGAAHIGAMFTAFL  419

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            SV+SALGTPP + A+VLSFLSNIMGGLTHYGIGSAPVFYGA YVPLA+WWGYGF++S
Sbjct  420  SVSSALGTPPLIAAMVLSFLSNIMGGLTHYGIGSAPVFYGAGYVPLAQWWGYGFVIS  476



>gb|EYU46260.1| hypothetical protein MIMGU_mgv1a003794mg [Erythranthe guttata]
Length=564

 Score =   283 bits (724),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 171/198 (86%), Positives = 193/198 (97%), Gaps = 0/198 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            LL+TVGLW+ GSVLN+DAVTAAILGL++LL+TGVV+WKECL+E+VAWDTLTWFAALIAMA
Sbjct  367  LLLTVGLWISGSVLNVDAVTAAILGLSVLLITGVVTWKECLAESVAWDTLTWFAALIAMA  426

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLISWFS+TVV+ VGGLGLSWQLSFG+LVLLYFYSHYFFASGAAHIGAMFTAFL
Sbjct  427  GYLNKYGLISWFSQTVVQFVGGLGLSWQLSFGVLVLLYFYSHYFFASGAAHIGAMFTAFL  486

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVSvvn  216
            SVA+ALGTPPYLGA VL+F+SN+MGG+THYGIGSAPVFYGA YVPL KWWGYGFL+S+VN
Sbjct  487  SVATALGTPPYLGACVLAFVSNLMGGITHYGIGSAPVFYGAGYVPLGKWWGYGFLISIVN  546

Query  215  iiiwlgvggiwWKAIGLW  162
            ++IWLGVGG+WWKAIGLW
Sbjct  547  LVIWLGVGGLWWKAIGLW  564



>emb|CAX65044.1| plastidic 2-oxoglutarate/malate translocator [Pisum sativum]
Length=480

 Score =   280 bits (717),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 172/198 (87%), Positives = 190/198 (96%), Gaps = 0/198 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            L +TVGLWVFG +LN+DAVT+AILGL +LL+TGVV+ KECL+E VAWDTLTWFAALIAMA
Sbjct  283  LFLTVGLWVFGGLLNVDAVTSAILGLAVLLITGVVTCKECLAEGVAWDTLTWFAALIAMA  342

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLISWFS+TVVK VGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL
Sbjct  343  GYLNKYGLISWFSQTVVKFVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  402

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVSvvn  216
            SVA+ALGTPP+ GA+VLSFLSN+MGGLTHYGIGSAPVF+GANYVPLAKWWGYGF++S+VN
Sbjct  403  SVATALGTPPFFGAMVLSFLSNLMGGLTHYGIGSAPVFFGANYVPLAKWWGYGFVISIVN  462

Query  215  iiiwlgvggiwWKAIGLW  162
            IIIWLG+G IWWKAIGLW
Sbjct  463  IIIWLGLGSIWWKAIGLW  480



>ref|XP_008363620.1| PREDICTED: dicarboxylate transporter 1, chloroplastic [Malus 
domestica]
Length=569

 Score =   283 bits (723),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 171/177 (97%), Gaps = 0/177 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            L +TVGLW+FG +L +DAVTAAILGL++LLVTGV++WKECL+E+VAWDTLTWFAALIAMA
Sbjct  372  LFLTVGLWIFGGILGVDAVTAAILGLSVLLVTGVITWKECLAESVAWDTLTWFAALIAMA  431

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLISWFS+T+VK VGGLGLSWQ SFGILVLLYFYSHYFFASGAAHIGAMFTAFL
Sbjct  432  GYLNKYGLISWFSQTIVKFVGGLGLSWQASFGILVLLYFYSHYFFASGAAHIGAMFTAFL  491

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            SV++ALGTPPY GA+VL+FLSN+MGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS
Sbjct  492  SVSTALGTPPYFGAMVLAFLSNLMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  548



>ref|XP_010102341.1| 2-oxoglutarate/malate translocator [Morus notabilis]
 gb|EXB93302.1| 2-oxoglutarate/malate translocator [Morus notabilis]
Length=565

 Score =   282 bits (721),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            LL+TVGLW+FG +LN+DAVTAAILGL+ILLVTGVV+WKECL+E VAWDTLTWFAALIAMA
Sbjct  368  LLLTVGLWIFGGILNVDAVTAAILGLSILLVTGVVTWKECLAEGVAWDTLTWFAALIAMA  427

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLISWFS+TVVK VGGLGLSWQ SFG+LVLLYFYSHYFFASGAAHIGAMFTAFL
Sbjct  428  GYLNKYGLISWFSQTVVKFVGGLGLSWQYSFGLLVLLYFYSHYFFASGAAHIGAMFTAFL  487

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            SVASALGTP Y  A+VL+FLSN+MGGLTHYGIGSAPVFYGANYVPLAKWWGYGFL+S
Sbjct  488  SVASALGTPSYFAAMVLAFLSNLMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLIS  544



>ref|XP_006446115.1| hypothetical protein CICLE_v10014769mg [Citrus clementina]
 ref|XP_006470607.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Citrus 
sinensis]
 gb|ESR59355.1| hypothetical protein CICLE_v10014769mg [Citrus clementina]
 gb|KDO61260.1| hypothetical protein CISIN_1g008538mg [Citrus sinensis]
Length=562

 Score =   281 bits (720),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            LL+TVGLWVFG  LN+D VTAAILGL+ILLVTGVV+WKECL+E+VAWDTLTWFAALIAMA
Sbjct  365  LLLTVGLWVFGGRLNVDPVTAAILGLSILLVTGVVTWKECLAESVAWDTLTWFAALIAMA  424

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLI+WFS+TVVK VGGLGLSWQLSFGIL+LLYFYSHYFFASGAAHIGAMFTAFL
Sbjct  425  GYLNKYGLITWFSQTVVKFVGGLGLSWQLSFGILILLYFYSHYFFASGAAHIGAMFTAFL  484

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            SVASALG PPY  A+VL+F SN+MGGLTHYGIGSAPVFYGANYVPLAKWWGYGF+VS
Sbjct  485  SVASALGCPPYFVAMVLAFFSNLMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFIVS  541



>ref|XP_010453336.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like isoform 
X2 [Camelina sativa]
Length=560

 Score =   281 bits (719),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            L++TVGLW+FG+ L++DAVTAAILGL++LLVTGVV+WKECL+E+VAWDTLTWFAALIAMA
Sbjct  363  LVLTVGLWIFGAKLSVDAVTAAILGLSVLLVTGVVTWKECLAESVAWDTLTWFAALIAMA  422

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLI WFS+TVVK VGGLGLSWQLSFGILVLLYFY+HYFFASGAAHIGAMFTAFL
Sbjct  423  GYLNKYGLIEWFSQTVVKFVGGLGLSWQLSFGILVLLYFYTHYFFASGAAHIGAMFTAFL  482

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            SV++ALGTPPY  ALVL+FLSN+MGGLTHYGIGSAP+FYGANYVPLAKWWGYGFL+S
Sbjct  483  SVSTALGTPPYFAALVLAFLSNLMGGLTHYGIGSAPIFYGANYVPLAKWWGYGFLIS  539



>ref|NP_001066885.1| Os12g0515400 [Oryza sativa Japonica Group]
 gb|ABA98704.1| 2-oxoglutarate/malate translocator, chloroplast precursor, putative, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF29904.1| Os12g0515400 [Oryza sativa Japonica Group]
Length=548

 Score =   281 bits (718),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            L +TVGLW+FG +LN+DAV+AAILGL++LL++GVV+WKECL EAVAWDTLTWFAALIAMA
Sbjct  351  LFLTVGLWIFGGMLNVDAVSAAILGLSVLLISGVVTWKECLGEAVAWDTLTWFAALIAMA  410

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLISWFSETVVK VGGLGLSWQLSFG+LVLLYFYSHYFFASGAAHIGAMFTAFL
Sbjct  411  GYLNKYGLISWFSETVVKFVGGLGLSWQLSFGVLVLLYFYSHYFFASGAAHIGAMFTAFL  470

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            SV+SALGTPP + A+VLSFLSNIMGGLTHYGIGSAPVFYGA YVPLA+WWGYGF++S
Sbjct  471  SVSSALGTPPLIAAMVLSFLSNIMGGLTHYGIGSAPVFYGAGYVPLAQWWGYGFVIS  527



>ref|XP_010453335.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like isoform 
X1 [Camelina sativa]
Length=559

 Score =   281 bits (719),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            L++TVGLW+FG+ L++DAVTAAILGL++LLVTGVV+WKECL+E+VAWDTLTWFAALIAMA
Sbjct  362  LVLTVGLWIFGAKLSVDAVTAAILGLSVLLVTGVVTWKECLAESVAWDTLTWFAALIAMA  421

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLI WFS+TVVK VGGLGLSWQLSFGILVLLYFY+HYFFASGAAHIGAMFTAFL
Sbjct  422  GYLNKYGLIEWFSQTVVKFVGGLGLSWQLSFGILVLLYFYTHYFFASGAAHIGAMFTAFL  481

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            SV++ALGTPPY  ALVL+FLSN+MGGLTHYGIGSAP+FYGANYVPLAKWWGYGFL+S
Sbjct  482  SVSTALGTPPYFAALVLAFLSNLMGGLTHYGIGSAPIFYGANYVPLAKWWGYGFLIS  538



>ref|NP_001119216.1| dicarboxylate transporter 1 [Arabidopsis thaliana]
 gb|AED91823.1| dicarboxylate transporter 1 [Arabidopsis thaliana]
Length=556

 Score =   281 bits (719),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            L +TVGLW+FG+ L +DAVTAAILGL++LLVTGVV+WKECL+E+VAWDTLTWFAALIAMA
Sbjct  360  LFLTVGLWIFGAKLGVDAVTAAILGLSVLLVTGVVTWKECLAESVAWDTLTWFAALIAMA  419

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLI WFS+TVVK VGGLGLSWQLSFGILVLLYFY+HYFFASGAAHIGAMFTAFL
Sbjct  420  GYLNKYGLIEWFSQTVVKFVGGLGLSWQLSFGILVLLYFYTHYFFASGAAHIGAMFTAFL  479

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            SV++ALGTPPY  ALVL+FLSN+MGGLTHYGIGSAP+FYGANYVPLAKWWGYGFL+S
Sbjct  480  SVSTALGTPPYFAALVLAFLSNLMGGLTHYGIGSAPIFYGANYVPLAKWWGYGFLIS  536



>ref|XP_009375074.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Pyrus 
x bretschneideri]
Length=623

 Score =   283 bits (723),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            L +TVGLW+FG +L +DAVTAAILGL +LLVTGV++WKECL+E+VAWDTLTWFAALIAMA
Sbjct  426  LFLTVGLWIFGGILGVDAVTAAILGLFVLLVTGVITWKECLAESVAWDTLTWFAALIAMA  485

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLISWFS+TVVK VGGLGLSWQ SFGILVLLYFYSHYFFASGAAHIGAMFTAFL
Sbjct  486  GYLNKYGLISWFSQTVVKFVGGLGLSWQASFGILVLLYFYSHYFFASGAAHIGAMFTAFL  545

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            SV++ALGTPP+ GA+VL+FLSN+MGGLTHYGIGSAPVFYGANYVPLAKWWGYGFL+S
Sbjct  546  SVSTALGTPPFFGAMVLAFLSNLMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLIS  602



>ref|XP_002873582.1| hypothetical protein ARALYDRAFT_909232 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49841.1| hypothetical protein ARALYDRAFT_909232 [Arabidopsis lyrata subsp. 
lyrata]
Length=554

 Score =   281 bits (718),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 171/177 (97%), Gaps = 0/177 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            L +TVGLW+FG+ L++DAVTAAILGL++LLVTGVV+WKECL+E+VAWDTLTWFAALIAMA
Sbjct  357  LFLTVGLWIFGAKLSVDAVTAAILGLSVLLVTGVVTWKECLAESVAWDTLTWFAALIAMA  416

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLI WFS+TVVK VGGLGLSWQLSFGILVLLYFY+HYFFASGAAHIGAMFTAFL
Sbjct  417  GYLNKYGLIEWFSQTVVKFVGGLGLSWQLSFGILVLLYFYTHYFFASGAAHIGAMFTAFL  476

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            SV++ALGTPPY  ALVL+FLSN+MGGLTHYGIGSAP+FYGANYVPLAKWWGYGFL+S
Sbjct  477  SVSTALGTPPYFAALVLAFLSNLMGGLTHYGIGSAPIFYGANYVPLAKWWGYGFLIS  533



>ref|XP_009343722.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Pyrus 
x bretschneideri]
 ref|XP_009343726.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Pyrus 
x bretschneideri]
Length=569

 Score =   281 bits (719),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            L +TVGLW+FG +L +DAVTAAILGL +LLVTGV++WKECL+E+VAWDTLTWFAALIAMA
Sbjct  372  LFLTVGLWIFGGILGVDAVTAAILGLFVLLVTGVITWKECLAESVAWDTLTWFAALIAMA  431

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLISWFS+TVVK VGGLGLSWQ SFGILVLLYFYSHYFFASGAAHIGAMFTAFL
Sbjct  432  GYLNKYGLISWFSQTVVKFVGGLGLSWQASFGILVLLYFYSHYFFASGAAHIGAMFTAFL  491

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            SV++ALGTPP+ GA+VL+FLSN+MGGLTHYGIGSAPVFYGANYVPLAKWWGYGFL+S
Sbjct  492  SVSTALGTPPFFGAMVLAFLSNLMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLIS  548



>ref|XP_006287403.1| hypothetical protein CARUB_v10000609mg [Capsella rubella]
 gb|EOA20301.1| hypothetical protein CARUB_v10000609mg [Capsella rubella]
Length=557

 Score =   281 bits (718),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 171/177 (97%), Gaps = 0/177 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            L +TVGLW+FG+ L++DAVTAAILGL++LLVTGVV+WKECL+E+VAWDTLTWFAALIAMA
Sbjct  360  LFLTVGLWIFGAKLSVDAVTAAILGLSVLLVTGVVTWKECLAESVAWDTLTWFAALIAMA  419

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLI WFS+TVVK VGGLGLSWQLSFGILVLLYFY+HYFFASGAAHIGAMFTAFL
Sbjct  420  GYLNKYGLIEWFSQTVVKFVGGLGLSWQLSFGILVLLYFYTHYFFASGAAHIGAMFTAFL  479

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            SV++ALGTPPY  ALVL+FLSN+MGGLTHYGIGSAP+FYGANYVPLAKWWGYGFL+S
Sbjct  480  SVSTALGTPPYFAALVLAFLSNLMGGLTHYGIGSAPIFYGANYVPLAKWWGYGFLIS  536



>ref|XP_010419844.1| PREDICTED: dicarboxylate transporter 1, chloroplastic [Camelina 
sativa]
Length=559

 Score =   281 bits (718),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 171/177 (97%), Gaps = 0/177 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            L +TVGLW+FG+ L++DAVTAAILGL++LLVTGVV+WKECL+E+VAWDTLTWFAALIAMA
Sbjct  362  LFLTVGLWIFGAKLSVDAVTAAILGLSVLLVTGVVTWKECLAESVAWDTLTWFAALIAMA  421

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLI WFS+TVVK VGGLGLSWQLSFGILVLLYFY+HYFFASGAAHIGAMFTAFL
Sbjct  422  GYLNKYGLIEWFSQTVVKFVGGLGLSWQLSFGILVLLYFYTHYFFASGAAHIGAMFTAFL  481

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            SV++ALGTPPY  ALVL+FLSN+MGGLTHYGIGSAP+FYGANYVPLAKWWGYGFL+S
Sbjct  482  SVSTALGTPPYFAALVLAFLSNLMGGLTHYGIGSAPIFYGANYVPLAKWWGYGFLIS  538



>gb|ACR38538.1| unknown [Zea mays]
Length=297

 Score =   273 bits (697),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 168/198 (85%), Positives = 187/198 (94%), Gaps = 0/198 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            LL+TVGLW+FG +LN+DAV+AAILGL +LL++GVV+WKECL+E+VAWDTLTWFAALIAMA
Sbjct  100  LLLTVGLWIFGGMLNVDAVSAAILGLAVLLISGVVTWKECLAESVAWDTLTWFAALIAMA  159

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNK+GLISWFSETVVK VGGLG+SWQLSFG+LVLLYFYSHYFFASGAAHIGAMFTAFL
Sbjct  160  GYLNKFGLISWFSETVVKFVGGLGMSWQLSFGVLVLLYFYSHYFFASGAAHIGAMFTAFL  219

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVSvvn  216
            SVASALGTP    A+VLSFLSN+MGG THYGIGSAPVFYGA YVPLA+WWGYGF++SVVN
Sbjct  220  SVASALGTPSLFAAMVLSFLSNLMGGTTHYGIGSAPVFYGAGYVPLAQWWGYGFVISVVN  279

Query  215  iiiwlgvggiwWKAIGLW  162
            IIIWLGVGG WWK IGLW
Sbjct  280  IIIWLGVGGFWWKIIGLW  297



>ref|XP_009121830.1| PREDICTED: dicarboxylate transporter 1, chloroplastic [Brassica 
rapa]
Length=548

 Score =   280 bits (716),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 171/177 (97%), Gaps = 0/177 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            L +TVGLW+FG+ L++DAVTAAILGL++LLVTGVV+WKECL+E+VAWDTLTWFAALIAMA
Sbjct  351  LFLTVGLWIFGAKLSVDAVTAAILGLSVLLVTGVVTWKECLAESVAWDTLTWFAALIAMA  410

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLI WFS+TVVK VGGLGLSWQLSFGILVLLYFY+HYFFASGAAHIGAMFTAFL
Sbjct  411  GYLNKYGLIEWFSQTVVKFVGGLGLSWQLSFGILVLLYFYTHYFFASGAAHIGAMFTAFL  470

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            SV++ALGTPPY  ALVL+FLSN+MGGLTHYGIGSAP+FYGANYVPL+KWWGYGFL+S
Sbjct  471  SVSTALGTPPYFAALVLAFLSNLMGGLTHYGIGSAPIFYGANYVPLSKWWGYGFLIS  527



>gb|KFK25523.1| hypothetical protein AALP_AA8G126300 [Arabis alpina]
Length=556

 Score =   280 bits (717),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 171/177 (97%), Gaps = 0/177 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            L +TVGLW+FG+ L++DAVTAAILGL++LLVTGVV+WKECL+E+VAWDTLTWFAALIAMA
Sbjct  359  LFLTVGLWIFGAKLSVDAVTAAILGLSVLLVTGVVTWKECLAESVAWDTLTWFAALIAMA  418

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLI WFS+TVVK VGGLGLSWQLSFGILVLLYFY+HYFFASGAAHIGAMFTAFL
Sbjct  419  GYLNKYGLIEWFSQTVVKFVGGLGLSWQLSFGILVLLYFYTHYFFASGAAHIGAMFTAFL  478

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            SV++ALGTPPY  ALVL+FLSN+MGGLTHYGIGSAP+FYGANYVPLAKWWGYGFL+S
Sbjct  479  SVSTALGTPPYFAALVLAFLSNLMGGLTHYGIGSAPIFYGANYVPLAKWWGYGFLIS  535



>ref|NP_568283.2| dicarboxylate transporter 1 [Arabidopsis thaliana]
 sp|Q9LXV3.1|DIT1_ARATH RecName: Full=Dicarboxylate transporter 1, chloroplastic; AltName: 
Full=2-oxoglutarate/malate translocator 1; Short=AtpOMT1; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAB88250.1| 2-oxoglutarate/malate translocator precursor-like protein [Arabidopsis 
thaliana]
 gb|AED91822.1| dicarboxylate transporter 1 [Arabidopsis thaliana]
Length=557

 Score =   280 bits (717),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            L +TVGLW+FG+ L +DAVTAAILGL++LLVTGVV+WKECL+E+VAWDTLTWFAALIAMA
Sbjct  360  LFLTVGLWIFGAKLGVDAVTAAILGLSVLLVTGVVTWKECLAESVAWDTLTWFAALIAMA  419

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLI WFS+TVVK VGGLGLSWQLSFGILVLLYFY+HYFFASGAAHIGAMFTAFL
Sbjct  420  GYLNKYGLIEWFSQTVVKFVGGLGLSWQLSFGILVLLYFYTHYFFASGAAHIGAMFTAFL  479

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            SV++ALGTPPY  ALVL+FLSN+MGGLTHYGIGSAP+FYGANYVPLAKWWGYGFL+S
Sbjct  480  SVSTALGTPPYFAALVLAFLSNLMGGLTHYGIGSAPIFYGANYVPLAKWWGYGFLIS  536



>ref|XP_010492022.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Camelina 
sativa]
Length=557

 Score =   280 bits (716),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 171/177 (97%), Gaps = 0/177 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            L +TVGLW+FG+ L++DAVTAAILGL++LLVTGVV+WKECL+E+VAWDTLTWFAALIAMA
Sbjct  360  LFLTVGLWIFGAKLSVDAVTAAILGLSVLLVTGVVTWKECLAESVAWDTLTWFAALIAMA  419

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLI WFS+TVVK VGGLGLSWQLSFGILVLLYFY+HYFFASGAAHIGAMFTAFL
Sbjct  420  GYLNKYGLIEWFSQTVVKFVGGLGLSWQLSFGILVLLYFYTHYFFASGAAHIGAMFTAFL  479

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            SV++ALGTPPY  ALVL+FLSN+MGGLTHYGIGSAP+FYGANYVPLAKWWGYGF++S
Sbjct  480  SVSTALGTPPYFAALVLAFLSNLMGGLTHYGIGSAPIFYGANYVPLAKWWGYGFVIS  536



>emb|CDY53969.1| BnaA10g30010D [Brassica napus]
Length=552

 Score =   280 bits (716),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 171/177 (97%), Gaps = 0/177 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            L +TVGLW+FG+ L++DAVTAAILGL++LLVTGVV+WKECL+E+VAWDTLTWFAALIAMA
Sbjct  355  LFLTVGLWIFGAKLSVDAVTAAILGLSVLLVTGVVTWKECLAESVAWDTLTWFAALIAMA  414

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLI WFS+TVVK VGGLGLSWQLSFGILVLLYFY+HYFFASGAAHIGAMFTAFL
Sbjct  415  GYLNKYGLIEWFSQTVVKFVGGLGLSWQLSFGILVLLYFYTHYFFASGAAHIGAMFTAFL  474

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            SV++ALGTPPY  ALVL+FLSN+MGGLTHYGIGSAP+FYGANYVPL+KWWGYGFL+S
Sbjct  475  SVSTALGTPPYFAALVLAFLSNLMGGLTHYGIGSAPIFYGANYVPLSKWWGYGFLIS  531



>ref|XP_003575954.1| PREDICTED: LOW QUALITY PROTEIN: dicarboxylate transporter 1, 
chloroplastic [Brachypodium distachyon]
Length=560

 Score =   280 bits (715),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 171/177 (97%), Gaps = 0/177 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            LL+TVGLW+FG +L++DAV+AAILGL++LL+TGVV+WKECL+E+VAWDTLTWFAALIAMA
Sbjct  363  LLLTVGLWIFGGMLSVDAVSAAILGLSVLLITGVVTWKECLAESVAWDTLTWFAALIAMA  422

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLI+WFSETVVK VGGLGLSWQLSFG+LVLLYFYSHYFFASGAAHIGAMFTAFL
Sbjct  423  GYLNKYGLIAWFSETVVKFVGGLGLSWQLSFGVLVLLYFYSHYFFASGAAHIGAMFTAFL  482

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            SV+SALGTPP   A+VLSFLSNIMGGLTHYGIGSAPVFYGA YVPLA+WWGYGF++S
Sbjct  483  SVSSALGTPPLFAAMVLSFLSNIMGGLTHYGIGSAPVFYGAGYVPLAQWWGYGFVIS  539



>emb|CDX97208.1| BnaC09g44170D [Brassica napus]
Length=569

 Score =   280 bits (716),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 171/177 (97%), Gaps = 0/177 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            L +TVGLW+FG+ L++DAVTAAILGL++LLVTGVV+WKECL+E+VAWDTLTWFAALIAMA
Sbjct  372  LFLTVGLWIFGAKLSVDAVTAAILGLSVLLVTGVVTWKECLAESVAWDTLTWFAALIAMA  431

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLI WFS+TVVK VGGLGLSWQLSFGILVLLYFY+HYFFASGAAHIGAMFTAFL
Sbjct  432  GYLNKYGLIEWFSQTVVKFVGGLGLSWQLSFGILVLLYFYTHYFFASGAAHIGAMFTAFL  491

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            SV++ALGTPPY  ALVL+FLSN+MGGLTHYGIGSAP+FYGANYVPL+KWWGYGFL+S
Sbjct  492  SVSTALGTPPYFAALVLAFLSNLMGGLTHYGIGSAPIFYGANYVPLSKWWGYGFLIS  548



>gb|AAK43871.1|AF370494_1 2-oxoglutarate/malate translocator precursor-like protein [Arabidopsis 
thaliana]
Length=413

 Score =   275 bits (704),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            L +TVGLW+FG+ L +DAVTAAILGL++LLVTGVV+WKECL+E+VAWDTLTWFAALIAMA
Sbjct  216  LFLTVGLWIFGAKLGVDAVTAAILGLSVLLVTGVVTWKECLAESVAWDTLTWFAALIAMA  275

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLI WFS+TVVK VGGLGLSWQLSFGILVLLYFY+HYFFASGAAHIGAMFTAFL
Sbjct  276  GYLNKYGLIEWFSQTVVKFVGGLGLSWQLSFGILVLLYFYTHYFFASGAAHIGAMFTAFL  335

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            SV++ALGTPPY  ALV +FLSN+MGGLTHYGIGSAP+FYGANYVPLAKWWGYGFL+S
Sbjct  336  SVSTALGTPPYFAALVHAFLSNLMGGLTHYGIGSAPIFYGANYVPLAKWWGYGFLIS  392



>ref|XP_002965332.1| hypothetical protein SELMODRAFT_230600 [Selaginella moellendorffii]
 gb|EFJ34170.1| hypothetical protein SELMODRAFT_230600 [Selaginella moellendorffii]
Length=413

 Score =   275 bits (703),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            L++TVGLW+FGS + +DAVTAAILGL++LL TGVV+WKECL EAVAWDTLTWFAALIAMA
Sbjct  216  LIVTVGLWIFGSAIKVDAVTAAILGLSVLLTTGVVTWKECLGEAVAWDTLTWFAALIAMA  275

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLI+WFS+TVVKVVGGLGLSWQ SFGILV+LYFYSHYFFASGAAHIGAMFTAFL
Sbjct  276  GYLNKYGLIAWFSQTVVKVVGGLGLSWQASFGILVMLYFYSHYFFASGAAHIGAMFTAFL  335

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            SVA+ALGTPP  GALVL+FLSN+MGGLTHYGIGSAPVFYGA YVPL+ WWGYGFL+S
Sbjct  336  SVATALGTPPLFGALVLAFLSNLMGGLTHYGIGSAPVFYGAGYVPLSTWWGYGFLMS  392



>ref|XP_002977176.1| hypothetical protein SELMODRAFT_151685 [Selaginella moellendorffii]
 gb|EFJ21785.1| hypothetical protein SELMODRAFT_151685 [Selaginella moellendorffii]
Length=413

 Score =   274 bits (701),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            L++TVGLW+FGS + +DAVTAAILGL++LL TGVV+WKECL EAVAWDTLTWFAALIAMA
Sbjct  216  LIVTVGLWIFGSAIKVDAVTAAILGLSVLLTTGVVTWKECLGEAVAWDTLTWFAALIAMA  275

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLI+WFS+TVVKVVGGLGLSWQ SFGILV+LYFYSHYFFASGAAHIGAMFTAFL
Sbjct  276  GYLNKYGLIAWFSQTVVKVVGGLGLSWQASFGILVMLYFYSHYFFASGAAHIGAMFTAFL  335

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            SV++ALGTPP  GALVL+FLSN+MGGLTHYGIGSAPVFYGA YVPL+ WWGYGFL+S
Sbjct  336  SVSTALGTPPLFGALVLAFLSNLMGGLTHYGIGSAPVFYGAGYVPLSTWWGYGFLMS  392



>ref|XP_006399771.1| hypothetical protein EUTSA_v10013154mg [Eutrema salsugineum]
 dbj|BAJ33726.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ41224.1| hypothetical protein EUTSA_v10013154mg [Eutrema salsugineum]
Length=555

 Score =   278 bits (711),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            L +TVGLW+FG+ L +DAVTAAILGL++LLVTGVV+WKECL+E+VAWDTLTWFAALIAMA
Sbjct  358  LFLTVGLWIFGAKLGVDAVTAAILGLSVLLVTGVVTWKECLAESVAWDTLTWFAALIAMA  417

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLI WFS+TVVK VGGLGLSWQLSFGILVLLYFY+HYFFASGAAHIGAMFTAFL
Sbjct  418  GYLNKYGLIEWFSQTVVKFVGGLGLSWQLSFGILVLLYFYTHYFFASGAAHIGAMFTAFL  477

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            SV++ALGTPPY  ALVL+FLSN+MGGLTHYGIGSAP+FYGANYVPLAKWWGYGF +S
Sbjct  478  SVSTALGTPPYFAALVLAFLSNLMGGLTHYGIGSAPIFYGANYVPLAKWWGYGFAIS  534



>dbj|BAK00367.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=559

 Score =   278 bits (711),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 171/177 (97%), Gaps = 0/177 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            LL+TVGLW+FG +L++DAV+AAILGL++LL+TGVV+WKECL+E+VAWDTLTWFAALIAMA
Sbjct  362  LLLTVGLWIFGGMLSVDAVSAAILGLSVLLITGVVTWKECLAESVAWDTLTWFAALIAMA  421

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLISWFSETVVK VGGLGLSWQLSFG+LVL+YFYSHYFFASGAAHIGAMFTAFL
Sbjct  422  GYLNKYGLISWFSETVVKFVGGLGLSWQLSFGVLVLMYFYSHYFFASGAAHIGAMFTAFL  481

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            SVASALGTPP   A+V+SFLSN+MGGLTHYGIGSAPVFYGA YVPLA+WWGYGF++S
Sbjct  482  SVASALGTPPLFAAMVMSFLSNLMGGLTHYGIGSAPVFYGAGYVPLAEWWGYGFVIS  538



>ref|XP_006379073.1| hypothetical protein POPTR_0009s05840g [Populus trichocarpa]
 gb|ERP56870.1| hypothetical protein POPTR_0009s05840g [Populus trichocarpa]
Length=186

 Score =   265 bits (677),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 169/186 (91%), Positives = 181/186 (97%), Gaps = 0/186 (0%)
 Frame = -3

Query  719  VLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGYLNKYGLISWF  540
            +LN+DAVTAAILGL++LLVTGVV+WKECL+EAVAWDTLTWFAALIAMAGYLNKYGLISWF
Sbjct  1    MLNVDAVTAAILGLSVLLVTGVVTWKECLAEAVAWDTLTWFAALIAMAGYLNKYGLISWF  60

Query  539  SETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVASALGTPPYL  360
            S+TVVK VGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVASALGTPP  
Sbjct  61   SQTVVKFVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVASALGTPPLF  120

Query  359  GALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVSvvniiiwlgvggiwW  180
            GA+VL+F SN+MGGLTHYGIGSAPVFYGANYVPLAKWWGYGFL+SVVNIIIWLGVGG+WW
Sbjct  121  GAMVLAFFSNLMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLISVVNIIIWLGVGGVWW  180

Query  179  KAIGLW  162
            K IGLW
Sbjct  181  KFIGLW  186



>ref|XP_004291789.1| PREDICTED: dicarboxylate transporter 1, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=568

 Score =   276 bits (707),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            L +TVGLW+FG ++ +DAVTAAILGL++LLVTGVV+WKECL+E+VAWDTLTWFAALIAMA
Sbjct  371  LFLTVGLWIFGGMIGVDAVTAAILGLSVLLVTGVVTWKECLAESVAWDTLTWFAALIAMA  430

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLISWFSETVVK VGGLGL WQ +FGILVLLYFYSHYFFASGAAHIGAMFTAFL
Sbjct  431  GYLNKYGLISWFSETVVKFVGGLGLGWQPAFGILVLLYFYSHYFFASGAAHIGAMFTAFL  490

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            SVASALGTPPY  A+VLSFLSN+MGGLTHYGIGSAPVFYGA YVPLA+WWGYGFL+S
Sbjct  491  SVASALGTPPYFAAMVLSFLSNLMGGLTHYGIGSAPVFYGAGYVPLAQWWGYGFLMS  547



>ref|NP_001105570.1| LOC542560 [Zea mays]
 dbj|BAD06219.1| plastidic 2-oxoglutarate/malate transporter [Zea mays]
 gb|AFW56593.1| plastidic 2-oxoglutarate/malate transporter [Zea mays]
Length=578

 Score =   274 bits (701),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            LL+TVGLW+FG +LN+DAV+AAILGL +LL++GVV+WKECL+E+VAWDTLTWFAALIAMA
Sbjct  381  LLLTVGLWIFGGMLNVDAVSAAILGLAVLLISGVVTWKECLAESVAWDTLTWFAALIAMA  440

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNK+GLISWFSETVVK VGGLG+SWQLSFG+LVLLYFYSHYFFASGAAHIGAMFTAFL
Sbjct  441  GYLNKFGLISWFSETVVKFVGGLGMSWQLSFGVLVLLYFYSHYFFASGAAHIGAMFTAFL  500

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            SVASALGTP    A+VLSFLSN+MGG THYGIGSAPVFYGA YVPLA+WWGYGF++S
Sbjct  501  SVASALGTPSLFAAMVLSFLSNLMGGTTHYGIGSAPVFYGAGYVPLAQWWGYGFVIS  557



>ref|XP_004507091.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Cicer 
arietinum]
Length=557

 Score =   273 bits (699),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 169/198 (85%), Positives = 185/198 (93%), Gaps = 0/198 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            L +TVGLW+FG VLNIDAVT+AILGL +LL+TGVV+    L+E VAWDTLTWFAALIAMA
Sbjct  360  LFLTVGLWIFGGVLNIDAVTSAILGLAVLLITGVVTXXXXLAEGVAWDTLTWFAALIAMA  419

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLISWFS+TVVK VGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL
Sbjct  420  GYLNKYGLISWFSQTVVKFVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  479

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVSvvn  216
            SVA+ALGTPP  GA+VLSFLSN+MGGLTHYGIGSAPVF+GANYVPLAKWWGYGFL+S+VN
Sbjct  480  SVATALGTPPLFGAMVLSFLSNLMGGLTHYGIGSAPVFFGANYVPLAKWWGYGFLISIVN  539

Query  215  iiiwlgvggiwWKAIGLW  162
            I+IWLG+G  WWKAIGLW
Sbjct  540  ILIWLGLGSFWWKAIGLW  557



>ref|XP_001755334.1| predicted protein [Physcomitrella patens]
 gb|EDQ79814.1| predicted protein [Physcomitrella patens]
Length=413

 Score =   268 bits (686),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 148/177 (84%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            L+ TVGLW+FG VL +DAV+AAILGL++LL TGVV+WKECL E+VAWDTLTWFAALIAMA
Sbjct  216  LIATVGLWIFGGVLGVDAVSAAILGLSVLLTTGVVTWKECLGESVAWDTLTWFAALIAMA  275

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLI+WFS+ VV VVGGLGL+WQ SFGILVLLYFYSHYFFASGAAHIGAMFTAFL
Sbjct  276  GYLNKYGLIAWFSQNVVNVVGGLGLAWQASFGILVLLYFYSHYFFASGAAHIGAMFTAFL  335

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            SV +ALGTPP  GALVL+FLSN+MGGLTHYGIGSAPVFYGA YVPL++WWGYGFL S
Sbjct  336  SVGTALGTPPLFGALVLAFLSNLMGGLTHYGIGSAPVFYGAGYVPLSQWWGYGFLCS  392



>ref|XP_004964101.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Setaria 
italica]
Length=567

 Score =   268 bits (685),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            LL+TVGLW+FG ++++DAV+AAILGL +LL+TGVV+WKECL+E+VAWDTLTWFAALIAMA
Sbjct  370  LLLTVGLWIFGGMISVDAVSAAILGLGVLLITGVVTWKECLAESVAWDTLTWFAALIAMA  429

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLI+WFSETVVK VGGLGLSWQLSF +LVLLYFYSHYFFASGAAHIGAMF AFL
Sbjct  430  GYLNKYGLIAWFSETVVKFVGGLGLSWQLSFSVLVLLYFYSHYFFASGAAHIGAMFAAFL  489

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            SVA ALGTP    A+VLSFLSN+MGG+THYGIGSAPVFYGA YVPLA+WWGYGF++S
Sbjct  490  SVAKALGTPSLFAAMVLSFLSNLMGGITHYGIGSAPVFYGAGYVPLAQWWGYGFVIS  546



>ref|XP_002442229.1| hypothetical protein SORBIDRAFT_08g016630 [Sorghum bicolor]
 gb|EES16067.1| hypothetical protein SORBIDRAFT_08g016630 [Sorghum bicolor]
Length=584

 Score =   268 bits (686),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 148/177 (84%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            LL+TVGLW+FG +L++DAV+AAILGL +LL+TGVV+WKECL+E+VAWDTLTWFAALIAMA
Sbjct  387  LLLTVGLWIFGGMLSVDAVSAAILGLGVLLITGVVTWKECLAESVAWDTLTWFAALIAMA  446

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYG ISWFSETVVK VGGLGLSWQ SFG+LVLLYFYSHYFFASGAAHIGAMF AFL
Sbjct  447  GYLNKYGFISWFSETVVKFVGGLGLSWQASFGVLVLLYFYSHYFFASGAAHIGAMFAAFL  506

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            SVASALGTP    A+VLSFLSN+MGG THYGIGSAPVFYGA YVPLA+WWGYGF++S
Sbjct  507  SVASALGTPSLFAAMVLSFLSNLMGGTTHYGIGSAPVFYGAGYVPLAQWWGYGFVIS  563



>gb|EPS73843.1| hypothetical protein M569_00906, partial [Genlisea aurea]
Length=448

 Score =   261 bits (666),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 146/166 (88%), Positives = 160/166 (96%), Gaps = 0/166 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            LL+TVGLWVFGS +N+DAVTAAILGL++LL++GVV+WKECL+E+VAWDTLTWFAALIAMA
Sbjct  275  LLLTVGLWVFGSAINVDAVTAAILGLSVLLISGVVTWKECLAESVAWDTLTWFAALIAMA  334

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLISWFS+TVVK VGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL
Sbjct  335  GYLNKYGLISWFSQTVVKFVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  394

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPL  258
            SVASALGTPPYL A+VL+FLSNIMGG+THYGIGSAPVFY A YV L
Sbjct  395  SVASALGTPPYLAAIVLAFLSNIMGGITHYGIGSAPVFYSAGYVSL  440



>gb|EMT21699.1| 2-oxoglutarate/malate translocator, chloroplastic [Aegilops tauschii]
Length=462

 Score =   253 bits (647),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 124/142 (87%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = -3

Query  650  SWKECLSEAVAWDTLTWFAALIAMAGYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILV  471
            S +EC++E+VAWDTLTWFAALIAMAGYLNKYGLISWFSETVVK VGGLGLSWQLSFG+LV
Sbjct  263  SRRECVAESVAWDTLTWFAALIAMAGYLNKYGLISWFSETVVKFVGGLGLSWQLSFGVLV  322

Query  470  LLYFYSHYFFASGAAHIGAMFTAFLSVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSA  291
            L+YFYSHYFFASGAAHIGAMFTAFLSVASALGTPP   A+V+SFLSN+MGGLTHYGIGSA
Sbjct  323  LMYFYSHYFFASGAAHIGAMFTAFLSVASALGTPPLFAAMVMSFLSNLMGGLTHYGIGSA  382

Query  290  PVFYGANYVPLAKWWGYGFLVS  225
            PVFYGA YVPLA+WWGYGF++S
Sbjct  383  PVFYGAGYVPLAEWWGYGFVIS  404



>gb|KJB30127.1| hypothetical protein B456_005G130700 [Gossypium raimondii]
Length=146

 Score =   221 bits (563),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 111/121 (92%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = -3

Query  590  LIAMAGYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAM  411
            LIA+AGYLNKYGLISWFS+TVVKVVGGLGLSWQ+SFGILVLLYFYSHYFFA+GAAHIGAM
Sbjct  19   LIAIAGYLNKYGLISWFSQTVVKVVGGLGLSWQMSFGILVLLYFYSHYFFANGAAHIGAM  78

Query  410  FTAFLSVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFL  231
            FTAFLSVA+ALGTP YLGALVLSFLSN+MGG+THYGIGSAPVFYGA YVPLAKWWGYGFL
Sbjct  79   FTAFLSVATALGTPSYLGALVLSFLSNLMGGITHYGIGSAPVFYGAGYVPLAKWWGYGFL  138

Query  230  V  228
            +
Sbjct  139  I  139



>ref|XP_005843613.1| hypothetical protein CHLNCDRAFT_140201 [Chlorella variabilis]
 gb|EFN51511.1| hypothetical protein CHLNCDRAFT_140201 [Chlorella variabilis]
Length=536

 Score =   221 bits (562),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 145/175 (83%), Gaps = 0/175 (0%)
 Frame = -3

Query  749  ITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGY  570
            ITVGLW+FG  + ++AV AA+ GL ILLVTGVVSWK+CLS+  AWDTLTWFAALIAMA +
Sbjct  341  ITVGLWIFGGSVGVNAVAAALTGLGILLVTGVVSWKQCLSDNQAWDTLTWFAALIAMAAF  400

Query  569  LNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSV  390
            LNK+G ISWFS+ VV +VGGLGLSWQ +FGI++ LYFYSHYFFASGAAHIGAM+TAFLSV
Sbjct  401  LNKFGFISWFSDKVVGIVGGLGLSWQATFGIILTLYFYSHYFFASGAAHIGAMYTAFLSV  460

Query  389  ASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            A A GTP  + AL L  LSN+MG LT YGIGSAP FYG  YVP AKW+ +GFL S
Sbjct  461  AIACGTPGLMAALALGQLSNVMGCLTTYGIGSAPPFYGTGYVPQAKWYQWGFLFS  515



>ref|XP_003057697.1| divalent Anion:Na+ symporter family [Micromonas pusilla CCMP1545]
 gb|EEH57648.1| divalent Anion:Na+ symporter family [Micromonas pusilla CCMP1545]
Length=515

 Score =   218 bits (555),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 141/174 (81%), Gaps = 0/174 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            L++TVGLW+FG+ + + +V AA++GL+ LL+ GV++WKECL+E  AWDTLTWFAALIAMA
Sbjct  318  LVVTVGLWIFGASIGVGSVAAALVGLSTLLIAGVITWKECLAEGPAWDTLTWFAALIAMA  377

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
             YLNKYGLI WFS+TVVK V   GL+WQ +F ++VLLYFYSHY FASGAAHIGAM+TAFL
Sbjct  378  SYLNKYGLIPWFSQTVVKGVSAAGLAWQPAFLVVVLLYFYSHYAFASGAAHIGAMYTAFL  437

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGF  234
            SV  A G PP + ALVL   SNIMG  THYGIGSAP F+GA YVPLA WW  GF
Sbjct  438  SVLVACGAPPLVSALVLGIFSNIMGCTTHYGIGSAPPFFGAGYVPLATWWKIGF  491



>ref|XP_002507903.1| divalent Anion:Na+ symporter family [Micromonas sp. RCC299]
 gb|ACO69161.1| divalent Anion:Na+ symporter family [Micromonas sp. RCC299]
Length=563

 Score =   219 bits (557),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 123/174 (71%), Positives = 138/174 (79%), Gaps = 0/174 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            L +TV LW+FGS   I AV AA++GL+ LL+TGV++WKECL+E  AWDTLTWFAALIAMA
Sbjct  366  LSVTVALWIFGSKFGIGAVAAALVGLSTLLITGVITWKECLAEGPAWDTLTWFAALIAMA  425

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
             YLNKYGLI WFS TVVKVV   GL+WQ +F ++VLLYFYSHY FASGAAHIGAM+TAFL
Sbjct  426  AYLNKYGLIPWFSSTVVKVVSAAGLAWQPAFLVVVLLYFYSHYMFASGAAHIGAMYTAFL  485

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGF  234
            SV  A G PP   ALVL   SNIMG  THYGIGSAP F+GA YVPLA WW  GF
Sbjct  486  SVLVACGAPPLASALVLGIFSNIMGCTTHYGIGSAPPFFGAGYVPLATWWKIGF  539



>ref|XP_007512423.1| 2-oxoglutarate/malate translocator [Bathycoccus prasinos]
 emb|CCO17023.1| 2-oxoglutarate/malate translocator [Bathycoccus prasinos]
Length=594

 Score =   213 bits (542),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 118/172 (69%), Positives = 140/172 (81%), Gaps = 0/172 (0%)
 Frame = -3

Query  749  ITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGY  570
            +TV LWVFG+ + + +V AA+ GLTILLV+GV+SWKECL+E  AWDTLTWFAALIAMA Y
Sbjct  399  LTVLLWVFGASVGVGSVAAALNGLTILLVSGVISWKECLAEGPAWDTLTWFAALIAMASY  458

Query  569  LNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSV  390
            L KYGLI WF+++VVKVV G+GL+WQ +F ++VLLYFYSHY FASGAAHIGAM+TAFLSV
Sbjct  459  LQKYGLIPWFADSVVKVVSGMGLAWQPAFLVVVLLYFYSHYLFASGAAHIGAMYTAFLSV  518

Query  389  ASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGF  234
              A G PP + A++L   SNIMG  THYGIGSAP F+GA YVPL  WW  GF
Sbjct  519  LIACGAPPLVSAIILGIFSNIMGCTTHYGIGSAPPFFGAGYVPLGTWWKIGF  570



>ref|XP_011397588.1| Dicarboxylate transporter 1, chloroplastic [Auxenochlorella protothecoides]
 gb|KFM24700.1| Dicarboxylate transporter 1, chloroplastic [Auxenochlorella protothecoides]
Length=486

 Score =   209 bits (533),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 142/175 (81%), Gaps = 0/175 (0%)
 Frame = -3

Query  749  ITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGY  570
            +TV LW+ G  L I+AV AA+ GL+ILLVT VV+W++CLS+  AWDTLTWFAALIAMA Y
Sbjct  291  LTVCLWIGGQSLGINAVAAALAGLSILLVTNVVTWEQCLSDNQAWDTLTWFAALIAMAAY  350

Query  569  LNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSV  390
            LNKYG ISWFS+ VV +VGGLGLSWQ +FG++  LYFYSHYFFASGAAHIGAM+TAF+SV
Sbjct  351  LNKYGFISWFSDKVVGMVGGLGLSWQAAFGVVTALYFYSHYFFASGAAHIGAMYTAFVSV  410

Query  389  ASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            + A GTP  + AL L  LSN+MG LT YGIGSAP +YG  YVP AKW+ +GF+ S
Sbjct  411  SIACGTPGIVAALALGQLSNVMGCLTTYGIGSAPPYYGTGYVPQAKWYQFGFIFS  465



>ref|XP_003078785.1| 2-oxoglutarate/malate translocator (ISS) [Ostreococcus tauri]
 emb|CAL51665.1| Sodium/sulphate symporter [Ostreococcus tauri]
Length=565

 Score =   211 bits (536),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 122/177 (69%), Positives = 140/177 (79%), Gaps = 0/177 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            L +TVGLWVFGS   I +V AA+ GLTILLV+GV++WKECL+E  AWDTL WFAALIAMA
Sbjct  368  LTLTVGLWVFGSKFGIGSVAAALCGLTILLVSGVITWKECLAEGPAWDTLVWFAALIAMA  427

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLN +GLI  FS  VV VV GLGL+WQ +F I+ L+YFYSHY FASGAAHIGAM++AFL
Sbjct  428  GYLNTFGLIPAFSAGVVNVVSGLGLAWQPAFVIITLVYFYSHYMFASGAAHIGAMYSAFL  487

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            SV  A G PP + ALVL  LSN+MG  THYGIGSAP F+GA YVPLA WW  GF +S
Sbjct  488  SVLIACGAPPLVSALVLGILSNVMGCTTHYGIGSAPPFFGAGYVPLATWWKIGFGMS  544



>gb|EMS55971.1| 2-oxoglutarate/malate translocator, chloroplastic [Triticum urartu]
Length=436

 Score =   207 bits (527),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            LL+TVGLW+FG +L++DAV+AAILGL++LL+TGVV+WKECL+E+VAWDTLTWFAALIAMA
Sbjct  242  LLLTVGLWIFGGMLSVDAVSAAILGLSVLLITGVVTWKECLAESVAWDTLTWFAALIAMA  301

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLNKYGLISWFSETVVK VGGLGLSWQLSFG+LVL+YFYSHYFFASGAAHIGAMFTAFL
Sbjct  302  GYLNKYGLISWFSETVVKFVGGLGLSWQLSFGVLVLMYFYSHYFFASGAAHIGAMFTAFL  361

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYG  303
            SVASALGTPP   A+    L    G L   G
Sbjct  362  SVASALGTPPLFAAMKEKNLRRDNGALGALG  392



>ref|XP_005650106.1| oxoglutarate:malate antiporter, partial [Coccomyxa subellipsoidea 
C-169]
 gb|EIE25562.1| oxoglutarate:malate antiporter, partial [Coccomyxa subellipsoidea 
C-169]
Length=466

 Score =   207 bits (527),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 138/175 (79%), Gaps = 0/175 (0%)
 Frame = -3

Query  749  ITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGY  570
            +TV LW+FG  L ++AV AA+LGL ILL+T VV+WK+CL+   AWDTLTWFAALI MA Y
Sbjct  271  LTVALWIFGGQLGVNAVAAALLGLGILLITNVVTWKDCLANGAAWDTLTWFAALIGMASY  330

Query  569  LNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSV  390
            LNKYG I WFS  VV VV   GL+WQ SFGI+V+LYFYSHY FASGAAHIGAM+TAFLSV
Sbjct  331  LNKYGFIKWFSNQVVNVVSNFGLAWQQSFGIIVILYFYSHYLFASGAAHIGAMYTAFLSV  390

Query  389  ASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            A A GTP  L A+ L  LSNIMG LT YGIGSAP ++GA YVP AKW+  GF++S
Sbjct  391  AIACGTPGLLAAIALGQLSNIMGCLTTYGIGSAPPYFGAGYVPQAKWYQLGFIMS  445



>gb|KJB72206.1| hypothetical protein B456_011G165400 [Gossypium raimondii]
Length=238

 Score =   197 bits (500),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 125/145 (86%), Positives = 131/145 (90%), Gaps = 11/145 (8%)
 Frame = -3

Query  596  AALIAMAGYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIG  417
            + LIAMAGYLNKYGLIS FS+TVVKVVGGLGLSWQ+SFGILVLLYFYSHYFFASGAAHIG
Sbjct  105  SELIAMAGYLNKYGLISCFSQTVVKVVGGLGLSWQMSFGILVLLYFYSHYFFASGAAHIG  164

Query  416  AMFTAFLSVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYG  237
            AMFTAFLS           GALVLSFLSN+MGG+THYGIGSAPVFYGA YVPLAKWWGYG
Sbjct  165  AMFTAFLS-----------GALVLSFLSNLMGGITHYGIGSAPVFYGAGYVPLAKWWGYG  213

Query  236  FLVSvvniiiwlgvggiwWKAIGLW  162
            FL+SVVNIIIWLGVGGIWWKAIGLW
Sbjct  214  FLISVVNIIIWLGVGGIWWKAIGLW  238



>ref|XP_001700410.1| oxoglutarate:malate antiporter [Chlamydomonas reinhardtii]
 gb|EDO98099.1| oxoglutarate:malate antiporter [Chlamydomonas reinhardtii]
Length=553

 Score =   197 bits (502),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 140/175 (80%), Gaps = 0/175 (0%)
 Frame = -3

Query  749  ITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGY  570
            ITV LW+FG  + ++AV AAI+GL ILLVT V +WKECL+   AWDTLTWFAALIAMA  
Sbjct  358  ITVALWIFGGSIGVNAVAAAIVGLFILLVTNVTNWKECLNNNAAWDTLTWFAALIAMAAA  417

Query  569  LNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSV  390
            LNKYG I W S +VV +VGGLGL WQ +FGI+VLLYFYSHYFFASGAAHIGAM+TAFL+V
Sbjct  418  LNKYGFIPWLSTSVVNIVGGLGLGWQGAFGIVVLLYFYSHYFFASGAAHIGAMYTAFLAV  477

Query  389  ASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            A+A GTPP L A+ L  LSN+MG LT YGIGSAP ++GA YVP   W  +GF++S
Sbjct  478  ATACGTPPMLAAIALGQLSNLMGCLTTYGIGSAPPYFGAGYVPQGDWLKFGFILS  532



>ref|XP_001700411.1| chloroplast oxoglutarate-malate translocator [Chlamydomonas reinhardtii]
 gb|EDO98100.1| chloroplast oxoglutarate-malate translocator [Chlamydomonas reinhardtii]
Length=587

 Score =   197 bits (500),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 140/175 (80%), Gaps = 0/175 (0%)
 Frame = -3

Query  749  ITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGY  570
            ITV LW+FG  + ++AV AAI+GL ILLVT V +WKECL+   AWDTLTWFAALIAMA  
Sbjct  392  ITVALWIFGGSIGVNAVAAAIVGLFILLVTNVTNWKECLNNNAAWDTLTWFAALIAMAAA  451

Query  569  LNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSV  390
            LNKYG I W S +VV +VGGLGL WQ +FGI+VLLYFYSHYFFASGAAHIGAM+TAFL+V
Sbjct  452  LNKYGFIPWLSTSVVNIVGGLGLGWQGAFGIVVLLYFYSHYFFASGAAHIGAMYTAFLAV  511

Query  389  ASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            A+A GTPP L A+ L  LSN+MG LT YGIGSAP ++GA YVP   W  +GF++S
Sbjct  512  ATACGTPPMLAAIALGQLSNLMGCLTTYGIGSAPPYFGAGYVPQGDWLKFGFILS  566



>ref|XP_002955862.1| hypothetical protein VOLCADRAFT_106989 [Volvox carteri f. nagariensis]
 gb|EFJ43063.1| hypothetical protein VOLCADRAFT_106989 [Volvox carteri f. nagariensis]
Length=551

 Score =   195 bits (495),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 120/175 (69%), Positives = 139/175 (79%), Gaps = 0/175 (0%)
 Frame = -3

Query  749  ITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGY  570
            ITV LW+FG  L I+AV AAI+GL ILLVT V +WKECL+   AWDTLTWFAALIAMA  
Sbjct  356  ITVALWIFGGSLGINAVAAAIVGLFILLVTNVTNWKECLNNNAAWDTLTWFAALIAMAAA  415

Query  569  LNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSV  390
            LNKYG I W S +VV+VVGGLGL WQ +FGI+V LYFYSHYFFASGAAHIGAM+TAFL+V
Sbjct  416  LNKYGFIPWLSNSVVQVVGGLGLGWQGAFGIVVALYFYSHYFFASGAAHIGAMYTAFLAV  475

Query  389  ASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            A+A GTPP L A+ L  LSN+MG LT YGIGSAP ++GA YVP + W   G ++S
Sbjct  476  ATACGTPPMLAAIALGQLSNLMGCLTTYGIGSAPPYFGAGYVPQSDWLRLGAILS  530



>ref|XP_001417246.1| DASS family transporter: 2-oxoglutarate/malate [Ostreococcus 
lucimarinus CCE9901]
 gb|ABO95539.1| DASS family transporter: 2-oxoglutarate/malate [Ostreococcus 
lucimarinus CCE9901]
Length=414

 Score =   191 bits (485),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 137/174 (79%), Gaps = 0/174 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            L +TVGLW+FGS   + +V AA+ GL ILLV+GV++WKECL+E  AWDTL WFAALIAMA
Sbjct  217  LSLTVGLWIFGSKFGVGSVAAALNGLAILLVSGVITWKECLAEGPAWDTLVWFAALIAMA  276

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            GYLN YGLI  FS+ VV VV GLGL+WQ +F I+ L+YFYSHY FASGAAHIGAM++AFL
Sbjct  277  GYLNTYGLIPAFSKGVVGVVSGLGLAWQPAFVIVTLVYFYSHYLFASGAAHIGAMYSAFL  336

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGF  234
            SV  A G PP + AL L  LSN+MG  THYGIGSAP F+GA YVPLA WW  GF
Sbjct  337  SVLIACGAPPLVSALTLGILSNVMGCTTHYGIGSAPPFFGAGYVPLATWWKIGF  390



>emb|CAN74405.1| hypothetical protein VITISV_043635 [Vitis vinifera]
Length=193

 Score =   175 bits (444),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 130/194 (67%), Positives = 145/194 (75%), Gaps = 46/194 (24%)
 Frame = -3

Query  743  VGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGYLN  564
            VGLW+FG VLN+DAVTAAILGL++LLVTGVV+WKECL+E+VAWDTLTWFAALIAMAG   
Sbjct  46   VGLWIFGGVLNVDAVTAAILGLSVLLVTGVVTWKECLAESVAWDTLTWFAALIAMAG---  102

Query  563  KYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVAS  384
                                                       GAAHIGAMFTAFLSVAS
Sbjct  103  -------------------------------------------GAAHIGAMFTAFLSVAS  119

Query  383  ALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVSvvniiiw  204
            ALGTPPY GA+VL+FLSN+MGGLTHYGIGSAP+FYGANYV LAKWWGYGFL+S+VNI+IW
Sbjct  120  ALGTPPYFGAMVLAFLSNLMGGLTHYGIGSAPIFYGANYVSLAKWWGYGFLISIVNIVIW  179

Query  203  lgvggiwWKAIGLW  162
            LGVGG+WWKAIGLW
Sbjct  180  LGVGGVWWKAIGLW  193



>ref|WP_036200998.1| 2-oxoglutarate translocator [Lysinibacillus sinduriensis]
 gb|KGR75386.1| 2-oxoglutarate translocator [Lysinibacillus sinduriensis BLB-1 
= JCM 15800]
Length=478

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 142/197 (72%), Gaps = 2/197 (1%)
 Frame = -3

Query  752  LITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAG  573
            L+ VGLW+FGS LN+D    A +GL +LL+T V++W +   E  AWDTL WF+ L+ MA 
Sbjct  284  LLLVGLWIFGSKLNLDTTVTAFIGLVLLLLTQVLTWSDIKQEQGAWDTLIWFSVLVMMAM  343

Query  572  YLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLS  393
            YLN  G+I WFSE V  ++G    SW L+  +L ++YFYSHYFFAS  AH+ AM+ AFLS
Sbjct  344  YLNSTGMIPWFSEMVQGMIGET--SWMLALIVLAIVYFYSHYFFASNTAHVSAMYAAFLS  401

Query  392  VASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVSvvni  213
            V  A G PP + AL+L+F SN+ G LT+YG G APVF+G  YV   KWWG GF++S+++I
Sbjct  402  VIVAAGAPPLVSALLLAFFSNLFGCLTNYGSGPAPVFFGTGYVTQEKWWGLGFVISIIHI  461

Query  212  iiwlgvggiwWKAIGLW  162
            +IWL +GG+WWKA+GLW
Sbjct  462  VIWLFIGGLWWKALGLW  478



>gb|KJB56606.1| hypothetical protein B456_009G127300 [Gossypium raimondii]
Length=118

 Score =   158 bits (400),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 104/124 (84%), Positives = 111/124 (90%), Gaps = 11/124 (9%)
 Frame = -3

Query  533  TVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVASALGTPPYLGA  354
            + ++VVGGLGLSWQ+SFGILVLLYFYSHYFFASGAAHIGAMFTAFLS           GA
Sbjct  6    SFLQVVGGLGLSWQMSFGILVLLYFYSHYFFASGAAHIGAMFTAFLS-----------GA  54

Query  353  LVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVSvvniiiwlgvggiwWKA  174
            LVLSFLSN+MGG+THYGIGSAPVFYGA YVPLAKWWGYGFL+SVVNIIIWLGVGGIWWKA
Sbjct  55   LVLSFLSNLMGGITHYGIGSAPVFYGAGYVPLAKWWGYGFLISVVNIIIWLGVGGIWWKA  114

Query  173  IGLW  162
            IGLW
Sbjct  115  IGLW  118



>ref|WP_003328331.1| 2-oxoglutarate translocator [Bacillus atrophaeus]
 gb|EIM09398.1| 2-oxoglutarate/malate transporter [Bacillus atrophaeus C89]
Length=478

 Score =   167 bits (422),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 91/170 (54%), Positives = 123/170 (72%), Gaps = 2/170 (1%)
 Frame = -3

Query  734  WVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGYLNKYG  555
            W+FG   NIDA T A++GL++LL++ V++W +   E  AWDTLTWFAAL+ +A +LN+ G
Sbjct  290  WIFGGSFNIDATTTALIGLSVLLLSQVLTWDDIKKEQGAWDTLTWFAALVMLANFLNELG  349

Query  554  LISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVASALG  375
            ++SWFS  +   V G   SW ++F IL+++YFYSHYFFAS  AHI AM++AFL+V    G
Sbjct  350  MVSWFSNAMKSSVSGF--SWIVAFLILIVVYFYSHYFFASATAHISAMYSAFLAVVGGGG  407

Query  374  TPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
             PP L AL L+F SN+ G  THYG G+APVF+GA Y+P  KWW  GF++S
Sbjct  408  PPPLLAALSLAFFSNLFGSTTHYGSGAAPVFFGAGYIPQGKWWSIGFILS  457



>ref|WP_036154823.1| 2-oxoglutarate translocator [Lysinibacillus odysseyi]
 gb|KGR84276.1| 2-oxoglutarate translocator [Lysinibacillus odysseyi 34hs-1 = 
NBRC 100172]
Length=472

 Score =   165 bits (418),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 93/171 (54%), Positives = 121/171 (71%), Gaps = 2/171 (1%)
 Frame = -3

Query  737  LWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGYLNKY  558
            LW+FGS  ++DA   A +GL++LL+T V++W +   E  AWDTL WF+ L+ MA +LN  
Sbjct  283  LWIFGSNFHLDATVTAFIGLSLLLLTQVLTWNDIKQEQGAWDTLIWFSVLVMMAMFLNST  342

Query  557  GLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVASAL  378
            GLI WFS+ V   +GG   SW L+  ILV++YFYSHYFFAS  AH+ AM+ AFLSV  A 
Sbjct  343  GLIPWFSDKVQGFIGGT--SWMLALVILVIVYFYSHYFFASNTAHVSAMYGAFLSVLVAA  400

Query  377  GTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            G PP + AL+L+F SN+ G LT+YG G APVF+GA YV   KWWG GF++S
Sbjct  401  GAPPMVSALILAFFSNLFGCLTNYGSGPAPVFFGAGYVTQEKWWGIGFVIS  451



>gb|ABO87606.1| chloroplast 2-oxoglutarate/malate translocator [Pisum sativum]
Length=104

 Score =   155 bits (392),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 93/104 (89%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = -3

Query  473  VLLYFYSHYFFASGAAHIGAMFTAFLSVASALGTPPYLGALVLSFLSNIMGGLTHYGIGS  294
            VLLYFYSHYFFASGAAHIGAMFTAFLSVA+ALGTPP+ GA+VLSFLSN+MGGLTHYGIGS
Sbjct  1    VLLYFYSHYFFASGAAHIGAMFTAFLSVATALGTPPFFGAMVLSFLSNLMGGLTHYGIGS  60

Query  293  APVFYGANYVPLAKWWGYGFLVSvvniiiwlgvggiwWKAIGLW  162
            APVF+GANYVPLAKWWGYGF++S+VNIIIWLG+G IWWKAIGLW
Sbjct  61   APVFFGANYVPLAKWWGYGFVISIVNIIIWLGLGSIWWKAIGLW  104



>gb|AGK55800.1| divalent anion:Na+ symporter (DASS) family transporter [Bacillus 
sp. 1NLA3E]
Length=491

 Score =   165 bits (418),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 122/174 (70%), Gaps = 2/174 (1%)
 Frame = -3

Query  752  LITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAG  573
            L+ + LW+FG+ LNI+A T A +GL +LL+T V+SW +   E  AWDTL WFA L+ MA 
Sbjct  297  LLILALWIFGTSLNINATTTAFIGLGVLLLTQVLSWNDIKKEEGAWDTLVWFAVLVMMAT  356

Query  572  YLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLS  393
            +LN+ G+I WFSET+   V G+  SW  +  IL ++YFYSHYFFAS  AH+ AM+ AFL+
Sbjct  357  FLNELGMIPWFSETMKGAVSGM--SWIWALVILSVVYFYSHYFFASSTAHVSAMYAAFLT  414

Query  392  VASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFL  231
            V  A G PP + AL+L+F SN+ G +THYG G APVF+G+ YV   KWW  GFL
Sbjct  415  VVIAAGAPPLVSALILAFFSNLFGCMTHYGCGPAPVFFGSGYVTQNKWWSLGFL  468



>ref|WP_041581256.1| 2-oxoglutarate translocator [Bacillus sp. 1NLA3E]
Length=481

 Score =   165 bits (417),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 122/174 (70%), Gaps = 2/174 (1%)
 Frame = -3

Query  752  LITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAG  573
            L+ + LW+FG+ LNI+A T A +GL +LL+T V+SW +   E  AWDTL WFA L+ MA 
Sbjct  287  LLILALWIFGTSLNINATTTAFIGLGVLLLTQVLSWNDIKKEEGAWDTLVWFAVLVMMAT  346

Query  572  YLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLS  393
            +LN+ G+I WFSET+   V G+  SW  +  IL ++YFYSHYFFAS  AH+ AM+ AFL+
Sbjct  347  FLNELGMIPWFSETMKGAVSGM--SWIWALVILSVVYFYSHYFFASSTAHVSAMYAAFLT  404

Query  392  VASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFL  231
            V  A G PP + AL+L+F SN+ G +THYG G APVF+G+ YV   KWW  GFL
Sbjct  405  VVIAAGAPPLVSALILAFFSNLFGCMTHYGCGPAPVFFGSGYVTQNKWWSLGFL  458



>ref|WP_025752426.1| 2-oxoglutarate translocator [Bacillus flexus]
Length=477

 Score =   162 bits (410),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 105/192 (55%), Positives = 136/192 (71%), Gaps = 2/192 (1%)
 Frame = -3

Query  737  LWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGYLNKY  558
            LW+FG+ LNI+A T A +GL  LL+T V+SW +   E  AWDTL WFA L+ MA +LN  
Sbjct  288  LWIFGANLNINATTTAFIGLCTLLLTQVLSWSDIKKEQGAWDTLVWFAVLVMMATFLNDL  347

Query  557  GLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVASAL  378
            G+I WFS+ +   V  +  SW  +  +L + YFYSHYFFAS  AH+ AM+ AFLSV  A 
Sbjct  348  GMIPWFSDLMKGTVSHM--SWMTALIVLAIAYFYSHYFFASNTAHVSAMYAAFLSVIVAA  405

Query  377  GTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVSvvniiiwlg  198
            G PP L AL+L+F SN+ G LTHYG G APVF+G+ YV   KWW  GFL+S+++IIIW+G
Sbjct  406  GAPPLLSALILAFFSNLFGCLTHYGSGPAPVFFGSGYVTQQKWWSLGFLISIIHIIIWIG  465

Query  197  vggiwWKAIGLW  162
            +GG+WWK +GLW
Sbjct  466  IGGLWWKLLGLW  477



>ref|WP_014457694.1| 2-oxoglutarate translocator [Bacillus megaterium]
 gb|AEN86919.1| Dicarboxylase translocator [Bacillus megaterium WSH-002]
Length=477

 Score =   162 bits (409),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 105/192 (55%), Positives = 136/192 (71%), Gaps = 2/192 (1%)
 Frame = -3

Query  737  LWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGYLNKY  558
            LW+FG+ LNI+A T A +GL  LL+T V+SW +   E  AWDTL WFA L+ MA +LN  
Sbjct  288  LWIFGANLNINATTTAFIGLCTLLLTQVLSWSDIKKEQGAWDTLVWFAVLVMMATFLNDL  347

Query  557  GLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVASAL  378
            G+I WFS+ +   V  +  SW  +  +L + YFYSHYFFAS  AH+ AM+ AFLSV  A 
Sbjct  348  GMIPWFSDLMKGTVSHM--SWMTALIVLAIAYFYSHYFFASNTAHVSAMYAAFLSVIVAA  405

Query  377  GTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVSvvniiiwlg  198
            G PP L AL+L+F SN+ G LTHYG G APVF+G+ YV   KWW  GFL+S+++IIIW+G
Sbjct  406  GAPPLLSALILAFFSNLFGCLTHYGSGPAPVFFGSGYVTQQKWWSLGFLISIIHIIIWIG  465

Query  197  vggiwWKAIGLW  162
            +GG+WWK +GLW
Sbjct  466  IGGLWWKLLGLW  477



>ref|WP_028411930.1| MULTISPECIES: 2-oxoglutarate translocator [Bacillus]
Length=477

 Score =   162 bits (409),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 105/192 (55%), Positives = 136/192 (71%), Gaps = 2/192 (1%)
 Frame = -3

Query  737  LWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGYLNKY  558
            LW+FG+ LNI+A T A +GL  LL+T V+SW +   E  AWDTL WFA L+ MA +LN  
Sbjct  288  LWIFGANLNINATTTAFIGLCALLLTQVLSWSDIKKEQGAWDTLVWFAVLVMMATFLNDL  347

Query  557  GLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVASAL  378
            G+I WFS+ +   V  +  SW  +  +L + YFYSHYFFAS  AH+ AM+ AFLSV  A 
Sbjct  348  GMIPWFSDLMKGTVSHM--SWMTALIVLAIAYFYSHYFFASNTAHVSAMYAAFLSVIVAA  405

Query  377  GTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVSvvniiiwlg  198
            G PP L AL+L+F SN+ G LTHYG G APVF+G+ YV   KWW  GFL+S+++IIIW+G
Sbjct  406  GAPPLLSALILAFFSNLFGCLTHYGSGPAPVFFGSGYVTQQKWWSLGFLISIIHIIIWIG  465

Query  197  vggiwWKAIGLW  162
            +GG+WWK +GLW
Sbjct  466  IGGLWWKLLGLW  477



>ref|WP_043977584.1| 2-oxoglutarate translocator [Bacillus aryabhattai]
Length=477

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 105/192 (55%), Positives = 136/192 (71%), Gaps = 2/192 (1%)
 Frame = -3

Query  737  LWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGYLNKY  558
            LW+FG+ LNI+A T A +GL  LL+T V+SW +   E  AWDTL WFA L+ MA +LN  
Sbjct  288  LWIFGANLNINATTTAFIGLCALLLTQVLSWSDIKKEQGAWDTLVWFAVLVMMATFLNDL  347

Query  557  GLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVASAL  378
            G+I WFS+ +   V  +  SW  +  +L + YFYSHYFFAS  AH+ AM+ AFLSV  A 
Sbjct  348  GMIPWFSDLMKGTVSHM--SWMTALIVLAIAYFYSHYFFASNTAHVSAMYAAFLSVIVAA  405

Query  377  GTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVSvvniiiwlg  198
            G PP L AL+L+F SN+ G LTHYG G APVF+G+ YV   KWW  GFL+S+++IIIW+G
Sbjct  406  GAPPLLSALILAFFSNLFGCLTHYGSGPAPVFFGSGYVTQQKWWSLGFLISIIHIIIWIG  465

Query  197  vggiwWKAIGLW  162
            +GG+WWK +GLW
Sbjct  466  IGGLWWKLLGLW  477



>ref|WP_028409745.1| 2-oxoglutarate translocator [Bacillus sp. 171095_106]
Length=477

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 105/192 (55%), Positives = 136/192 (71%), Gaps = 2/192 (1%)
 Frame = -3

Query  737  LWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGYLNKY  558
            LW+FG+ LNI+A T A +GL  LL+T V+SW +   E  AWDTL WFA L+ MA +LN  
Sbjct  288  LWIFGANLNINATTTAFIGLCALLLTQVLSWSDIKKEQGAWDTLVWFAVLVMMATFLNDL  347

Query  557  GLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVASAL  378
            G+I WFS+ +   V  +  SW  +  +L + YFYSHYFFAS  AH+ AM+ AFLSV  A 
Sbjct  348  GMIPWFSDLMKGTVSHM--SWMTALIVLAIAYFYSHYFFASNTAHVSAMYAAFLSVIVAA  405

Query  377  GTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVSvvniiiwlg  198
            G PP L AL+L+F SN+ G LTHYG G APVF+G+ YV   KWW  GFL+S+++IIIW+G
Sbjct  406  GAPPLLSALILAFFSNLFGCLTHYGSGPAPVFFGSGYVTQQKWWSLGFLISIIHIIIWIG  465

Query  197  vggiwWKAIGLW  162
            +GG+WWK +GLW
Sbjct  466  IGGLWWKLLGLW  477



>ref|WP_029319476.1| 2-oxoglutarate translocator [Bacillus sp. RP1137]
Length=477

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 105/192 (55%), Positives = 136/192 (71%), Gaps = 2/192 (1%)
 Frame = -3

Query  737  LWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGYLNKY  558
            LW+FG+ LNI+A T A +GL  LL+T V+SW +   E  AWDTL WFA L+ MA +LN  
Sbjct  288  LWIFGANLNINATTTAFIGLCTLLLTQVLSWSDIKKEQGAWDTLVWFAVLVMMATFLNDL  347

Query  557  GLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVASAL  378
            G+I WFS+ +   V  +  SW  +  +L + YFYSHYFFAS  AH+ AM+ AFLSV  A 
Sbjct  348  GMIPWFSDLMKGTVSHM--SWMTALIVLAVAYFYSHYFFASNTAHVSAMYAAFLSVIVAA  405

Query  377  GTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVSvvniiiwlg  198
            G PP L AL+L+F SN+ G LTHYG G APVF+G+ YV   KWW  GFL+S+++IIIW+G
Sbjct  406  GAPPLLSALILAFFSNLFGCLTHYGSGPAPVFFGSGYVTQQKWWSLGFLISIIHIIIWIG  465

Query  197  vggiwWKAIGLW  162
            +GG+WWK +GLW
Sbjct  466  IGGLWWKLLGLW  477



>ref|WP_013059892.1| 2-oxoglutarate translocator [Bacillus megaterium]
 gb|ADE72219.1| transporter, divalent anion:Na+ symporter (DASS) family protein 
[Bacillus megaterium QM B1551]
Length=477

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 105/192 (55%), Positives = 136/192 (71%), Gaps = 2/192 (1%)
 Frame = -3

Query  737  LWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGYLNKY  558
            LW+FG+ LNI+A T A +GL  LL+T V+SW +   E  AWDTL WFA L+ MA +LN  
Sbjct  288  LWIFGANLNINATTTAFIGLCTLLLTQVLSWSDIKKEQGAWDTLVWFAVLVMMATFLNDL  347

Query  557  GLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVASAL  378
            G+I WFS+ +   V  +  SW  +  +L + YFYSHYFFAS  AH+ AM+ AFLSV  A 
Sbjct  348  GMIPWFSDLMKGTVSHM--SWMTALIVLAVAYFYSHYFFASNTAHVSAMYAAFLSVIVAA  405

Query  377  GTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVSvvniiiwlg  198
            G PP L AL+L+F SN+ G LTHYG G APVF+G+ YV   KWW  GFL+S+++IIIW+G
Sbjct  406  GAPPLLSALILAFFSNLFGCLTHYGSGPAPVFFGSGYVTQQKWWSLGFLISIIHIIIWIG  465

Query  197  vggiwWKAIGLW  162
            +GG+WWK +GLW
Sbjct  466  IGGLWWKLLGLW  477



>ref|WP_013085539.1| 2-oxoglutarate translocator [Bacillus megaterium]
 gb|ADF42029.1| transporter, divalent anion:Na+ symporter (DASS) family protein 
[Bacillus megaterium DSM 319]
Length=477

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 105/192 (55%), Positives = 136/192 (71%), Gaps = 2/192 (1%)
 Frame = -3

Query  737  LWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGYLNKY  558
            LW+FG+ LNI+A T A +GL  LL+T V+SW +   E  AWDTL WFA L+ MA +LN  
Sbjct  288  LWIFGANLNINATTTAFIGLCALLLTQVLSWSDIKKEQGAWDTLVWFAVLVMMATFLNDL  347

Query  557  GLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVASAL  378
            G+I WFS+ +   V  +  SW  +  +L + YFYSHYFFAS  AH+ AM+ AFLSV  A 
Sbjct  348  GMIPWFSDLMKGTVSHM--SWMTALIVLAVAYFYSHYFFASNTAHVSAMYAAFLSVIVAA  405

Query  377  GTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVSvvniiiwlg  198
            G PP L AL+L+F SN+ G LTHYG G APVF+G+ YV   KWW  GFL+S+++IIIW+G
Sbjct  406  GAPPLLSALILAFFSNLFGCLTHYGSGPAPVFFGSGYVTQQKWWSLGFLISIIHIIIWIG  465

Query  197  vggiwWKAIGLW  162
            +GG+WWK +GLW
Sbjct  466  IGGLWWKLLGLW  477



>ref|WP_016765975.1| 2-oxoglutarate translocator [Bacillus megaterium]
Length=477

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 105/192 (55%), Positives = 135/192 (70%), Gaps = 2/192 (1%)
 Frame = -3

Query  737  LWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGYLNKY  558
            LW+FG+ LNI+A T A +GL  LL+T V+SW +   E  AWDTL WFA L+ MA +LN  
Sbjct  288  LWIFGANLNINATTTAFIGLCALLLTQVLSWSDIKKEQGAWDTLVWFAVLVMMATFLNDL  347

Query  557  GLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVASAL  378
            G+I WFS+ +   V  +  SW  +  +L + YFYSHYFFAS  AH+ AM+ AFLSV  A 
Sbjct  348  GMIPWFSDLMKGTVSHM--SWMTALIVLAVAYFYSHYFFASNTAHVSAMYAAFLSVIVAA  405

Query  377  GTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVSvvniiiwlg  198
            G PP L AL+L+F SN+ G LTHYG G APVF+G+ YV   KWW  GFL+S+++IIIW+G
Sbjct  406  GAPPLLSALILAFFSNLFGCLTHYGSGPAPVFFGSGYVTQQKWWSLGFLISIIHIIIWIG  465

Query  197  vggiwWKAIGLW  162
            +GG WWK +GLW
Sbjct  466  IGGFWWKLLGLW  477



>ref|WP_034648188.1| 2-oxoglutarate translocator [Bacillus megaterium]
 gb|KFN06787.1| 2-oxoglutarate/malate translocator, chloroplastic [Bacillus megaterium]
 gb|KGJ85087.1| 2-oxoglutarate translocator [Bacillus megaterium NBRC 15308 = 
ATCC 14581]
 gb|AJI23694.1| transporter, divalent anion:Na+ symporter family protein [Bacillus 
megaterium NBRC 15308 = ATCC 14581]
Length=477

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 105/192 (55%), Positives = 136/192 (71%), Gaps = 2/192 (1%)
 Frame = -3

Query  737  LWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGYLNKY  558
            LW+FG+ LNI+A T A +GL  LL+T V+SW +   E  AWDTL WFA L+ MA +LN  
Sbjct  288  LWIFGANLNINATTTAFIGLCALLLTQVLSWSDIKKEQGAWDTLVWFAVLVMMATFLNDL  347

Query  557  GLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVASAL  378
            G+I WFS+ +   V  +  SW  +  +L + YFYSHYFFAS  AH+ AM+ AFLSV  A 
Sbjct  348  GMIPWFSDLMKGTVSHM--SWMTALIVLAVAYFYSHYFFASNTAHVSAMYAAFLSVIVAA  405

Query  377  GTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVSvvniiiwlg  198
            G PP L AL+L+F SN+ G LTHYG G APVF+G+ YV   KWW  GFL+S+++IIIW+G
Sbjct  406  GAPPLLSALILAFFSNLFGCLTHYGSGPAPVFFGSGYVTQQKWWSLGFLISIIHIIIWIG  465

Query  197  vggiwWKAIGLW  162
            +GG+WWK +GLW
Sbjct  466  IGGLWWKLLGLW  477



>ref|WP_021268254.1| transporter, DASS family [Bacteriovorax sp. BAL6_X]
 gb|EPZ49707.1| transporter, DASS family [Bacteriovorax sp. BAL6_X]
Length=470

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 91/173 (53%), Positives = 118/173 (68%), Gaps = 2/173 (1%)
 Frame = -3

Query  743  VGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGYLN  564
            + LW+ GS L ++A T A  GL+ILL++GV++W +  SE  AWDTL WF  L+ MA YLN
Sbjct  279  ITLWILGSTLKVNATTTAFCGLSILLISGVLNWDDIKSEKGAWDTLIWFGVLVMMADYLN  338

Query  563  KYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVAS  384
            K+G + WFS+ V   V  L  +W L+F IL  +YFYSHYFFAS  AH+ AM   F+ V  
Sbjct  339  KFGFVPWFSKYVAMEVSAL--TWTLAFPILAGIYFYSHYFFASATAHVTAMAAVFIGVGI  396

Query  383  ALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
             +G PPYL A+ L F SN+ G LTHYG G APVF+G+ YV L++WW  GFL+S
Sbjct  397  QVGVPPYLMAITLGFFSNLFGSLTHYGSGPAPVFFGSGYVELSEWWKMGFLIS  449



>ref|WP_028402895.1| 2-oxoglutarate translocator [Bacillus panaciterrae]
Length=483

 Score =   160 bits (406),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 92/169 (54%), Positives = 113/169 (67%), Gaps = 2/169 (1%)
 Frame = -3

Query  737  LWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGYLNKY  558
            LW+FG  LNI+A T A +GL  LL+T V+SW +   E  AWDTL WFA L+ MA YLN  
Sbjct  294  LWIFGGNLNINATTTAFIGLCTLLLTQVLSWSDIKKEQGAWDTLVWFAVLVMMATYLNDL  353

Query  557  GLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVASAL  378
            G+I WFS  +   V  +   W  +  IL ++YFYSHYFFAS  AH+ AM+ AFLSV  A 
Sbjct  354  GMIPWFSHLMQGTVSHM--PWMATLIILAIVYFYSHYFFASNTAHVSAMYAAFLSVIVAA  411

Query  377  GTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFL  231
            G PP L AL+L+F SN+ G LTHYG G+APVF+G+ YV   KWW  GFL
Sbjct  412  GAPPLLSALILAFFSNLFGCLTHYGSGAAPVFFGSGYVTQQKWWSLGFL  460



>ref|WP_006637412.1| sodium/sulfate symporter YflS [Bacillus sonorensis]
 gb|EME75561.1| sodium/sulfate symporter YflS [Bacillus sonorensis L12]
Length=478

 Score =   160 bits (404),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 119/171 (70%), Gaps = 2/171 (1%)
 Frame = -3

Query  737  LWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGYLNKY  558
            LW+FGS  NIDA T A++GL++L +T V+ W +   E  AWDTL WF+ L+ +A +LNK 
Sbjct  289  LWIFGSNANIDATTTALIGLSVLFLTQVLDWGDIKKEQGAWDTLIWFSTLLMLATFLNKL  348

Query  557  GLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVASAL  378
            G++ WFS  +   V G   SW  +F +L+L+YFYSHYFFAS  AHI AM++AF +V  A 
Sbjct  349  GMVGWFSVMMESFVSGF--SWISAFLVLILVYFYSHYFFASATAHISAMYSAFFAVMVAA  406

Query  377  GTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            G PP L AL L+F SN+ G  THYG G+APVF+GA Y+P  KWW  GF++S
Sbjct  407  GAPPLLSALTLAFFSNLFGCTTHYGAGAAPVFFGAGYIPEGKWWFIGFILS  457



>gb|KDD74484.1| sodium:sulfate symporter [Helicosporidium sp. ATCC 50920]
Length=140

 Score =   151 bits (382),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 91/119 (76%), Gaps = 0/119 (0%)
 Frame = -3

Query  581  MAGYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTA  402
            MAG LN+ G I+WFS+ VV +V GLGL W+ +F ++  LYFYSHYFFASGAAHIGAM+TA
Sbjct  1    MAGQLNRAGFIAWFSQRVVGLVQGLGLRWEAAFALVAALYFYSHYFFASGAAHIGAMYTA  60

Query  401  FLSVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            FLSVA A G PP   AL L+ LSN+MG LT YGIGSAP +YGA YVP  +W+  GF+ S
Sbjct  61   FLSVAVACGAPPVFAALCLAQLSNLMGCLTTYGIGSAPPYYGAGYVPQGRWYALGFVFS  119



>ref|WP_026589611.1| 2-oxoglutarate translocator [Bacillus sp. NSP9.1]
Length=478

 Score =   160 bits (404),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 120/171 (70%), Gaps = 2/171 (1%)
 Frame = -3

Query  737  LWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGYLNKY  558
            LW+FG   +IDA T A++GL++L +T V++W +   E  AWDTL WF+ L+ +A +LNK 
Sbjct  289  LWIFGGNAHIDATTTALIGLSVLFLTQVLTWDDIKKEQGAWDTLIWFSTLLMLATFLNKL  348

Query  557  GLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVASAL  378
            G++ WFS+ +   V G   SW  +F IL+L+YFYSHYFFAS  AHI AM++AF +V  A 
Sbjct  349  GMVGWFSDMMKSFVSGF--SWISAFLILILVYFYSHYFFASATAHISAMYSAFFAVIVAA  406

Query  377  GTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            G PP L AL L+F SN+ G  THYG G+APVF+GA Y+P  KWW  GF++S
Sbjct  407  GAPPLLSALTLAFFSNLFGCTTHYGAGAAPVFFGAGYIPEGKWWFIGFILS  457



>ref|WP_033543815.1| 2-oxoglutarate translocator [Planococcus sp. CAU13]
Length=474

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 89/173 (51%), Positives = 119/173 (69%), Gaps = 2/173 (1%)
 Frame = -3

Query  743  VGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGYLN  564
            + LW+FG    ++A T+A +GL +LL++GV+SW +   E  AWDTL WFA L+ MA +LN
Sbjct  283  LALWIFGGTFGVNATTSAFVGLCVLLLSGVLSWSDIKKEQGAWDTLVWFAVLVMMATFLN  342

Query  563  KYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVAS  384
            + G+I WFS+ +   V     SW L+  +L ++YFYSHYFFAS  AH+ AM+ AFLSV  
Sbjct  343  ELGMIPWFSDLMGDAVSQY--SWTLTLVVLAIVYFYSHYFFASNTAHVSAMYAAFLSVIV  400

Query  383  ALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            A G PP L AL+L+F SN+   LTHYG G APVF+G+ YVP  KWW  GF++S
Sbjct  401  ASGAPPLLSALILAFFSNLFSCLTHYGAGPAPVFFGSGYVPQQKWWMLGFIIS  453



>gb|ETP70180.1| 2-oxoglutarate translocator [Planomicrobium glaciei CHR43]
Length=474

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 91/170 (54%), Positives = 117/170 (69%), Gaps = 2/170 (1%)
 Frame = -3

Query  743  VGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGYLN  564
            + LW+FG    +DA T+A +GL +LL++GV++W +   E  AWDTL WF+ L+ MA YLN
Sbjct  283  LALWIFGGNFGVDATTSAFIGLCVLLLSGVLTWSDIKKEQGAWDTLVWFSVLVMMATYLN  342

Query  563  KYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVAS  384
            + G+I WFSE +   VG L  SW L+  IL ++YFYSHYFFAS  AH+ AM+ AFLSV  
Sbjct  343  ELGMIPWFSELMGNAVGQL--SWTLTLVILAIVYFYSHYFFASNTAHVSAMYAAFLSVIV  400

Query  383  ALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGF  234
            A G PP L AL+L+F SN+   LTHYG G APVF+G+ YV   KWW  GF
Sbjct  401  ASGAPPLLSALILAFFSNLFSCLTHYGAGPAPVFFGSGYVSQQKWWMLGF  450



>ref|WP_036802812.1| 2-oxoglutarate translocator [Planomicrobium glaciei]
Length=482

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 91/170 (54%), Positives = 117/170 (69%), Gaps = 2/170 (1%)
 Frame = -3

Query  743  VGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGYLN  564
            + LW+FG    +DA T+A +GL +LL++GV++W +   E  AWDTL WF+ L+ MA YLN
Sbjct  291  LALWIFGGNFGVDATTSAFIGLCVLLLSGVLTWSDIKKEQGAWDTLVWFSVLVMMATYLN  350

Query  563  KYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVAS  384
            + G+I WFSE +   VG L  SW L+  IL ++YFYSHYFFAS  AH+ AM+ AFLSV  
Sbjct  351  ELGMIPWFSELMGNAVGQL--SWTLTLVILAIVYFYSHYFFASNTAHVSAMYAAFLSVIV  408

Query  383  ALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGF  234
            A G PP L AL+L+F SN+   LTHYG G APVF+G+ YV   KWW  GF
Sbjct  409  ASGAPPLLSALILAFFSNLFSCLTHYGAGPAPVFFGSGYVSQQKWWMLGF  458



>ref|WP_024715768.1| 2-oxoglutarate translocator [Bacillus tequilensis]
Length=478

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 96/176 (55%), Positives = 128/176 (73%), Gaps = 2/176 (1%)
 Frame = -3

Query  752  LITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAG  573
            L+ + LW+FG   NIDA T A++GL +LL++ V++W +   E  AWDTLTWFAAL+ +A 
Sbjct  284  LLVLALWIFGGSFNIDATTTALIGLAVLLLSQVLTWDDIKKEQGAWDTLTWFAALVMLAN  343

Query  572  YLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLS  393
            +LN+ G++SWFS  +   V G   SW L+F IL+++YFYSHYFFAS  AHI AM++AFL+
Sbjct  344  FLNELGMVSWFSNAMKSSVSGF--SWILAFFILIVVYFYSHYFFASATAHISAMYSAFLA  401

Query  392  VASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            V  A G PP L AL L+F SN+ G  THYG G+APVF+GA YVP +KWW  GF++S
Sbjct  402  VIVAAGAPPLLAALSLAFFSNLFGSTTHYGAGAAPVFFGAGYVPQSKWWSIGFILS  457



>ref|WP_013943547.1| 2-oxoglutarate translocator [Simkania negevensis]
 emb|CCB89080.1| putative malate transporter yflS [Simkania negevensis Z]
Length=470

 Score =   157 bits (396),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 121/171 (71%), Gaps = 2/171 (1%)
 Frame = -3

Query  737  LWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGYLNKY  558
            LWV G  + + AV AA++GL+ILL+T V++W + + E  AW+TL WFA LI MAG+LN+ 
Sbjct  281  LWVLGPYIKMGAVIAALIGLSILLLTSVLTWDDVIKEKGAWNTLMWFATLIMMAGFLNQL  340

Query  557  GLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVASAL  378
            GL +WFS  V   V GL   W  +F IL L+YFYSHYFFAS  AHIG+M++ FL +  A+
Sbjct  341  GLTTWFSNYVQTHVQGL--YWFTAFVILALVYFYSHYFFASVVAHIGSMYSPFLLLCVAM  398

Query  377  GTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            GTPP + AL L F SN+ GGLTHYG G AP+F+G+ YV + +WW +G  +S
Sbjct  399  GTPPMIAALALGFFSNLYGGLTHYGCGPAPIFFGSGYVKITEWWKFGLFIS  449



>ref|WP_026349007.1| C4-dicarboxylate ABC transporter [Psychrobacter lutiphocae]
Length=492

 Score =   157 bits (397),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 91/169 (54%), Positives = 118/169 (70%), Gaps = 0/169 (0%)
 Frame = -3

Query  731  VFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGYLNKYGL  552
            +FG  L +DA T A++GL+ILL+TGV+SW++ L E  AWDT+ WFAAL+ MA YLNK GL
Sbjct  303  IFGEHLTLDATTTALVGLSILLITGVLSWQDVLKEKSAWDTIVWFAALVMMANYLNKLGL  362

Query  551  ISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVASALGT  372
            ISWFS  +   +G  G+SW  +  IL L+Y Y HYFFAS  AHI AMF AF +V  +LG 
Sbjct  363  ISWFSTNIETAIGMTGVSWVGAVVILTLVYLYMHYFFASTTAHITAMFAAFYAVGISLGA  422

Query  371  PPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            PP L AL+L+   NIM  LTHY  G+APV + + Y  +A+WW  GF++S
Sbjct  423  PPMLFALILAAAGNIMMTLTHYATGTAPVIFNSGYTTMAEWWKVGFIMS  471



>ref|WP_034710102.1| 2-oxoglutarate translocator [Chryseobacterium soli]
 gb|KFF13460.1| 2-oxoglutarate translocator [Chryseobacterium soli]
Length=476

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 91/174 (52%), Positives = 122/174 (70%), Gaps = 2/174 (1%)
 Frame = -3

Query  749  ITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGY  570
            I +GLW+FG  L+IDA T A +GLT+LL+T V++W++  +E  AWDT+ WFA L+ MA  
Sbjct  283  ILLGLWIFGGALSIDATTTAFIGLTLLLLTSVLTWEDVKAEKGAWDTIVWFAVLVMMAST  342

Query  569  LNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSV  390
            LN+ G I WFS+ +   +GGL  SWQ++F ++VL+YF+SHY FAS  AH+ AM+ A L V
Sbjct  343  LNELGFIGWFSDLIKAKIGGL--SWQVAFPVIVLVYFFSHYIFASATAHVAAMYAALLGV  400

Query  389  ASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLV  228
              +LG PP L A++L FL +I G LTHYG G APVFYG+ YV L  WW  G  +
Sbjct  401  GVSLGIPPMLLAMMLGFLGSIYGVLTHYGHGPAPVFYGSGYVELKAWWLRGLEI  454



>ref|WP_037389590.1| C4-dicarboxylate ABC transporter [Serratia symbiotica]
Length=490

 Score =   155 bits (392),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 87/169 (51%), Positives = 120/169 (71%), Gaps = 0/169 (0%)
 Frame = -3

Query  731  VFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGYLNKYGL  552
            +FG  L ++  TAA++GL  LL TGV+SW++ L    AWDT+ WF+AL+ MA +L K GL
Sbjct  301  IFGPALTVNPTTAALIGLAALLATGVLSWQDVLKHKGAWDTVVWFSALVMMASFLGKLGL  360

Query  551  ISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVASALGT  372
            I W S+TV K +  +G+SW     +L+++Y YSHYFFAS  AH+ AMF AFL+   ALG 
Sbjct  361  IDWLSQTVGKGIDQMGMSWVGGTVLLIIIYLYSHYFFASTIAHVTAMFAAFLTAGIALGA  420

Query  371  PPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            PP L AL+L+F S++M  LTHYG G+AP+ +G+NYV L +WW  GF++S
Sbjct  421  PPALLALILAFSSSLMMSLTHYGTGTAPIIFGSNYVTLGEWWKTGFVMS  469



>ref|WP_026684112.1| 2-oxoglutarate translocator [Bacillus coagulans]
Length=477

 Score =   155 bits (391),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 94/176 (53%), Positives = 119/176 (68%), Gaps = 2/176 (1%)
 Frame = -3

Query  752  LITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAG  573
            L+ + LW+FG  L IDA T A++GL++LL+T V++W +   E  AWDTL WFA+L+ MA 
Sbjct  283  LLILALWIFGGKLGIDATTTALIGLSVLLLTSVLTWNDVKKEEGAWDTLVWFASLVMMAT  342

Query  572  YLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLS  393
            +LN  G+I WFS  +   V GL   W L    L L++FYSHYFFAS  AH+ AM+ AFL 
Sbjct  343  FLNSLGMIPWFSHLMGTAVHGLPWIWALI--ALALIFFYSHYFFASNTAHVSAMYAAFLG  400

Query  392  VASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            VA A G PP L AL+L F+ N+ G LTHYG G APVF+G+ YVP  KWW  GF VS
Sbjct  401  VAIAAGAPPMLAALLLGFIGNLFGCLTHYGSGPAPVFFGSGYVPQDKWWLLGFSVS  456



>gb|EFW11377.1| putative transporter, divalent anion:Na+ symporter (DASS) family 
[Serratia symbiotica str. Tucson]
Length=534

 Score =   155 bits (392),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 87/169 (51%), Positives = 120/169 (71%), Gaps = 0/169 (0%)
 Frame = -3

Query  731  VFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGYLNKYGL  552
            +FG  L ++  TAA++GL  LL TGV+SW++ L    AWDT+ WF+AL+ MA +L K GL
Sbjct  345  IFGPALTVNPTTAALIGLAALLATGVLSWQDVLKHKGAWDTVVWFSALVMMASFLGKLGL  404

Query  551  ISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVASALGT  372
            I W S+TV K +  +G+SW     +L+++Y YSHYFFAS  AH+ AMF AFL+   ALG 
Sbjct  405  IDWLSQTVGKGIDQMGMSWVGGTVLLIIIYLYSHYFFASTIAHVTAMFAAFLTAGIALGA  464

Query  371  PPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            PP L AL+L+F S++M  LTHYG G+AP+ +G+NYV L +WW  GF++S
Sbjct  465  PPALLALILAFSSSLMMSLTHYGTGTAPIIFGSNYVTLGEWWKTGFVMS  513



>ref|WP_026212968.1| C4-dicarboxylate ABC transporter [Moraxella boevrei]
Length=499

 Score =   155 bits (391),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 116/169 (69%), Gaps = 0/169 (0%)
 Frame = -3

Query  731  VFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGYLNKYGL  552
            +FG    +DA T A +GL+ LL+TGV++W + L +  AWDT+ WF+ALI MA +L+K GL
Sbjct  310  IFGDTFKVDATTTAFIGLSALLLTGVLTWDDALKQKSAWDTIIWFSALIMMATFLDKLGL  369

Query  551  ISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVASALGT  372
            I WF+E +   +G L + W  +  IL L+Y Y+HYFFAS  AHI AMF AF  V  ALG 
Sbjct  370  IKWFAENIQAGIGHLDVGWVGACAILTLIYLYTHYFFASATAHITAMFAAFYGVGLALGA  429

Query  371  PPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            PP L AL+L+   NIM G+THYG G+APV +G+ +V L +WW  GF++S
Sbjct  430  PPMLYALILAAAGNIMMGITHYGTGTAPVIFGSGFVTLGEWWKTGFIIS  478



>ref|WP_014113016.1| 2-oxoglutarate translocator [Bacillus subtilis]
 gb|AEP85700.1| 2-oxoglutarate/malate translocator [Bacillus subtilis subsp. 
spizizenii TU-B-10]
Length=478

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 93/170 (55%), Positives = 124/170 (73%), Gaps = 2/170 (1%)
 Frame = -3

Query  734  WVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGYLNKYG  555
            W+FG   NIDA T A++GL +LL++ V++W +   E  AWDTLTWFAAL+ +A +LN+ G
Sbjct  290  WIFGGSFNIDATTTALIGLAVLLLSQVLTWDDIKKEQGAWDTLTWFAALVMLANFLNELG  349

Query  554  LISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVASALG  375
            ++SWFS  +   V G   SW ++F IL+++YFYSHYFFAS  AHI AM++AFL+V  A G
Sbjct  350  MVSWFSNAMKSSVSGF--SWIVAFLILIVVYFYSHYFFASATAHISAMYSAFLAVIVAAG  407

Query  374  TPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
             PP L AL L+F SN+ G  THYG G+APVF+GA YVP +KWW  GF++S
Sbjct  408  APPLLAALSLAFFSNLFGSTTHYGAGAAPVFFGAGYVPQSKWWSIGFILS  457



>ref|WP_040262880.1| C4-dicarboxylate ABC transporter [Serratia symbiotica]
Length=490

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 119/168 (71%), Gaps = 0/168 (0%)
 Frame = -3

Query  731  VFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGYLNKYGL  552
            +FG  L ++  TAA++GL  LL TGV+SW++ L    AWDT+ WF+AL+ MA +L K GL
Sbjct  301  IFGPALTVNPTTAALIGLAALLATGVLSWQDVLKHKGAWDTVVWFSALVMMASFLGKLGL  360

Query  551  ISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVASALGT  372
            I W S+TV K +  +G+SW     +L+++Y YSHYFFAS  AH+ AMF AFL+   ALG 
Sbjct  361  IDWLSQTVGKGIDQMGMSWVGGTVLLIIIYLYSHYFFASTIAHVTAMFAAFLTAGIALGA  420

Query  371  PPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLV  228
            PP L AL+L+F S++M  LTHYG G+AP+ +G+NYV L +WW  GF++
Sbjct  421  PPALLALILAFSSSLMMSLTHYGTGTAPIIFGSNYVTLGEWWKTGFVM  468



>ref|WP_014097116.1| 2-oxoglutarate translocator [Bacillus coagulans]
 gb|AEP01032.1| anion transporter [Bacillus coagulans 36D1]
Length=475

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 93/176 (53%), Positives = 118/176 (67%), Gaps = 2/176 (1%)
 Frame = -3

Query  752  LITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAG  573
            L+ + LW+FG  L IDA T A++GL++LL+T V++W +   E  AWDTL WFA+L+ MA 
Sbjct  281  LLILALWIFGGKLGIDATTTALIGLSVLLLTSVLTWNDVKKEEGAWDTLVWFASLVMMAT  340

Query  572  YLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLS  393
            +LN  G+I WFS  +   V GL   W L    L L++FYSHYFFAS  AH+ AM+ AFL 
Sbjct  341  FLNSLGMIPWFSHLMGTAVHGLPWIWALI--ALALIFFYSHYFFASNTAHVSAMYAAFLG  398

Query  392  VASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            VA   G PP L AL+L F+ N+ G LTHYG G APVF+G+ YVP  KWW  GF VS
Sbjct  399  VAIVAGAPPMLAALLLGFIGNLFGCLTHYGSGPAPVFFGSGYVPQDKWWLLGFSVS  454



>emb|CDS55553.1| putative malate transporter YflS [Serratia symbiotica]
Length=534

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 119/168 (71%), Gaps = 0/168 (0%)
 Frame = -3

Query  731  VFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGYLNKYGL  552
            +FG  L ++  TAA++GL  LL TGV+SW++ L    AWDT+ WF+AL+ MA +L K GL
Sbjct  345  IFGPALTVNPTTAALIGLAALLATGVLSWQDVLKHKGAWDTVVWFSALVMMASFLGKLGL  404

Query  551  ISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVASALGT  372
            I W S+TV K +  +G+SW     +L+++Y YSHYFFAS  AH+ AMF AFL+   ALG 
Sbjct  405  IDWLSQTVGKGIDQMGMSWVGGTVLLIIIYLYSHYFFASTIAHVTAMFAAFLTAGIALGA  464

Query  371  PPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLV  228
            PP L AL+L+F S++M  LTHYG G+AP+ +G+NYV L +WW  GF++
Sbjct  465  PPALLALILAFSSSLMMSLTHYGTGTAPIIFGSNYVTLGEWWKTGFVM  512



>gb|ETZ23288.1| 2-oxoglutarate translocator [Pedobacter sp. V48]
Length=476

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 86/171 (50%), Positives = 113/171 (66%), Gaps = 2/171 (1%)
 Frame = -3

Query  737  LWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGYLNKY  558
            LW+ G +  IDA T A +GL  LL++ V++W++  SE  AWDT+ WF+AL+ M   LN  
Sbjct  287  LWITGDIFKIDATTTAFIGLVFLLLSQVLTWEDVKSEKGAWDTIVWFSALVMMGSSLNSL  346

Query  557  GLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVASAL  378
            GLI WFSE V   +GGL  SW ++F I+VL+YFYSHY FAS  AH+ +M+ A L V   +
Sbjct  347  GLIPWFSELVRAKIGGL--SWTMAFPIIVLVYFYSHYMFASATAHVASMYAALLGVGITI  404

Query  377  GTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            G PP L AL L F   I G LTHYG G APVF+G+ +V +  WW  GF++S
Sbjct  405  GIPPMLLALSLGFCGGIFGTLTHYGHGPAPVFFGSTFVDVKDWWSKGFVLS  455



>ref|WP_040083848.1| 2-oxoglutarate translocator [Bacillus sp. A053]
 gb|KIH38638.1| 2-oxoglutarate translocator [Bacillus sp. A053]
Length=478

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 92/170 (54%), Positives = 123/170 (72%), Gaps = 2/170 (1%)
 Frame = -3

Query  734  WVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGYLNKYG  555
            W+FG   NIDA T A++GL +LL++ V++W +   E  AWDTLTWFAAL+ +A +LN+ G
Sbjct  290  WIFGGSFNIDATTTALIGLAVLLLSQVLTWDDIKKEQGAWDTLTWFAALVMLANFLNELG  349

Query  554  LISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVASALG  375
            ++SWFS  +   V G   SW ++F IL+++YFYSHYFFAS  AHI AM++AFL+V  A G
Sbjct  350  MVSWFSNAMKSSVSGF--SWIVAFLILIVVYFYSHYFFASATAHISAMYSAFLAVVVAAG  407

Query  374  TPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
             PP L AL L+F SN+ G  THYG G+APVF+GA Y+P  KWW  GF++S
Sbjct  408  APPLLAALSLAFFSNLFGSTTHYGSGAAPVFFGAGYIPQGKWWSIGFILS  457



>ref|WP_014663179.1| 2-oxoglutarate translocator [Bacillus sp. JS]
 gb|AFI27386.1| 2-oxoglutarate/malate translocator [Bacillus sp. JS]
Length=478

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 92/170 (54%), Positives = 123/170 (72%), Gaps = 2/170 (1%)
 Frame = -3

Query  734  WVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGYLNKYG  555
            W+FG   NIDA T A++GL +LL++ V++W +   E  AWDTLTWFAAL+ +A +LN+ G
Sbjct  290  WIFGGSFNIDATTTALIGLAVLLLSQVLTWDDIKKEQGAWDTLTWFAALVMLANFLNELG  349

Query  554  LISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVASALG  375
            ++SWFS  +   V G   SW ++F IL+++YFYSHYFFAS  AHI AM++AFL+V  A G
Sbjct  350  MVSWFSNAMKSSVSGF--SWIVAFLILIVVYFYSHYFFASATAHISAMYSAFLAVVVAAG  407

Query  374  TPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
             PP L AL L+F SN+ G  THYG G+APVF+GA Y+P  KWW  GF++S
Sbjct  408  APPLLAALSLAFFSNLFGSTTHYGSGAAPVFFGAGYIPQGKWWSIGFILS  457



>ref|WP_038464208.1| 2-oxoglutarate translocator [Candidatus Paracaedibacter acanthamoebae]
 gb|AIK96149.1| 2-oxoglutarate translocator [Candidatus Paracaedibacter acanthamoebae]
Length=467

 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 101/196 (52%), Positives = 138/196 (70%), Gaps = 2/196 (1%)
 Frame = -3

Query  749  ITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGY  570
            + +GLW+FG    I A T A+LGL +LLVT +++W + L E  AW TL WFA L+ MA Y
Sbjct  274  LMLGLWIFGEPYGISAATTALLGLCLLLVTKILTWNDVLEEKEAWHTLIWFAILVTMAKY  333

Query  569  LNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSV  390
            L  YG+++WFS  V  +V   G+ W  +F +L+L+YFYSHYFFAS  +H+ AM+ AFL+V
Sbjct  334  LQIYGVVAWFSTMVSTLV--TGMDWMSAFAVLILIYFYSHYFFASNTSHVSAMYAAFLAV  391

Query  389  ASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVSvvnii  210
            A ++GTPP + AL   F S++   +THYG  S+ +F+GA YV +  WW  GF++SV+N+I
Sbjct  392  AISVGTPPLIAALGFGFCSSLFSSMTHYGASSSAMFFGAGYVDIGTWWRLGFMISVINLI  451

Query  209  iwlgvggiwWKAIGLW  162
            IW GVG IWWKAIGLW
Sbjct  452  IWFGVGSIWWKAIGLW  467



>ref|WP_003679629.1| C4-dicarboxylate ABC transporter [Neisseria flavescens]
 gb|EEG34394.1| transporter, DASS family [Neisseria flavescens NRL30031/H210]
Length=483

 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 97/142 (68%), Gaps = 0/142 (0%)
 Frame = -3

Query  650  SWKECLSEAVAWDTLTWFAALIAMAGYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILV  471
            +W++ L E  AWDT+ WFAAL+ MA +LNK GLISW S+++   +  +GL W+    +L+
Sbjct  321  TWEDALKEKSAWDTIVWFAALVMMANFLNKLGLISWLSDSMQSGIAHMGLGWEAGCALLM  380

Query  470  LLYFYSHYFFASGAAHIGAMFTAFLSVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSA  291
            L Y Y+HY FASG AH+ AMF AF     ALG PP L ALV++  + IM  LTHY  GSA
Sbjct  381  LAYLYAHYVFASGTAHVTAMFGAFYGAGLALGAPPMLFALVMASATGIMMSLTHYATGSA  440

Query  290  PVFYGANYVPLAKWWGYGFLVS  225
            PV YG+NYV + +WW  GF++S
Sbjct  441  PVIYGSNYVTMTEWWKAGFIMS  462



>ref|WP_015417012.1| MULTISPECIES: 2-oxoglutarate/malate transporter [Bacillus]
 emb|CCP20741.1| 2-oxoglutarate/malate transporter [Bacillus amyloliquefaciens 
subsp. plantarum UCMB5036]
 gb|AJC24759.1| 2-oxoglutarate translocator [Bacillus sp. Pc3]
 gb|AJH23098.1| 2-oxoglutarate translocator [Bacillus amyloliquefaciens]
Length=478

 Score =   152 bits (384),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 130/176 (74%), Gaps = 2/176 (1%)
 Frame = -3

Query  752  LITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAG  573
            L+ + LW+FG  LNIDA T A++GL++LL++ V++W++   E  AWDTLTWFAAL+ +A 
Sbjct  284  LLVLALWIFGGSLNIDATTTALIGLSVLLLSQVLTWEDIKKEQGAWDTLTWFAALVMLAN  343

Query  572  YLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLS  393
            +LN+ G++SWFS+ +   V G   SW ++F IL+++Y+Y+HYFFAS  AHI AM+ AFL+
Sbjct  344  FLNELGMVSWFSDMMKSSVSGF--SWIVAFMILIVVYYYTHYFFASATAHISAMYAAFLA  401

Query  392  VASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            V  A G PP L AL L+F SN+ G  THYG G+APVF+GA Y+  +KWW  GF++S
Sbjct  402  VIVAAGAPPLLAALSLAFFSNLFGSTTHYGSGAAPVFFGAGYISQSKWWSIGFILS  457



>ref|WP_003239908.1| hypothetical protein [Bacillus subtilis]
 gb|ELS60507.1| hypothetical protein BSI_29070 [Bacillus subtilis subsp. inaquosorum 
KCTC 13429]
Length=478

 Score =   152 bits (384),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 91/170 (54%), Positives = 124/170 (73%), Gaps = 2/170 (1%)
 Frame = -3

Query  734  WVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGYLNKYG  555
            W+FG   NIDA T A++GL +LL++ V++W +   E  AWDTLTWFAAL+ +A +LN+ G
Sbjct  290  WIFGGSFNIDATTTALIGLAVLLLSQVLTWDDVKKEQGAWDTLTWFAALVMLANFLNELG  349

Query  554  LISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVASALG  375
            ++SWFS  +   V G   SW ++F IL+++Y+YSHYFFAS  AHI AM++AFL+V  A G
Sbjct  350  MVSWFSNAMKSSVSGF--SWIVAFIILIVVYYYSHYFFASATAHISAMYSAFLAVVVAAG  407

Query  374  TPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
             PP L AL L+F+SN+ G  THYG G+APVF+GA Y+P  KWW  GF++S
Sbjct  408  APPLLAALSLAFISNLFGSTTHYGSGAAPVFFGAGYIPQGKWWSIGFILS  457



>ref|WP_019257759.1| 2-oxoglutarate translocator [Bacillus subtilis]
Length=478

 Score =   152 bits (384),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 91/170 (54%), Positives = 124/170 (73%), Gaps = 2/170 (1%)
 Frame = -3

Query  734  WVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGYLNKYG  555
            W+FG   NIDA T A++GL +LL++ V++W +   E  AWDTLTWFAAL+ +A +LN+ G
Sbjct  290  WIFGGSFNIDATTTALIGLAVLLLSQVLTWDDVKKEQGAWDTLTWFAALVMLANFLNELG  349

Query  554  LISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVASALG  375
            ++SWFS  +   V G   SW ++F IL+++Y+YSHYFFAS  AHI AM++AFL+V  A G
Sbjct  350  MVSWFSNAMKSSVSGF--SWIVAFIILIVVYYYSHYFFASATAHISAMYSAFLAVVVAAG  407

Query  374  TPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
             PP L AL L+F+SN+ G  THYG G+APVF+GA Y+P  KWW  GF++S
Sbjct  408  APPLLAALSLAFISNLFGSTTHYGSGAAPVFFGAGYIPQGKWWSIGFILS  457



>ref|WP_026853279.1| 2-oxoglutarate translocator [Geothrix fermentans]
Length=475

 Score =   152 bits (383),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 95/142 (67%), Gaps = 2/142 (1%)
 Frame = -3

Query  650  SWKECLSEAVAWDTLTWFAALIAMAGYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILV  471
            +W +  +E  AWDTL WFAAL+ MA +LNK G+I WFS T+  +V G G  W  +F +L 
Sbjct  315  TWDDIKTETGAWDTLVWFAALVMMASFLNKLGMIPWFSRTMGGMVAGKG--WIAAFLVLG  372

Query  470  LLYFYSHYFFASGAAHIGAMFTAFLSVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSA  291
            L+YFYSHYFFAS  AH+ +M+ AFL V+   G PP L ALVL+F SN+  G+THYG G A
Sbjct  373  LVYFYSHYFFASNTAHVASMYAAFLGVSIVAGAPPVLAALVLAFFSNLFAGMTHYGTGPA  432

Query  290  PVFYGANYVPLAKWWGYGFLVS  225
            PV +G  YV L  WW  G  +S
Sbjct  433  PVLFGTGYVELGTWWRLGLFIS  454



>ref|WP_003233725.1| 2-oxoglutarate translocator [Bacillus subtilis]
 ref|NP_388638.1| malate transporter YflS [Bacillus subtilis subsp. subtilis str. 
168]
 sp|O34726.1|YFLS_BACSU RecName: Full=Putative malate transporter YflS [Bacillus subtilis 
subsp. subtilis str. 168]
 dbj|BAA22312.1| YflS [Bacillus subtilis]
 emb|CAB12586.1| 2-oxoglutarate/malate transporter [Bacillus subtilis subsp. subtilis 
str. 168]
 dbj|BAI84272.1| hypothetical protein BSNT_07134 [Bacillus subtilis subsp. natto 
BEST195]
 gb|ADV95745.1| 2-oxoglutarate/malate transporter [Bacillus subtilis BSn5]
 gb|AEP89842.1| 2-oxoglutarate/malate translocator [Bacillus subtilis subsp. 
subtilis str. RO-NN-1]
 gb|EHA29288.1| hypothetical protein BSSC8_35680 [Bacillus subtilis subsp. subtilis 
str. SC-8]
 gb|AFQ56676.1| 2-oxoglutarate/malate transporter [Bacillus subtilis QB928]
 dbj|BAM49680.1| 2-oxoglutarate/malate transporter [Bacillus subtilis BEST7613]
 dbj|BAM56950.1| 2-oxoglutarate/malate transporter [Bacillus subtilis BEST7003]
 gb|AGA21274.1| Malate transporter YflS [Bacillus subtilis subsp. subtilis str. 
BSP1]
 gb|EME07702.1| Na+ symporter (DASS) family protein [Bacillus subtilis MB73/2]
 gb|AGG60110.1| 2-oxoglutarate/malate transporter YflS [Bacillus subtilis subsp. 
subtilis 6051-HGW]
 gb|AHA76716.1| Putative malate transporter yflS [Bacillus subtilis PY79]
 gb|EXF51708.1| 2-oxoglutarate translocator [Bacillus subtilis QH-1]
 gb|KDE24759.1| 2-oxoglutarate translocator [Bacillus subtilis]
 gb|AIC39140.1| 2-oxoglutarate/malate transporter [Bacillus subtilis subsp. subtilis 
str. JH642 substr. AG174]
 gb|AIC43372.1| 2-oxoglutarate/malate transporter [Bacillus subtilis subsp. subtilis 
str. AG1839]
 gb|KFC28723.1| 2-oxoglutarate translocator [Bacillus subtilis]
 gb|KFH30358.1| 2-oxoglutarate translocator [Bacillus subtilis subsp. subtilis]
 gb|KFH30640.1| 2-oxoglutarate translocator [Bacillus subtilis subsp. subtilis]
 dbj|GAK79227.1| 2-oxoglutarate/malate transporter [Bacillus subtilis Miyagi-4]
 gb|AIX06521.1| Putative malate transporter YflS [Bacillus subtilis]
 emb|CEI55895.1| malate transporter YflS [Bacillus subtilis]
 emb|CEJ76320.1| malate transporter YflS [Bacillus sp.]
 gb|AIY92047.1| 2-oxoglutarate translocator [Bacillus subtilis subsp. subtilis 
str. 168]
 gb|AIY96359.1| 2-oxoglutarate translocator [Bacillus subtilis]
 gb|AJE93426.1| 2-oxoglutarate translocator [Bacillus subtilis subsp. subtilis]
 gb|KIX81986.1| Putative malate transporter YflS [Bacillus subtilis]
Length=478

 Score =   152 bits (383),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 91/170 (54%), Positives = 124/170 (73%), Gaps = 2/170 (1%)
 Frame = -3

Query  734  WVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGYLNKYG  555
            W+FG   NIDA T A++GL +LL++ V++W +   E  AWDTLTWFAAL+ +A +LN+ G
Sbjct  290  WIFGGSFNIDATTTALIGLAVLLLSQVLTWDDIKKEQGAWDTLTWFAALVMLANFLNELG  349

Query  554  LISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVASALG  375
            ++SWFS  +   V G   SW ++F IL+++Y+YSHYFFAS  AHI AM++AFL+V  A G
Sbjct  350  MVSWFSNAMKSSVSGF--SWIVAFIILIVVYYYSHYFFASATAHISAMYSAFLAVVVAAG  407

Query  374  TPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
             PP L AL L+F+SN+ G  THYG G+APVF+GA Y+P  KWW  GF++S
Sbjct  408  APPLLAALSLAFISNLFGSTTHYGSGAAPVFFGAGYIPQGKWWSIGFILS  457



>ref|WP_034674881.1| 2-oxoglutarate translocator [Chryseobacterium formosense]
 gb|KFF00545.1| 2-oxoglutarate translocator [Chryseobacterium formosense]
Length=476

 Score =   152 bits (383),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 120/168 (71%), Gaps = 2/168 (1%)
 Frame = -3

Query  749  ITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGY  570
            I +GLW+FG  L+IDA T A +GLT+LL+T V++W++  SE  AWDT+ WFA L+ MA  
Sbjct  283  ILLGLWIFGGALSIDATTTAFIGLTLLLLTSVLTWEDVKSEKGAWDTIVWFAVLVMMASS  342

Query  569  LNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSV  390
            LN+ G I WFS+ +   +GG+  +W ++F +++L+YF+SHY FAS  AH+ AM+ A LSV
Sbjct  343  LNELGFIGWFSDLIKLKIGGM--TWTVAFPVIILVYFFSHYIFASATAHVAAMYAALLSV  400

Query  389  ASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWW  246
              A+G PP L A++L FL +I G LTHYG G APVF+G+ YV L  WW
Sbjct  401  GIAVGIPPMLLAMMLGFLGSIYGVLTHYGHGPAPVFFGSGYVDLKSWW  448



>gb|EFC51259.1| transporter, DASS family [Neisseria subflava NJ9703]
Length=488

 Score =   152 bits (383),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 96/142 (68%), Gaps = 0/142 (0%)
 Frame = -3

Query  650  SWKECLSEAVAWDTLTWFAALIAMAGYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILV  471
            +W + L E  AWDT+ WFAAL+ MA +LNK GLISW S+++   +  +GL W+    +L+
Sbjct  321  TWDDALKEKSAWDTIVWFAALVMMANFLNKLGLISWLSDSMQSGIAHMGLGWEAGCALLM  380

Query  470  LLYFYSHYFFASGAAHIGAMFTAFLSVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSA  291
            L Y Y+HY FASG AH+ AMF AF     ALG PP L AL+++  + IM  LTHY  GSA
Sbjct  381  LAYLYAHYVFASGTAHVTAMFGAFYGAGLALGAPPMLFALIMAAATGIMMSLTHYATGSA  440

Query  290  PVFYGANYVPLAKWWGYGFLVS  225
            PV YG+NYV + +WW  GF++S
Sbjct  441  PVIYGSNYVNMTEWWKAGFIMS  462



>ref|WP_019713597.1| 2-oxoglutarate translocator [Bacillus subtilis]
Length=478

 Score =   152 bits (383),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 92/170 (54%), Positives = 124/170 (73%), Gaps = 2/170 (1%)
 Frame = -3

Query  734  WVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGYLNKYG  555
            W+FG   NIDA T A++GL++LL++ V++W +   E  AWDTLTWFAAL+ +A +LN+ G
Sbjct  290  WIFGGSFNIDATTTALIGLSVLLLSQVLTWDDIKKEQGAWDTLTWFAALVMLANFLNELG  349

Query  554  LISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVASALG  375
            ++SWFS  +   V G   SW ++F IL+++YFYSHYFFAS  AHI AM++AFL+V  A G
Sbjct  350  MVSWFSNAMKSSVSGF--SWIVAFLILIVVYFYSHYFFASATAHISAMYSAFLAVVVAAG  407

Query  374  TPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
             PP L AL L+F SN+ G  THYG G+APVF+GA Y+P  KWW  GF++S
Sbjct  408  APPLLAALSLAFFSNLFGSTTHYGSGAAPVFFGAGYIPQGKWWSIGFILS  457



>ref|WP_013390434.1| MULTISPECIES: 2-oxoglutarate translocator [Bacillus subtilis 
group]
 gb|ADP31232.1| 2-oxoglutarate/malate transporter [Bacillus atrophaeus 1942]
 gb|AIK49393.1| 2-oxoglutarate/malate translocator [Bacillus atrophaeus subsp. 
globigii]
 gb|KFK81246.1| 2-oxoglutarate/malate translocator, chloroplastic [Bacillus subtilis 
subsp. niger]
 gb|AJF84091.1| 2-oxoglutarate translocator [Bacillus atrophaeus]
Length=478

 Score =   152 bits (383),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 92/170 (54%), Positives = 124/170 (73%), Gaps = 2/170 (1%)
 Frame = -3

Query  734  WVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGYLNKYG  555
            W+FG   NIDA T A++GL++LL++ V++W +   E  AWDTLTWFAAL+ +A +LN+ G
Sbjct  290  WIFGGSFNIDATTTALIGLSVLLLSQVLTWDDIKKEQGAWDTLTWFAALVMLANFLNELG  349

Query  554  LISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVASALG  375
            ++SWFS  +   V G   SW ++F IL+++YFYSHYFFAS  AHI AM++AFL+V  A G
Sbjct  350  MVSWFSNAMKSSVSGF--SWIVAFLILIVVYFYSHYFFASATAHISAMYSAFLAVVVAAG  407

Query  374  TPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
             PP L AL L+F SN+ G  THYG G+APVF+GA Y+P  KWW  GF++S
Sbjct  408  APPLLAALSLAFFSNLFGSTTHYGSGAAPVFFGAGYIPQGKWWSIGFILS  457



>ref|WP_006343274.1| 2-oxoglutarate translocator [Chlamydia psittaci]
 ref|YP_004064550.1| putative sodium:sulfate symporter [Chlamydia psittaci RD1]
 emb|CBY17115.1| putative sodium:sulfate symporter [Chlamydia psittaci RD1]
 gb|ADZ19009.1| putative sodium:sulfate symporter [Chlamydia psittaci 6BC]
 gb|EGF85197.1| transporter, divalent anion:Na+ symporter (DASS) family [Chlamydia 
psittaci Cal10]
 gb|AEB55622.1| sodium:sulfate symporter family protein [Chlamydia psittaci 6BC]
 gb|AEG85643.1| putative sodium:sulfate symporter [Chlamydia psittaci C19/98]
 gb|AEG86621.1| putative sodium:sulfate symporter [Chlamydia psittaci 01DC11]
 gb|AEG87596.1| putative sodium:sulfate symporter [Chlamydia psittaci 02DC15]
 gb|AEG88572.1| putative sodium:sulfate symporter [Chlamydia psittaci 08DC60]
 gb|AFS19662.1| Na+ symporter (DASS) family protein [Chlamydia psittaci 84/55]
 gb|AFS20730.1| Na+ symporter (DASS) family protein [Chlamydia psittaci GR9]
 gb|AFS23487.1| Na+ symporter (DASS) family protein [Chlamydia psittaci WS/RT/E30]
 gb|AFS25178.1| Na+ symporter (DASS) family protein [Chlamydia psittaci M56]
 gb|AFS26365.1| Na+ symporter (DASS) family protein [Chlamydia psittaci WC]
 gb|AGE75183.1| putative sodium:sulfate symporter [Chlamydia psittaci Mat116]
 gb|EPJ12923.1| sodium:sulfate symporter transmembrane region family protein 
[Chlamydia psittaci 02DC16]
 gb|EPJ14572.1| sodium:sulfate symporter transmembrane region family protein 
[Chlamydia psittaci 02DC15]
 gb|EPJ15426.1| sodium:sulfate symporter transmembrane region family protein 
[Chlamydia psittaci 02DC18]
 gb|EPJ16580.1| sodium:sulfate symporter transmembrane region family protein 
[Chlamydia psittaci 02DC22]
 gb|EPJ18704.1| sodium:sulfate symporter transmembrane region family protein 
[Chlamydia psittaci 01DC11]
 gb|EPJ19526.1| sodium:sulfate symporter transmembrane region family protein 
[Chlamydia psittaci 02DC21]
 gb|EPJ20633.1| sodium:sulfate symporter transmembrane region family protein 
[Chlamydia psittaci 02DC23]
 gb|EPJ21748.1| sodium:sulfate symporter transmembrane region family protein 
[Chlamydia psittaci 04DC42]
 gb|EPJ22536.1| sodium:sulfate symporter transmembrane region family protein 
[Chlamydia psittaci 03DC29]
 gb|EPJ24063.1| sodium:sulfate symporter transmembrane region family protein 
[Chlamydia psittaci 08DC60]
 gb|EPJ27406.1| sodium:sulfate symporter transmembrane region family protein 
[Chlamydia psittaci 99DC5]
 gb|EPJ29202.1| sodium:sulfate symporter transmembrane region family protein 
[Chlamydia psittaci C19/98]
 gb|EPJ29947.1| sodium:sulfate symporter transmembrane region family protein 
[Chlamydia psittaci 03DC35]
 gb|EPJ97203.1| sulfate symporter transmembrane region family protein [Chlamydia 
psittaci 02DC14]
 gb|EPJ99154.1| sodium:sulfate symporter transmembrane region family protein 
[Chlamydia psittaci 02DC24]
 gb|EPP28234.1| sodium:sulfate symporter transmembrane region family protein 
[Chlamydia psittaci 08-2626_L3]
 gb|EPP31565.1| sodium:sulfate symporter transmembrane region family protein 
[Chlamydia psittaci C1/97]
 gb|EPP33329.1| sodium:sulfate symporter transmembrane region family protein 
[Chlamydia psittaci C6/98]
Length=470

 Score =   151 bits (382),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 121/177 (68%), Gaps = 3/177 (2%)
 Frame = -3

Query  752  LITVGLWVFGSVLNIDavtaailgltillvtgvVSW-KECLSEAVAWDTLTWFAALIAMA  576
            ++ V LW FG +L I A TAA++GL++L++T ++ W K+ ++   AW+T  WF ALI MA
Sbjct  275  ILLVVLWTFGDLLRISATTAALIGLSLLVLTNILDWHKDVMANTTAWETFIWFGALIMMA  334

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
             +LN+ G I    ++V   V GL  SW++ F IL L+YFYSHY FAS  AHIGAMF  FL
Sbjct  335  SFLNQLGFIPLIGDSVASAVTGL--SWKIGFPILALMYFYSHYLFASNTAHIGAMFPVFL  392

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            +V+ ALGT P    LVL+F SN+ GGLTHYG G AP+++G+  V +  WW  GF++S
Sbjct  393  AVSIALGTNPIFACLVLAFSSNLFGGLTHYGSGPAPLYFGSQLVSIKDWWQSGFVLS  449



>ref|WP_039076181.1| 2-oxoglutarate translocator [Bacillus sp. MSP13]
Length=478

 Score =   151 bits (382),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 92/170 (54%), Positives = 123/170 (72%), Gaps = 2/170 (1%)
 Frame = -3

Query  734  WVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGYLNKYG  555
            W+FG    IDA T A++GL +LL++ V++W +   E  AWDTLTWFAAL+ +A +LN+ G
Sbjct  290  WIFGGKFKIDATTTALIGLAVLLLSQVLTWDDIKKEQGAWDTLTWFAALVMLANFLNELG  349

Query  554  LISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVASALG  375
            ++SWFS  +   V G   SW ++F IL+++YFYSHYFFAS  AHI AM++AFL+V  A G
Sbjct  350  MVSWFSNAMKSSVSGF--SWIVAFLILIVVYFYSHYFFASATAHISAMYSAFLAVIVAAG  407

Query  374  TPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
             PP L AL L+F SN+ G  THYG G+APVF+GA YVP +KWW  GF++S
Sbjct  408  APPLLAALSLAFFSNLFGSTTHYGAGAAPVFFGAGYVPQSKWWSIGFILS  457



>ref|WP_031502137.1| 2-oxoglutarate translocator [Chryseobacterium haifense]
Length=476

 Score =   151 bits (382),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 121/174 (70%), Gaps = 2/174 (1%)
 Frame = -3

Query  749  ITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGY  570
            I +GLW+FG  L+IDA T A +GLT+LL+T V++W++   E  AWDT+ WFA L+ MA  
Sbjct  283  ILLGLWIFGGALSIDATTTAFIGLTLLLLTSVLTWEDVKGEKGAWDTIVWFAVLVMMASS  342

Query  569  LNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSV  390
            LN+ G I WFS  +   VGG+  +W ++F +++L+YF+SHY FAS  AH+ AM+ A LSV
Sbjct  343  LNELGFIGWFSNLIKMEVGGM--TWTIAFPVIILVYFFSHYIFASATAHVAAMYAALLSV  400

Query  389  ASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLV  228
              A+G PP L A++L F+ +I G LTHYG G APVF+G+ YV L +WW  G  +
Sbjct  401  GVAVGIPPMLLAMMLGFMGSIYGVLTHYGHGPAPVFFGSGYVDLKEWWLRGLEI  454



>ref|NP_001062066.1| Os08g0481800 [Oryza sativa Japonica Group]
 dbj|BAF23980.1| Os08g0481800, partial [Oryza sativa Japonica Group]
Length=239

 Score =   146 bits (369),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 83/174 (48%), Positives = 118/174 (68%), Gaps = 0/174 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            +++ V LW+FG  + + +V AA++GL+ILL+ GV++W++CL+E  AWDTL WFA L+ MA
Sbjct  42   MILAVSLWIFGDTIGVSSVVAAMIGLSILLLLGVLNWEDCLNEKSAWDTLAWFAILVGMA  101

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            G L   G++SW S  V KV+    LSW  +FG+L   YF+ HY FAS  AH+GA+++AFL
Sbjct  102  GQLTNLGIVSWMSNCVAKVLQSFSLSWPAAFGVLQASYFFIHYLFASQTAHVGALYSAFL  161

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGF  234
            ++  A G P  L AL L++ SN+ G LTHY  G + V+YGA YV L   +  GF
Sbjct  162  AMHLAAGVPAILSALALTYNSNLFGALTHYSSGQSAVYYGAGYVDLPDVFKLGF  215



>ref|WP_014946075.1| 2-oxoglutarate translocator [Chlamydia psittaci]
 gb|AFS21507.1| Na+ symporter (DASS) family protein [Chlamydia psittaci MN]
 gb|AFS27097.1| Na+ symporter (DASS) family protein [Chlamydia psittaci CP3]
 emb|CCO02101.1| putative sodium:sulfate symporter [Chlamydia psittaci 01DC12]
 gb|EPJ24627.1| sodium:sulfate symporter transmembrane region family protein 
[Chlamydia psittaci 09DC77]
 gb|EPJ26244.1| sodium:sulfate symporter transmembrane region family protein 
[Chlamydia psittaci 09DC80]
 gb|EPJ29535.1| sodium:sulfate symporter transmembrane region family protein 
[Chlamydia psittaci 09DC78]
 gb|EPL01019.1| sodium:sulfate symporter transmembrane region family protein 
[Chlamydia psittaci 09DC79]
Length=470

 Score =   151 bits (382),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 121/177 (68%), Gaps = 3/177 (2%)
 Frame = -3

Query  752  LITVGLWVFGSVLNIDavtaailgltillvtgvVSW-KECLSEAVAWDTLTWFAALIAMA  576
            ++ V LW FG +L I A TAA++GL++L++T ++ W K+ ++   AW+T  WF ALI MA
Sbjct  275  ILLVVLWTFGDLLRISATTAALIGLSLLVLTNILDWHKDVMANTTAWETFIWFGALIMMA  334

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
             +LN+ G I    ++V   V GL  SW++ F IL L+YFYSHY FAS  AHIGAMF  FL
Sbjct  335  SFLNQLGFIPLIGDSVASAVTGL--SWKIGFPILALMYFYSHYLFASNTAHIGAMFPVFL  392

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            +V+ ALGT P    LVL+F SN+ GGLTHYG G AP+++G+  V +  WW  GF++S
Sbjct  393  AVSIALGTNPIFACLVLAFSSNLFGGLTHYGSGPAPLYFGSQLVSIKDWWQSGFVLS  449



>ref|WP_014946742.1| 2-oxoglutarate translocator [Chlamydia psittaci]
 gb|AFS28164.1| Na+ symporter (DASS) family protein [Chlamydia psittaci NJ1]
Length=470

 Score =   151 bits (382),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 121/177 (68%), Gaps = 3/177 (2%)
 Frame = -3

Query  752  LITVGLWVFGSVLNIDavtaailgltillvtgvVSW-KECLSEAVAWDTLTWFAALIAMA  576
            ++ V LW FG +L I A TAA++GL++L++T ++ W K+ ++   AW+T  WF ALI MA
Sbjct  275  ILLVVLWTFGDLLRISATTAALIGLSLLVLTNILDWHKDVMANTTAWETFIWFGALIMMA  334

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
             +LN+ G I    ++V   V GL  SW++ F IL L+YFYSHY FAS  AHIGAMF  FL
Sbjct  335  SFLNQLGFIPLIGDSVASAVTGL--SWKIGFPILALMYFYSHYLFASNTAHIGAMFPVFL  392

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            +V+ ALGT P    LVL+F SN+ GGLTHYG G AP+++G+  V +  WW  GF++S
Sbjct  393  AVSIALGTNPIFACLVLAFSSNLFGGLTHYGSGPAPLYFGSQLVSIKDWWQSGFVLS  449



>ref|WP_014944315.1| 2-oxoglutarate translocator [Chlamydia psittaci]
 gb|AFS22849.1| Na+ symporter (DASS) family protein [Chlamydia psittaci VS225]
Length=470

 Score =   151 bits (382),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 121/177 (68%), Gaps = 3/177 (2%)
 Frame = -3

Query  752  LITVGLWVFGSVLNIDavtaailgltillvtgvVSW-KECLSEAVAWDTLTWFAALIAMA  576
            ++ V LW FG +L I A TAA++GL++L++T ++ W K+ ++   AW+T  WF ALI MA
Sbjct  275  ILLVVLWTFGDLLRISATTAALIGLSLLVLTNILDWHKDVMANTTAWETFIWFGALIMMA  334

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
             +LN+ G I    ++V   V GL  SW++ F IL L+YFYSHY FAS  AHIGAMF  FL
Sbjct  335  SFLNQLGFIPLIGDSVASAVTGL--SWKIGFPILALMYFYSHYLFASNTAHIGAMFPVFL  392

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            +V+ ALGT P    LVL+F SN+ GGLTHYG G AP+++G+  V +  WW  GF++S
Sbjct  393  AVSIALGTNPIFACLVLAFSSNLFGGLTHYGSGPAPLYFGSQLVSIKDWWQSGFVLS  449



>ref|WP_036491426.1| C4-dicarboxylate ABC transporter [Neisseria mucosa]
 gb|KGJ32311.1| C4-dicarboxylate ABC transporter [Neisseria mucosa]
Length=483

 Score =   151 bits (382),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 96/142 (68%), Gaps = 0/142 (0%)
 Frame = -3

Query  650  SWKECLSEAVAWDTLTWFAALIAMAGYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILV  471
            +W + L E  AWDT+ WFAAL+ MA +LNK GLISW S+++   +  +GL W+    +L+
Sbjct  321  TWDDALKEKSAWDTIVWFAALVMMANFLNKLGLISWLSDSMQSGIAHMGLGWEAGCALLM  380

Query  470  LLYFYSHYFFASGAAHIGAMFTAFLSVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSA  291
            L Y Y+HY FASG AH+ AMF AF     ALG PP L AL+++  + IM  LTHY  GSA
Sbjct  381  LAYLYAHYVFASGTAHVTAMFGAFYGAGLALGAPPMLFALIMAAATGIMMSLTHYATGSA  440

Query  290  PVFYGANYVPLAKWWGYGFLVS  225
            PV YG+NYV + +WW  GF++S
Sbjct  441  PVIYGSNYVNMTEWWKAGFIMS  462



>ref|WP_003746210.1| C4-dicarboxylate ABC transporter [Neisseria mucosa]
 gb|EFV81289.1| 2-oxoglutarate/malate translocator [Neisseria mucosa C102]
Length=483

 Score =   151 bits (382),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 96/142 (68%), Gaps = 0/142 (0%)
 Frame = -3

Query  650  SWKECLSEAVAWDTLTWFAALIAMAGYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILV  471
            +W + L E  AWDT+ WFAAL+ MA +LNK GLISW S+++   +  +GL W+    +L+
Sbjct  321  TWDDALKEKSAWDTIVWFAALVMMANFLNKLGLISWLSDSMQSGIAHMGLGWEAGCALLM  380

Query  470  LLYFYSHYFFASGAAHIGAMFTAFLSVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSA  291
            L Y Y+HY FASG AH+ AMF AF     ALG PP L AL+++  + IM  LTHY  GSA
Sbjct  381  LAYLYAHYVFASGTAHVTAMFGAFYGAGLALGAPPMLFALIMAAATGIMMSLTHYATGSA  440

Query  290  PVFYGANYVPLAKWWGYGFLVS  225
            PV YG+NYV + +WW  GF++S
Sbjct  441  PVIYGSNYVNMTEWWKAGFIMS  462



>ref|WP_010787924.1| 2-oxoglutarate/malate translocator [Bacillus atrophaeus]
 gb|EOB38136.1| 2-oxoglutarate/malate translocator [Bacillus atrophaeus UCMB-5137]
Length=478

 Score =   151 bits (382),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 92/170 (54%), Positives = 124/170 (73%), Gaps = 2/170 (1%)
 Frame = -3

Query  734  WVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGYLNKYG  555
            W+FG   NIDA T A++GL++LL++ V++W +   E  AWDTLTWFAAL+ +A +LN+ G
Sbjct  290  WIFGGNFNIDATTTALIGLSVLLLSQVLTWDDIKKEQGAWDTLTWFAALVMLANFLNELG  349

Query  554  LISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVASALG  375
            ++SWFS  +   V G   SW ++F IL+++YFYSHYFFAS  AHI AM++AFL+V  A G
Sbjct  350  MVSWFSNAMKSSVSGF--SWIVAFLILIVVYFYSHYFFASATAHISAMYSAFLAVVVAAG  407

Query  374  TPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
             PP L AL L+F SN+ G  THYG G+APVF+GA Y+P  KWW  GF++S
Sbjct  408  APPLLAALSLAFFSNLFGSTTHYGSGAAPVFFGAGYIPQGKWWSIGFILS  457



>ref|WP_010330322.1| 2-oxoglutarate translocator [Bacillus vallismortis]
Length=478

 Score =   151 bits (382),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 92/170 (54%), Positives = 123/170 (72%), Gaps = 2/170 (1%)
 Frame = -3

Query  734  WVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGYLNKYG  555
            W+FG    IDA T A++GL +LL++ V++W +   E  AWDTLTWFAAL+ +A +LN+ G
Sbjct  290  WIFGGSFKIDATTTALIGLAVLLLSQVLTWDDIKKEQGAWDTLTWFAALVMLANFLNELG  349

Query  554  LISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVASALG  375
            ++SWFS  +   V G   SW ++F IL+++YFYSHYFFAS  AHI AM++AFL+V  A G
Sbjct  350  MVSWFSNAMKSSVSGF--SWIVAFLILIVVYFYSHYFFASATAHISAMYSAFLAVIVAAG  407

Query  374  TPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
             PP L AL L+F SN+ G  THYG G+APVF+GA YVP +KWW  GF++S
Sbjct  408  APPLLAALSLAFFSNLFGSTTHYGAGAAPVFFGAGYVPQSKWWSIGFILS  457



>ref|WP_040998492.1| 2-oxoglutarate translocator [Chryseobacterium oranimense]
 emb|CEJ71319.1| Putative malate transporter YflS [Chryseobacterium oranimense 
G311]
Length=476

 Score =   151 bits (381),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 117/169 (69%), Gaps = 2/169 (1%)
 Frame = -3

Query  734  WVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGYLNKYG  555
            W+FG  L+IDA T A +GLT+LL+T V++W++   E  AWDT+ WFA L+ MA  LN+ G
Sbjct  288  WIFGGALSIDATTTAFIGLTMLLLTSVLTWEDIKGEKGAWDTIVWFAVLVMMASSLNELG  347

Query  554  LISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVASALG  375
             I WFS+ +   +GGL  SWQ++F +++++YF+SHY FAS  AH+ AM+ A L V  +LG
Sbjct  348  FIGWFSDLIKVKIGGL--SWQVAFPVIIVVYFFSHYIFASATAHVAAMYAALLGVGVSLG  405

Query  374  TPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLV  228
             PP L A++L FL +I G LTHYG G APVFYG+ YV L  WW  G  +
Sbjct  406  IPPMLLAMMLGFLGSIYGVLTHYGHGPAPVFYGSGYVELKAWWLRGLEI  454



>ref|WP_034730448.1| 2-oxoglutarate translocator [Chryseobacterium sp. JM1]
 gb|KFF17169.1| 2-oxoglutarate translocator [Chryseobacterium sp. JM1]
Length=476

 Score =   151 bits (381),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 117/169 (69%), Gaps = 2/169 (1%)
 Frame = -3

Query  734  WVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGYLNKYG  555
            W+FG  L+IDA T A +GLT+LL+T V++W++   E  AWDT+ WFA L+ MA  LN+ G
Sbjct  288  WIFGGALSIDATTTAFIGLTMLLLTSVLTWEDIKGEKGAWDTIVWFAVLVMMASSLNELG  347

Query  554  LISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVASALG  375
             I WFS+ +   +GGL  SWQ++F +++++YF+SHY FAS  AH+ AM+ A L V  +LG
Sbjct  348  FIGWFSDLIKVKIGGL--SWQVAFPVIIVVYFFSHYIFASATAHVAAMYAALLGVGVSLG  405

Query  374  TPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLV  228
             PP L A++L FL +I G LTHYG G APVFYG+ YV L  WW  G  +
Sbjct  406  IPPMLLAMMLGFLGSIYGVLTHYGHGPAPVFYGSGYVELKAWWLRGLEI  454



>ref|WP_015383080.1| MULTISPECIES: 2-oxoglutarate/malate transporter [Bacillus]
 gb|AGE62620.1| 2-oxoglutarate/malate transporter [Bacillus subtilis XF-1]
 gb|AGI28021.1| 2-oxoglutarate/malate transporter [Bacillus subtilis subsp. subtilis 
str. BAB-1]
 gb|ERI42751.1| 2-oxoglutarate translocator [Bacillus sp. EGD-AK10]
 gb|AID00435.1| 2-oxoglutarate translocator [Bacillus subtilis subsp. subtilis 
str. OH 131.1]
 emb|CCU59962.1| 2-oxoglutarate/malate translocator [Bacillus subtilis E1]
 gb|KFF56609.1| 2-oxoglutarate translocator [Bacillus subtilis]
 gb|KIN32357.1| hypothetical protein B4068_0716 [Bacillus subtilis]
 gb|KIN34108.1| hypothetical protein B4070_0771 [Bacillus subtilis]
 gb|KIN49661.1| hypothetical protein B4146_0798 [Bacillus subtilis]
 gb|KIN53365.1| hypothetical protein B4073_0722 [Bacillus subtilis]
 gb|KIO54969.1| hypothetical protein B4143_0730 [Bacillus subtilis]
 gb|AJO57407.1| 2-oxoglutarate translocator [Bacillus sp. YP1]
Length=478

 Score =   151 bits (381),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 91/170 (54%), Positives = 125/170 (74%), Gaps = 2/170 (1%)
 Frame = -3

Query  734  WVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGYLNKYG  555
            W+FG   NIDA T A++GL++LL++ V++W +   E  AWDTLTWFAAL+ +A +LN+ G
Sbjct  290  WIFGGSFNIDATTTALIGLSVLLLSQVLTWDDIKKEQGAWDTLTWFAALVMLANFLNELG  349

Query  554  LISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVASALG  375
            ++SWFS  +   V G   SW ++F IL+++Y+YSHYFFAS  AHI AM++AFL+V  A G
Sbjct  350  MVSWFSNAMKSSVSGF--SWIVAFIILIVVYYYSHYFFASATAHISAMYSAFLAVVVAAG  407

Query  374  TPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
             PP L AL L+F+SN+ G  THYG G+APVF+GA Y+P  KWW  GF++S
Sbjct  408  APPLLAALSLAFISNLFGSTTHYGSGAAPVFFGAGYIPQGKWWSIGFILS  457



>ref|WP_007408966.1| MULTISPECIES: 2-oxoglutarate translocator [Bacillales]
 gb|ABS73157.1| YflS [Bacillus amyloliquefaciens subsp. plantarum str. FZB42]
 emb|CCG48710.1| Citrate carrier Citrate transporter [Bacillus amyloliquefaciens 
subsp. plantarum YAU B9601-Y2]
 gb|EIF12295.1| 2-oxoglutarate/malate translocator [Bacillus sp. 5B6]
 gb|AFJ60820.1| divalent anion:Na+ symporter, DASS family [Bacillus amyloliquefaciens 
Y2]
 gb|EJD67601.1| YflS [Bacillus sp. 916]
 gb|AFZ89764.1| divalent anion:Na+ symporter, DASS family protein [Bacillus amyloliquefaciens 
subsp. plantarum AS43.3]
 emb|CDG28718.1| 2-oxoglutarate/malate transporter [Bacillus amyloliquefaciens 
subsp. plantarum UCMB5033]
 emb|CDG25023.1| 2-oxoglutarate/malate transporter [Bacillus amyloliquefaciens 
subsp. plantarum UCMB5113]
 gb|ERH50988.1| 2-oxoglutarate translocator [Bacillus amyloliquefaciens EGD-AQ14]
 emb|CDH94478.1| Citrate carrier [Bacillus amyloliquefaciens subsp. plantarum 
NAU-B3]
 gb|AGZ55461.1| 2-oxoglutarate/malate translocator [Bacillus amyloliquefaciens 
CC178]
 gb|AHK48341.1| 2-oxoglutarate translocator [Bacillus amyloliquefaciens subsp. 
plantarum TrigoCor1448]
 gb|EYB35514.1| 2-oxoglutarate translocator [Bacillus amyloliquefaciens EBL11]
 gb|AHZ14735.1| Citrate carrier Citrate transporter [Bacillus amyloliquefaciens 
SQR9]
 gb|KFI14833.1| 2-oxoglutarate translocator [Bacillus subtilis]
 gb|KFX40261.1| 2-oxoglutarate translocator [Bacillus amyloliquefaciens]
 gb|AIU80898.1| Putative malate transporter YflS [Bacillus methylotrophicus]
 gb|AIW29039.1| 2-oxoglutarate translocator [Bacillus subtilis]
 gb|AIW36630.1| 2-oxoglutarate translocator [Bacillus subtilis]
 gb|AJE77762.1| 2-oxoglutarate translocator [Bacillus sp. BH072]
 gb|KIR06440.1| 2-oxoglutarate translocator [Bacillus amyloliquefaciens subsp. 
plantarum]
 gb|KJD58150.1| 2-oxoglutarate translocator [Bacillus amyloliquefaciens]
Length=478

 Score =   151 bits (381),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 129/176 (73%), Gaps = 2/176 (1%)
 Frame = -3

Query  752  LITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAG  573
            L+ + LW+FG  LNIDA T A++GL++LL++ V++W++   E  AWDTLTWFAAL+ +A 
Sbjct  284  LLVLALWIFGGSLNIDATTTALIGLSVLLLSQVLTWEDIKKEQGAWDTLTWFAALVMLAN  343

Query  572  YLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLS  393
            +LN+ G++SWFS  +   V G   SW ++F IL+++Y+Y+HYFFAS  AHI AM+ AFL+
Sbjct  344  FLNELGMVSWFSNMMKSSVSGF--SWIVAFMILIVVYYYTHYFFASATAHISAMYAAFLA  401

Query  392  VASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            V  A G PP L AL L+F SN+ G  THYG G+APVF+GA Y+  +KWW  GF++S
Sbjct  402  VIVAAGAPPLLAALSLAFFSNLFGSTTHYGSGAAPVFFGAGYISQSKWWSIGFILS  457



>ref|WP_024572847.1| 2-oxoglutarate translocator [Bacillus subtilis]
 gb|KIU10460.1| 2-oxoglutarate/malate transporter [Bacillus subtilis]
Length=478

 Score =   151 bits (381),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 91/170 (54%), Positives = 125/170 (74%), Gaps = 2/170 (1%)
 Frame = -3

Query  734  WVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGYLNKYG  555
            W+FG   NIDA T A++GL++LL++ V++W +   E  AWDTLTWFAAL+ +A +LN+ G
Sbjct  290  WIFGGSFNIDATTTALIGLSVLLLSQVLTWDDIKKEQGAWDTLTWFAALVMLANFLNELG  349

Query  554  LISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVASALG  375
            ++SWFS  +   V G   SW ++F IL+++Y+YSHYFFAS  AHI AM++AFL+V  A G
Sbjct  350  MVSWFSNAMKSSVSGF--SWIVAFIILIVVYYYSHYFFASATAHISAMYSAFLAVVVAAG  407

Query  374  TPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
             PP L AL L+F+SN+ G  THYG G+APVF+GA Y+P  KWW  GF++S
Sbjct  408  APPLLAALSLAFISNLFGSTTHYGSGAAPVFFGAGYIPQGKWWSIGFILS  457



>ref|WP_013351349.1| MULTISPECIES: 2-oxoglutarate translocator [Bacillus subtilis 
group]
 emb|CBI41844.1| 2-oxoglutarate/malate transporter [Bacillus amyloliquefaciens 
DSM 7]
 gb|AEB22862.1| 2-oxoglutarate/malate transporter [Bacillus amyloliquefaciens 
TA208]
 gb|AEB62315.1| 2-oxoglutarate/malate transporter [Bacillus amyloliquefaciens 
LL3]
 gb|AEK87860.1| 2-oxoglutarate/malate transporter [Bacillus amyloliquefaciens 
XH7]
 gb|AIW32753.1| 2-oxoglutarate translocator [Bacillus subtilis]
Length=478

 Score =   151 bits (381),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 129/176 (73%), Gaps = 2/176 (1%)
 Frame = -3

Query  752  LITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAG  573
            L+ + LW+FG  LNIDA T A++GL++LL++ V++W++   E  AWDTLTWFAAL+ +A 
Sbjct  284  LLVLALWIFGGSLNIDATTTALIGLSVLLLSQVLTWEDIKKEQGAWDTLTWFAALVMLAN  343

Query  572  YLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLS  393
            +LN+ G++SWFS  +   V G   SW ++F IL+++Y+Y+HYFFAS  AHI AM+ AFL+
Sbjct  344  FLNELGMVSWFSNMMKSSVSGF--SWIVAFMILIVVYYYTHYFFASATAHISAMYAAFLA  401

Query  392  VASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            V  A G PP L AL L+F SN+ G  THYG G+APVF+GA Y+  +KWW  GF++S
Sbjct  402  VIVAAGAPPLLAALSLAFFSNLFGSTTHYGSGAAPVFFGAGYISQSKWWSIGFILS  457



>ref|WP_020370215.1| MULTISPECIES: sodium:sulfate symporter transmembrane region family 
protein [Chlamydia]
 gb|EPP35555.1| sodium:sulfate symporter transmembrane region family protein 
[Chlamydia psittaci 10_1398_11]
 gb|EQM62783.1| Sodium:sulfate symporter [Chlamydia ibidis 10-1398/6]
Length=470

 Score =   151 bits (381),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 122/177 (69%), Gaps = 3/177 (2%)
 Frame = -3

Query  752  LITVGLWVFGSVLNIDavtaailgltillvtgvVSW-KECLSEAVAWDTLTWFAALIAMA  576
            ++ V LW FG VL I A TAA++GL++L++T ++ W K+ ++   AW+T  WF ALI MA
Sbjct  275  ILLVVLWTFGDVLRISATTAALIGLSLLILTNILDWQKDVIANTTAWETFIWFGALIMMA  334

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
             +LN+ G I    E+V   V GL  SW++ F IL L+YFYSHY FAS  AHIGAM+  FL
Sbjct  335  SFLNQLGFIPLIGESVATAVSGL--SWKIGFPILFLIYFYSHYLFASNTAHIGAMYPVFL  392

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            +V+ +LGT P    LVL+F SN+ GGLTHYG G AP+++G+  V + +WW  GF++S
Sbjct  393  AVSVSLGTNPIFAVLVLAFSSNLFGGLTHYGSGPAPLYFGSQLVSVKEWWRSGFILS  449



>ref|WP_042634956.1| 2-oxoglutarate translocator [Bacillus amyloliquefaciens]
 gb|AJK64496.1| 2-oxoglutarate/malate transporter [Bacillus amyloliquefaciens 
subsp. amyloliquefaciens KHG19]
Length=478

 Score =   151 bits (381),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 129/176 (73%), Gaps = 2/176 (1%)
 Frame = -3

Query  752  LITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAG  573
            L+ + LW+FG  LNIDA T A++GL++LL++ V++W++   E  AWDTLTWFAAL+ +A 
Sbjct  284  LLVLALWIFGGSLNIDATTTALIGLSVLLLSQVLTWEDIKKEQGAWDTLTWFAALVMLAN  343

Query  572  YLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLS  393
            +LN+ G++SWFS  +   V G   SW ++F IL+++Y+Y+HYFFAS  AHI AM+ AFL+
Sbjct  344  FLNELGMVSWFSNMMKSSVSGF--SWIVAFMILIVVYYYTHYFFASATAHISAMYAAFLA  401

Query  392  VASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            V  A G PP L AL L+F SN+ G  THYG G+APVF+GA Y+  +KWW  GF++S
Sbjct  402  VIVAAGAPPLLAALSLAFFSNLFGSTTHYGSGAAPVFFGAGYISQSKWWSIGFILS  457



>ref|WP_026852457.1| 2-oxoglutarate translocator [Geothrix fermentans]
Length=461

 Score =   151 bits (381),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 93/172 (54%), Positives = 112/172 (65%), Gaps = 3/172 (2%)
 Frame = -3

Query  737  LWVFGS-VLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGYLNK  561
            LWV G     ID  TAA+LGL +LL+TGV++WK+ L E  AWD L W   LI MAG+LNK
Sbjct  271  LWVIGEKTFGIDGTTAALLGLALLLLTGVLTWKDVLEEHNAWDVLIWTGGLIMMAGFLNK  330

Query  560  YGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVASA  381
             G+I WFS+ V   + G G  W  +F +L L YFY+HYFFAS  AH GAM+ AFL VA  
Sbjct  331  LGMIPWFSKVVGASMAGHG--WHFAFIVLSLTYFYAHYFFASMTAHAGAMYAAFLGVALT  388

Query  380  LGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            LG PP L ALVL F SN+   +THYG G AP  +G  YVP+  WW  GF+ S
Sbjct  389  LGAPPMLAALVLCFFSNLHASMTHYGTGPAPAMFGLGYVPIGTWWRLGFIAS  440



>ref|WP_034704428.1| 2-oxoglutarate translocator [Chryseobacterium luteum]
 gb|KFF03840.1| 2-oxoglutarate translocator [Chryseobacterium luteum]
Length=476

 Score =   151 bits (381),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 117/169 (69%), Gaps = 2/169 (1%)
 Frame = -3

Query  734  WVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGYLNKYG  555
            W+FG  L++DA T A +GLT+LL+T V++W++   E  AWDT+ WFA L+ MA  LN+ G
Sbjct  288  WIFGGTLSVDATTTAFIGLTMLLLTSVLTWEDIKGEKGAWDTIVWFAVLVMMASSLNELG  347

Query  554  LISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVASALG  375
             I WFS+ +   +GGL  SWQ++F +++++YF+SHY FAS  AH+ AM+ A L V  +LG
Sbjct  348  FIGWFSDLIKVKIGGL--SWQIAFPVIIVVYFFSHYIFASATAHVAAMYAALLGVGVSLG  405

Query  374  TPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLV  228
             PP L A++L FL +I G LTHYG G APVFYG+ YV L  WW  G  +
Sbjct  406  IPPMLLAMMLGFLGSIYGVLTHYGHGPAPVFYGSGYVELKAWWLRGLEI  454



>ref|WP_041057032.1| 2-oxoglutarate translocator [Bacillus subtilis]
 gb|KIL30211.1| hypothetical protein B4067_0819 [Bacillus subtilis subsp. subtilis]
 gb|KIN58890.1| hypothetical protein B4145_0772 [Bacillus subtilis]
Length=478

 Score =   151 bits (381),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 91/170 (54%), Positives = 125/170 (74%), Gaps = 2/170 (1%)
 Frame = -3

Query  734  WVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGYLNKYG  555
            W+FG   NIDA T A++GL++LL++ V++W +   E  AWDTLTWFAAL+ +A +LN+ G
Sbjct  290  WIFGGSFNIDATTTALIGLSVLLLSQVLTWDDIKKEQGAWDTLTWFAALVMLANFLNELG  349

Query  554  LISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVASALG  375
            ++SWFS  +   V G   SW ++F IL+++Y+YSHYFFAS  AHI AM++AFL+V  A G
Sbjct  350  MVSWFSNAMKSSVSGF--SWIVAFIILIVVYYYSHYFFASATAHISAMYSAFLAVVVAAG  407

Query  374  TPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
             PP L AL L+F+SN+ G  THYG G+APVF+GA Y+P  KWW  GF++S
Sbjct  408  APPLLAALSLAFISNLFGSTTHYGSGAAPVFFGAGYIPQGKWWSIGFILS  457



>ref|WP_034745423.1| 2-oxoglutarate translocator [Chryseobacterium vrystaatense]
 gb|KFF25275.1| 2-oxoglutarate translocator [Chryseobacterium vrystaatense]
Length=476

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 117/169 (69%), Gaps = 2/169 (1%)
 Frame = -3

Query  734  WVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGYLNKYG  555
            W+FG  L+IDA T A +GLT+LL+T V++W++   E  AWDT+ WFA L+ MA  LN+ G
Sbjct  288  WIFGGALSIDATTTAFIGLTMLLLTSVLTWEDIKGEKGAWDTIVWFAVLVMMASSLNELG  347

Query  554  LISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVASALG  375
             I WFS+ +   +GGL  SWQ++F +++++YF+SHY FAS  AH+ AM+ A L V  +LG
Sbjct  348  FIGWFSDLIKVKIGGL--SWQVAFPVIIVVYFFSHYIFASATAHVAAMYAALLGVGVSLG  405

Query  374  TPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLV  228
             PP L A++L FL +I G LTHYG G APVFYG+ YV L  WW  G  +
Sbjct  406  IPPMLLAMMLGFLGSIYGVLTHYGHGPAPVFYGSGYVELKAWWLRGLEI  454



>ref|WP_025644633.1| MULTISPECIES: C4-dicarboxylate ABC transporter [Psychrobacter]
Length=485

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 95/142 (67%), Gaps = 0/142 (0%)
 Frame = -3

Query  650  SWKECLSEAVAWDTLTWFAALIAMAGYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILV  471
            +W++ L E  AWDT+ WF ALI MA YLN+ GLI WFS+ +  ++G  GL W  +  IL 
Sbjct  323  TWEDILKEKSAWDTIIWFGALIMMAAYLNELGLIRWFSDNIEAMIGTTGLGWVGAVAILT  382

Query  470  LLYFYSHYFFASGAAHIGAMFTAFLSVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSA  291
            L+Y Y HYFFAS  AHI A+F AF +V  +LG PP L AL+L+   NIM  LTHY  G+A
Sbjct  383  LVYLYIHYFFASTTAHITALFAAFYAVGLSLGAPPMLYALILAAAGNIMMTLTHYATGTA  442

Query  290  PVFYGANYVPLAKWWGYGFLVS  225
            PV + + YV L KWWG G ++S
Sbjct  443  PVIFNSGYVTLKKWWGIGAIMS  464



>gb|KGA69105.1| sulfate symporter transmembrane region family protein [Yersinia 
enterocolitica]
 gb|KGA76615.1| sulfate symporter transmembrane region family protein [Yersinia 
enterocolitica]
Length=221

 Score =   145 bits (366),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 83/173 (48%), Positives = 110/173 (64%), Gaps = 2/173 (1%)
 Frame = -3

Query  743  VGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGYLN  564
            V LWV G+ LNIDA   A +GL ILL++G ++W + ++E  AW T+ WFA L+ +A  LN
Sbjct  30   VTLWVCGAALNIDATMTAFIGLAILLLSGALTWDDVIAEKEAWHTVIWFAVLLTLASQLN  89

Query  563  KYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVAS  384
            K G ISWF  ++   V G+  +W    GIL+L Y+YSHY  AS  AHI AM+  F+S+A 
Sbjct  90   KLGFISWFGASIADSVQGM--NWVPMMGILLLAYYYSHYMMASAIAHISAMYAIFVSIAI  147

Query  383  ALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            A G PP L  LV    SN+    THY  G AP+ +G N++PLA WW  GFL+S
Sbjct  148  AAGAPPMLTVLVFGMFSNLYMATTHYSGGPAPILFGCNFIPLATWWKIGFLIS  200



>gb|KIN32538.1| hypothetical protein B4069_0846 [Bacillus subtilis]
 gb|KIN44477.1| hypothetical protein B4071_0845 [Bacillus subtilis]
 gb|KIN49092.1| hypothetical protein B4072_0842 [Bacillus subtilis]
Length=493

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 91/170 (54%), Positives = 125/170 (74%), Gaps = 2/170 (1%)
 Frame = -3

Query  734  WVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGYLNKYG  555
            W+FG   NIDA T A++GL++LL++ V++W +   E  AWDTLTWFAAL+ +A +LN+ G
Sbjct  305  WIFGGSFNIDATTTALIGLSVLLLSQVLTWDDIKKEQGAWDTLTWFAALVMLANFLNELG  364

Query  554  LISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVASALG  375
            ++SWFS  +   V G   SW ++F IL+++Y+YSHYFFAS  AHI AM++AFL+V  A G
Sbjct  365  MVSWFSNAMKSSVSGF--SWIVAFIILIVVYYYSHYFFASATAHISAMYSAFLAVVVAAG  422

Query  374  TPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
             PP L AL L+F+SN+ G  THYG G+APVF+GA Y+P  KWW  GF++S
Sbjct  423  APPLLAALSLAFISNLFGSTTHYGSGAAPVFFGAGYIPQGKWWSIGFILS  472



>ref|WP_003685739.1| C4-dicarboxylate ABC transporter [Neisseria flavescens]
 gb|EER56025.1| transporter, DASS family [Neisseria flavescens SK114]
Length=475

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 96/142 (68%), Gaps = 0/142 (0%)
 Frame = -3

Query  650  SWKECLSEAVAWDTLTWFAALIAMAGYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILV  471
            +W + L E  AWDT+ WFAAL+ MA +LNK GLI+W SE++   +  +GLSW+    +L+
Sbjct  321  TWDDALKEKGAWDTIVWFAALVMMANFLNKLGLIAWLSESMQGGIAHMGLSWEAGCALLM  380

Query  470  LLYFYSHYFFASGAAHIGAMFTAFLSVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSA  291
            L Y Y+HY FASG AH+ AMF AF     ALG PP L ALV++  + IM  LTHY  GSA
Sbjct  381  LAYLYAHYVFASGTAHVTAMFGAFYGAGLALGAPPMLFALVMASATGIMMSLTHYATGSA  440

Query  290  PVFYGANYVPLAKWWGYGFLVS  225
            PV Y +NYV + +WW  GF++S
Sbjct  441  PVIYCSNYVTMTEWWKAGFIMS  462



>ref|WP_029103488.1| C4-dicarboxylate ABC transporter [Moraxella caprae]
Length=485

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 88/169 (52%), Positives = 114/169 (67%), Gaps = 0/169 (0%)
 Frame = -3

Query  731  VFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGYLNKYGL  552
            +FG  L +DA   A LGL+++++TGV++W + L E  AWDTL WF  LI MA YLNK GL
Sbjct  296  LFGDALAVDATAVAFLGLSVVILTGVLTWDDILKEKSAWDTLVWFGVLIMMATYLNKLGL  355

Query  551  ISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVASALGT  372
            I+WFS  +   + G+GL W  +  IL L+Y Y+HYFFAS  AHI AMF AF  V  ALG 
Sbjct  356  IAWFSGQIETAIVGMGLGWVGAMAILTLVYLYAHYFFASTTAHITAMFGAFYGVGLALGA  415

Query  371  PPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            PP L AL+L+  S++M  LTHY  G+APV +GA YV L +WW  G ++S
Sbjct  416  PPMLYALILAASSSLMMTLTHYATGTAPVIFGAGYVSLGQWWKVGAVMS  464



>ref|WP_003714648.1| C4-dicarboxylate ABC transporter [Neisseria lactamica]
 emb|CBX23119.1| unnamed protein product [Neisseria lactamica Y92-1009]
Length=483

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 95/142 (67%), Gaps = 0/142 (0%)
 Frame = -3

Query  650  SWKECLSEAVAWDTLTWFAALIAMAGYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILV  471
            +W + L E  AWDT+ WFAAL+ MA +LNK GLI W SE++   +  LGL W+    +L+
Sbjct  321  TWDDALKEKSAWDTIVWFAALVMMANFLNKLGLIGWLSESMQSGIAHLGLGWEAGCALLM  380

Query  470  LLYFYSHYFFASGAAHIGAMFTAFLSVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSA  291
            L Y Y+HY FASG AH+ AMF AF     ALG PP L AL+++  + IM  LTHY  GSA
Sbjct  381  LAYLYAHYVFASGTAHVTAMFGAFYGAGLALGAPPMLFALMMAAATGIMMSLTHYATGSA  440

Query  290  PVFYGANYVPLAKWWGYGFLVS  225
            PV YG+NYV + +WW  GF++S
Sbjct  441  PVIYGSNYVNMGEWWKAGFIMS  462



>ref|XP_002525819.1| 2-oxoglutarate/malate translocator, chloroplast precursor, putative 
[Ricinus communis]
 gb|EEF36513.1| 2-oxoglutarate/malate translocator, chloroplast precursor, putative 
[Ricinus communis]
Length=337

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 118/177 (67%), Gaps = 0/177 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            +L+ V LWVFG  L I +V  A++GL+ILL+ GV+ W +CLSE  AWDTL WFA L+ MA
Sbjct  140  MLLAVSLWVFGDALGIPSVVTAMIGLSILLLLGVLDWDDCLSEKSAWDTLAWFAVLVGMA  199

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            G L   G+++W S+ V K +  L LSW  +FG+L   YF+ HY FAS   H+GA+++AFL
Sbjct  200  GQLTNLGIVTWMSDCVAKSLQSLSLSWPAAFGVLQASYFFIHYLFASQTGHVGALYSAFL  259

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            ++  A G P  L AL L++ +N+ G +THY  G A V+YGA YV L   +  GF+++
Sbjct  260  AMHLAAGVPGVLAALALAYNTNLFGAITHYSSGQAAVYYGAGYVDLPDVFKMGFVIA  316



>ref|WP_003751723.1| C4-dicarboxylate ABC transporter [Neisseria polysaccharea]
 gb|EFH23089.1| transporter, DASS family [Neisseria polysaccharea ATCC 43768]
Length=483

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 95/142 (67%), Gaps = 0/142 (0%)
 Frame = -3

Query  650  SWKECLSEAVAWDTLTWFAALIAMAGYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILV  471
            +W + L E  AWDT+ WFAAL+ MA +LNK GLI W SE++   +  LGL W+    +L+
Sbjct  321  TWDDALKEKSAWDTIVWFAALVMMANFLNKLGLIGWLSESMQSGIAHLGLGWEAGCALLM  380

Query  470  LLYFYSHYFFASGAAHIGAMFTAFLSVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSA  291
            L Y Y+HY FASG AH+ AMF AF     ALG PP L AL+++  + IM  LTHY  GSA
Sbjct  381  LAYLYAHYVFASGTAHVTAMFGAFYGAGLALGAPPMLFALMMAAATGIMMSLTHYATGSA  440

Query  290  PVFYGANYVPLAKWWGYGFLVS  225
            PV YG+NYV + +WW  GF++S
Sbjct  441  PVIYGSNYVNMGEWWKAGFIMS  462



>ref|WP_044163592.1| 2-oxoglutarate translocator [Salinibacillus aidingensis]
Length=478

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 128/176 (73%), Gaps = 2/176 (1%)
 Frame = -3

Query  752  LITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAG  573
            L+ + LW+FG   NIDA T A++GL++LL++ V++W +   E  AWDTLTWFAAL+ +A 
Sbjct  284  LLVLALWIFGGSFNIDATTTALIGLSVLLLSQVLTWDDIKKEQGAWDTLTWFAALVMLAN  343

Query  572  YLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLS  393
            +LN+ G++SWFS  +   V G   SW ++F IL+++Y+YSHYFFAS  AHI AM++AFL+
Sbjct  344  FLNELGMVSWFSNAMKSSVSGF--SWIVAFIILIVVYYYSHYFFASATAHISAMYSAFLA  401

Query  392  VASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            V  A G PP L AL L+F+SN+ G  THYG G+APVF+GA Y+   KWW  GF++S
Sbjct  402  VVVAAGAPPLLAALSLAFISNLFGSTTHYGSGAAPVFFGAGYISQGKWWSIGFILS  457



>ref|WP_034727777.1| 2-oxoglutarate translocator [Bacteriovorax sp. BSW11_IV]
Length=475

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 88/170 (52%), Positives = 113/170 (66%), Gaps = 2/170 (1%)
 Frame = -3

Query  734  WVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGYLNKYG  555
            W+ G  L I+A T AI GL ILL++GV++W++  SE  AWDTL WF  L+ MA +LNK G
Sbjct  287  WILGGTLGINATTTAIAGLAILLISGVLNWEDVKSEKGAWDTLIWFGILVMMADFLNKLG  346

Query  554  LISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVASALG  375
             I WFS  + K +GG   +W L+F  L+L+YFYSHY FAS  AH+ AM  AF+ V   +G
Sbjct  347  FIPWFSALIAKEMGGH--AWTLAFPALLLIYFYSHYMFASATAHVTAMAAAFMGVGITVG  404

Query  374  TPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
             PPYL A+ L F SN+ G  THYG+G APV +G+ YV L  WW  GF +S
Sbjct  405  VPPYLMAISLGFFSNLFGSTTHYGMGPAPVLFGSGYVELTDWWKLGFYLS  454



>gb|EQC49451.1| transporter, DASS family [Bacteriovorax sp. BSW11_IV]
Length=474

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 88/170 (52%), Positives = 113/170 (66%), Gaps = 2/170 (1%)
 Frame = -3

Query  734  WVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGYLNKYG  555
            W+ G  L I+A T AI GL ILL++GV++W++  SE  AWDTL WF  L+ MA +LNK G
Sbjct  286  WILGGTLGINATTTAIAGLAILLISGVLNWEDVKSEKGAWDTLIWFGILVMMADFLNKLG  345

Query  554  LISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVASALG  375
             I WFS  + K +GG   +W L+F  L+L+YFYSHY FAS  AH+ AM  AF+ V   +G
Sbjct  346  FIPWFSALIAKEMGGH--AWTLAFPALLLIYFYSHYMFASATAHVTAMAAAFMGVGITVG  403

Query  374  TPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
             PPYL A+ L F SN+ G  THYG+G APV +G+ YV L  WW  GF +S
Sbjct  404  VPPYLMAISLGFFSNLFGSTTHYGMGPAPVLFGSGYVELTDWWKLGFYLS  453



>ref|WP_013448646.1| C4-dicarboxylate ABC transporter [Neisseria lactamica]
 emb|CBN86900.1| putative integral membrane transport protein [Neisseria lactamica 
020-06]
Length=483

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 95/142 (67%), Gaps = 0/142 (0%)
 Frame = -3

Query  650  SWKECLSEAVAWDTLTWFAALIAMAGYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILV  471
            +W + L E  AWDT+ WFAAL+ MA +LNK GLI W SE++   +  LGL W+    +L+
Sbjct  321  TWDDALKEKSAWDTIVWFAALVMMANFLNKLGLIGWLSESMQSGIAHLGLGWEAGCALLM  380

Query  470  LLYFYSHYFFASGAAHIGAMFTAFLSVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSA  291
            L Y Y+HY FASG AH+ AMF AF     ALG PP L AL+++  + IM  LTHY  GSA
Sbjct  381  LAYLYAHYVFASGTAHVTAMFGAFYGAGLALGAPPMLFALMMAAATGIMMSLTHYATGSA  440

Query  290  PVFYGANYVPLAKWWGYGFLVS  225
            PV YG+NYV + +WW  GF++S
Sbjct  441  PVIYGSNYVNMGEWWKAGFIMS  462



>ref|WP_011097177.1| 2-oxoglutarate translocator [Chlamydophila abortus]
 emb|CAH64028.1| putative sodium:sulfate symporter [Chlamydophila abortus S26/3]
 emb|CED80633.1| putative sodium:sulfate symporter [Chlamydophila abortus]
Length=470

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 88/174 (51%), Positives = 119/174 (68%), Gaps = 3/174 (2%)
 Frame = -3

Query  743  VGLWVFGSVLNIDavtaailgltillvtgvVSW-KECLSEAVAWDTLTWFAALIAMAGYL  567
            V LW FG +L I A TAA++GL++L++T ++ W K+ ++   AW+T  WF ALI MA +L
Sbjct  278  VVLWTFGDLLRISATTAALIGLSLLILTNILDWHKDVMANTTAWETFIWFGALIMMASFL  337

Query  566  NKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVA  387
            N+ G I    ++V    G  GLSW++ F IL L+YFYSHY FAS  AHIGAMF  FL+V+
Sbjct  338  NQLGFIPLIGDSVAA--GVAGLSWKIGFPILFLMYFYSHYLFASNTAHIGAMFPVFLAVS  395

Query  386  SALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
             ALGT P    LVL+F SN+ GGLTHYG G AP+++G+  V +  WW  GF++S
Sbjct  396  IALGTNPIFACLVLAFSSNLFGGLTHYGSGPAPLYFGSQLVSIKDWWQSGFILS  449



>ref|WP_025126065.1| 2-oxoglutarate translocator [Myroides odoratimimus]
Length=476

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 84/175 (48%), Positives = 117/175 (67%), Gaps = 2/175 (1%)
 Frame = -3

Query  752  LITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAG  573
            +I + LW+ G + +ID+ T A +GL ILL+T V++W +  +E  AWDT+ WFA L+ MA 
Sbjct  282  VILLALWITGDLFSIDSTTTAFIGLAILLLTSVLTWDDVKAEKGAWDTIVWFAVLVMMAS  341

Query  572  YLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLS  393
             LNK G I WFS+ V   +G +   W  +F I+V++YF+SHY FAS  AH+ AM+ A L 
Sbjct  342  SLNKLGFIGWFSDLVKGKMGDM--DWHYAFPIIVIVYFFSHYIFASATAHVAAMYAALLG  399

Query  392  VASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLV  228
            V  +LG PP L A++L F+ +I G LTHYG G APVF+G+ YV L  WW YG ++
Sbjct  400  VGVSLGVPPVLLAMMLGFMGSIYGTLTHYGHGPAPVFFGSGYVELKSWWTYGLII  454



>ref|WP_003766241.1| C4-dicarboxylate ABC transporter [Neisseria sicca]
 gb|EIG28345.1| transporter, DASS family [Neisseria sicca VK64]
Length=483

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 96/142 (68%), Gaps = 0/142 (0%)
 Frame = -3

Query  650  SWKECLSEAVAWDTLTWFAALIAMAGYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILV  471
            +W + L E  AWDT+ WFAAL+ MA +LNK GLI+W SE++   +  LGL W+    +LV
Sbjct  321  TWDDALKEKGAWDTIVWFAALVMMANFLNKLGLIAWLSESMQGGISHLGLGWEAGCALLV  380

Query  470  LLYFYSHYFFASGAAHIGAMFTAFLSVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSA  291
            L Y Y+HY FASG AH+ AMF AF     ALG PP L AL+++  + IM  LTHY  GS+
Sbjct  381  LAYLYAHYVFASGTAHVTAMFGAFYGAGLALGAPPMLFALIMASATGIMMSLTHYASGSS  440

Query  290  PVFYGANYVPLAKWWGYGFLVS  225
            PV YG+NYV + +WW  GF++S
Sbjct  441  PVIYGSNYVSMTEWWKAGFIMS  462



>ref|WP_006258443.1| MULTISPECIES: 2-oxoglutarate translocator [Myroides]
 gb|EHO07438.1| divalent anion:Na+ symporter (DASS) family transporter [Myroides 
odoratimimus CCUG 12901]
 gb|EHO08827.1| divalent anion:Na+ symporter (DASS) family transporter [Myroides 
odoratimimus CIP 101113]
 gb|EHO09677.1| divalent anion:Na+ symporter (DASS) family transporter [Myroides 
odoratimimus CCUG 10230]
 gb|EKB05428.1| divalent anion:Na+ symporter (DASS) family transporter [Myroides 
odoratimimus CCUG 3837]
 gb|EPH13782.1| DASS family divalent anion:Na+ symporter [Myroides odoratimimus 
CCUG 12700]
 gb|AJA70758.1| anion transporter [Myroides sp. A21]
 gb|AJH15664.1| divalent anion:Na+ symporter, DASS family [Myroides profundi]
Length=476

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 85/175 (49%), Positives = 117/175 (67%), Gaps = 2/175 (1%)
 Frame = -3

Query  752  LITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAG  573
            +I + LW+ G + +IDA T A +GL ILL+T V++W +  +E  AWDT+ WFA L+ MA 
Sbjct  282  VILLALWITGDLFSIDATTTAFIGLAILLLTSVLTWDDVKAEKGAWDTIVWFAVLVMMAS  341

Query  572  YLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLS  393
             LNK G I WFS+ V   +G +   W  +F I+V++YF+SHY FAS  AH+ AM+ A L 
Sbjct  342  SLNKLGFIGWFSDLVKGKMGDM--DWHYAFPIIVIVYFFSHYIFASATAHVAAMYAALLG  399

Query  392  VASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLV  228
            V  +LG PP L A++L F+ +I G LTHYG G APVF+G+ YV L  WW YG ++
Sbjct  400  VGVSLGVPPVLLAMMLGFMGSIYGTLTHYGHGPAPVFFGSGYVELKSWWTYGLII  454



>ref|WP_003777396.1| C4-dicarboxylate ABC transporter [Neisseria macacae]
 gb|EGQ77475.1| DASS family divalent anion:sodium (Na+) symporter [Neisseria 
macacae ATCC 33926]
Length=483

 Score =   150 bits (378),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 96/142 (68%), Gaps = 0/142 (0%)
 Frame = -3

Query  650  SWKECLSEAVAWDTLTWFAALIAMAGYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILV  471
            +W + L E  AWDT+ WFAAL+ MA +LNK GLI+W SE++   +  LGL W+    +LV
Sbjct  321  TWDDALKEKGAWDTIVWFAALVMMANFLNKLGLIAWLSESMQGGISHLGLGWEAGCALLV  380

Query  470  LLYFYSHYFFASGAAHIGAMFTAFLSVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSA  291
            L Y Y+HY FASG AH+ AMF AF     ALG PP L AL+++  + IM  LTHY  GS+
Sbjct  381  LAYLYAHYVFASGTAHVTAMFGAFYGAGLALGAPPMLFALIMASATGIMMSLTHYASGSS  440

Query  290  PVFYGANYVPLAKWWGYGFLVS  225
            PV YG+NYV + +WW  GF++S
Sbjct  441  PVIYGSNYVSMTEWWKAGFIMS  462



>ref|XP_001753146.1| predicted protein [Physcomitrella patens]
 gb|EDQ82187.1| predicted protein [Physcomitrella patens]
Length=443

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 88/173 (51%), Positives = 117/173 (68%), Gaps = 0/173 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            +L+ V LWVFG  L I +V +A+LGL ILL+ GV++W +CLSE  AWDTLTWFA L+ MA
Sbjct  246  MLLAVTLWVFGETLGIASVVSAMLGLCILLLVGVLNWDDCLSEKSAWDTLTWFAVLVGMA  305

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            G L+  GL+ W S+ V K +    LSW  +FG+L   YF SHY FAS   H+GA+++AFL
Sbjct  306  GNLSSLGLVKWMSDAVAKTLASYSLSWPAAFGVLQGTYFVSHYLFASQTGHVGALYSAFL  365

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYG  237
            ++  A G P  L AL L+F +N+ GGLTHY  G A V++G+ YV L   + YG
Sbjct  366  AMHIASGVPTILAALALAFNTNLFGGLTHYSSGQAAVYFGSGYVELKDVFKYG  418



>ref|WP_032858509.1| 2-oxoglutarate translocator [Bacillus amyloliquefaciens]
 gb|KDN91710.1| 2-oxoglutarate translocator [Bacillus amyloliquefaciens]
Length=478

 Score =   150 bits (378),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 91/176 (52%), Positives = 128/176 (73%), Gaps = 2/176 (1%)
 Frame = -3

Query  752  LITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAG  573
            L+ + LW+FG   NIDA T A++GL++LL++ V++W++   E  AWDTLTWFAAL+ +A 
Sbjct  284  LLVLALWIFGGSFNIDATTTALIGLSVLLLSQVLTWEDIKKEQGAWDTLTWFAALVMLAN  343

Query  572  YLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLS  393
            +LN+ G++SWFS  +   V G   SW ++F IL+++Y+Y+HYFFAS  AHI AM+ AFL+
Sbjct  344  FLNELGMVSWFSNMMKSSVSGF--SWIVAFMILIVVYYYTHYFFASATAHISAMYAAFLA  401

Query  392  VASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            V  A G PP L AL L+F SN+ G  THYG G+APVF+GA Y+  +KWW  GF++S
Sbjct  402  VIVAAGAPPLLAALSLAFFSNLFGSTTHYGSGAAPVFFGAGYISQSKWWSIGFILS  457



>ref|WP_019270868.1| C4-dicarboxylate ABC transporter [Neisseria sicca]
Length=483

 Score =   150 bits (378),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 96/142 (68%), Gaps = 0/142 (0%)
 Frame = -3

Query  650  SWKECLSEAVAWDTLTWFAALIAMAGYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILV  471
            +W + L E  AWDT+ WFAAL+ MA +LNK GLI+W SE++   +  LGL W+    +LV
Sbjct  321  TWDDALKEKGAWDTIVWFAALVMMANFLNKLGLIAWLSESLQGGISHLGLGWEAGCALLV  380

Query  470  LLYFYSHYFFASGAAHIGAMFTAFLSVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSA  291
            L Y Y+HY FASG AH+ AMF AF     ALG PP L AL+++  + IM  LTHY  GS+
Sbjct  381  LAYLYAHYVFASGTAHVTAMFGAFYGAGLALGAPPMLFALIMASATGIMMSLTHYASGSS  440

Query  290  PVFYGANYVPLAKWWGYGFLVS  225
            PV YG+NYV + +WW  GF++S
Sbjct  441  PVIYGSNYVSMTEWWKAGFIMS  462



>ref|WP_011457948.1| 2-oxoglutarate translocator [Chlamydophila felis]
 dbj|BAE81168.1| dicarboxylase translocator [Chlamydophila felis Fe/C-56]
Length=470

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 122/177 (69%), Gaps = 3/177 (2%)
 Frame = -3

Query  752  LITVGLWVFGSVLNIDavtaailgltillvtgvVSW-KECLSEAVAWDTLTWFAALIAMA  576
            ++ V LW FG +L I A TAA++GL++L++T ++ W K+ ++   AW+T  WF ALI MA
Sbjct  275  ILLVVLWTFGDLLRISATTAALIGLSLLILTNILDWHKDVMANTTAWETFIWFGALIMMA  334

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
             +LN+ G I    ++V   V GL  SW++ F IL L+YFYSHY FAS  AHIGAMF  FL
Sbjct  335  SFLNQLGFIPLVGDSVAAAVSGL--SWKVGFPILFLMYFYSHYLFASNTAHIGAMFPVFL  392

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            +V+ +LGT P    LVL+F SN+ GGLTHYG G AP+++G+  V + +WW  GF++S
Sbjct  393  AVSISLGTNPIFACLVLAFSSNLFGGLTHYGSGPAPLYFGSQLVSVKEWWRSGFILS  449



>ref|WP_043925701.1| 2-oxoglutarate translocator [Bacillus licheniformis]
 gb|EWH23105.1| 2-oxoglutarate translocator [Bacillus licheniformis S 16]
Length=478

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 127/176 (72%), Gaps = 2/176 (1%)
 Frame = -3

Query  752  LITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAG  573
            L+ + LW+FG  +NIDA T A++GL +LL+T V++W +   E  AWDTLTWFAAL+ +A 
Sbjct  284  LLVLFLWIFGGNMNIDATTTALIGLAVLLLTQVLTWDDIKKEQGAWDTLTWFAALVMLAS  343

Query  572  YLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLS  393
            +LN+ G++ WFS+ +   V G   SW  +F IL+++Y+YSHYFFAS  AHI AM++AFL+
Sbjct  344  FLNELGMVGWFSDAMKSYVSGF--SWVSAFLILIVVYYYSHYFFASATAHISAMYSAFLA  401

Query  392  VASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            V  A G PP L AL L+F SN+    THYG G+APVF+GA Y+P +KWW  GF++S
Sbjct  402  VIIAAGAPPLLAALNLAFFSNLFASTTHYGAGAAPVFFGAGYIPQSKWWSIGFILS  457



>ref|WP_003155645.1| MULTISPECIES: 2-oxoglutarate translocator [Bacillus subtilis 
group]
 emb|CCF04276.1| Citrate carrier Citrate transporter [Bacillus amyloliquefaciens 
subsp. plantarum CAU B946]
 gb|EKE46374.1| Citrate carrier Citrate transporter [Bacillus amyloliquefaciens 
subsp. plantarum M27]
 gb|AGF28678.1| Citrate carrier Citrate transporter [Bacillus amyloliquefaciens 
IT-45]
 gb|ERK81651.1| 2-oxoglutarate translocator [Bacillus amyloliquefaciens UASWS 
BA1]
 gb|AHC41276.1| 2-oxoglutarate translocator [Bacillus amyloliquefaciens LFB112]
 gb|AIU76127.1| 2-oxoglutarate translocator [Bacillus subtilis]
Length=478

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 91/176 (52%), Positives = 128/176 (73%), Gaps = 2/176 (1%)
 Frame = -3

Query  752  LITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAG  573
            L+ + LW+FG   NIDA T A++GL++LL++ V++W++   E  AWDTLTWFAAL+ +A 
Sbjct  284  LLVLALWIFGGSFNIDATTTALIGLSVLLLSQVLTWEDIKKEQGAWDTLTWFAALVMLAN  343

Query  572  YLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLS  393
            +LN+ G++SWFS  +   V G   SW ++F IL+++Y+Y+HYFFAS  AHI AM+ AFL+
Sbjct  344  FLNELGMVSWFSNMMKSSVSGF--SWIVAFMILIVVYYYTHYFFASATAHISAMYAAFLA  401

Query  392  VASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            V  A G PP L AL L+F SN+ G  THYG G+APVF+GA Y+  +KWW  GF++S
Sbjct  402  VIVAAGAPPLLAALSLAFFSNLFGSTTHYGSGAAPVFFGAGYISQSKWWSIGFILS  457



>gb|AHN27693.1| 2-oxoglutarate/malate translocator [Snodgrassella alvi wkB2]
 gb|KEQ00805.1| Di- and tricarboxylate transporter [Snodgrassella alvi SCGC AB-598-J21]
Length=488

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 96/141 (68%), Gaps = 0/141 (0%)
 Frame = -3

Query  647  WKECLSEAVAWDTLTWFAALIAMAGYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVL  468
            W + L E  AWDT+TWFAAL+ MA +LNK GLI WFS  +   +GGLG+ W  +  +L+L
Sbjct  327  WDDILKEKSAWDTITWFAALVMMATFLNKLGLIKWFSGVLESSIGGLGMGWMGACALLLL  386

Query  467  LYFYSHYFFASGAAHIGAMFTAFLSVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAP  288
             Y Y+HY FAS  AHI AMF AF S   ALG PP L AL+++  S+IM  LTHY  G++P
Sbjct  387  AYMYAHYMFASTTAHITAMFAAFYSAGLALGAPPMLFALMMAAASSIMMTLTHYATGTSP  446

Query  287  VFYGANYVPLAKWWGYGFLVS  225
            V +G+ YV L +WW  GF++S
Sbjct  447  VIFGSGYVTLGEWWKVGFIMS  467



>ref|WP_039367064.1| 2-oxoglutarate translocator [Chryseobacterium taiwanense]
 gb|KIC63511.1| 2-oxoglutarate translocator [Chryseobacterium taiwanense]
Length=476

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 118/169 (70%), Gaps = 2/169 (1%)
 Frame = -3

Query  734  WVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGYLNKYG  555
            W+FG  L+IDA T A +GLT+LL+T V++W++  SE  AWDT+ WFA L+ MA  LN+ G
Sbjct  288  WIFGGALSIDATTTAFIGLTLLLLTSVLTWEDVKSEKGAWDTIVWFAVLVMMASSLNELG  347

Query  554  LISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVASALG  375
             I WFS+ +   +GG+  +W ++F ++VL+YF+SHY FAS  AH+ AM+ A LSV  A+G
Sbjct  348  FIGWFSDLIKAEIGGM--TWTIAFPVIVLVYFFSHYIFASATAHVAAMYAALLSVGVAVG  405

Query  374  TPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLV  228
             PP L A++L FL +I G LTHYG G APVF+G+ YV L  WW  G  +
Sbjct  406  IPPMLLAMMLGFLGSIYGVLTHYGHGPAPVFFGSGYVDLKAWWLRGLEI  454



>gb|EFE55095.1| transporter, DASS family [Providencia rettgeri DSM 1131]
Length=494

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 96/142 (68%), Gaps = 0/142 (0%)
 Frame = -3

Query  650  SWKECLSEAVAWDTLTWFAALIAMAGYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILV  471
            +W + L    AWDT+ WF+AL+ MA +L K GLI W S TV   + GLG+SW     ILV
Sbjct  332  NWDDVLKNKGAWDTVVWFSALVMMASFLGKLGLIKWMSLTVGATIDGLGISWVWGMLILV  391

Query  470  LLYFYSHYFFASGAAHIGAMFTAFLSVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSA  291
            L+Y YSHYFFAS  AHI AM+ AF S   ALG PP L AL L+F S++M  LTHYG G+A
Sbjct  392  LIYVYSHYFFASTTAHITAMYAAFFSAGLALGAPPMLLALTLAFSSSLMMSLTHYGTGTA  451

Query  290  PVFYGANYVPLAKWWGYGFLVS  225
            P+ +G+ Y  LA+WW  GF++S
Sbjct  452  PIIFGSGYATLAEWWKTGFVMS  473



>ref|WP_025329952.1| C4-dicarboxylate ABC transporter [Snodgrassella alvi]
Length=484

 Score =   149 bits (377),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 96/141 (68%), Gaps = 0/141 (0%)
 Frame = -3

Query  647  WKECLSEAVAWDTLTWFAALIAMAGYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVL  468
            W + L E  AWDT+TWFAAL+ MA +LNK GLI WFS  +   +GGLG+ W  +  +L+L
Sbjct  323  WDDILKEKSAWDTITWFAALVMMATFLNKLGLIKWFSGVLESSIGGLGMGWMGACALLLL  382

Query  467  LYFYSHYFFASGAAHIGAMFTAFLSVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAP  288
             Y Y+HY FAS  AHI AMF AF S   ALG PP L AL+++  S+IM  LTHY  G++P
Sbjct  383  AYMYAHYMFASTTAHITAMFAAFYSAGLALGAPPMLFALMMAAASSIMMTLTHYATGTSP  442

Query  287  VFYGANYVPLAKWWGYGFLVS  225
            V +G+ YV L +WW  GF++S
Sbjct  443  VIFGSGYVTLGEWWKVGFIMS  463



>ref|WP_036957836.1| C4-dicarboxylate ABC transporter [Providencia rettgeri]
Length=490

 Score =   149 bits (377),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 96/142 (68%), Gaps = 0/142 (0%)
 Frame = -3

Query  650  SWKECLSEAVAWDTLTWFAALIAMAGYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILV  471
            +W + L    AWDT+ WF+AL+ MA +L K GLI W S TV   + GLG+SW     ILV
Sbjct  328  NWDDVLKNKGAWDTVVWFSALVMMASFLGKLGLIKWMSLTVGATIDGLGISWVWGMLILV  387

Query  470  LLYFYSHYFFASGAAHIGAMFTAFLSVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSA  291
            L+Y YSHYFFAS  AHI AM+ AF S   ALG PP L AL L+F S++M  LTHYG G+A
Sbjct  388  LIYVYSHYFFASTTAHITAMYAAFFSAGLALGAPPMLLALTLAFSSSLMMSLTHYGTGTA  447

Query  290  PVFYGANYVPLAKWWGYGFLVS  225
            P+ +G+ Y  LA+WW  GF++S
Sbjct  448  PIIFGSGYATLAEWWKTGFVMS  469



>ref|WP_024120552.1| 2-oxoglutarate translocator [Bacillus mojavensis]
Length=478

 Score =   149 bits (377),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 127/176 (72%), Gaps = 2/176 (1%)
 Frame = -3

Query  752  LITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAG  573
            L+ + LW+FG   NIDA T A++GL++LL++ V++W +   E  AWDTLTWFAAL+ +A 
Sbjct  284  LLVLALWIFGGSFNIDATTTALIGLSVLLLSQVLTWDDIKKEQGAWDTLTWFAALVMLAN  343

Query  572  YLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLS  393
            +LN+ G++SWFS  +   V G   SW ++F IL+++Y+YSHYFFAS  AHI AM++AFL+
Sbjct  344  FLNELGMVSWFSNAMKSSVSGF--SWIVAFLILIVVYYYSHYFFASATAHISAMYSAFLA  401

Query  392  VASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            V  A G PP L AL L+F SN+ G  THYG G+APVF+GA Y+   KWW  GF++S
Sbjct  402  VIVAAGAPPLLAALSLAFFSNLFGSTTHYGSGAAPVFFGAGYISQGKWWSIGFILS  457



>ref|WP_016687717.1| C4-dicarboxylate ABC transporter [Neisseria sicca]
Length=483

 Score =   149 bits (377),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 96/142 (68%), Gaps = 0/142 (0%)
 Frame = -3

Query  650  SWKECLSEAVAWDTLTWFAALIAMAGYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILV  471
            +W + L E  AWDT+ WFAAL+ MA +LNK GLI+W SE++   +  LGL W+    +LV
Sbjct  321  TWGDALKEKGAWDTIVWFAALVMMANFLNKLGLIAWLSESMQGGISHLGLGWEAGCALLV  380

Query  470  LLYFYSHYFFASGAAHIGAMFTAFLSVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSA  291
            L Y Y+HY FASG AH+ AMF AF     ALG PP L AL+++  + IM  LTHY  GS+
Sbjct  381  LAYLYAHYVFASGTAHVTAMFGAFYGACLALGAPPMLFALIMASATGIMMSLTHYASGSS  440

Query  290  PVFYGANYVPLAKWWGYGFLVS  225
            PV YG+NYV + +WW  GF++S
Sbjct  441  PVIYGSNYVSMTEWWKAGFIMS  462



>ref|WP_025458100.1| C4-dicarboxylate ABC transporter [Neisseria polysaccharea]
Length=483

 Score =   149 bits (377),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 95/142 (67%), Gaps = 0/142 (0%)
 Frame = -3

Query  650  SWKECLSEAVAWDTLTWFAALIAMAGYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILV  471
            +W + L E  AWDT+ WFAAL+ MA +LNK GLI W SE++   +  +GL W+    +L+
Sbjct  321  TWDDALKEKSAWDTIVWFAALVMMANFLNKLGLIGWLSESMQSGITHMGLGWEAGCALLM  380

Query  470  LLYFYSHYFFASGAAHIGAMFTAFLSVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSA  291
            L Y Y+HY FASG AH+ AMF AF     ALG PP L AL+++  + IM  LTHY  GSA
Sbjct  381  LAYLYAHYVFASGTAHVTAMFGAFYGAGLALGAPPMLFALMMAAATGIMMSLTHYATGSA  440

Query  290  PVFYGANYVPLAKWWGYGFLVS  225
            PV YG+NYV + +WW  GF++S
Sbjct  441  PVIYGSNYVNMGEWWKAGFIMS  462



>gb|EAZ07383.1| hypothetical protein OsI_29635 [Oryza sativa Indica Group]
Length=337

 Score =   147 bits (370),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 83/174 (48%), Positives = 118/174 (68%), Gaps = 0/174 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            +++ V LW+FG  + + +V AA++GL+ILL+ GV++W++CL+E  AWDTL WFA L+ MA
Sbjct  140  MILAVSLWIFGDTIGVSSVVAAMIGLSILLLLGVLNWEDCLNEKSAWDTLAWFAILVGMA  199

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            G L   G++SW S  V KV+    LSW  +FG+L   YF+ HY FAS  AH+GA+++AFL
Sbjct  200  GQLTNLGIVSWMSNCVAKVLQSFSLSWPAAFGVLQASYFFIHYLFASQTAHVGALYSAFL  259

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGF  234
            ++  A G P  L AL L++ SN+ G LTHY  G + V+YGA YV L   +  GF
Sbjct  260  AMHLAAGIPAILSALALTYNSNLFGALTHYSSGQSAVYYGAGYVDLPDVFKLGF  313



>ref|WP_003709104.1| C4-dicarboxylate ABC transporter [Neisseria lactamica]
 gb|EEZ75683.1| transporter, DASS family [Neisseria lactamica ATCC 23970]
 gb|KFJ35857.1| transporter, divalent anion:Na+ symporter family protein [Neisseria 
lactamica ATCC 23970]
Length=483

 Score =   149 bits (377),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 95/142 (67%), Gaps = 0/142 (0%)
 Frame = -3

Query  650  SWKECLSEAVAWDTLTWFAALIAMAGYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILV  471
            +W + L E  +WDT+ WFAAL+ MA +LNK GLI W SE++   +  LGL W+    +L+
Sbjct  321  TWDDALKEKSSWDTIVWFAALVMMANFLNKLGLIGWLSESMQSGIAHLGLGWEAGCALLM  380

Query  470  LLYFYSHYFFASGAAHIGAMFTAFLSVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSA  291
            L Y Y+HY FASG AH+ AMF AF     ALG PP L AL+++  + IM  LTHY  GSA
Sbjct  381  LAYLYAHYVFASGTAHVTAMFGAFYGAGLALGAPPMLFALMMAAATGIMMSLTHYATGSA  440

Query  290  PVFYGANYVPLAKWWGYGFLVS  225
            PV YG+NYV + +WW  GF++S
Sbjct  441  PVIYGSNYVNMGEWWKAGFIMS  462



>ref|WP_011197641.1| 2-oxoglutarate translocator [Bacillus licheniformis]
 gb|AAU39715.1| putative malate transporter YflS [Bacillus licheniformis DSM 
13 = ATCC 14580]
 gb|AAU22366.2| putative 2-oxoglutarate/malate translocator [Bacillus licheniformis 
DSM 13 = ATCC 14580]
 gb|KJE31653.1| transporter, divalent anion:Na+ symporter family protein [Bacillus 
licheniformis]
Length=478

 Score =   149 bits (377),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 93/176 (53%), Positives = 126/176 (72%), Gaps = 2/176 (1%)
 Frame = -3

Query  752  LITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAG  573
            L+ + LW+FG  LNIDA T A++GL +LL+T V++W +   E  AWDTLTWFAAL+ +A 
Sbjct  284  LLVLFLWIFGGNLNIDATTTALIGLAVLLLTQVLTWDDIKKEQGAWDTLTWFAALVMLAS  343

Query  572  YLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLS  393
            +LN+ G++ WFS+ +   V G   SW  +F IL+ +Y+YSHYFFAS  AHI AM++AFL+
Sbjct  344  FLNELGMVGWFSDAMKSYVSGF--SWISAFLILIAVYYYSHYFFASATAHISAMYSAFLA  401

Query  392  VASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            V  A G PP L AL L+F SN+    THYG G+APVF+GA Y+P +KWW  GF++S
Sbjct  402  VIIAAGAPPLLAALSLAFFSNLFASTTHYGAGAAPVFFGAGYIPQSKWWSIGFILS  457



>ref|WP_003179716.1| MULTISPECIES: 2-oxoglutarate translocator [Bacillus]
 gb|EFV71632.1| YflS protein [Bacillus sp. BT1B_CT2]
 gb|EID49989.1| 2-oxoglutarate/malate translocator [Bacillus licheniformis WX-02]
 gb|EQM29468.1| 2-oxoglutarate translocator [Bacillus licheniformis CG-B52]
Length=478

 Score =   149 bits (377),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 93/176 (53%), Positives = 126/176 (72%), Gaps = 2/176 (1%)
 Frame = -3

Query  752  LITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAG  573
            L+ + LW+FG  LNIDA T A++GL +LL+T V++W +   E  AWDTLTWFAAL+ +A 
Sbjct  284  LLVLFLWIFGGNLNIDATTTALIGLAVLLLTQVLTWDDIKKEQGAWDTLTWFAALVMLAS  343

Query  572  YLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLS  393
            +LN+ G++ WFS+ +   V G   SW  +F IL+ +Y+YSHYFFAS  AHI AM++AFL+
Sbjct  344  FLNELGMVGWFSDAMKSYVSGF--SWISAFLILIAVYYYSHYFFASATAHISAMYSAFLA  401

Query  392  VASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            V  A G PP L AL L+F SN+    THYG G+APVF+GA Y+P +KWW  GF++S
Sbjct  402  VIIAAGAPPLLAALSLAFFSNLFASTTHYGAGAAPVFFGAGYIPQSKWWSIGFILS  457



>ref|WP_026073362.1| 2-oxoglutarate translocator [Bacillus massiliosenegalensis]
Length=478

 Score =   149 bits (376),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 97/142 (68%), Gaps = 2/142 (1%)
 Frame = -3

Query  650  SWKECLSEAVAWDTLTWFAALIAMAGYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILV  471
            +W++  +E  AWDTL WFAAL+ MA  LN+ GLI WFSE +   V G   +W ++F IL 
Sbjct  318  NWEDVKNERGAWDTLVWFAALVMMATQLNELGLIPWFSEKMGGAVSGT--TWIVAFLILG  375

Query  470  LLYFYSHYFFASGAAHIGAMFTAFLSVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSA  291
            L+Y+YSHY FAS  AH+ AM+TAFL V  A G PP L AL+L+F SN+  GLTHYG G A
Sbjct  376  LVYYYSHYIFASNTAHVSAMYTAFLGVMIAAGAPPMLSALLLAFFSNLFSGLTHYGNGPA  435

Query  290  PVFYGANYVPLAKWWGYGFLVS  225
             V YGA YV   KWW  GF++S
Sbjct  436  AVLYGAGYVNQNKWWSVGFVIS  457



>ref|WP_016199625.1| anion transporter [Elizabethkingia meningoseptica]
 gb|EOR29438.1| anion transporter [Elizabethkingia meningoseptica ATCC 13253 
= NBRC 12535]
Length=476

 Score =   149 bits (376),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 119/169 (70%), Gaps = 2/169 (1%)
 Frame = -3

Query  734  WVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGYLNKYG  555
            W+FG+ L+IDA T A +GLT+LL+T V++W++  SE  AWDT+ WFA L+ MA  LN+ G
Sbjct  288  WIFGASLSIDATTTAFIGLTLLLLTSVLTWEDVKSEKGAWDTIVWFAVLVMMASSLNELG  347

Query  554  LISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVASALG  375
             I WFS+ +   +GGL  SWQ++F +++L+YF+SHY FAS  AH+ AM+ A L V  +LG
Sbjct  348  FIGWFSDLIKVKIGGL--SWQVAFPVIILVYFFSHYIFASATAHVAAMYAALLGVGVSLG  405

Query  374  TPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLV  228
             PP L A++L F+ +I G LTHYG G APV++G+ YV L  WW  G  +
Sbjct  406  IPPMLLAMMLGFMGSIYGVLTHYGHGPAPVYFGSGYVELKAWWLRGLEI  454



>ref|WP_004910038.1| sodium:sulfate symporter [Providencia rettgeri]
 gb|EKT58064.1| sodium:sulfate symporter [Providencia rettgeri Dmel1]
Length=490

 Score =   149 bits (376),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 96/142 (68%), Gaps = 0/142 (0%)
 Frame = -3

Query  650  SWKECLSEAVAWDTLTWFAALIAMAGYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILV  471
            +W + L    AWDT+ WF+AL+ MA +L K GLI W S TV   + G+G+SW     ILV
Sbjct  328  NWDDVLKNKGAWDTVVWFSALVMMASFLGKLGLIKWMSLTVGATIDGMGISWVWGMLILV  387

Query  470  LLYFYSHYFFASGAAHIGAMFTAFLSVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSA  291
            L+Y YSHYFFAS  AHI AM+ AF S   ALG PP L AL L+F S++M  LTHYG G+A
Sbjct  388  LIYVYSHYFFASTTAHITAMYAAFFSAGLALGAPPMLLALTLAFSSSLMMSLTHYGTGTA  447

Query  290  PVFYGANYVPLAKWWGYGFLVS  225
            P+ +G+ Y  LA+WW  GF++S
Sbjct  448  PIIFGSGYATLAEWWKTGFVMS  469



>ref|WP_019551967.1| 2-oxoglutarate translocator [Zymophilus raffinosivorans]
Length=469

 Score =   149 bits (375),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 78/171 (46%), Positives = 116/171 (68%), Gaps = 0/171 (0%)
 Frame = -3

Query  737  LWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGYLNKY  558
            LW  GS+ NI+A    +L + ++L+T V++W++ L+E  AWDT+ W  +LIA+A  L K 
Sbjct  278  LWATGSITNINATVVGMLAVCVMLLTKVLTWQDVLNEKGAWDTMFWMGSLIALATALAKT  337

Query  557  GLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVASAL  378
            G I W +      + G G+SW L+F +L++ Y YSHY FAS  AHI AM+ AFL+++  +
Sbjct  338  GFIGWLAAMAGGAIQGAGISWYLAFPLLIIAYVYSHYAFASVTAHISAMYAAFLAISVVV  397

Query  377  GTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            GTPP L AL  + +SN+M  LTHYG G+AP+ YGA+YV ++ WW  GF+++
Sbjct  398  GTPPLLAALTFAAMSNLMIPLTHYGGGAAPILYGADYVSMSDWWRLGFIIT  448



>ref|WP_024568310.1| 2-oxoglutarate translocator [Elizabethkingia anophelis]
Length=476

 Score =   149 bits (375),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 118/169 (70%), Gaps = 2/169 (1%)
 Frame = -3

Query  734  WVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGYLNKYG  555
            W+FG  L+IDA T A +GLT+LL+T V++W++  SE  AWDT+ WFA L+ MA  LN+ G
Sbjct  288  WIFGGSLSIDATTTAFIGLTLLLLTSVLTWEDVKSEKGAWDTIVWFAVLVMMASSLNELG  347

Query  554  LISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVASALG  375
             I WFS+ +   +GGL  SWQ++F +++L+YF+SHY FAS  AH+ AM+ A L V  +LG
Sbjct  348  FIGWFSDMIKVKIGGL--SWQVAFPVIILVYFFSHYIFASATAHVAAMYAALLGVGVSLG  405

Query  374  TPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLV  228
             PP L A++L F+ +I G LTHYG G APV++G+ YV L  WW  G  +
Sbjct  406  IPPMLLAMMLGFMGSIYGVLTHYGHGPAPVYFGSGYVELKAWWLRGLEI  454



>ref|WP_031848249.1| 2-oxoglutarate translocator, partial [Vibrio parahaemolyticus]
 gb|KEE00145.1| hypothetical protein EM60_23420, partial [Vibrio parahaemolyticus]
Length=202

 Score =   142 bits (359),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 94/194 (48%), Positives = 125/194 (64%), Gaps = 2/194 (1%)
 Frame = -3

Query  743  VGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGYLN  564
            V LWV G  L I A   A+LGL  LL+T  ++W   L E  AW T+TWFA L+ MA  LN
Sbjct  11   VSLWVLGPTLGIHATVTALLGLVFLLLTHTITWDAVLGEKEAWHTITWFAVLVMMAAQLN  70

Query  563  KYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVAS  384
            K G ISWFSE++ + + G G  W  +  +L+L+Y+YSHY  AS  AHI AM++AFL++A 
Sbjct  71   KLGFISWFSESMAESLSGFG--WVTTIVVLLLVYYYSHYLMASAMAHISAMYSAFLAIAI  128

Query  383  ALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVSvvniiiw  204
            + GTPP L A+VL   SN+    THY  G AP+ +GA +  L  WW  GF+ S++ I I+
Sbjct  129  SAGTPPMLAAIVLGIFSNLYMSTTHYSSGPAPILFGAGFHTLQNWWKIGFIFSLIVIPIF  188

Query  203  lgvggiwWKAIGLW  162
            + VGG WWK +GLW
Sbjct  189  VFVGGAWWKLLGLW  202



>gb|EJO23151.1| transporter, DASS family [Selenomonas sp. FOBRC6]
Length=284

 Score =   145 bits (365),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 116/163 (71%), Gaps = 0/163 (0%)
 Frame = -3

Query  650  SWKECLSEAVAWDTLTWFAALIAMAGYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILV  471
            +W + L+E  AW+T+ W  +LIA+A  L+K G I + +E   +++   G+SW L+F +L+
Sbjct  122  TWDDVLNEKGAWNTMFWMGSLIALASALSKSGFIKYVAEGAGRMIESAGISWTLAFVLLI  181

Query  470  LLYFYSHYFFASGAAHIGAMFTAFLSVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSA  291
            L+Y YSHY FAS +AHIGAM+ AFL+VA A+GTPP L A+  + +SNIM  LTHYG G+A
Sbjct  182  LIYVYSHYGFASVSAHIGAMYAAFLTVAIAVGTPPMLAAIAFAAMSNIMIPLTHYGGGAA  241

Query  290  PVFYGANYVPLAKWWGYGFLVSvvniiiwlgvggiwWKAIGLW  162
            P+ YGA YV    WW  GF+++ VN+ IWL +GG WWK IGLW
Sbjct  242  PILYGAGYVSQNDWWRLGFIITTVNVAIWLILGGAWWKVIGLW  284



>ref|WP_029292431.1| 2-oxoglutarate translocator [Chryseobacterium hispalense]
Length=476

 Score =   148 bits (374),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 84/169 (50%), Positives = 118/169 (70%), Gaps = 2/169 (1%)
 Frame = -3

Query  734  WVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGYLNKYG  555
            W+FG  L+IDA T A +GLT+LL+T V++W++  SE  AWDT+ WFA L+ MA  LN+ G
Sbjct  288  WIFGGSLSIDATTTAFIGLTLLLLTSVLTWEDVKSEKGAWDTIVWFAVLVMMASSLNELG  347

Query  554  LISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVASALG  375
             I WFS+ + + +GG+  +W ++F ++VL+YF+SHY FAS  AH+ AM+ A L V  A+G
Sbjct  348  FIGWFSDLIKQKIGGM--TWTIAFPVIVLVYFFSHYIFASATAHVAAMYAALLGVGVAVG  405

Query  374  TPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLV  228
             PP L A++L FL +I G LTHYG G APVF+G+ Y+ L  WW  G  +
Sbjct  406  IPPMLLAMMLGFLGSIYGVLTHYGHGPAPVFFGSGYIDLKSWWVRGLEI  454



>ref|WP_003740744.1| C4-dicarboxylate ABC transporter [Neisseria mucosa]
 gb|EFC89785.1| transporter, DASS family [Neisseria mucosa ATCC 25996]
Length=483

 Score =   149 bits (375),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 95/142 (67%), Gaps = 0/142 (0%)
 Frame = -3

Query  650  SWKECLSEAVAWDTLTWFAALIAMAGYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILV  471
            +W + L E  AWDT+ WFAAL+ MA +LNK GLI+W SE++   +  LGL W+    +L 
Sbjct  321  TWDDALKEKGAWDTIVWFAALVMMANFLNKLGLIAWLSESMQGGISHLGLGWEAGCALLT  380

Query  470  LLYFYSHYFFASGAAHIGAMFTAFLSVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSA  291
            L Y Y+HY FASG AH+ AMF AF     ALG PP L AL+++  + IM  LTHY  GS+
Sbjct  381  LAYLYAHYVFASGTAHVTAMFGAFYGAGLALGAPPMLFALIMASATGIMMSLTHYASGSS  440

Query  290  PVFYGANYVPLAKWWGYGFLVS  225
            PV YG+NYV + +WW  GF++S
Sbjct  441  PVIYGSNYVSMTEWWKAGFIMS  462



>ref|WP_034687098.1| 2-oxoglutarate translocator [Chryseobacterium piperi]
 gb|KFF18169.1| 2-oxoglutarate translocator [Chryseobacterium piperi]
Length=476

 Score =   148 bits (374),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 118/169 (70%), Gaps = 2/169 (1%)
 Frame = -3

Query  734  WVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGYLNKYG  555
            W+FG  L+IDA T A +GLT+LL+T V++W++  +E  AWDT+ WFA L+ MA  LN+ G
Sbjct  288  WIFGGALSIDATTTAFIGLTLLLLTSVLTWEDVKAEKGAWDTIVWFAVLVMMASSLNELG  347

Query  554  LISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVASALG  375
             I WFS+ +   +GGL  SWQ++F +++++YF+SHY FAS  AH+ AM+ A L V  A+G
Sbjct  348  FIGWFSDLIKVKIGGL--SWQVAFPVIIVVYFFSHYIFASATAHVAAMYAALLGVGVAVG  405

Query  374  TPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLV  228
             PP L A++L FL +I G LTHYG G APVF+G+ YV L  WW  G  +
Sbjct  406  IPPMLLAMMLGFLGSIYGVLTHYGHGPAPVFFGSGYVELKAWWLRGLEI  454



>ref|WP_036674200.1| 2-oxoglutarate translocator [Pedobacter heparinus]
Length=476

 Score =   148 bits (374),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 81/170 (48%), Positives = 114/170 (67%), Gaps = 2/170 (1%)
 Frame = -3

Query  734  WVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGYLNKYG  555
            W+ G +  IDA T A +GL  LL++ V++W++  SE  AWDT+ WF+AL+ M   LN+ G
Sbjct  288  WITGDIFKIDATTTAFIGLVFLLLSQVLTWEDVKSEKGAWDTIVWFSALVMMGSALNQLG  347

Query  554  LISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVASALG  375
            LI WFSE V   +G +  +W ++F I++L+YFYSHY FAS  AH+ +M+ A L V  ++G
Sbjct  348  LIPWFSELVKAKIGHM--NWTMAFPIIILVYFYSHYMFASATAHVASMYAALLGVGISVG  405

Query  374  TPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
             PP L AL L F   I G LTHYG G APVF+G+ +V + +WW  GF++S
Sbjct  406  IPPMLLALSLGFCGGIYGTLTHYGHGPAPVFFGSTFVEVKEWWSRGFILS  455



>ref|WP_003223030.1| 2-oxoglutarate translocator [Bacillus subtilis]
 gb|EFG91812.1| 2-oxoglutarate/malate transporter [Bacillus subtilis subsp. spizizenii 
ATCC 6633]
 gb|ADM36825.1| 2-oxoglutarate/malate transporter [Bacillus subtilis subsp. spizizenii 
str. W23]
 gb|KFK80732.1| 2-oxoglutarate/malate translocator [Bacillus subtilis]
 gb|AJD35451.1| 2-oxoglutarate translocator [Bacillus subtilis subsp. spizizenii]
Length=477

 Score =   148 bits (374),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 91/170 (54%), Positives = 123/170 (72%), Gaps = 2/170 (1%)
 Frame = -3

Query  734  WVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGYLNKYG  555
            W+FG   NIDA T A++GL++LL++ V++W +   E  AWDTLTWFAAL+ +A +LN+ G
Sbjct  289  WIFGGSFNIDATTTALIGLSVLLLSQVLTWDDIKKEQGAWDTLTWFAALVMLANFLNELG  348

Query  554  LISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVASALG  375
            ++SWFS  +   V G   SW ++F IL+++YFYSHYFFAS  AHI AM++AFL+V  A G
Sbjct  349  MVSWFSNAMKSSVSGF--SWIIAFLILIVVYFYSHYFFASATAHISAMYSAFLAVVVAAG  406

Query  374  TPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
             PP L AL L+F SN+ G  THYG G+APVF+GA Y+   KWW  GF++S
Sbjct  407  APPLLAALSLAFFSNLFGSTTHYGSGAAPVFFGAGYISQGKWWSIGFILS  456



>gb|KFK28120.1| hypothetical protein AALP_AA8G475200 [Arabis alpina]
Length=559

 Score =   149 bits (376),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 120/177 (68%), Gaps = 0/177 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            +L+ V LW+ G  L I +V AA++GL+ILL+ GV++W +CLSE  AWDTL WFA L+ MA
Sbjct  362  MLLAVTLWICGETLGIPSVVAAMIGLSILLLLGVLNWDDCLSEKSAWDTLAWFAVLVGMA  421

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            G L   G++SW S+ V KV+  L LSW  +FG+L   YF+ HY FAS   H+GA+F+AFL
Sbjct  422  GQLTNLGVVSWMSDCVAKVLQSLSLSWPAAFGLLQAAYFFIHYLFASQTGHVGALFSAFL  481

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            ++  A G P  L AL L++ +N+ G LTHY  G A V+YGA YV L   +  GF+++
Sbjct  482  AMHIAAGVPGILAALALAYNTNLFGALTHYSSGQAAVYYGAGYVDLPDVFKIGFVMA  538



>ref|WP_041906771.1| MULTISPECIES: 2-oxoglutarate translocator [Bacillus]
 gb|KFI01861.1| 2-oxoglutarate translocator [Bacillus sp. BSC154]
Length=478

 Score =   148 bits (374),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 91/170 (54%), Positives = 123/170 (72%), Gaps = 2/170 (1%)
 Frame = -3

Query  734  WVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGYLNKYG  555
            W+FG   NIDA T A++GL++LL++ V++W +   E  AWDTLTWFAAL+ +A +LN+ G
Sbjct  290  WIFGGSFNIDATTTALIGLSVLLLSQVLTWDDIKKEQGAWDTLTWFAALVMLANFLNELG  349

Query  554  LISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVASALG  375
            ++SWFS  +   V G   SW ++F IL+++YFYSHYFFAS  AHI AM++AFL+V  A G
Sbjct  350  MVSWFSNAMKSSVSGF--SWIIAFLILIVVYFYSHYFFASATAHISAMYSAFLAVVVAAG  407

Query  374  TPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
             PP L AL L+F SN+ G  THYG G+APVF+GA Y+   KWW  GF++S
Sbjct  408  APPLLAALSLAFFSNLFGSTTHYGSGAAPVFFGAGYISQGKWWSIGFILS  457



>ref|WP_021346170.1| 2-oxoglutarate translocator [Elizabethkingia meningoseptica]
 gb|EQB93156.1| 2-oxoglutarate translocator [Elizabethkingia meningoseptica 502]
 gb|KFC38805.1| 2-oxoglutarate translocator [Elizabethkingia meningoseptica]
 gb|KGT10334.1| 2-oxoglutarate translocator [Elizabethkingia meningoseptica]
Length=476

 Score =   148 bits (374),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 118/169 (70%), Gaps = 2/169 (1%)
 Frame = -3

Query  734  WVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGYLNKYG  555
            W+FG  L+IDA T A +GLT+LL+T V++W++  SE  AWDT+ WFA L+ MA  LN+ G
Sbjct  288  WIFGGSLSIDATTTAFIGLTLLLLTSVLTWEDVKSEKGAWDTIVWFAVLVMMASSLNELG  347

Query  554  LISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVASALG  375
             I WFS+ +   +GGL  SWQ++F +++L+YF+SHY FAS  AH+ AM+ A L V  +LG
Sbjct  348  FIGWFSDLIKVKIGGL--SWQVAFPVIILVYFFSHYIFASATAHVAAMYAALLGVGVSLG  405

Query  374  TPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLV  228
             PP L A++L F+ +I G LTHYG G APV++G+ YV L  WW  G  +
Sbjct  406  IPPMLLAMMLGFMGSIYGVLTHYGHGPAPVYFGSGYVELKAWWLRGLEI  454



>gb|ESV70337.1| sulfate symporter transmembrane region family protein [Vibrio 
parahaemolyticus 10296]
Length=235

 Score =   143 bits (361),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 83/173 (48%), Positives = 109/173 (63%), Gaps = 2/173 (1%)
 Frame = -3

Query  743  VGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGYLN  564
            V LWV G  L I A   A+LGL  LL+T  ++W   L E  AW T+TWFA L+ MA  LN
Sbjct  44   VSLWVLGPTLGIHATVTALLGLVFLLLTHTITWDAVLGEKEAWHTITWFAVLVMMAAQLN  103

Query  563  KYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVAS  384
            K G ISWFSE++ + + G G  W  +  +L+L+Y+YSHY  AS  AHI AM++AFL++A 
Sbjct  104  KLGFISWFSESMAESLSGFG--WVTTIVVLLLVYYYSHYLMASAMAHISAMYSAFLAIAI  161

Query  383  ALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            + GTPP L A+VL   SN+    THY  G AP+ +GA +  L  WW  GF+ S
Sbjct  162  SAGTPPMLAAIVLGIFSNLYMSTTHYSSGPAPILFGAGFHTLQNWWKIGFIFS  214



>ref|WP_009087594.1| MULTISPECIES: 2-oxoglutarate translocator [Elizabethkingia]
 gb|EHM97817.1| anion transporter [Elizabethkingia anophelis Ag1]
 gb|ELR77708.1| anion transporter [Elizabethkingia anophelis R26]
 emb|CDN78900.1| putative malate transporter YflS [Elizabethkingia anophelis]
 emb|CDN73067.1| putative malate transporter YflS [Elizabethkingia anophelis]
 gb|AIL44656.1| 2-oxoglutarate/malate translocator [Elizabethkingia anophelis 
NUHP1]
 gb|KGO11035.1| 2-oxoglutarate translocator [Elizabethkingia miricola]
Length=476

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 118/169 (70%), Gaps = 2/169 (1%)
 Frame = -3

Query  734  WVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGYLNKYG  555
            W+FG  L+IDA T A +GLT+LL+T V++W++  SE  AWDT+ WFA L+ MA  LN+ G
Sbjct  288  WIFGGSLSIDATTTAFIGLTLLLLTSVLTWEDVKSEKGAWDTIVWFAVLVMMASSLNELG  347

Query  554  LISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVASALG  375
             I WFS+ +   +GGL  SWQ++F +++L+YF+SHY FAS  AH+ AM+ A L V  +LG
Sbjct  348  FIGWFSDLIKVKIGGL--SWQVAFPVIILVYFFSHYIFASATAHVAAMYAALLGVGVSLG  405

Query  374  TPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLV  228
             PP L A++L F+ +I G LTHYG G APV++G+ YV L  WW  G  +
Sbjct  406  IPPMLLAMMLGFMGSIYGVLTHYGHGPAPVYFGSGYVELKAWWLRGLEI  454



>gb|ACU05461.1| anion transporter [Pedobacter heparinus DSM 2366]
Length=494

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 81/170 (48%), Positives = 114/170 (67%), Gaps = 2/170 (1%)
 Frame = -3

Query  734  WVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGYLNKYG  555
            W+ G +  IDA T A +GL  LL++ V++W++  SE  AWDT+ WF+AL+ M   LN+ G
Sbjct  306  WITGDIFKIDATTTAFIGLVFLLLSQVLTWEDVKSEKGAWDTIVWFSALVMMGSALNQLG  365

Query  554  LISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVASALG  375
            LI WFSE V   +G +  +W ++F I++L+YFYSHY FAS  AH+ +M+ A L V  ++G
Sbjct  366  LIPWFSELVKAKIGHM--NWTMAFPIIILVYFYSHYMFASATAHVASMYAALLGVGISVG  423

Query  374  TPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
             PP L AL L F   I G LTHYG G APVF+G+ +V + +WW  GF++S
Sbjct  424  IPPMLLALSLGFCGGIYGTLTHYGHGPAPVFFGSTFVEVKEWWSRGFILS  473



>ref|WP_043498342.1| 2-oxoglutarate translocator [Georgenia sp. SUBG003]
 gb|KEP24014.1| 2-oxoglutarate translocator [Georgenia sp. SUBG003]
Length=465

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 87/163 (53%), Positives = 109/163 (67%), Gaps = 2/163 (1%)
 Frame = -3

Query  650  SWKECLSEAVAWDTLTWFAALIAMAGYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILV  471
            +W +   E  AWDTL WFA L+ MA  LN  GLI W S  +  +V G+G  WQ +F +L 
Sbjct  305  TWDDIKRETQAWDTLVWFAVLVMMATQLNALGLIPWLSGEMSTIVSGMG--WQSAFVLLT  362

Query  470  LLYFYSHYFFASGAAHIGAMFTAFLSVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSA  291
            L+YF+SHY FAS  AHI AM+ AFL+ A   G PP L ALVL F+S++   +THY  G A
Sbjct  363  LVYFFSHYLFASNTAHISAMYAAFLATALMAGAPPLLAALVLGFISSLFASVTHYSSGPA  422

Query  290  PVFYGANYVPLAKWWGYGFLVSvvniiiwlgvggiwWKAIGLW  162
            PV +GA YVP+  WW  GF+VS+VNI IW+GVGG W K IG+W
Sbjct  423  PVLFGAGYVPVGAWWRTGFVVSLVNIAIWMGVGGAWLKVIGMW  465



>ref|WP_019072567.1| hypothetical protein [Streptomyces sp. R1-NS-10]
Length=467

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 95/142 (67%), Gaps = 2/142 (1%)
 Frame = -3

Query  650  SWKECLSEAVAWDTLTWFAALIAMAGYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILV  471
            +W + ++E  AW TL WF+ L+ MAG L + G+I WFS+T+ K   G+G  WQ +F IL 
Sbjct  307  TWGDLVAEKSAWTTLVWFSVLVMMAGQLQELGVIGWFSDTMTKATDGVG--WQTAFVILT  364

Query  470  LLYFYSHYFFASGAAHIGAMFTAFLSVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSA  291
            L+Y +SHY FAS  AH+ AM+ AFLS A A G PP + ALVL F+S++ GGLTHY  G A
Sbjct  365  LVYLFSHYLFASNTAHVAAMYAAFLSAAIATGAPPVMAALVLGFISSLYGGLTHYASGPA  424

Query  290  PVFYGANYVPLAKWWGYGFLVS  225
            PV +G  YV L +WW  G + +
Sbjct  425  PVLFGGGYVTLGEWWRTGLIAA  446



>ref|WP_003761818.1| C4-dicarboxylate ABC transporter [Neisseria sicca]
 gb|EET42819.1| transporter, DASS family [Neisseria sicca ATCC 29256]
Length=483

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 95/142 (67%), Gaps = 0/142 (0%)
 Frame = -3

Query  650  SWKECLSEAVAWDTLTWFAALIAMAGYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILV  471
            +W + L E  AWDT+ WFAAL+ MA +LNK GLI+W SE++   +  LGL W+    +LV
Sbjct  321  TWDDALKEKGAWDTIVWFAALVMMANFLNKLGLIAWLSESMQGGISHLGLGWEAGCALLV  380

Query  470  LLYFYSHYFFASGAAHIGAMFTAFLSVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSA  291
            L Y Y+HY FASG AH+ AMF AF     AL  PP L AL+++  + IM  LTHY  GS+
Sbjct  381  LAYLYAHYVFASGTAHVTAMFGAFYGAGLALNAPPMLFALIMASATGIMMSLTHYASGSS  440

Query  290  PVFYGANYVPLAKWWGYGFLVS  225
            PV YG+NYV + +WW  GF++S
Sbjct  441  PVIYGSNYVSMTEWWKAGFIMS  462



>ref|WP_009311665.1| C4-dicarboxylate ABC transporter [Neisseria sp. GT4A_CT1]
 gb|EGY61134.1| hypothetical protein HMPREF1028_00946 [Neisseria sp. GT4A_CT1]
Length=483

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 95/142 (67%), Gaps = 0/142 (0%)
 Frame = -3

Query  650  SWKECLSEAVAWDTLTWFAALIAMAGYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILV  471
            +W + L E  AWDT+ WFAAL+ MA +LNK GLI+W SE++   +  LGL W+    +LV
Sbjct  321  TWDDALKEKGAWDTIVWFAALVMMANFLNKLGLIAWLSESMQGGISHLGLGWEAGCALLV  380

Query  470  LLYFYSHYFFASGAAHIGAMFTAFLSVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSA  291
            L Y Y+HY FASG AH+ AMF AF     AL  PP L AL+++  + IM  LTHY  GS+
Sbjct  381  LAYLYAHYVFASGTAHVTAMFGAFYGAGLALDAPPMLFALIMASATGIMMSLTHYASGSS  440

Query  290  PVFYGANYVPLAKWWGYGFLVS  225
            PV YG+NYV + +WW  GF++S
Sbjct  441  PVIYGSNYVSMTEWWKAGFIMS  462



>ref|WP_026878255.1| C4-dicarboxylate ABC transporter [Ignatzschineria larvae]
Length=489

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 94/142 (66%), Gaps = 0/142 (0%)
 Frame = -3

Query  650  SWKECLSEAVAWDTLTWFAALIAMAGYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILV  471
            +W E L    AWDT+ WF+ALI MA +L K GLI W +  V   +  LG  W +S  ILV
Sbjct  327  TWDEALKHKSAWDTVVWFSALIMMATFLGKLGLIKWLAGAVSSSIDVLGFGWVISMLILV  386

Query  470  LLYFYSHYFFASGAAHIGAMFTAFLSVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSA  291
            L+Y Y+HYFFAS  AHI AMF AFL+   ALG PP L AL L+F S++M  LTHY  G+A
Sbjct  387  LVYVYTHYFFASTTAHITAMFAAFLAAGVALGAPPMLLALTLAFSSSLMMSLTHYATGTA  446

Query  290  PVFYGANYVPLAKWWGYGFLVS  225
            P+ +G+NY  L +WW  GF++S
Sbjct  447  PIIFGSNYATLGEWWRVGFVMS  468



>ref|WP_029378255.1| 2-oxoglutarate translocator [Staphylococcus xylosus]
 gb|AID02343.1| 2-oxoglutarate translocator [Staphylococcus xylosus]
 gb|AID41849.1| 2-oxoglutarate/malate translocator [Staphylococcus xylosus]
 emb|CEF17850.1| Putative di-and tricarboxylate transporter [Staphylococcus xylosus]
Length=471

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 83/169 (49%), Positives = 110/169 (65%), Gaps = 2/169 (1%)
 Frame = -3

Query  752  LITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAG  573
            +I +GLW+ GS LNI+A   A + L++LL+TGV++W + L E  AW+TL WF+ L+ MA 
Sbjct  277  IIALGLWILGSTLNINATLTAFIALSLLLITGVLTWNDILKETGAWNTLVWFSILVMMAN  336

Query  572  YLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLS  393
             LN+ G I W SE++   +GGL  SW +   IL+L YFYSHY FAS  AH+ AM++A L 
Sbjct  337  QLNELGFIPWLSESISGSLGGL--SWPIVLIILILFYFYSHYLFASSTAHVSAMYSALLG  394

Query  392  VASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWW  246
            VA A G PP   AL+L F  N+M   THY  G AP+ Y A YV   +WW
Sbjct  395  VAIATGAPPLYSALMLGFFGNLMASTTHYSSGPAPILYSAGYVSQNRWW  443



>ref|WP_006344203.1| 2-oxoglutarate translocator [Chlamydophila abortus]
 gb|EGK69326.1| putative sodium:sulfate symporter [Chlamydophila abortus LLG]
Length=470

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 120/177 (68%), Gaps = 3/177 (2%)
 Frame = -3

Query  752  LITVGLWVFGSVLNIDavtaailgltillvtgvVSW-KECLSEAVAWDTLTWFAALIAMA  576
            ++ V LW FG +L I A TAA++GL++L++T ++ W K+ ++   AW+T  WF ALI MA
Sbjct  275  ILLVVLWTFGDLLRISATTAALIGLSLLILTNILDWHKDVMANTTAWETFIWFGALIMMA  334

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
             +LN+ G      ++V    G  GLSW++ F IL L+YFYSHY FAS  AHIGAMF  FL
Sbjct  335  SFLNQLGFSPLIGDSVAA--GVAGLSWKIGFPILFLMYFYSHYLFASNTAHIGAMFPVFL  392

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            +V+ ALGT P    LVL+F SN+ GGLTHYG G AP+++G+  V +  WW  GF++S
Sbjct  393  AVSIALGTNPIFACLVLAFSSNLFGGLTHYGSGPAPLYFGSQLVSIKDWWQSGFILS  449



>ref|WP_039409462.1| C4-dicarboxylate ABC transporter [Morococcus cerebrosus]
 gb|KIC06429.1| C4-dicarboxylate ABC transporter [Morococcus cerebrosus]
Length=483

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 95/142 (67%), Gaps = 0/142 (0%)
 Frame = -3

Query  650  SWKECLSEAVAWDTLTWFAALIAMAGYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILV  471
            +W + L E  AWDT+ WFAAL+ MA +LNK GLI+W SE++   +  LGL W+    +LV
Sbjct  321  TWDDALKEKGAWDTIVWFAALVMMANFLNKLGLIAWLSESMQGGISHLGLGWEAGCALLV  380

Query  470  LLYFYSHYFFASGAAHIGAMFTAFLSVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSA  291
            L Y Y+HY FASG AH+ AMF AF     AL  PP L AL+++  + IM  LTHY  GS+
Sbjct  381  LAYLYAHYVFASGTAHVTAMFGAFYGAGLALDAPPMLFALIMASATGIMMSLTHYASGSS  440

Query  290  PVFYGANYVPLAKWWGYGFLVS  225
            PV YG+NYV + +WW  GF++S
Sbjct  441  PVIYGSNYVSMTEWWKAGFIMS  462



>ref|WP_009173872.1| C4-dicarboxylate ABC transporter [Neisseria sp. oral taxon 014]
 gb|EFI24658.1| 2-oxoglutarate/malate translocator [Neisseria sp. oral taxon 
014 str. F0314]
Length=483

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 95/142 (67%), Gaps = 0/142 (0%)
 Frame = -3

Query  650  SWKECLSEAVAWDTLTWFAALIAMAGYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILV  471
            +W + L E  AWDT+ WFAAL+ MA +LNK GLI+W SE++   +  LGL W+    +LV
Sbjct  321  TWDDALKEKGAWDTIVWFAALVMMANFLNKLGLIAWLSESLQGGISHLGLGWEAGCALLV  380

Query  470  LLYFYSHYFFASGAAHIGAMFTAFLSVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSA  291
            L Y Y+HY FASG AH+ AMF AF     AL  PP L AL+++  + IM  LTHY  GS+
Sbjct  381  LAYLYAHYVFASGTAHVTAMFGAFYGAGLALDAPPMLFALIMASATGIMMSLTHYASGSS  440

Query  290  PVFYGANYVPLAKWWGYGFLVS  225
            PV YG+NYV + +WW  GF++S
Sbjct  441  PVIYGSNYVSMTEWWKAGFIMS  462



>ref|WP_034699340.1| 2-oxoglutarate translocator [Chryseobacterium sp. CF365]
Length=476

 Score =   147 bits (372),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 84/169 (50%), Positives = 117/169 (69%), Gaps = 2/169 (1%)
 Frame = -3

Query  734  WVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGYLNKYG  555
            W+FG  L+IDA T A +GLT+LL+T V++W++  +E  AWDT+ WFA L+ MA  LN+ G
Sbjct  288  WIFGGALSIDATTTAFIGLTLLLLTSVLTWEDVKAEKGAWDTIVWFAVLVMMASSLNELG  347

Query  554  LISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVASALG  375
             I WFS  +   +GGL  SWQ++F +++++YF+SHY FAS  AH+ AM+ A L V  +LG
Sbjct  348  FIEWFSNLIKVQIGGL--SWQVAFPVIIVVYFFSHYIFASATAHVAAMYAALLGVGVSLG  405

Query  374  TPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLV  228
             PP L A++L F+ +I G LTHYG G APVF+G+ YV L  WW  G  +
Sbjct  406  IPPMLLAMMLGFMGSIYGVLTHYGHGPAPVFFGSGYVELKTWWIKGLEI  454



>ref|WP_042357669.1| 2-oxoglutarate translocator [Bacillus sp. MT2]
Length=490

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 117/172 (68%), Gaps = 4/172 (2%)
 Frame = -3

Query  737  LWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGYLNKY  558
            LW+FG    I A    ++GL++LL++GV++W++  SE  AWDTL WFAAL+ MA +LN  
Sbjct  301  LWIFGEGFGISATATGLIGLSVLLLSGVLNWEDVKSEKGAWDTLIWFAALVMMATFLNTL  360

Query  557  GLISWFSETVVKVVGGL-GLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVASA  381
            G I WFSE   K+ GG+ G SW  +  ILVL+YFYSHY FAS  AHI AM+ AFL+V  A
Sbjct  361  GFIPWFSE---KMAGGVSGYSWVAAVTILVLVYFYSHYLFASATAHISAMYPAFLAVCVA  417

Query  380  LGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
             G P  L AL+L+F+SN+    THYG G +PV +GA YV   KWW  GF++S
Sbjct  418  AGAPGMLAALLLAFVSNLFYCTTHYGGGPSPVLFGAGYVSQNKWWSIGFIIS  469



>ref|XP_008373247.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
[Malus domestica]
Length=304

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 82/177 (46%), Positives = 118/177 (67%), Gaps = 0/177 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            +L+ V LWVFG  L + +V  A++GL+ILL+ GV++W +CLSE  AWDTL WF+ L+ MA
Sbjct  107  MLLAVSLWVFGDALGVASVVTAMIGLSILLLLGVLNWDDCLSEKSAWDTLAWFSVLVGMA  166

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            G L   G+++W S +V K +    LSW  +FG+L   YF+ HY FAS   H+GA+++AFL
Sbjct  167  GQLTNLGIVNWMSSSVAKTLQSYSLSWPAAFGVLQAAYFFIHYLFASQTGHVGALYSAFL  226

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            ++  A G P  L AL L++ +N+ G LTHY  G A V+YGA YV L   +  GF+++
Sbjct  227  AMNLAAGVPGVLAALALAYNTNLFGALTHYSSGQAAVYYGAGYVDLPDVFKVGFIMA  283



>ref|WP_011006564.1| 2-oxoglutarate translocator [Chlamydophila caviae]
 gb|AAP05349.1| sodium:sulfate symporter family protein [Chlamydophila caviae 
GPIC]
Length=470

 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 86/177 (49%), Positives = 120/177 (68%), Gaps = 3/177 (2%)
 Frame = -3

Query  752  LITVGLWVFGSVLNIDavtaailgltillvtgvVSW-KECLSEAVAWDTLTWFAALIAMA  576
            ++ V LW FG +L I A TAA++GL++L++T ++ W K+ ++   AW+T  WF ALI MA
Sbjct  275  ILLVVLWTFGDLLRISATTAALIGLSLLILTNILDWHKDVMANTTAWETFIWFGALIMMA  334

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
             +LN++G I     +V    G  GLSW++ F IL L+YFYSHY FAS  AHIGAMF  FL
Sbjct  335  SFLNQFGFIPLIGNSVAA--GVAGLSWKVGFPILFLIYFYSHYLFASNTAHIGAMFPVFL  392

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            +V+ +LGT P    LV +F SN+ GGLTHYG G AP+++G+  V +  WW  GF++S
Sbjct  393  AVSISLGTNPIFACLVFAFSSNLFGGLTHYGSGPAPLYFGSQLVSIKDWWRSGFILS  449



>ref|WP_004653955.1| hypothetical protein [Acinetobacter sp. NIPH 809]
 gb|ENU23631.1| hypothetical protein F993_01784 [Acinetobacter sp. NIPH 809]
Length=485

 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 118/169 (70%), Gaps = 0/169 (0%)
 Frame = -3

Query  731  VFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGYLNKYGL  552
            +FGS   +D  T A +GL +LL+TGV++W++ L++  AWDT+TWFAAL+ MA YLNK GL
Sbjct  296  IFGSAWAVDPTTTAFIGLGLLLITGVLTWEDILTQKSAWDTITWFAALVMMATYLNKLGL  355

Query  551  ISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVASALGT  372
            I+WFS  +   +G LGLSW  +  +L+L Y Y+HY FAS  AHI AMF AF +   ALG 
Sbjct  356  ITWFSGVLETGIGHLGLSWMPACILLMLAYLYAHYMFASTTAHITAMFAAFYTAGLALGA  415

Query  371  PPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            PP L AL+++  S+IM  LTHY  G++PV +G+ Y  L +WW  GF++S
Sbjct  416  PPMLFALMMAAASSIMMTLTHYATGTSPVVFGSGYTTLGEWWKAGFVMS  464



>ref|XP_001781877.1| predicted protein [Physcomitrella patens]
 gb|EDQ53332.1| predicted protein [Physcomitrella patens]
Length=443

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 121/177 (68%), Gaps = 0/177 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            +L+ V LWVFG  L I +V AA+LGL ILL+TGV++W +CLSE  AWDTLTWFA L+ MA
Sbjct  246  MLLAVTLWVFGETLGIASVVAAMLGLCILLLTGVLNWDDCLSEKSAWDTLTWFAVLVGMA  305

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            G L+  GL+ W S++V   +    LSW  +FG+L   YF SHY FAS   H+GA+++AFL
Sbjct  306  GNLSNLGLVKWMSDSVAGALASYSLSWPAAFGVLQATYFLSHYLFASQTGHVGALYSAFL  365

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            ++  A G P  L AL L+F +N+ GGLTHY  G A V++G+ +V L   + YG +++
Sbjct  366  AMHIASGVPSSLAALALAFNTNLFGGLTHYSSGQAAVYFGSGFVELKDVFKYGAIMA  422



>ref|XP_002866607.1| DCT/DIT2.1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42866.1| DCT/DIT2.1 [Arabidopsis lyrata subsp. lyrata]
Length=561

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 86/177 (49%), Positives = 120/177 (68%), Gaps = 0/177 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            +L+ V LW+ G  L I +V AA++GL+ILL+ GV++W +CLSE  AWDTL WFA L+ MA
Sbjct  364  MLLAVTLWICGETLGIPSVVAAMIGLSILLLLGVLNWDDCLSEKSAWDTLAWFAVLVGMA  423

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            G L   G+++W S+ V KV+  L L W  +FG+L   YF+ HY FAS   H+GA+F+AFL
Sbjct  424  GQLTNLGVVTWMSDCVAKVLQSLSLGWPAAFGLLQAAYFFIHYLFASQTGHVGALFSAFL  483

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            ++  A G P  LGAL L++ +N+ G LTHY  G A V+YGA YV L   +  GF+++
Sbjct  484  AMHIAAGVPGILGALALAYNTNLFGALTHYSSGQAAVYYGAGYVDLPDVFKIGFVMA  540



>ref|XP_006394170.1| hypothetical protein EUTSA_v10003922mg [Eutrema salsugineum]
 dbj|BAJ34188.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ31456.1| hypothetical protein EUTSA_v10003922mg [Eutrema salsugineum]
Length=561

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 86/177 (49%), Positives = 120/177 (68%), Gaps = 0/177 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            +L+ V LW+ G  L I +V AA++GL+ILL+ GV++W +CLSE  AWDTL WFA L+ MA
Sbjct  364  MLLAVTLWICGETLGIPSVVAAMIGLSILLLLGVLNWDDCLSEKSAWDTLAWFAVLVGMA  423

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            G L   G+++W S+ V KV+  L LSW  +FG+L   YF+ HY FAS   H+GA+F+AFL
Sbjct  424  GQLTNLGVVTWMSDCVAKVLQSLSLSWPAAFGLLQAAYFFIHYLFASQTGHVGALFSAFL  483

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            ++  A G P  L AL L++ +N+ G LTHY  G A V+YGA YV L   +  GF+++
Sbjct  484  AMNIAAGVPGILAALALAYNTNLFGALTHYSSGQAAVYYGAGYVDLPDVFKIGFVMA  540



>ref|WP_035157533.1| 2-oxoglutarate translocator [Lactobacillus reuteri]
 gb|KGE70211.1| 2-oxoglutarate translocator [Lactobacillus reuteri]
Length=473

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 93/197 (47%), Positives = 131/197 (66%), Gaps = 2/197 (1%)
 Frame = -3

Query  752  LITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAG  573
            +I + LW+ GS + IDA  AA + L +LL+ GV+SW+E L E  AW+TLTWF+ L+ MAG
Sbjct  279  VIALVLWIVGSFIGIDATLAAFIALGLLLLCGVLSWQEVLHETGAWNTLTWFSVLVMMAG  338

Query  572  YLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLS  393
             L   G I W S+TV   + G+  +W L   IL++ YFYSHY FAS  AH+ AM++AFL+
Sbjct  339  QLTTLGFIPWLSKTVGNSLHGM--NWILVLVILIIAYFYSHYLFASSTAHVTAMYSAFLA  396

Query  392  VASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVSvvni  213
            VA +   PP L AL+L F  N+M   THY  G APV +G+ YVP +KWW   F++ +  +
Sbjct  397  VAISAHVPPMLAALMLGFFGNLMASTTHYASGPAPVLFGSGYVPQSKWWSLNFVLGIFYL  456

Query  212  iiwlgvggiwWKAIGLW  162
            ++W+G+G +W K IG+W
Sbjct  457  VVWIGIGSLWMKVIGMW  473



>ref|WP_020356279.1| MULTISPECIES: sodium:sulfate symporter transmembrane region family 
protein [Chlamydia]
 gb|EPP36673.1| sodium:sulfate symporter transmembrane region family protein 
[Chlamydia psittaci 10_743_SC13]
 gb|EPP38268.1| sodium:sulfate symporter transmembrane region family protein 
[Chlamydia psittaci 10_881_SC42]
 gb|AHK63253.1| Putative malate transporter YflS [Chlamydia avium 10DC88]
Length=470

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 116/174 (67%), Gaps = 3/174 (2%)
 Frame = -3

Query  743  VGLWVFGSVLNIDavtaailgltillvtgvVSW-KECLSEAVAWDTLTWFAALIAMAGYL  567
            V LW FG  L I A TAA++G+++L++T ++ W K+ ++   AW+T  WF ALI MA  L
Sbjct  278  VILWTFGDFLRISATTAALIGISLLILTNILDWQKDVIANTTAWETFIWFGALIMMASLL  337

Query  566  NKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVA  387
            NK G I    ET    V GL  SW++ F IL L+YFYSHY FAS  AHIGAM+  FL+VA
Sbjct  338  NKLGFIPLIGETAAAAVAGL--SWKIGFPILFLIYFYSHYLFASNTAHIGAMYPVFLAVA  395

Query  386  SALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
             +LGT P    L L+F SN+ GGLTHYG G AP+++G+  V + +WW  GF++S
Sbjct  396  ISLGTNPMFAVLSLAFSSNLFGGLTHYGSGPAPLYFGSKLVNIKEWWRSGFILS  449



>ref|WP_033565163.1| 2-oxoglutarate translocator [Sphingobacteriaceae bacterium DW12]
Length=476

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 119/170 (70%), Gaps = 2/170 (1%)
 Frame = -3

Query  737  LWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGYLNKY  558
            LW+FG+ L+IDA T A +GLT+LL+T V++W++  SE  AWDT+ WFA L+ MA  LN+ 
Sbjct  287  LWIFGASLSIDATTTAFIGLTLLLLTSVLTWEDVKSEKGAWDTIVWFAVLVMMASSLNEL  346

Query  557  GLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVASAL  378
            G I WFS+ V   +GGL  +W ++F +++L+YF+SHY FAS  AH+ AM+ A L V  +L
Sbjct  347  GFIGWFSDLVRVQIGGL--NWMIAFPVIILVYFFSHYIFASATAHVAAMYAALLGVGVSL  404

Query  377  GTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLV  228
            G PP L A++L F+ +I G LTHYG G APV++G+ YV L  WW  G  +
Sbjct  405  GIPPMLLAMMLGFMGSIYGVLTHYGHGPAPVYFGSGYVELKAWWLRGLEI  454



>ref|WP_020450525.1| MULTISPECIES: 2-oxoglutarate/malate transporter YflS [Bacillus]
 gb|AGN35273.1| 2-oxoglutarate/malate transporter YflS [Bacillus licheniformis 
9945A]
 gb|ETB72216.1| 2-oxoglutarate translocator [Bacillus sp. CPSM8]
 gb|KJD54202.1| 2-oxoglutarate translocator [Bacillus amyloliquefaciens]
Length=478

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 125/176 (71%), Gaps = 2/176 (1%)
 Frame = -3

Query  752  LITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAG  573
            L+ + LW+FG  L IDA T A++GL +LL+T V++W +   E  AWDTLTWFAAL+ +A 
Sbjct  284  LLVLFLWIFGGNLKIDATTTALIGLAVLLLTQVLTWDDIKKEQGAWDTLTWFAALVMLAS  343

Query  572  YLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLS  393
            +LN+ G++ WFS+ +   V G   SW  +F IL+ +Y+YSHYFFAS  AHI AM++AFL+
Sbjct  344  FLNELGMVGWFSDAMKSYVSGF--SWVSAFLILIAVYYYSHYFFASATAHISAMYSAFLA  401

Query  392  VASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            V  A G PP L AL L+F SN+    THYG G+APVF+GA Y+P +KWW  GF++S
Sbjct  402  VIIAAGAPPLLAALSLAFFSNLFASTTHYGAGAAPVFFGAGYIPQSKWWSIGFILS  457



>ref|NP_201234.1| dicarboxylate transport 2.1 [Arabidopsis thaliana]
 sp|Q9FMF7.1|DIT21_ARATH RecName: Full=Dicarboxylate transporter 2.1, chloroplastic; AltName: 
Full=AtpDCT1; AltName: Full=Glutamate/malate translocator; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB09860.1| 2-oxoglutarate/malate translocator [Arabidopsis thaliana]
 gb|AAL07178.1| putative 2-oxoglutarate/malate translocator protein [Arabidopsis 
thaliana]
 gb|AAN31801.1| putative 2-oxoglutarate/malate translocator [Arabidopsis thaliana]
 gb|AAU95461.1| At5g64290 [Arabidopsis thaliana]
 gb|AED97866.1| dicarboxylate transport 2.1 [Arabidopsis thaliana]
Length=563

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 87/177 (49%), Positives = 120/177 (68%), Gaps = 0/177 (0%)
 Frame = -3

Query  755  LLITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMA  576
            +L+ V LW+ G  L I +V AA++GL+ILLV GV++W +CLSE  AWDTL WFA L+ MA
Sbjct  366  MLLAVTLWICGETLGIPSVVAAMIGLSILLVLGVLNWDDCLSEKSAWDTLAWFAVLVGMA  425

Query  575  GYLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFL  396
            G L   G+++W S+ V KV+  L LSW  +FG+L   YF+ HY FAS   H+GA+F+AFL
Sbjct  426  GQLTNLGVVTWMSDCVAKVLQSLSLSWPAAFGLLQAAYFFIHYLFASQTGHVGALFSAFL  485

Query  395  SVASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            ++  A G P  L AL L++ +N+ G LTHY  G A V+YGA YV L   +  GF+++
Sbjct  486  AMHIAAGVPGILAALALAYNTNLFGALTHYSSGQAAVYYGAGYVDLPDVFKIGFVMA  542



>ref|WP_039073282.1| MULTISPECIES: 2-oxoglutarate translocator [Bacillus]
 gb|AJO17019.1| YflS protein [Bacillus licheniformis]
Length=478

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 125/176 (71%), Gaps = 2/176 (1%)
 Frame = -3

Query  752  LITVGLWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAG  573
            L+ + LW+FG  L IDA T A++GL +LL+T V++W +   E  AWDTLTWFAAL+ +A 
Sbjct  284  LLVLFLWIFGGNLKIDATTTALIGLAVLLLTQVLTWDDIKKEQGAWDTLTWFAALVMLAS  343

Query  572  YLNKYGLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLS  393
            +LN+ G++ WFS+ +   V G   SW  +F IL+ +Y+YSHYFFAS  AHI AM++AFL+
Sbjct  344  FLNELGMVGWFSDAMKSYVSGF--SWVSAFLILIAVYYYSHYFFASATAHISAMYSAFLA  401

Query  392  VASALGTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLVS  225
            V  A G PP L AL L+F SN+    THYG G+APVF+GA Y+P +KWW  GF++S
Sbjct  402  VIIAAGAPPLLAALSLAFFSNLFASTTHYGAGAAPVFFGAGYIPQSKWWSIGFILS  457



>ref|WP_027378953.1| 2-oxoglutarate translocator [Chryseobacterium daeguense]
Length=476

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 84/170 (49%), Positives = 118/170 (69%), Gaps = 2/170 (1%)
 Frame = -3

Query  737  LWVFGSVLNIDavtaailgltillvtgvVSWKECLSEAVAWDTLTWFAALIAMAGYLNKY  558
            LW+FG  L+IDA T A +GLT+LL+T V++W++  SE  AWDT+ WFA L+ MA  LN+ 
Sbjct  287  LWIFGGSLSIDATTTAFIGLTLLLLTSVLTWEDVKSEKGAWDTIVWFAVLVMMASSLNEL  346

Query  557  GLISWFSETVVKVVGGLGLSWQLSFGILVLLYFYSHYFFASGAAHIGAMFTAFLSVASAL  378
            G I WFS+ + + +G +  +W ++F +++L+YF+SHY FAS  AH+ AM+ A L V  A+
Sbjct  347  GFIGWFSDLIKQKIGDM--TWTVAFPVIILVYFFSHYIFASATAHVAAMYAALLGVGVAV  404

Query  377  GTPPYLGALVLSFLSNIMGGLTHYGIGSAPVFYGANYVPLAKWWGYGFLV  228
            G PP L A++L FL +I G LTHYG G APVF+G+ YV L  WW  G  +
Sbjct  405  GIPPMLLAMMLGFLGSIYGVLTHYGHGPAPVFFGSGYVDLKSWWLRGLEI  454



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1414353888260