BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF008F22

Length=689
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ACF81592.1|  unknown                                                 325   1e-109   Zea mays [maize]
dbj|BAO57272.1|  elongation factor 1-alpha                              334   1e-109   Ipomoea nil [qian niu]
ref|XP_009613861.1|  PREDICTED: elongation factor 1-alpha-like          332   8e-109   Nicotiana tomentosiformis
dbj|BAH20400.1|  AT1G07940                                              322   2e-108   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009617039.1|  PREDICTED: elongation factor 1-alpha               331   2e-108   Nicotiana tomentosiformis
ref|XP_006307730.1|  hypothetical protein CARUB_v100096370mg            321   4e-108   
ref|NP_001234035.1|  elongation factor 1-alpha                          330   5e-108   Solanum lycopersicum
gb|AAT72900.1|  elongation factor 1A SMV resistance-related protein     321   6e-108   Glycine max [soybeans]
sp|P43643.1|EF1A_TOBAC  RecName: Full=Elongation factor 1-alpha; ...    330   8e-108   Nicotiana tabacum [American tobacco]
ref|XP_009783256.1|  PREDICTED: elongation factor 1-alpha               330   8e-108   Nicotiana sylvestris
gb|KJB73626.1|  hypothetical protein B456_011G2412002                   320   8e-108   Gossypium raimondii
dbj|BAA34348.1|  elongation factor-1 alpha                              330   8e-108   Nicotiana paniculata
gb|ABW74483.1|  elongation factor                                       320   1e-107   Paeonia suffruticosa [moutan peony]
ref|XP_004251154.1|  PREDICTED: elongation factor 1-alpha-like          329   1e-107   Solanum lycopersicum
gb|AAQ90154.1|  putative translation elongation factor protein          323   1e-107   Solanum tuberosum [potatoes]
gb|AFW76429.1|  putative translation elongation factor Tu family ...    323   2e-107   
ref|XP_009593325.1|  PREDICTED: elongation factor 1-alpha               328   3e-107   Nicotiana tomentosiformis
gb|AGH55661.1|  elongation factor 1-alpha                               325   3e-107   Atropa belladonna [deadly nightshade]
dbj|BAC23049.1|  Elongation factor 1-alpha                              328   3e-107   Solanum tuberosum [potatoes]
ref|XP_007015467.1|  GTP binding Elongation factor Tu family prot...    325   3e-107   
ref|XP_009793830.1|  PREDICTED: elongation factor 1-alpha-like          328   3e-107   Nicotiana sylvestris
ref|XP_009762748.1|  PREDICTED: elongation factor 1-alpha-like          328   3e-107   Nicotiana sylvestris
dbj|BAF75826.1|  hypothetical protein                                   319   3e-107   Malus domestica [apple tree]
dbj|BAF75825.1|  hypothetical protein                                   318   4e-107   Malus domestica [apple tree]
gb|ABV26710.1|  elongation factor 1 alpha                               327   6e-107   Gerbera hybrid cultivar
ref|NP_001049145.1|  Os03g0177400                                       327   6e-107   
ref|XP_006646939.1|  PREDICTED: elongation factor 1-alpha-like          327   6e-107   Oryza brachyantha
gb|ABF94276.1|  Elongation factor 1-alpha, putative, expressed          327   7e-107   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006340223.1|  PREDICTED: elongation factor 1-alpha-like          327   7e-107   Solanum tuberosum [potatoes]
gb|AAC15413.1|  translation elongation factor-1 alpha                   327   8e-107   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010557310.1|  PREDICTED: elongation factor 1-alpha-like          327   8e-107   Tarenaya hassleriana [spider flower]
dbj|BAA23658.1|  EF-1 alpha                                             327   8e-107   Oryza sativa [red rice]
dbj|BAN42602.1|  putative elongation factor 1-alpha                     318   8e-107   Pyrus pyrifolia var. culta [Asian pear]
ref|NP_001275420.1|  elongation factor 1-alpha-like protein             325   1e-106   Solanum tuberosum [potatoes]
ref|XP_010535587.1|  PREDICTED: elongation factor 1-alpha               327   1e-106   Tarenaya hassleriana [spider flower]
gb|AAN77897.1|  elongation factor 1 alpha                               327   1e-106   Stevia rebaudiana
ref|XP_007015463.1|  GTP binding Elongation factor Tu family protein    327   2e-106   
gb|AHE76183.1|  elongation factor 1-alpha                               327   2e-106   Chrysanthemum indicum
gb|AAR83865.1|  elongation factor 1-alpha                               316   2e-106   Capsicum annuum
ref|NP_001275481.1|  elongation factor 1-alpha-like                     326   3e-106   Solanum tuberosum [potatoes]
gb|ABB02622.1|  elongation factor 1-alpha-like protein                  324   3e-106   Solanum tuberosum [potatoes]
gb|ABB86283.1|  elongation factor-1 alpha-like                          326   3e-106   Solanum tuberosum [potatoes]
dbj|BAL14665.1|  elongation factor 1-alpha                              326   3e-106   Chrysanthemum seticuspe f. boreale
ref|XP_010521772.1|  PREDICTED: elongation factor 1-alpha-like          326   3e-106   Tarenaya hassleriana [spider flower]
emb|CAL25349.1|  elongation factor 1 alpha                              317   3e-106   Platanus x hispanica [London plane tree]
ref|XP_006343452.1|  PREDICTED: elongation factor 1-alpha-like          325   3e-106   Solanum tuberosum [potatoes]
gb|AGT16893.1|  elongation factor 1-alpha                               325   3e-106   Saccharum hybrid cultivar R570
gb|AGT16628.1|  elongation factor 1 alpha                               324   4e-106   Saccharum hybrid cultivar R570
ref|XP_007015466.1|  GTP binding Elongation factor Tu family prot...    325   4e-106   Theobroma cacao [chocolate]
ref|XP_011091454.1|  PREDICTED: elongation factor 1-alpha-like          325   5e-106   Sesamum indicum [beniseed]
ref|XP_010937512.1|  PREDICTED: elongation factor 1-alpha               325   5e-106   Elaeis guineensis
ref|XP_010542598.1|  PREDICTED: elongation factor 1-alpha-like          325   5e-106   Tarenaya hassleriana [spider flower]
gb|AGZ15393.1|  elongation factor 1-alpha                               320   5e-106   Phaseolus vulgaris [French bean]
gb|KDP29082.1|  hypothetical protein JCGZ_16471                         318   6e-106   Jatropha curcas
ref|NP_001152668.1|  LOC100286309                                       325   6e-106   Zea mays [maize]
gb|ACR38047.1|  unknown                                                 325   6e-106   Zea mays [maize]
ref|XP_006304901.1|  hypothetical protein CARUB_v100092941mg            320   7e-106   
gb|KJB53395.1|  hypothetical protein B456_009G4199001                   320   7e-106   Gossypium raimondii
gb|ABU63160.1|  elongation factor                                       325   9e-106   Saccharum officinarum [noble cane]
gb|AFC88830.1|  putative elongation factor 1-alpha                      325   9e-106   Miscanthus sinensis
gb|AGH32502.1|  translation elongation factor-1 alpha                   324   9e-106   Stylosanthes guianensis [stylo]
gb|AAL79775.1|  elongation factor 1 alpha                               324   1e-105   Saccharum hybrid cultivar CP72-2086
gb|KHG26926.1|  Elongation factor 1-alpha                               324   1e-105   Gossypium arboreum [tree cotton]
ref|XP_002518072.1|  elongation factor 1-alpha, putative                319   1e-105   Ricinus communis
gb|KHG20498.1|  Elongation factor 1-alpha                               324   1e-105   Gossypium arboreum [tree cotton]
gb|KJB53396.1|  hypothetical protein B456_009G4199001                   320   1e-105   Gossypium raimondii
gb|AAL79774.1|AF331849_1  elongation factor 1 alpha                     324   1e-105   Saccharum hybrid cultivar CP65-357
ref|XP_002539209.1|  elongation factor 1-alpha, putative                319   1e-105   Ricinus communis
ref|XP_004962277.1|  PREDICTED: elongation factor 1-alpha-like is...    324   1e-105   Setaria italica
emb|CDX70032.1|  BnaA10g23810D                                          320   1e-105   
ref|XP_004962249.1|  PREDICTED: elongation factor 1-alpha-like          324   1e-105   
gb|AID52924.1|  elongation factor 1-alpha                               324   2e-105   Carthamus tinctorius
ref|NP_001274875.1|  elongation factor 1-alpha-like protein             324   2e-105   Solanum tuberosum [potatoes]
gb|AGZ90153.1|  elongation factor 1-alpha                               317   2e-105   Litsea cubeba [may chang]
dbj|BAH56641.1|  elongation factor 1a                                   321   2e-105   Nelumbo nucifera [Indian lotus]
ref|XP_010916901.1|  PREDICTED: elongation factor 1-alpha               324   2e-105   Elaeis guineensis
ref|XP_007009760.1|  GTP binding Elongation factor Tu family prot...    323   2e-105   Theobroma cacao [chocolate]
ref|XP_010032223.1|  PREDICTED: elongation factor 1-alpha isoform X2    323   2e-105   Eucalyptus grandis [rose gum]
ref|XP_010032224.1|  PREDICTED: elongation factor 1-alpha isoform X3    323   2e-105   
ref|XP_008783723.1|  PREDICTED: elongation factor 1-alpha isoform X2    318   2e-105   
ref|XP_008656153.1|  PREDICTED: elongation factor 1-alpha-like          323   2e-105   Zea mays [maize]
gb|AIX10769.1|  elongation factor 1 alpha                               323   3e-105   Panax notoginseng [san-qi]
ref|NP_001105587.1|  elongation factor 1-alpha                          323   3e-105   Zea mays [maize]
emb|CAD60652.1|  elongation factor                                      323   3e-105   Solanum tuberosum [potatoes]
ref|XP_010032221.1|  PREDICTED: elongation factor 1-alpha isoform X1    323   3e-105   Eucalyptus grandis [rose gum]
emb|CAL07988.1|  translation elongation factor 1 alpha                  315   3e-105   Platanus x hispanica [London plane tree]
gb|ABA12225.1|  translation elongation factor 1A-9                      323   3e-105   Gossypium hirsutum [American cotton]
gb|KJB09231.1|  hypothetical protein B456_001G130700                    323   3e-105   Gossypium raimondii
dbj|BAN42601.1|  putative elongation factor 1-alpha                     314   4e-105   Pyrus pyrifolia var. culta [Asian pear]
ref|XP_004984833.1|  PREDICTED: elongation factor 1-alpha-like          323   4e-105   Setaria italica
gb|ACG34498.1|  elongation factor 1-alpha                               323   4e-105   Zea mays [maize]
ref|XP_008656156.1|  PREDICTED: elongation factor 1-alpha-like is...    323   4e-105   Zea mays [maize]
gb|KHG23927.1|  Elongation factor 1-alpha                               323   4e-105   Gossypium arboreum [tree cotton]
ref|XP_010244958.1|  PREDICTED: elongation factor 1-alpha-like          323   4e-105   Nelumbo nucifera [Indian lotus]
ref|XP_010937806.1|  PREDICTED: elongation factor 1-alpha-like          323   4e-105   Elaeis guineensis
gb|AEN79476.1|  elongation factor 1-alpha                               323   4e-105   Ziziphus jujuba [Chinese jujube]
ref|XP_010541344.1|  PREDICTED: elongation factor 1-alpha               323   5e-105   Tarenaya hassleriana [spider flower]
emb|CAA06245.1|  elongation factor 1-alpha (EF1-a)                      318   5e-105   Cicer arietinum [garbanzo]
gb|ABA12221.1|  translation elongation factor 1A-5                      323   5e-105   Gossypium hirsutum [American cotton]
gb|AGY80449.1|  elongation factor 1-alpha                               322   6e-105   Dendrocalamus latiflorus [sweet bamboo]
dbj|BAC66180.1|  elongation factor 1A                                   322   6e-105   Avicennia marina
ref|XP_006417745.1|  hypothetical protein EUTSA_v10007619mg             322   6e-105   Eutrema salsugineum [saltwater cress]
ref|XP_006436251.1|  hypothetical protein CICLE_v10033471mg             322   6e-105   Citrus clementina [clementine]
ref|XP_009342341.1|  PREDICTED: elongation factor 1-alpha               322   7e-105   Pyrus x bretschneideri [bai li]
gb|AFY06644.1|  elongation factor 1-alpha                               318   7e-105   Carica papaya [mamon]
gb|KDO48480.1|  hypothetical protein CISIN_1g0132372mg                  322   7e-105   Citrus sinensis [apfelsine]
gb|AGJ50595.1|  EF1alpha                                                322   7e-105   Pericallis cruenta
gb|AAF63516.1|AF242732_1  translation elongation factor 1a              322   7e-105   Capsicum annuum
gb|KDP29085.1|  hypothetical protein JCGZ_16474                         321   8e-105   Jatropha curcas
ref|NP_001105617.1|  elongation factor alpha3                           322   8e-105   Zea mays [maize]
ref|NP_001105933.1|  elongation factor alpha2                           322   8e-105   
ref|XP_008792062.1|  PREDICTED: elongation factor 1-alpha               322   9e-105   Phoenix dactylifera
gb|ADC68236.1|  elongation factor 1-alpha                               314   1e-104   Dendrobium nobile
gb|ADI24333.1|  elongation factor 1-alpha                               322   1e-104   Miscanthus sinensis
emb|CDY61938.1|  BnaCnng38780D                                          321   1e-104   Brassica napus [oilseed rape]
emb|CDY22710.1|  BnaC08g43440D                                          321   1e-104   Brassica napus [oilseed rape]
ref|XP_010542596.1|  PREDICTED: elongation factor 1-alpha-like          322   1e-104   Tarenaya hassleriana [spider flower]
gb|KHN18669.1|  Elongation factor 1-alpha                               322   1e-104   Glycine soja [wild soybean]
ref|NP_001288465.1|  elongation factor 1-alpha-like                     322   1e-104   Zea mays [maize]
gb|AFW77593.1|  putative translation elongation factor Tu family ...    322   1e-104   
gb|AAL57653.1|  At1g07930/T6D22_3                                       322   1e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009144204.1|  PREDICTED: elongation factor 1-alpha 1-like        322   1e-104   Brassica rapa
ref|XP_002528020.1|  elongation factor 1-alpha, putative                318   1e-104   
gb|ACG31866.1|  elongation factor 1-alpha                               322   1e-104   Zea mays [maize]
ref|NP_200847.1|  elongation factor 1-alpha 4                           322   1e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006280459.1|  hypothetical protein CARUB_v10026391mg             322   1e-104   Capsella rubella
ref|XP_010032227.1|  PREDICTED: elongation factor 1-alpha-like          322   1e-104   Eucalyptus grandis [rose gum]
dbj|BAF02151.1|  elongation factor 1-alpha                              322   1e-104   Arabidopsis thaliana [mouse-ear cress]
gb|AAK82537.1|  At1g07930/T6D22_3                                       322   1e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009148045.1|  PREDICTED: elongation factor 1-alpha 1             322   1e-104   Brassica rapa
emb|CAA34456.1|  elongation factor 1-alpha                              322   2e-104   Arabidopsis thaliana [mouse-ear cress]
gb|AAK32834.1|AF361822_1  At1g07930/T6D22_3                             322   2e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008790814.1|  PREDICTED: elongation factor 1-alpha-like          321   2e-104   Phoenix dactylifera
ref|XP_011089874.1|  PREDICTED: elongation factor 1-alpha               321   2e-104   Sesamum indicum [beniseed]
ref|XP_011089339.1|  PREDICTED: elongation factor 1-alpha isoform X1    321   2e-104   Sesamum indicum [beniseed]
gb|AAK25877.1|AF360167_1  putative translation elongation factor ...    321   2e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004309880.1|  PREDICTED: elongation factor 1-alpha               321   2e-104   Fragaria vesca subsp. vesca
gb|ABA12220.1|  translation elongation factor 1A-4                      321   2e-104   Gossypium hirsutum [American cotton]
ref|XP_009126609.1|  PREDICTED: elongation factor 1-alpha 1-like        321   2e-104   Brassica rapa
ref|XP_010067278.1|  PREDICTED: elongation factor 1-alpha-like          321   2e-104   Eucalyptus grandis [rose gum]
gb|ABA12217.1|  translation elongation factor 1A-1                      321   2e-104   Gossypium hirsutum [American cotton]
ref|NP_001288407.1|  elongation factor 1-alpha-like                     321   2e-104   Zea mays [maize]
gb|AAL69396.1|  elongation factor 1-alpha                               321   2e-104   Elaeis oleifera
sp|Q41803.1|EF1A_MAIZE  RecName: Full=Elongation factor 1-alpha; ...    321   2e-104   Zea mays [maize]
ref|XP_009358244.1|  PREDICTED: elongation factor 1-alpha-like          321   2e-104   Pyrus x bretschneideri [bai li]
gb|ABA12218.1|  translation elongation factor 1A-2                      321   3e-104   Gossypium hirsutum [American cotton]
ref|XP_004157309.1|  PREDICTED: elongation factor 1-alpha-like          321   3e-104   
ref|XP_008358325.1|  PREDICTED: elongation factor 1-alpha               320   3e-104   Malus domestica [apple tree]
gb|KDP29084.1|  hypothetical protein JCGZ_16473                         319   3e-104   Jatropha curcas
gb|ABA12219.1|  translation elongation factor 1A-3                      320   3e-104   Gossypium hirsutum [American cotton]
gb|KJB48746.1|  hypothetical protein B456_008G084000                    319   3e-104   Gossypium raimondii
ref|XP_008792073.1|  PREDICTED: elongation factor 1-alpha-like          320   3e-104   Phoenix dactylifera
emb|CDX93604.1|  BnaA06g04440D                                          321   3e-104   
gb|AAD56020.1|AF181492_1  elongation factor-1 alpha 3                   320   4e-104   Lilium longiflorum [Easter lily]
ref|XP_010032225.1|  PREDICTED: elongation factor 1-alpha-like          320   4e-104   Eucalyptus grandis [rose gum]
ref|XP_006424629.1|  hypothetical protein CICLE_v10028446mg             320   4e-104   Citrus clementina [clementine]
ref|XP_002518073.1|  elongation factor 1-alpha, putative                320   4e-104   Ricinus communis
ref|XP_007205199.1|  hypothetical protein PRUPE_ppa005718mg             320   4e-104   Prunus persica
emb|CDX95108.1|  BnaC05g05630D                                          321   5e-104   
gb|ABA12223.1|  translation elongation factor 1A-7                      320   5e-104   Gossypium hirsutum [American cotton]
ref|NP_001290506.1|  elongation factor 1-alpha                          320   6e-104   Elaeis guineensis
ref|XP_007151789.1|  hypothetical protein PHAVU_004G075100g             320   6e-104   Phaseolus vulgaris [French bean]
ref|XP_009392715.1|  PREDICTED: elongation factor 1-alpha-like          320   6e-104   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB48747.1|  hypothetical protein B456_008G084000                    319   6e-104   Gossypium raimondii
ref|XP_008380545.1|  PREDICTED: elongation factor 1-alpha-like          320   6e-104   Malus domestica [apple tree]
ref|XP_008789061.1|  PREDICTED: elongation factor 1-alpha-like          320   7e-104   Phoenix dactylifera
gb|AEI29162.1|  EF1a-like protein                                       318   7e-104   Phalaenopsis hybrid cultivar
ref|XP_011026992.1|  PREDICTED: elongation factor 1-alpha isoform X2    320   7e-104   Populus euphratica
ref|XP_004489551.1|  PREDICTED: elongation factor 1-alpha-like          320   7e-104   Cicer arietinum [garbanzo]
ref|XP_007009751.1|  GTP binding Elongation factor Tu family prot...    320   7e-104   Theobroma cacao [chocolate]
ref|XP_011031783.1|  PREDICTED: elongation factor 1-alpha-like          320   7e-104   Populus euphratica
ref|XP_010043711.1|  PREDICTED: elongation factor 1-alpha               320   7e-104   Eucalyptus grandis [rose gum]
ref|XP_011026991.1|  PREDICTED: elongation factor 1-alpha isoform X1    320   8e-104   Populus euphratica
ref|XP_011031786.1|  PREDICTED: elongation factor 1-alpha-like          316   8e-104   Populus euphratica
gb|AAN31833.1|  putative translation elongation factor eEF-1 alph...    320   9e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010939624.1|  PREDICTED: elongation factor 1-alpha-like          319   9e-104   Elaeis guineensis
gb|KHG01531.1|  Elongation factor 1-alpha                               319   9e-104   Gossypium arboreum [tree cotton]
gb|ABS10822.1|  elongation factor 1-alpha                               310   9e-104   Phaseolus vulgaris [French bean]
dbj|BAH19898.1|  AT1G07930                                              319   9e-104   Arabidopsis thaliana [mouse-ear cress]
sp|P29521.1|EF1A1_DAUCA  RecName: Full=Elongation factor 1-alpha;...    319   1e-103   Daucus carota [carrots]
ref|NP_001105565.1|  elongation factor alpha5                           319   1e-103   
gb|KDP29083.1|  hypothetical protein JCGZ_16472                         319   1e-103   Jatropha curcas
ref|XP_006858667.1|  hypothetical protein AMTR_s00066p00072310          319   1e-103   Amborella trichopoda
ref|XP_008783722.1|  PREDICTED: elongation factor 1-alpha isoform X1    319   1e-103   
ref|XP_010920912.1|  PREDICTED: elongation factor 1-alpha-like          319   1e-103   Elaeis guineensis
gb|ABA12224.1|  translation elongation factor 1A-8                      319   1e-103   Gossypium hirsutum [American cotton]
ref|XP_002528028.1|  elongation factor 1-alpha, putative                319   1e-103   
ref|XP_004307410.1|  PREDICTED: elongation factor 1-alpha               319   1e-103   Fragaria vesca subsp. vesca
ref|XP_003547695.1|  PREDICTED: elongation factor 1-alpha isoform 2     319   1e-103   Glycine max [soybeans]
ref|XP_007222129.1|  hypothetical protein PRUPE_ppa005702mg             319   1e-103   Prunus persica
ref|XP_010937804.1|  PREDICTED: elongation factor 1-alpha-like          319   1e-103   Elaeis guineensis
emb|CAA65453.1|  elongation factor                                      311   2e-103   Narcissus pseudonarcissus
gb|ACS68200.1|  elongation factor 1 alpha                               319   2e-103   Brassica napus [oilseed rape]
emb|CDY58828.1|  BnaAnng15460D                                          322   2e-103   Brassica napus [oilseed rape]
gb|KEH43533.1|  GTP-binding elongation factor Tu family protein         315   2e-103   Medicago truncatula
ref|XP_008224543.1|  PREDICTED: elongation factor 1-alpha               318   2e-103   Prunus mume [ume]
gb|KDP29086.1|  hypothetical protein JCGZ_16475                         318   2e-103   Jatropha curcas
ref|NP_001105935.1|  elongation factor alpha8                           318   2e-103   
ref|XP_003553292.1|  PREDICTED: elongation factor 1-alpha isoform 1     318   2e-103   Glycine max [soybeans]
gb|KGN51228.1|  Elongation factor 1-alpha                               317   2e-103   Cucumis sativus [cucumbers]
ref|XP_006424633.1|  hypothetical protein CICLE_v10028443mg             318   2e-103   Citrus clementina [clementine]
ref|XP_009126611.1|  PREDICTED: elongation factor 1-alpha 1-like        318   2e-103   Brassica rapa
gb|KHG28979.1|  Elongation factor 1-alpha                               318   3e-103   Gossypium arboreum [tree cotton]
gb|ABD66072.1|  elongation factor 1-alpha                               311   3e-103   Phoenix dactylifera
ref|XP_007207457.1|  hypothetical protein PRUPE_ppa005717mg             318   3e-103   Prunus persica
gb|KHN42761.1|  Elongation factor 1-alpha                               318   3e-103   Glycine soja [wild soybean]
gb|ACI96243.1|  elongation factor 1-alpha                               318   3e-103   Prunus persica
gb|KHN14872.1|  Elongation factor 1-alpha                               318   3e-103   Glycine soja [wild soybean]
gb|AFP44110.1|  elongation factor 1-alpha                               318   3e-103   Lycoris longituba
gb|AFJ04514.1|  elongation factor 1-alpha                               318   3e-103   Vernicia fordii [tung oil tree]
gb|ABB72813.1|  elongation factor 1-alpha-like protein                  318   3e-103   Solanum tuberosum [potatoes]
ref|XP_011089340.1|  PREDICTED: elongation factor 1-alpha isoform X2    318   3e-103   
dbj|BAC22125.1|  eukaryotic elongation factor 1A                        318   3e-103   Bruguiera sexangula
gb|ADR70875.1|  eukaryotic translation elongation factor 1-alpha        318   4e-103   Hevea brasiliensis [jebe]
ref|XP_009388387.1|  PREDICTED: elongation factor 1-alpha-like          318   4e-103   Musa acuminata subsp. malaccensis [pisang utan]
gb|ADW83729.1|  elongation factor 1-alpha                               308   4e-103   Musa acuminata AAA Group [Cavendish banana]
gb|KGN51227.1|  hypothetical protein Csa_5G495940                       314   4e-103   Cucumis sativus [cucumbers]
gb|AAL32631.1|  putative elongation factor 1-a                          318   4e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004309883.1|  PREDICTED: elongation factor 1-alpha-like          318   4e-103   Fragaria vesca subsp. vesca
ref|XP_006600131.1|  PREDICTED: elongation factor-1A isoform X1         317   5e-103   
ref|NP_001183947.1|  uncharacterized protein LOC100502553               316   5e-103   
gb|KHG24249.1|  Elongation factor 1-alpha                               316   6e-103   Gossypium arboreum [tree cotton]
ref|NP_001237425.1|  elongation factor-1A                               317   6e-103   
gb|ADR70874.1|  eukaryotic translation elongation factor 1-alpha        317   6e-103   Hevea brasiliensis [jebe]
gb|KGN47308.1|  hypothetical protein Csa_6G290890                       312   6e-103   Cucumis sativus [cucumbers]
gb|AIZ68131.1|  translation elongation factor 1-alpha                   317   7e-103   Ornithogalum longebracteatum [sea-onion]
sp|O24534.1|EF1A_VICFA  RecName: Full=Elongation factor 1-alpha; ...    317   7e-103   Vicia faba [broad bean]
gb|KHG27341.1|  Elongation factor 1-alpha                               317   7e-103   Gossypium arboreum [tree cotton]
gb|AHB86963.1|  elongation factor 1-alpha                               317   7e-103   Sedum alfredii
ref|XP_009403341.1|  PREDICTED: elongation factor 1-alpha-like          317   8e-103   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009381507.1|  PREDICTED: elongation factor 1-alpha-like          317   8e-103   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAN71914.1|  hypothetical protein VITISV_026485                     309   8e-103   Vitis vinifera
gb|AAY56337.1|  elongation factor-1 alpha                               317   8e-103   Musa acuminata [banana]
gb|AEQ75495.1|  elongation factor 1-alpha                               317   9e-103   Rosa multiflora [Japanese rose]
gb|AAV92325.1|  translation elongation factor-1 alpha                   310   9e-103   Pseudotsuga menziesii var. menziesii
ref|XP_009403064.1|  PREDICTED: elongation factor 1-alpha-like          317   9e-103   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009342345.1|  PREDICTED: elongation factor 1-alpha-like          317   9e-103   Pyrus x bretschneideri [bai li]
gb|ABA12222.1|  translation elongation factor 1A-6                      317   9e-103   Gossypium hirsutum [American cotton]
ref|XP_008380544.1|  PREDICTED: elongation factor 1-alpha-like          317   1e-102   Malus domestica [apple tree]
ref|XP_009420035.1|  PREDICTED: elongation factor 1-alpha               317   1e-102   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAD56019.1|AF181491_1  elongation factor-1 alpha 2                   317   1e-102   Lilium longiflorum [Easter lily]
gb|AAX54511.1|  elongation factor 1 alpha                               317   1e-102   Actinidia deliciosa [Chinese gooseberry]
gb|AGI15328.1|  elongation factor 1                                     317   1e-102   Aegiceras corniculatum
gb|KGN61480.1|  hypothetical protein Csa_2G139820                       313   1e-102   Cucumis sativus [cucumbers]
ref|NP_001280807.1|  elongation factor 1-alpha-like                     317   1e-102   Malus domestica [apple tree]
ref|XP_006846237.1|  hypothetical protein AMTR_s00012p00237190          317   1e-102   Amborella trichopoda
ref|XP_003604823.1|  Elongation factor 1-alpha                          317   1e-102   
dbj|BAM13874.1|  elongation factor 1 alpha                              316   1e-102   Symplocarpus renifolius
ref|XP_002311107.1|  ADR12-2 family protein                             316   1e-102   Populus trichocarpa [western balsam poplar]
ref|XP_002460859.1|  hypothetical protein SORBIDRAFT_02g036420          316   1e-102   Sorghum bicolor [broomcorn]
gb|AAD27590.1|AF121261_1  elongation factor 1-alpha 1                   316   1e-102   Lilium longiflorum [Easter lily]
gb|AIM48895.1|  elongation factor 1-alpha                               316   2e-102   Cinnamomum camphora
ref|XP_011040946.1|  PREDICTED: elongation factor 1-alpha-like is...    316   2e-102   Populus euphratica
ref|NP_001151074.1|  elongation factor 1-alpha                          316   2e-102   
gb|EPS66340.1|  elongation factor 1-alpha                               316   2e-102   Genlisea aurea
gb|AAF99703.1|  elongation factor                                       316   2e-102   Saccharum officinarum [noble cane]
ref|XP_002312029.1|  ADR12-2 family protein                             316   2e-102   Populus trichocarpa [western balsam poplar]
gb|AES59072.2|  GTP-binding elongation factor Tu family protein         317   2e-102   Medicago truncatula
emb|CAJ38380.1|  translation elongation factor 1 alpha                  309   2e-102   Plantago major [cart-track plant]
gb|KEH43536.1|  GTP-binding elongation factor Tu family protein         316   2e-102   Medicago truncatula
gb|AES62210.2|  GTP-binding elongation factor Tu family protein         316   2e-102   Medicago truncatula
ref|XP_003588821.1|  Elongation factor 1-alpha                          316   2e-102   
gb|KJB76528.1|  hypothetical protein B456_012G093800                    316   2e-102   Gossypium raimondii
gb|ABF00115.1|  elongation factor 1-alpha                               316   2e-102   Litchi chinensis [litchi]
ref|XP_007151593.1|  hypothetical protein PHAVU_004G060000g             316   2e-102   Phaseolus vulgaris [French bean]
gb|AGV54713.1|  elongation factor 1-alpha                               316   2e-102   Phaseolus vulgaris [French bean]
sp|P25698.2|EF1A_SOYBN  RecName: Full=Elongation factor 1-alpha; ...    316   2e-102   Glycine max [soybeans]
ref|XP_008457229.1|  PREDICTED: elongation factor 1-alpha               316   3e-102   Cucumis melo [Oriental melon]
gb|AGC94754.1|  elongation factor 1 alpha                               315   3e-102   Euphorbia lathyris
ref|XP_003558459.1|  PREDICTED: elongation factor 1-alpha               315   3e-102   Brachypodium distachyon [annual false brome]
sp|P34823.1|EF1A2_DAUCA  RecName: Full=Elongation factor 1-alpha;...    315   3e-102   Daucus carota [carrots]
ref|XP_011004182.1|  PREDICTED: elongation factor 1-alpha-like          315   4e-102   Populus euphratica
ref|XP_009380678.1|  PREDICTED: elongation factor 1-alpha-like          315   4e-102   
ref|XP_003536362.1|  PREDICTED: elongation factor 1-alpha-like is...    315   4e-102   Glycine max [soybeans]
ref|XP_002311106.1|  ADR12-2 family protein                             315   4e-102   Populus trichocarpa [western balsam poplar]
ref|XP_006381487.1|  hypothetical protein POPTR_0006s13310g             315   5e-102   Populus trichocarpa [western balsam poplar]
sp|O49169.1|EF1A_MANES  RecName: Full=Elongation factor 1-alpha; ...    315   5e-102   Manihot esculenta [manioc]
ref|XP_008463920.1|  PREDICTED: elongation factor 1-alpha               315   5e-102   Cucumis melo [Oriental melon]
ref|XP_010669657.1|  PREDICTED: elongation factor 1-alpha               315   5e-102   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002277159.1|  PREDICTED: elongation factor 1-alpha               315   5e-102   
ref|XP_008385284.1|  PREDICTED: elongation factor 1-alpha-like          315   5e-102   
ref|XP_008224492.1|  PREDICTED: elongation factor 1-alpha               315   6e-102   
ref|XP_008782124.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    305   6e-102   
ref|XP_007027265.1|  GTP binding Elongation factor Tu family protein    318   7e-102   
ref|XP_002284964.1|  PREDICTED: elongation factor 1-alpha               315   7e-102   
gb|EPS66069.1|  elongation factor 1-alpha                               314   8e-102   
dbj|BAM13877.1|  elongation factor 1 alpha                              314   8e-102   
dbj|BAC22127.1|  eukaryotic elongation factor 1A                        314   1e-101   
ref|NP_001104938.1|  elongation factor 1 alpha                          314   1e-101   
ref|XP_004138964.1|  PREDICTED: elongation factor 1-alpha-like          314   1e-101   
gb|AES74993.2|  GTP-binding elongation factor Tu family protein         313   2e-101   
ref|XP_003591959.1|  Elongation factor 1-alpha                          317   2e-101   
ref|XP_006378755.1|  hypothetical protein POPTR_0010s22560g             313   2e-101   
ref|XP_004512426.1|  PREDICTED: elongation factor 1-alpha-like          313   2e-101   
dbj|BAC22126.1|  eukaryotic elongation factor 1A                        313   2e-101   
ref|XP_006856244.1|  hypothetical protein AMTR_s00059p00216110          313   2e-101   
ref|XP_004163381.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    313   3e-101   
ref|XP_010521578.1|  PREDICTED: elongation factor 1-alpha               313   3e-101   
ref|XP_004149547.1|  PREDICTED: elongation factor 1-alpha-like          313   3e-101   
ref|XP_010669660.1|  PREDICTED: elongation factor 1-alpha-like          312   4e-101   
ref|XP_007218005.1|  hypothetical protein PRUPE_ppa005706mg             312   4e-101   
gb|AGD99674.1|  eukaryotic elongation factor 1A                         312   4e-101   
ref|XP_009131916.1|  PREDICTED: elongation factor 1-alpha 1-like        312   5e-101   
ref|XP_009421379.1|  PREDICTED: elongation factor 1-alpha-like          312   5e-101   
gb|ABD66517.1|  EF-1 alpha                                              312   8e-101   
gb|ADK73624.1|  elongation factor 1 alpha                               306   8e-101   
ref|XP_007143679.1|  hypothetical protein PHAVU_007G092500g             312   8e-101   
ref|XP_006387491.1|  hypothetical protein POPTR_0966s00200g             312   8e-101   
ref|XP_002315287.1|  hypothetical protein POPTR_0010s22620g             312   8e-101   
ref|NP_001104939.1|  elongation factor alpha6                           311   9e-101   
ref|XP_008233357.1|  PREDICTED: elongation factor 1-alpha-like          311   9e-101   
gb|KJB76560.1|  hypothetical protein B456_012G094600                    310   1e-100   
ref|XP_010669658.1|  PREDICTED: elongation factor 1-alpha-like          311   2e-100   
ref|XP_002279598.1|  PREDICTED: elongation factor 1-alpha               311   2e-100   
ref|NP_001105934.1|  elongation factor alpha7                           311   2e-100   
gb|EYU18863.1|  hypothetical protein MIMGU_mgv1a006280mg                310   3e-100   
sp|Q41011.1|EF1A_PEA  RecName: Full=Elongation factor 1-alpha; Sh...    310   4e-100   
emb|CAC27139.1|  translation elongation factor-1 alpha                  309   7e-100   
ref|XP_002892424.1|  T6D22.2                                            322   8e-100   
gb|ACN40081.1|  unknown                                                 309   9e-100   
gb|ABK25072.1|  unknown                                                 309   9e-100   
gb|ACN41180.1|  unknown                                                 309   1e-99    
ref|XP_002968419.1|  hypothetical protein SELMODRAFT_270693             308   1e-99    
ref|XP_002970579.1|  hypothetical protein SELMODRAFT_270852             308   2e-99    
gb|AAF79822.1|AC026875_2  T6D22.2                                       322   2e-99    
ref|XP_004143833.1|  PREDICTED: uncharacterized protein LOC101220517    321   2e-99    
ref|XP_002970583.1|  hypothetical protein SELMODRAFT_171512             308   2e-99    
ref|XP_002968422.1|  hypothetical protein SELMODRAFT_169717             308   2e-99    
gb|ABK24265.1|  unknown                                                 308   4e-99    
sp|Q03033.1|EF1A_WHEAT  RecName: Full=Elongation factor 1-alpha; ...    307   4e-99    
ref|XP_003604587.1|  Elongation factor 1-alpha                          307   5e-99    
ref|XP_001763198.1|  predicted protein                                  304   5e-99    
gb|EMS52529.1|  Elongation factor 1-alpha                               307   5e-99    
gb|AFQ37422.1|  translation elongation factor-1 alpha 1                 307   6e-99    
ref|XP_009917077.1|  PREDICTED: elongation factor 1-alpha 1             303   6e-99    
gb|EMS59091.1|  Elongation factor 1-alpha                               308   9e-99    
ref|XP_006373866.1|  hypothetical protein POPTR_0016s08780g             305   1e-98    
gb|AIZ74328.1|  translation elongation factor 1-alpha                   306   1e-98    
ref|XP_008465824.1|  PREDICTED: elongation factor 1-alpha-like          300   1e-98    
gb|ABK24843.1|  unknown                                                 306   2e-98    
gb|EYU36203.1|  hypothetical protein MIMGU_mgv1a006301mg                306   2e-98    
gb|KHG15275.1|  Elongation factor 1-alpha                               305   3e-98    
sp|Q40034.1|EF1A2_HORVU  RecName: Full=Elongation factor 1-alpha;...    305   4e-98    
gb|EMS49772.1|  Elongation factor 1-alpha                               305   4e-98    
ref|XP_001766482.1|  predicted protein                                  305   4e-98    
gb|AER42621.1|  elongation factor 1 alpha                               305   5e-98    
gb|AHA84124.1|  elongation factor 1-alpha                               304   7e-98    
gb|AFQ37423.1|  translation elongation factor-1 alpha 2                 304   8e-98    
gb|EMT12343.1|  Elongation factor 1-alpha                               304   8e-98    
gb|AGI78242.1|  elongation factor 1 alpha                               304   9e-98    
ref|XP_001753167.1|  predicted protein                                  303   2e-97    
ref|XP_001763194.1|  predicted protein                                  303   2e-97    
ref|XP_001763201.1|  predicted protein                                  303   2e-97    
ref|XP_001753181.1|  predicted protein                                  303   2e-97    
gb|AGO97079.1|  elongation factor 1-alpha                               294   2e-97    
sp|P34824.1|EF1A1_HORVU  RecName: Full=Elongation factor 1-alpha;...    303   3e-97    
gb|ACN40740.1|  unknown                                                 303   3e-97    
ref|XP_011031813.1|  PREDICTED: LOW QUALITY PROTEIN: HBS1-like pr...    317   4e-97    
gb|EMS65134.1|  Elongation factor 1-alpha                               307   7e-97    
ref|XP_003618775.1|  Elongation factor 1-alpha                          314   2e-96    
gb|AGO97080.1|  elongation factor 1-alpha                               291   2e-96    
gb|EMT09703.1|  Elongation factor 1-alpha                               308   2e-96    
gb|AEE98364.1|  elongation factor 1-alpha                               300   4e-96    
gb|ABR17675.1|  unknown                                                 299   7e-96    
ref|XP_001753059.1|  predicted protein                                  299   7e-96    
gb|AHZ58493.1|  translation elongation factor alpha                     299   8e-96    
gb|EEE58429.1|  hypothetical protein OsJ_09630                          297   2e-95    
gb|ABR16818.1|  unknown                                                 288   3e-95    
gb|AGO97078.1|  elongation factor 1-alpha                               288   4e-95    
gb|ABQ81936.1|  elongation factor 1-alpha                               295   1e-94    
ref|WP_033581549.1|  elongation factor 1-alpha                          285   2e-94    
dbj|BAK08818.1|  elongation factor 1-alpha                              295   3e-94    
dbj|BAK08744.1|  elongation factor 1-alpha                              295   3e-94    
gb|ABQ81942.1|  elongation factor 1-alpha                               287   4e-94    
dbj|BAK08819.1|  elongation factor 1-alpha                              293   1e-93    
gb|AFN42763.1|  elongation factor 1-alpha                               286   1e-93    
gb|AAR82894.1|  elongation factor 1-alpha                               293   2e-93    
gb|AAO61852.1|  translation elongation factor-1 alpha                   286   1e-91    
ref|XP_009773066.1|  PREDICTED: elongation factor 1-alpha               277   2e-91    
gb|KJB30602.1|  hypothetical protein B456_005G151200                    281   3e-91    
gb|ABL10112.1|  translation elongation factor 1-alpha                   276   2e-90    
dbj|BAH23674.1|  elongation factor 1-alpha                              276   3e-90    
gb|ACO50109.1|  elongation factor 1 alpha                               276   4e-89    
gb|AAV34150.1|  EF-1 alpha                                              271   4e-88    
gb|KCW65375.1|  hypothetical protein EUGRSUZ_G02807                     278   5e-88    
gb|ACO50110.1|  elongation factor 1 alpha                               278   1e-87    
gb|ACT36602.1|  elongation factor 1 alpha                               275   2e-87    
gb|ACL97363.1|  elongation factor-1 alpha                               276   4e-87    
ref|XP_005650451.1|  translation elongation factor                      275   2e-86    
emb|CDP93913.1|  Protein Bm5195, isoform h                              265   5e-86    
gb|AIM46989.1|  translation elongation factor 1-alpha                   273   8e-86    
gb|ABQ81935.1|  elongation factor 1-alpha                               272   1e-85    
gb|ACL97366.1|  elongation factor-1 alpha                               272   1e-85    
emb|CEJ91279.1|  Putative Elongation factor 1-alpha                     273   2e-85    
ref|XP_010458012.1|  PREDICTED: elongation factor 1-alpha 1 isofo...    262   3e-85    
gb|ACO50115.1|  elongation factor 1 alpha                               271   3e-85    
gb|AEK26871.1|  elongation factor 1-alpha                               261   6e-85    
emb|CAA40028.1|  42Sp48                                                 267   7e-85    
gb|ACF70735.1|  eukaryotic translation elongation factor 1              262   8e-85    
ref|XP_007876992.1|  hypothetical protein PFL1_01298                    271   1e-84    
gb|EKG07919.1|  elongation factor 1-alpha (ef-1-alpha), putative        261   1e-84    
gb|ACL97367.1|  elongation factor-1 alpha                               270   1e-84    
gb|KIO08245.1|  hypothetical protein M404DRAFT_997171                   270   1e-84    
gb|KIK43550.1|  hypothetical protein CY34DRAFT_699467                   270   2e-84    
gb|KHN88882.1|  Elongation factor 1-alpha                               270   2e-84    
gb|ABB46371.1|  elongation factor-1 alpha                               261   2e-84    
emb|CDH51884.1|  elongation factor 1-alpha                              263   2e-84    
gb|AJP77649.1|  elongation factor 1-alpha                               263   2e-84    
ref|XP_005941015.1|  PREDICTED: elongation factor 1-alpha-like          263   2e-84    
emb|CCW70819.1|  unnamed protein product                                263   2e-84    
gb|ADB55729.1|  elongation factor 1-alpha                               271   2e-84    
gb|KIK82926.1|  hypothetical protein PAXRUDRAFT_832117                  270   3e-84    
gb|EPY25861.1|  elongation factor 1-alpha                               266   4e-84    
gb|EPY33803.1|  elongation factor 1-alpha                               265   4e-84    
gb|ESA10680.1|  hypothetical protein GLOINDRAFT_348113                  269   4e-84    
gb|EPR59445.1|  putative elongation factor 1-alpha (EF-1-ALPHA)         262   4e-84    
gb|AFB18314.1|  translation elongation factor-1 alpha                   267   4e-84    
gb|EJW73271.1|  elongation factor 1-alpha                               264   4e-84    
gb|AEG78376.1|  elongation factor 1 alpha                               261   5e-84    
gb|KDQ63704.1|  hypothetical protein JAAARDRAFT_29726                   269   5e-84    
tpg|DAA05869.1|  TPA: eukaryotic translation elongation factor 1A       269   5e-84    
ref|XP_007762783.1|  translation elongation factor 1a                   269   5e-84    
dbj|BAD95246.1|  translation elongation factor eEF-1 alpha chain        258   6e-84    
ref|XP_002392294.1|  hypothetical protein MPER_08150                    264   6e-84    
gb|EKF27061.1|  elongation factor 1-alpha (ef-1-alpha), putative        259   6e-84    
ref|XP_004622541.1|  PREDICTED: elongation factor 1-alpha-like          266   7e-84    
gb|EWC64676.1|  hypothetical protein W893_14860                         259   7e-84    
emb|CBY16376.1|  unnamed protein product                                261   7e-84    
ref|XP_010730917.1|  PREDICTED: elongation factor 1-alpha 1             269   7e-84    
gb|AAC06383.1|  elongation factor 1 alpha                               258   8e-84    
gb|AAH14892.1|  Unknown (protein for IMAGE:3909122)                     261   9e-84    
gb|ELK00148.1|  Elongation factor 1-alpha 1                             261   9e-84    
ref|NP_001079602.1|  elongation factor 1-alpha, oocyte form             268   9e-84    
gb|EJW86012.1|  translation elongation factor EF-1                      267   9e-84    
emb|CCI49302.1|  unnamed protein product                                268   1e-83    
gb|AAH65761.1|  EEF1A1 protein                                          261   1e-83    
gb|ADO51768.1|  elongation factor 1-alpha                               268   1e-83    
emb|CAB59358.1|  translation elongation factor eEF-1 alpha chain        268   1e-83    
gb|KFG40151.1|  elongation factor 1-alpha                               261   1e-83    
gb|KIJ21706.1|  hypothetical protein PAXINDRAFT_65274                   268   2e-83    
dbj|BAH28836.1|  elongation factor 1-alpha                              268   2e-83    
ref|XP_007861104.1|  translation elongation factor 1a                   268   2e-83    
ref|XP_003873869.1|  elongation factor 1-alpha                          259   2e-83    
ref|XP_003037261.1|  translation elongation factor 1a                   268   2e-83    
ref|XP_005805806.1|  PREDICTED: elongation factor 1-alpha 1-like        268   2e-83    
sp|O42820.1|EF1A_SCHCO  RecName: Full=Elongation factor 1-alpha; ...    268   2e-83    
emb|CCA22726.1|  PREDICTED: hypothetical protein                        267   2e-83    
ref|XP_007567352.1|  PREDICTED: elongation factor 1-alpha 1             268   2e-83    
emb|CDQ04680.1|  Protein Bm5196, isoform a                              266   2e-83    
emb|CCX11704.1|  Similar to Elongation factor 1-alpha; acc. no. Q...    262   2e-83    
ref|XP_007314394.1|  hypothetical protein SERLADRAFT_458623             267   2e-83    
ref|NP_989301.1|  eukaryotic translation elongation factor 1 alph...    267   2e-83    
gb|KHJ95470.1|  putative translation elongation factor EF-1, subu...    264   2e-83    
ref|NP_001081521.1|  elongation factor 1-alpha, oocyte form             267   2e-83    
ref|XP_003141904.1|  elongation factor 1-alpha                          266   2e-83    
ref|XP_001893409.1|  elongation factor 1-alpha                          267   3e-83    
ref|XP_003380597.1|  elongation factor 1-alpha                          269   3e-83    
gb|KIK71054.1|  hypothetical protein GYMLUDRAFT_33174                   267   3e-83    
gb|ADK90073.1|  elongation factor 1 alpha                               267   3e-83    
gb|EPR56707.1|  elongation factor 1-alpha                               261   3e-83    
ref|XP_007298247.1|  translation elongation factor                      267   4e-83    
dbj|BAK23239.1|  eukaryotic translation elongation factor 1 alpha       266   4e-83    
ref|XP_011125707.1|  hypothetical protein AOL_s00169g48                 267   4e-83    
gb|KDR85040.1|  hypothetical protein GALMADRAFT_233641                  267   4e-83    
gb|AAH63511.1|  EEF1A1 protein                                          261   4e-83    
sp|P27592.1|EF1A_ONCVO  RecName: Full=Elongation factor 1-alpha; ...    266   5e-83    
gb|KIJ68393.1|  hypothetical protein HYDPIDRAFT_185471                  266   5e-83    
gb|EPR57682.1|  putative elongation factor 1-alpha (EF-1-ALPHA)         261   5e-83    
gb|KDQ12968.1|  hypothetical protein BOTBODRAFT_34109                   266   5e-83    
ref|XP_007359855.1|  translation elongation factor 1a                   266   5e-83    
gb|AHC00621.1|  tranlation elongation factor                            266   5e-83    
emb|CBQ70305.1|  probable translation elongation factor eEF-1 alp...    266   5e-83    
ref|XP_005993968.1|  PREDICTED: elongation factor 1-alpha, oocyte...    266   5e-83    
gb|KIK28513.1|  hypothetical protein PISMIDRAFT_673531                  266   6e-83    
emb|CDQ71533.1|  unnamed protein product                                259   6e-83    
gb|KFH65589.1|  elongation factor EF-1 alpha subunit                    262   6e-83    
ref|XP_004600825.1|  PREDICTED: elongation factor 1-alpha 1-like        257   6e-83    
gb|EPY27955.1|  elongation factor 1-alpha                               266   7e-83    
emb|CCO27325.1|  elongation factor EF-1 alpha subunit                   263   7e-83    
gb|AAH14377.1|  Unknown (protein for IMAGE:4041545)                     260   7e-83    
emb|CEJ01865.1|  Putative Elongation factor 1-alpha (Fragment)          266   7e-83    
gb|ABR13275.1|  putative elongation factor-1 alpha 3                    256   7e-83    
ref|XP_007061563.1|  PREDICTED: elongation factor 1-alpha 1             266   8e-83    
dbj|BAG65087.1|  unnamed protein product                                261   8e-83    
ref|XP_007246777.1|  PREDICTED: elongation factor 1-alpha 1-like        266   8e-83    
emb|CEG63380.1|  Putative Elongation factor 1-alpha                     266   8e-83    
ref|XP_005405386.1|  PREDICTED: elongation factor 1-alpha 1             261   8e-83    
ref|XP_822464.1|  elongation factor 1-alpha                             262   8e-83    
emb|CCU97773.1|  unnamed protein product                                266   9e-83    
dbj|BAE88353.1|  unnamed protein product                                261   9e-83    
gb|EIE83783.1|  elongation factor 1-alpha                               266   9e-83    
gb|AAD03711.1|  elongation translation factor 1 alpha                   265   1e-82    
dbj|BAA21513.1|  newt elongation factor 1-alpha                         258   1e-82    
gb|KIO18434.1|  hypothetical protein M407DRAFT_16247                    265   1e-82    
gb|AAB65435.1|  elongation factor 1 alpha                               261   1e-82    
gb|AAA52367.1|  elongation factor 1-alpha                               261   1e-82    
gb|KIL70783.1|  hypothetical protein M378DRAFT_116001                   266   1e-82    
sp|P28295.1|EF1A_ABSGL  RecName: Full=Elongation factor 1-alpha; ...    265   1e-82    
gb|AGW80518.1|  elongation factor 1-alpha 1                             256   1e-82    
gb|EPT04282.1|  hypothetical protein FOMPIDRAFT_1021956                 266   1e-82    



>gb|ACF81592.1| unknown [Zea mays]
Length=184

 Score =   325 bits (833),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 156/163 (96%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFT QVI
Sbjct  11   TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVI  70

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  71   IMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMI  130

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  131  PTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  173



>dbj|BAO57272.1| elongation factor 1-alpha [Ipomoea nil]
Length=447

 Score =   334 bits (857),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 162/163 (99%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  436



>ref|XP_009613861.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana tomentosiformis]
 ref|XP_009626606.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana tomentosiformis]
 ref|XP_009597916.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana tomentosiformis]
Length=447

 Score =   332 bits (852),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 160/163 (98%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  436



>dbj|BAH20400.1| AT1G07940 [Arabidopsis thaliana]
Length=186

 Score =   322 bits (825),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FT QVI
Sbjct  11   TTEVKSVEMHHESLLEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVI  70

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM 
Sbjct  71   IMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMT  130

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  131  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  173



>ref|XP_009617039.1| PREDICTED: elongation factor 1-alpha [Nicotiana tomentosiformis]
Length=447

 Score =   331 bits (849),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 159/163 (98%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG
Sbjct  394  PTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  436



>ref|XP_006307730.1| hypothetical protein CARUB_v100096370mg, partial [Capsella rubella]
 gb|EOA40628.1| hypothetical protein CARUB_v100096370mg, partial [Capsella rubella]
Length=188

 Score =   321 bits (823),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FT QVI
Sbjct  13   TTEVKSVEMHHESLLEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVI  72

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM 
Sbjct  73   IMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMT  132

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  133  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  175



>ref|NP_001234035.1| elongation factor 1-alpha [Solanum lycopersicum]
 ref|XP_004240579.1| PREDICTED: elongation factor 1-alpha [Solanum lycopersicum]
 sp|P17786.1|EF1A_SOLLC RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Solanum 
lycopersicum]
 emb|CAA32618.1| unnamed protein product [Solanum lycopersicum]
 emb|CAA37212.1| elongation factor 1-alpha [Solanum lycopersicum]
Length=448

 Score =   330 bits (847),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTAQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGV+KNVDKKDPTG
Sbjct  394  PTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVVKNVDKKDPTG  436



>gb|AAT72900.1| elongation factor 1A SMV resistance-related protein [Glycine 
max]
Length=193

 Score =   321 bits (822),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 155/163 (95%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT QVI
Sbjct  20   TTEVKSVEMHHEALTEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTAQVI  79

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+
Sbjct  80   IMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKMI  139

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  140  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  182



>sp|P43643.1|EF1A_TOBAC RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha; AltName: 
Full=Vitronectin-like adhesion protein 1; Short=PVN1 
[Nicotiana tabacum]
 gb|AAA20836.1| vitronectin-like adhesion protein [Nicotiana tabacum]
Length=447

 Score =   330 bits (845),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAKGAASFT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  436



>ref|XP_009783256.1| PREDICTED: elongation factor 1-alpha [Nicotiana sylvestris]
 dbj|BAA09709.1| elongation factor-1 alpha [Nicotiana tabacum]
Length=447

 Score =   330 bits (845),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAKGAASFT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  436



>gb|KJB73626.1| hypothetical protein B456_011G2412002, partial [Gossypium raimondii]
Length=187

 Score =   320 bits (821),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FT QVI
Sbjct  13   TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVI  72

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+
Sbjct  73   IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMV  132

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  133  PTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  175



>dbj|BAA34348.1| elongation factor-1 alpha [Nicotiana paniculata]
Length=447

 Score =   330 bits (845),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAKGA+SFT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGASSFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  436



>gb|ABW74483.1| elongation factor [Paeonia suffruticosa]
Length=186

 Score =   320 bits (820),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FT QVI
Sbjct  11   TTEVKSVEMHHESLLEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVI  70

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM 
Sbjct  71   IMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMT  130

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMR+TVAVGVIK+VDKKDPTG
Sbjct  131  PTKPMVVETFSEYPPLGRFAVRDMRRTVAVGVIKSVDKKDPTG  173



>ref|XP_004251154.1| PREDICTED: elongation factor 1-alpha-like [Solanum lycopersicum]
Length=447

 Score =   329 bits (844),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAKGAASFT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTAQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDP+G
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPSG  436



>gb|AAQ90154.1| putative translation elongation factor protein [Solanum tuberosum]
Length=287

 Score =   323 bits (829),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 156/163 (96%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAKGAASFT QVI
Sbjct  113  TTEVKSVEMHHEALLEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTAQVI  172

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  173  IMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMI  232

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGV+KNVDKKDPTG
Sbjct  233  PTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVVKNVDKKDPTG  275



>gb|AFW76429.1| putative translation elongation factor Tu family protein [Zea 
mays]
Length=293

 Score =   323 bits (828),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 157/163 (96%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFT QVI
Sbjct  120  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVI  179

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  180  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMV  239

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  240  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  282



>ref|XP_009593325.1| PREDICTED: elongation factor 1-alpha [Nicotiana tomentosiformis]
Length=447

 Score =   328 bits (842),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 157/163 (96%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAKGA+SFT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGASSFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  436



>gb|AGH55661.1| elongation factor 1-alpha, partial [Atropa belladonna]
Length=333

 Score =   325 bits (832),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 156/163 (96%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAKGAASFT QVI
Sbjct  161  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTSQVI  220

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFA +LTKIDRRSGKE+EKEPKFLKNGDAGMVKM+
Sbjct  221  IMNHPGQIGNGYAPVLDCHTSHIAVKFAXILTKIDRRSGKEIEKEPKFLKNGDAGMVKMI  280

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  281  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  323



>dbj|BAC23049.1| Elongation factor 1-alpha [Solanum tuberosum]
 gb|AHL27103.1| eukaryotic elongation factor 1A protein [Solanum chacoense]
Length=448

 Score =   328 bits (842),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 157/163 (96%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAKGAASFT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTAQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGV+KNVDKKDPTG
Sbjct  394  PTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVVKNVDKKDPTG  436



>ref|XP_007015467.1| GTP binding Elongation factor Tu family protein isoform 2 [Theobroma 
cacao]
 gb|EOY33086.1| GTP binding Elongation factor Tu family protein isoform 2 [Theobroma 
cacao]
Length=348

 Score =   325 bits (832),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 157/163 (96%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFT QVI
Sbjct  173  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVI  232

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF+ELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  233  IMNHPGQIGNGYAPVLDCHTSHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDAGMVKMV  292

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  293  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  335



>ref|XP_009793830.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana sylvestris]
Length=447

 Score =   328 bits (841),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 157/163 (96%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAKGA++FT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGASNFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  436



>ref|XP_009762748.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana sylvestris]
Length=447

 Score =   328 bits (841),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 157/163 (96%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAKGA++FT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGASNFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  436



>dbj|BAF75826.1| hypothetical protein [Malus domestica]
Length=184

 Score =   319 bits (817),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVA KDLKRG+VASNSKDDPAK AA+FT QVI
Sbjct  11   TTEVKSVEMHHEALQEALPGDNVGFNVKNVAAKDLKRGFVASNSKDDPAKEAANFTSQVI  70

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  71   IMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMI  130

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KK+PTG
Sbjct  131  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKEPTG  173



>dbj|BAF75825.1| hypothetical protein [Malus domestica]
Length=184

 Score =   318 bits (816),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK  A+FT QVI
Sbjct  11   TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKETANFTSQVI  70

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKML
Sbjct  71   IMNHPGQIGNGYAPVLDCHTSHIAVKFGEILTKIDRRSGKEIEKEPKFLKNGDAGMVKML  130

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  131  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  173



>gb|ABV26710.1| elongation factor 1 alpha [Gerbera hybrid cultivar]
Length=449

 Score =   327 bits (839),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 157/163 (96%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF+ELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDAGMVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  394  PTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>ref|NP_001049145.1| Os03g0177400 [Oryza sativa Japonica Group]
 ref|NP_001049146.1| Os03g0177500 [Oryza sativa Japonica Group]
 ref|NP_001049147.1| Os03g0177900 [Oryza sativa Japonica Group]
 ref|NP_001049148.1| Os03g0178000 [Oryza sativa Japonica Group]
 ref|XP_006649493.1| PREDICTED: elongation factor 1-alpha-like [Oryza brachyantha]
 ref|XP_006649494.1| PREDICTED: elongation factor 1-alpha-like [Oryza brachyantha]
 sp|O64937.2|EF1A_ORYSJ RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Oryza 
sativa Japonica Group]
 dbj|BAA23657.1| EF-1 alpha [Oryza sativa]
 dbj|BAA23659.1| EF-1 alpha [Oryza sativa]
 dbj|BAA23660.1| EF-1 alpha [Oryza sativa]
 gb|ABF94269.1| Elongation factor 1-alpha, putative [Oryza sativa Japonica Group]
 gb|ABF94270.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABF94273.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABF94274.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11059.1| Os03g0177400 [Oryza sativa Japonica Group]
 dbj|BAF11060.1| Os03g0177500 [Oryza sativa Japonica Group]
 dbj|BAF11061.1| Os03g0177900 [Oryza sativa Japonica Group]
 dbj|BAF11062.1| Os03g0178000 [Oryza sativa Japonica Group]
 gb|EAZ25788.1| hypothetical protein OsJ_09631 [Oryza sativa Japonica Group]
 gb|EAZ25791.1| hypothetical protein OsJ_09634 [Oryza sativa Japonica Group]
 gb|EAZ25792.1| hypothetical protein OsJ_09635 [Oryza sativa Japonica Group]
 dbj|BAG87945.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93078.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97075.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74621.1| hypothetical protein OsI_10237 [Oryza sativa Indica Group]
 gb|EEC74622.1| hypothetical protein OsI_10241 [Oryza sativa Indica Group]
 gb|EEC74623.1| hypothetical protein OsI_10242 [Oryza sativa Indica Group]
 gb|ADM86871.1| elongation factor-1 alpha [Oryza sativa Japonica Group]
 gb|ADM86885.1| elongation factor-1 alpha [Oryza sativa Japonica Group]
 gb|ADM86886.1| elongation factor-1 alpha [Oryza sativa Japonica Group]
 gb|ADM86887.1| elongation factor-1 alpha [Oryza sativa Japonica Group]
Length=447

 Score =   327 bits (839),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>ref|XP_006646939.1| PREDICTED: elongation factor 1-alpha-like [Oryza brachyantha]
Length=447

 Score =   327 bits (839),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>gb|ABF94276.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABF94277.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
Length=449

 Score =   327 bits (839),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFT QVI
Sbjct  276  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVI  335

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  336  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMI  395

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  396  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  438



>ref|XP_006340223.1| PREDICTED: elongation factor 1-alpha-like [Solanum tuberosum]
Length=447

 Score =   327 bits (839),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 157/163 (96%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAKGAASFT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTAQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDP+G
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPSG  436



>gb|AAC15413.1| translation elongation factor-1 alpha [Oryza sativa Japonica 
Group]
Length=447

 Score =   327 bits (839),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>ref|XP_010557310.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
 ref|XP_010557311.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score =   327 bits (839),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMV  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>dbj|BAA23658.1| EF-1 alpha [Oryza sativa]
Length=447

 Score =   327 bits (839),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>dbj|BAN42602.1| putative elongation factor 1-alpha, partial [Pyrus pyrifolia 
var. culta]
Length=201

 Score =   318 bits (816),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FT QVI
Sbjct  28   TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVI  87

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKML
Sbjct  88   IMNHPGQIGNGYAPVLDCHTSHIAVKFGEILTKIDRRSGKEIEKEPKFLKNGDAGMVKML  147

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PT+PMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  148  PTRPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  190



>ref|NP_001275420.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
 gb|ABB16975.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
Length=400

 Score =   325 bits (834),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 156/163 (96%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAKGAASFT QVI
Sbjct  226  TTEVKSVEMHHEALLEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTAQVI  285

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  286  IMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMI  345

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGV+KNVDKKDPTG
Sbjct  346  PTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVVKNVDKKDPTG  388



>ref|XP_010535587.1| PREDICTED: elongation factor 1-alpha [Tarenaya hassleriana]
Length=449

 Score =   327 bits (838),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AAN77897.1| elongation factor 1 alpha [Stevia rebaudiana]
Length=449

 Score =   327 bits (838),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 157/163 (96%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFT QVI
Sbjct  274  TTEVKSVEMHHEALTEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAGMVKML
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGMVKML  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  394  PTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>ref|XP_007015463.1| GTP binding Elongation factor Tu family protein [Theobroma cacao]
 gb|EOY33082.1| GTP binding Elongation factor Tu family protein [Theobroma cacao]
Length=449

 Score =   327 bits (837),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 158/163 (97%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMV  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>gb|AHE76183.1| elongation factor 1-alpha [Chrysanthemum indicum]
Length=449

 Score =   327 bits (837),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 157/163 (96%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFT QVI
Sbjct  274  TTEVKSVEMHHEALTEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF E+LTKIDRRSGKELEKEPKFLKNGDAGMVKML
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFGEILTKIDRRSGKELEKEPKFLKNGDAGMVKML  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  394  PTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>gb|AAR83865.1| elongation factor 1-alpha [Capsicum annuum]
Length=167

 Score =   316 bits (809),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 150/155 (97%), Positives = 154/155 (99%), Gaps = 0/155 (0%)
 Frame = -3

Query  663  MHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVIIMNHPGQI  484
            MHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFT QVIIMNHPGQI
Sbjct  1    MHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTAQVIIMNHPGQI  60

Query  483  GNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLPTKPMVVE  304
            GNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+PTKPMVVE
Sbjct  61   GNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVE  120

Query  303  TFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            TF+EYPPLGRFAVRDMRQTVAVGV+KNVDKKDPTG
Sbjct  121  TFAEYPPLGRFAVRDMRQTVAVGVVKNVDKKDPTG  155



>ref|NP_001275481.1| elongation factor 1-alpha-like [Solanum tuberosum]
 gb|ABB16996.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
Length=448

 Score =   326 bits (835),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 156/163 (96%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAKGAASFT QVI
Sbjct  274  TTEVKSVEMHHEALLEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTAQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGV+KNVDKKDPTG
Sbjct  394  PTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVVKNVDKKDPTG  436



>gb|ABB02622.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
Length=400

 Score =   324 bits (831),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 155/163 (95%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEV+SVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAKGAASFT QVI
Sbjct  226  TTEVQSVEMHHEALLEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTAQVI  285

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  286  IMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMI  345

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGV+KNVDKKDPTG
Sbjct  346  PTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVVKNVDKKDPTG  388



>gb|ABB86283.1| elongation factor-1 alpha-like [Solanum tuberosum]
Length=447

 Score =   326 bits (835),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 156/163 (96%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAKGAASFT QVI
Sbjct  274  TTEVKSVEMHHEALLEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTAQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGV+KNVDKKDPTG
Sbjct  394  PTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVVKNVDKKDPTG  436



>dbj|BAL14665.1| elongation factor 1-alpha [Chrysanthemum seticuspe f. boreale]
Length=449

 Score =   326 bits (835),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 156/163 (96%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFT QVI
Sbjct  274  TTEVKSVEMHHEALTEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKML
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFGEILTKIDRRSGKEIEKEPKFLKNGDAGMVKML  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  394  PTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>ref|XP_010521772.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score =   326 bits (835),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 157/163 (96%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMV  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>emb|CAL25349.1| elongation factor 1 alpha [Platanus x acerifolia]
Length=199

 Score =   317 bits (811),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 151/163 (93%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPA+ AA+FT QVI
Sbjct  26   TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVI  85

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAG VKM+
Sbjct  86   IMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGFVKMI  145

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  146  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  188



>ref|XP_006343452.1| PREDICTED: elongation factor 1-alpha-like [Solanum tuberosum]
 ref|XP_006343454.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006343455.1| PREDICTED: elongation factor 1-alpha-like [Solanum tuberosum]
 gb|ABB55388.1| elongation factor 1-alpha-like [Solanum tuberosum]
Length=448

 Score =   325 bits (834),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 156/163 (96%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAKGAASFT QVI
Sbjct  274  TTEVKSVEMHHEALLEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTAQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGV+KNVDKKDPTG
Sbjct  394  PTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVVKNVDKKDPTG  436



>gb|AGT16893.1| elongation factor 1-alpha [Saccharum hybrid cultivar R570]
Length=447

 Score =   325 bits (834),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 157/163 (96%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AGT16628.1| elongation factor 1 alpha [Saccharum hybrid cultivar R570]
Length=399

 Score =   324 bits (830),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 157/163 (96%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFT QVI
Sbjct  226  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVI  285

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  286  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMV  345

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  346  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  388



>ref|XP_007015466.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY33085.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
Length=449

 Score =   325 bits (834),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 157/163 (96%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF+ELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDAGMVKMV  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>ref|XP_011091454.1| PREDICTED: elongation factor 1-alpha-like [Sesamum indicum]
Length=449

 Score =   325 bits (834),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 157/163 (96%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKK+P+G
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKEPSG  436



>ref|XP_010937512.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
Length=447

 Score =   325 bits (833),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 157/163 (96%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTAQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAG VKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGFVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKD +G
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDASG  436



>ref|XP_010542598.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score =   325 bits (834),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 157/163 (96%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AGZ15393.1| elongation factor 1-alpha [Phaseolus vulgaris]
Length=305

 Score =   320 bits (820),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT QVI
Sbjct  120  TTEVKSVEMHHEALTEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVI  179

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+
Sbjct  180  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKMI  239

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  240  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  282



>gb|KDP29082.1| hypothetical protein JCGZ_16471 [Jatropha curcas]
Length=247

 Score =   318 bits (814),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FT QVI
Sbjct  74   TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVI  133

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+
Sbjct  134  IMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMI  193

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  194  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  236



>ref|NP_001152668.1| LOC100286309 [Zea mays]
 ref|XP_008647989.1| PREDICTED: LOC100286309 isoform X1 [Zea mays]
 gb|ACG48827.1| elongation factor 1-alpha [Zea mays]
 gb|AFW76430.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW76431.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
 gb|AFW76432.1| putative translation elongation factor Tu family protein isoform 
3 [Zea mays]
Length=447

 Score =   325 bits (833),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 157/163 (96%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMV  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|ACR38047.1| unknown [Zea mays]
 gb|AFW77623.1| elongation factor alpha1 [Zea mays]
Length=447

 Score =   325 bits (833),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 156/163 (96%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_006304901.1| hypothetical protein CARUB_v100092941mg, partial [Capsella rubella]
 gb|EOA37799.1| hypothetical protein CARUB_v100092941mg, partial [Capsella rubella]
Length=325

 Score =   320 bits (821),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FT QVI
Sbjct  150  TTEVKSVEMHHESLLEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVI  209

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM 
Sbjct  210  IMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMT  269

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  270  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  312



>gb|KJB53395.1| hypothetical protein B456_009G4199001 [Gossypium raimondii]
Length=300

 Score =   320 bits (819),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFT QVI
Sbjct  127  TTEVKSVEMHHEALSEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVI  186

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF+ELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+
Sbjct  187  IMNHPGQIGNGYAPVLDCHTSHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDAGMIKMV  246

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  247  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  289



>gb|ABU63160.1| elongation factor [Saccharum officinarum]
 gb|AGT15989.1| elongation factor 1-alpha [Saccharum hybrid cultivar R570]
 gb|AGT15990.1| elongation factor 1-alpha [Saccharum hybrid cultivar R570]
 gb|AGT16629.1| elongation factor 1 alpha [Saccharum hybrid cultivar R570]
Length=447

 Score =   325 bits (832),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 157/163 (96%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMV  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AFC88830.1| putative elongation factor 1-alpha [Miscanthus sinensis]
Length=447

 Score =   325 bits (832),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 157/163 (96%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMV  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AGH32502.1| translation elongation factor-1 alpha [Stylosanthes guianensis]
Length=447

 Score =   324 bits (831),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 156/163 (96%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAG+VKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGLVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDP+G
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPSG  436



>gb|AAL79775.1| elongation factor 1 alpha [Saccharum hybrid cultivar CP72-2086]
Length=441

 Score =   324 bits (831),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 157/163 (96%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFT QVI
Sbjct  268  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVI  327

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  328  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMV  387

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  388  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  430



>gb|KHG26926.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=448

 Score =   324 bits (831),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 156/163 (96%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMV  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_002518072.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF44205.1| elongation factor 1-alpha, putative [Ricinus communis]
Length=295

 Score =   319 bits (817),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTE+KSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT QVI
Sbjct  120  TTEIKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVI  179

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+
Sbjct  180  IMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMI  239

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  240  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  282



>gb|KHG20498.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=447

 Score =   324 bits (831),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 156/163 (96%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT QVI
Sbjct  274  TTEVKSVEMHHEALTEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>gb|KJB53396.1| hypothetical protein B456_009G4199001, partial [Gossypium raimondii]
Length=322

 Score =   320 bits (819),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFT QVI
Sbjct  149  TTEVKSVEMHHEALSEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVI  208

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF+ELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+
Sbjct  209  IMNHPGQIGNGYAPVLDCHTSHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDAGMIKMV  268

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  269  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  311



>gb|AAL79774.1|AF331849_1 elongation factor 1 alpha [Saccharum hybrid cultivar CP65-357]
Length=447

 Score =   324 bits (831),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 157/163 (96%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMV  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_002539209.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF23174.1| elongation factor 1-alpha, putative [Ricinus communis]
Length=295

 Score =   319 bits (817),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTE+KSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT QVI
Sbjct  120  TTEIKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVI  179

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+
Sbjct  180  IMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMI  239

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  240  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  282



>ref|XP_004962277.1| PREDICTED: elongation factor 1-alpha-like isoform X1 [Setaria 
italica]
 ref|XP_004962278.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Setaria 
italica]
 ref|XP_004962279.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
Length=447

 Score =   324 bits (830),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 156/163 (96%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>emb|CDX70032.1| BnaA10g23810D [Brassica napus]
Length=344

 Score =   320 bits (821),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FT QVI
Sbjct  169  TTEVKSVEMHHESLVEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVI  228

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM 
Sbjct  229  IMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMT  288

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  289  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  331



>ref|XP_004962249.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004962250.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004962268.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004962269.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004962270.1| PREDICTED: elongation factor 1-alpha-like isoform X1 [Setaria 
italica]
 ref|XP_004962271.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Setaria 
italica]
Length=447

 Score =   324 bits (830),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 156/163 (96%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AID52924.1| elongation factor 1-alpha [Carthamus tinctorius]
Length=449

 Score =   324 bits (830),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 155/163 (95%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFT QVI
Sbjct  274  TTEVKSVEMHHEALTEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF EL+TKIDRRSGKE+EKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFQELVTKIDRRSGKEIEKEPKFLKNGDAGMVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  394  PTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>ref|NP_001274875.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
 gb|ABC01896.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
Length=448

 Score =   324 bits (830),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 157/164 (96%), Positives = 162/164 (99%), Gaps = 1/164 (1%)
 Frame = -3

Query  687  TTEVKSVEMHH-EALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQV  511
            TTEVKSVEMHH EALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAKGAASFT QV
Sbjct  274  TTEVKSVEMHHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTAQV  333

Query  510  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKM  331
            IIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM
Sbjct  334  IIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKM  393

Query  330  LPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            +PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGV+KNVDKKDPTG
Sbjct  394  IPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVVKNVDKKDPTG  437



>gb|AGZ90153.1| elongation factor 1-alpha, partial [Litsea cubeba]
Length=239

 Score =   317 bits (811),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FT QVI
Sbjct  66   TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVI  125

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG+VKM+
Sbjct  126  IMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGLVKMI  185

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  186  PTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  228



>dbj|BAH56641.1| elongation factor 1a, partial [Nelumbo nucifera]
Length=355

 Score =   321 bits (822),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 156/163 (96%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHE LQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFT QVI
Sbjct  193  TTEVKSVEMHHETLQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVI  252

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAG VKM+
Sbjct  253  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGFVKMI  312

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK VDKKDPTG
Sbjct  313  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKAVDKKDPTG  355



>ref|XP_010916901.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
 ref|XP_010910504.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
Length=447

 Score =   324 bits (830),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 156/163 (96%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_007009760.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007009761.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY18570.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY18571.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
Length=449

 Score =   323 bits (829),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 156/163 (96%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGD+GMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDSGMVKMV  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>ref|XP_010032223.1| PREDICTED: elongation factor 1-alpha isoform X2 [Eucalyptus grandis]
Length=447

 Score =   323 bits (829),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 155/163 (95%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF+ELLTKIDRRSGKELEKEPKFLKNGD+GMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDSGMVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDP+G
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPSG  436



>ref|XP_010032224.1| PREDICTED: elongation factor 1-alpha isoform X3 [Eucalyptus grandis]
Length=447

 Score =   323 bits (829),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 155/163 (95%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF+ELLTKIDRRSGKELEKEPKFLKNGD+GMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDSGMVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDP+G
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPSG  436



>ref|XP_008783723.1| PREDICTED: elongation factor 1-alpha isoform X2 [Phoenix dactylifera]
Length=293

 Score =   318 bits (815),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFT QVI
Sbjct  120  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVI  179

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAG VKM+
Sbjct  180  IMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGFVKMI  239

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  240  PTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  282



>ref|XP_008656153.1| PREDICTED: elongation factor 1-alpha-like [Zea mays]
 ref|XP_008656154.1| PREDICTED: elongation factor 1-alpha-like [Zea mays]
 gb|AFW81463.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW81464.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
 gb|AFW81465.1| putative translation elongation factor Tu family protein isoform 
3 [Zea mays]
Length=447

 Score =   323 bits (829),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 155/163 (95%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKD+KRGYVASNSKDDPAK AASFT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDIKRGYVASNSKDDPAKEAASFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AIX10769.1| elongation factor 1 alpha [Panax notoginseng]
Length=449

 Score =   323 bits (829),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 156/163 (96%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FT QVI
Sbjct  274  TTEVKSVEMHHESLVEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKE+EKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKEIEKEPKFLKNGDAGMVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK VDKKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKAVDKKDPTG  436



>ref|NP_001105587.1| elongation factor 1-alpha [Zea mays]
 gb|AAB64207.1| elongation factor 1-alpha [Zea mays]
 gb|ACG32939.1| elongation factor 1-alpha [Zea mays]
 gb|AFW87114.1| LOW QUALITY PROTEIN: putative translation elongation factor Tu 
family protein [Zea mays]
Length=447

 Score =   323 bits (828),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 156/163 (96%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMV  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>emb|CAD60652.1| elongation factor [Solanum tuberosum]
Length=447

 Score =   323 bits (828),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 156/163 (96%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAKGAASFT QVI
Sbjct  274  TTEVKSVEMHHEALLEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTAQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDP+G
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPSG  436



>ref|XP_010032221.1| PREDICTED: elongation factor 1-alpha isoform X1 [Eucalyptus grandis]
 ref|XP_010032222.1| PREDICTED: elongation factor 1-alpha isoform X1 [Eucalyptus grandis]
Length=449

 Score =   323 bits (828),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 155/163 (95%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGD+GMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDSGMVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDP+G
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPSG  436



>emb|CAL07988.1| translation elongation factor 1 alpha [Platanus x acerifolia]
Length=236

 Score =   315 bits (808),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 151/163 (93%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPA+ AA+FT QVI
Sbjct  63   TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVI  122

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAG VKM+
Sbjct  123  IMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGFVKMI  182

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  183  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  225



>gb|ABA12225.1| translation elongation factor 1A-9 [Gossypium hirsutum]
Length=448

 Score =   323 bits (828),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 155/163 (95%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMV  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPM+VETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PTKPMLVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KJB09231.1| hypothetical protein B456_001G130700 [Gossypium raimondii]
 gb|KJB09232.1| hypothetical protein B456_001G130700 [Gossypium raimondii]
Length=447

 Score =   323 bits (828),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 155/163 (95%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT QVI
Sbjct  274  TTEVKSVEMHHEALTEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDP+G
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPSG  436



>dbj|BAN42601.1| putative elongation factor 1-alpha, partial [Pyrus pyrifolia 
var. culta]
Length=201

 Score =   314 bits (805),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEA+ EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT QVI
Sbjct  28   TTEVKSVEMHHEAMLEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVI  87

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIG GYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+
Sbjct  88   IMNHPGQIGQGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGFVKMI  147

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  148  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  190



>ref|XP_004984833.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004984834.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
Length=447

 Score =   323 bits (827),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 156/163 (96%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMV  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|ACG34498.1| elongation factor 1-alpha [Zea mays]
Length=447

 Score =   323 bits (827),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 155/163 (95%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_008656156.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Zea mays]
 gb|AFW81467.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW81468.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
 gb|AFW81469.1| putative translation elongation factor Tu family protein isoform 
3 [Zea mays]
Length=447

 Score =   323 bits (827),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 155/163 (95%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KHG23927.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=449

 Score =   323 bits (827),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 155/163 (95%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMV  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_010244958.1| PREDICTED: elongation factor 1-alpha-like [Nelumbo nucifera]
 ref|XP_010244959.1| PREDICTED: elongation factor 1-alpha-like [Nelumbo nucifera]
Length=449

 Score =   323 bits (827),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 155/163 (95%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHE LQEALPGDNVGFNVKNVAVKDLKRGYVASNSK+DPAK AASFT QVI
Sbjct  274  TTEVKSVEMHHETLQEALPGDNVGFNVKNVAVKDLKRGYVASNSKEDPAKEAASFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAG+VKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGLVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDP+G
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPSG  436



>ref|XP_010937806.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
Length=447

 Score =   323 bits (827),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 156/163 (96%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AEN79476.1| elongation factor 1-alpha [Ziziphus jujuba]
Length=447

 Score =   323 bits (827),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 155/163 (95%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE+EPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEREPKFLKNGDAGMVKMV  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_010541344.1| PREDICTED: elongation factor 1-alpha [Tarenaya hassleriana]
Length=449

 Score =   323 bits (827),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 157/163 (96%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFT QVI
Sbjct  274  TTEVKSVEMHHEALLEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMV  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>emb|CAA06245.1| elongation factor 1-alpha (EF1-a) [Cicer arietinum]
Length=326

 Score =   318 bits (816),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FT QVI
Sbjct  153  TTEVKSVEMHHEALTEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVI  212

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAG+VKM+
Sbjct  213  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGLVKMI  272

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  273  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  315



>gb|ABA12221.1| translation elongation factor 1A-5 [Gossypium hirsutum]
Length=448

 Score =   323 bits (827),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 155/163 (95%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMV  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AGY80449.1| elongation factor 1-alpha [Dendrocalamus latiflorus]
Length=447

 Score =   322 bits (826),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 156/163 (96%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMV  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  394  PTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>dbj|BAC66180.1| elongation factor 1A [Avicennia marina]
Length=449

 Score =   322 bits (826),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNV+VKDLKRGYVASNSKDDPAKGAASFT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVSVKDLKRGYVASNSKDDPAKGAASFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGFVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KK+P+G
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKEPSG  436



>ref|XP_006417745.1| hypothetical protein EUTSA_v10007619mg [Eutrema salsugineum]
 ref|XP_006417746.1| hypothetical protein EUTSA_v10007619mg [Eutrema salsugineum]
 ref|XP_006417749.1| hypothetical protein EUTSA_v10007620mg [Eutrema salsugineum]
 ref|XP_006417750.1| hypothetical protein EUTSA_v10007618mg [Eutrema salsugineum]
 ref|XP_006417751.1| hypothetical protein EUTSA_v10007618mg [Eutrema salsugineum]
 ref|XP_006400853.1| hypothetical protein EUTSA_v10013526mg [Eutrema salsugineum]
 dbj|BAJ33644.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ36098.1| hypothetical protein EUTSA_v10007619mg [Eutrema salsugineum]
 gb|ESQ36099.1| hypothetical protein EUTSA_v10007619mg [Eutrema salsugineum]
 gb|ESQ36102.1| hypothetical protein EUTSA_v10007620mg [Eutrema salsugineum]
 gb|ESQ36103.1| hypothetical protein EUTSA_v10007618mg [Eutrema salsugineum]
 gb|ESQ36104.1| hypothetical protein EUTSA_v10007618mg [Eutrema salsugineum]
 gb|ESQ42306.1| hypothetical protein EUTSA_v10013526mg [Eutrema salsugineum]
Length=449

 Score =   322 bits (826),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 155/163 (95%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FT QVI
Sbjct  274  TTEVKSVEMHHESLLEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAGMVKM 
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGMVKMT  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>ref|XP_006436251.1| hypothetical protein CICLE_v10033471mg [Citrus clementina]
 ref|XP_006485903.1| PREDICTED: elongation factor 1-alpha 1-like [Citrus sinensis]
 gb|ESR49491.1| hypothetical protein CICLE_v10033471mg [Citrus clementina]
Length=447

 Score =   322 bits (826),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHE+LQEALPGDNVGFNVKNV+VKDLKRGYVASNSKDDPAKGA++FT QVI
Sbjct  274  TTEVKSVEMHHESLQEALPGDNVGFNVKNVSVKDLKRGYVASNSKDDPAKGASNFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDP+G
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPSG  436



>ref|XP_009342341.1| PREDICTED: elongation factor 1-alpha [Pyrus x bretschneideri]
Length=447

 Score =   322 bits (826),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 155/163 (95%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KK+PTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKEPTG  436



>gb|AFY06644.1| elongation factor 1-alpha, partial [Carica papaya]
Length=334

 Score =   318 bits (816),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FT QVI
Sbjct  161  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVI  220

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+
Sbjct  221  IMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMI  280

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIKNV+KKDP+G
Sbjct  281  PTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKNVEKKDPSG  323



>gb|KDO48480.1| hypothetical protein CISIN_1g0132372mg [Citrus sinensis]
Length=447

 Score =   322 bits (826),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHE+LQEALPGDNVGFNVKNV+VKDLKRGYVASNSKDDPAKGA++FT QVI
Sbjct  274  TTEVKSVEMHHESLQEALPGDNVGFNVKNVSVKDLKRGYVASNSKDDPAKGASNFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDP+G
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPSG  436



>gb|AGJ50595.1| EF1alpha [Pericallis cruenta]
Length=449

 Score =   322 bits (826),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKD+KRGYVASNSKDDPAKGAASFT QVI
Sbjct  274  TTEVKSVEMHHEALSEALPGDNVGFNVKNVAVKDIKRGYVASNSKDDPAKGAASFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMM  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AAF63516.1|AF242732_1 translation elongation factor 1a [Capsicum annuum]
Length=447

 Score =   322 bits (825),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 155/163 (95%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFT QVI
Sbjct  273  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTAQVI  332

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF E+LTKIDR SGKELEKEPKFLKNGDAGMVKM+
Sbjct  333  IMNHPGQIGNGYAPVLDCHTSHIAVKFGEILTKIDRWSGKELEKEPKFLKNGDAGMVKMI  392

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETF+E PPLGRFAVRDMRQTVAVGV+KNVDKKDPTG
Sbjct  393  PTKPMVVETFAENPPLGRFAVRDMRQTVAVGVVKNVDKKDPTG  435



>gb|KDP29085.1| hypothetical protein JCGZ_16474 [Jatropha curcas]
Length=418

 Score =   321 bits (823),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FT QVI
Sbjct  171  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVI  230

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+
Sbjct  231  IMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMI  290

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  291  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  333



>ref|NP_001105617.1| elongation factor alpha3 [Zea mays]
 gb|AAF42977.1| elongation factor 1 alpha [Zea mays]
Length=447

 Score =   322 bits (825),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 155/163 (95%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|NP_001105933.1| elongation factor alpha2 [Zea mays]
 gb|AAF42976.1| elongation factor 1 alpha [Zea mays]
Length=447

 Score =   322 bits (825),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 155/163 (95%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_008792062.1| PREDICTED: elongation factor 1-alpha [Phoenix dactylifera]
Length=447

 Score =   322 bits (825),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 155/163 (95%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|ADC68236.1| elongation factor 1-alpha [Dendrobium nobile]
Length=238

 Score =   314 bits (805),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 151/163 (93%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FT QVI
Sbjct  66   TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVI  125

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELEKEPKFLKNGDAG VKM+
Sbjct  126  IMNHPGQIGNGYAPVLDCHTSHIAVKFAEIMTKIDRRSGKELEKEPKFLKNGDAGFVKMV  185

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PT+PMVVETFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  186  PTRPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  228



>gb|ADI24333.1| elongation factor 1-alpha [Miscanthus sinensis]
Length=447

 Score =   322 bits (825),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 155/163 (95%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMV  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>emb|CDY61938.1| BnaCnng38780D [Brassica napus]
 emb|CDY34479.1| BnaC04g13200D [Brassica napus]
 emb|CDY10804.1| BnaA05g11320D [Brassica napus]
 emb|CDY09211.1| BnaA02g06370D [Brassica napus]
Length=428

 Score =   321 bits (823),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FT QVI
Sbjct  253  TTEVKSVEMHHESLVEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVI  312

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM 
Sbjct  313  IMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMT  372

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  373  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  415



>emb|CDY22710.1| BnaC08g43440D [Brassica napus]
 emb|CDY22711.1| BnaC08g43450D [Brassica napus]
Length=427

 Score =   321 bits (823),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FT QVI
Sbjct  252  TTEVKSVEMHHESLVEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVI  311

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM 
Sbjct  312  IMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMT  371

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  372  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  414



>ref|XP_010542596.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score =   322 bits (824),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 155/162 (96%), Positives = 160/162 (99%), Gaps = 0/162 (0%)
 Frame = -3

Query  684  TEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVII  505
            TEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT QVII
Sbjct  275  TEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVII  334

Query  504  MNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLP  325
            MNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+P
Sbjct  335  MNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMIP  394

Query  324  TKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            TKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  395  TKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KHN18669.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   322 bits (824),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 155/163 (95%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT QVI
Sbjct  274  TTEVKSVEMHHEALTEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTAQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>ref|NP_001288465.1| elongation factor 1-alpha-like [Zea mays]
 ref|XP_008647262.1| PREDICTED: elongation factor alpha2 isoform X1 [Zea mays]
 gb|ACG25290.1| elongation factor 1-alpha [Zea mays]
 gb|AFW77596.1| putative translation elongation factor Tu family protein [Zea 
mays]
 gb|AFW77599.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW77600.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
Length=447

 Score =   322 bits (824),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 155/163 (95%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AFW77593.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW77594.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
Length=447

 Score =   322 bits (824),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 155/163 (95%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AAL57653.1| At1g07930/T6D22_3 [Arabidopsis thaliana]
Length=449

 Score =   322 bits (824),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FT QVI
Sbjct  274  TTEVKSVEMHHESLLEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM 
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMT  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>ref|XP_009144204.1| PREDICTED: elongation factor 1-alpha 1-like [Brassica rapa]
Length=449

 Score =   322 bits (824),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FT QVI
Sbjct  274  TTEVKSVEMHHESLVEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM 
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMT  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>ref|XP_002528020.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF34338.1| elongation factor 1-alpha, putative [Ricinus communis]
Length=348

 Score =   318 bits (815),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FT QVI
Sbjct  173  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVI  232

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+
Sbjct  233  IMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMI  292

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  293  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  335



>gb|ACG31866.1| elongation factor 1-alpha [Zea mays]
Length=447

 Score =   322 bits (824),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKD+KRGYVASNS DDPAK AASFT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDIKRGYVASNSXDDPAKEAASFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|NP_200847.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 ref|NP_563799.1| elongation factor 1-alpha 3 [Arabidopsis thaliana]
 ref|NP_563800.1| elongation factor 1-alpha 2 [Arabidopsis thaliana]
 ref|NP_563801.1| elongation factor 1-alpha 1 [Arabidopsis thaliana]
 ref|NP_001030993.1| elongation factor 1-alpha 1 [Arabidopsis thaliana]
 ref|NP_001119464.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 ref|XP_002864684.1| elongation factor 1-alpha [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002889674.1| elongation factor 1-alpha [Arabidopsis lyrata subsp. lyrata]
 sp|P0DH99.1|EF1A1_ARATH RecName: Full=Elongation factor 1-alpha 1; Short=EF-1-alpha 1; 
AltName: Full=eEF-1A1 [Arabidopsis thaliana]
 sp|Q8W4H7.2|EF1A2_ARATH RecName: Full=Elongation factor 1-alpha 2; Short=EF-1-alpha 2; 
AltName: Full=eEF-1A2 [Arabidopsis thaliana]
 sp|Q0WL56.2|EF1A3_ARATH RecName: Full=Elongation factor 1-alpha 3; Short=EF-1-alpha 3; 
AltName: Full=eEF-1A3 [Arabidopsis thaliana]
 sp|Q8GTY0.2|EF1A4_ARATH RecName: Full=Elongation factor 1-alpha 4; Short=EF-1-alpha 4; 
AltName: Full=eEF-1A4 [Arabidopsis thaliana]
 gb|AAF79847.1|AC026875_27 T6D22.3 [Arabidopsis thaliana]
 gb|AAL31918.1|AF419586_1 AT5g60390/muf9_40 [Arabidopsis thaliana]
 emb|CAA34453.1| elongation factor 1-alpha [Arabidopsis thaliana]
 emb|CAA34454.1| elongation factor 1-alpha [Arabidopsis thaliana]
 emb|CAA34455.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAB07882.1| EF-1alpha-A1 [Arabidopsis thaliana]
 gb|AAB07883.1| EF-1alpha-A2 [Arabidopsis thaliana]
 gb|AAB07884.1| EF-1alpha-A3 [Arabidopsis thaliana]
 dbj|BAB08224.1| elongation factor 1-alpha (EF-1-alpha) [Arabidopsis thaliana]
 gb|AAK62638.1| At1g07940/T6D22_14 [Arabidopsis thaliana]
 gb|AAL24386.1| elongation factor 1-alpha (EF-1-alpha) [Arabidopsis thaliana]
 gb|AAL31193.1| AT5g60390/muf9_40 [Arabidopsis thaliana]
 gb|AAL86336.1| putative elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAM65897.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAM67562.1| putative elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAM91202.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAM91362.1| At5g60390/muf9_40 [Arabidopsis thaliana]
 gb|AAM98236.1| unknown protein [Arabidopsis thaliana]
 gb|AAM98240.1| unknown protein [Arabidopsis thaliana]
 gb|AAN18164.1| At1g07940/T6D22_14 [Arabidopsis thaliana]
 gb|AAO00783.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAO00802.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAO00870.1| Unknown protein [Arabidopsis thaliana]
 gb|AAO29944.1| Unknown protein [Arabidopsis thaliana]
 gb|AAP21177.1| At5g60390/muf9_40 [Arabidopsis thaliana]
 dbj|BAE99963.1| elongation factor 1-alpha [Arabidopsis thaliana]
 dbj|BAE98497.1| translation elongation factor eEF-1 alpha chain [Arabidopsis 
thaliana]
 dbj|BAE98750.1| translation elongation factor eEF-1 alpha chain [Arabidopsis 
thaliana]
 gb|EFH40943.1| elongation factor 1-alpha [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65933.1| elongation factor 1-alpha [Arabidopsis lyrata subsp. lyrata]
 gb|AED97318.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 gb|AED97320.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 gb|AEE28212.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AEE28213.1| Elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AEE28215.1| Elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AEE28216.1| Elongation factor 1-alpha [Arabidopsis thaliana]
Length=449

 Score =   322 bits (824),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FT QVI
Sbjct  274  TTEVKSVEMHHESLLEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM 
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMT  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>ref|XP_006280459.1| hypothetical protein CARUB_v10026391mg [Capsella rubella]
 ref|XP_006304491.1| hypothetical protein CARUB_v10011249mg [Capsella rubella]
 ref|XP_010456336.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Camelina sativa]
 ref|XP_010456344.1| PREDICTED: elongation factor 1-alpha 1 isoform X2 [Camelina sativa]
 ref|XP_010456350.1| PREDICTED: elongation factor 1-alpha 1 isoform X3 [Camelina sativa]
 ref|XP_010456355.1| PREDICTED: elongation factor 1-alpha 1 isoform X4 [Camelina sativa]
 ref|XP_010456361.1| PREDICTED: elongation factor 1-alpha 1 isoform X5 [Camelina sativa]
 ref|XP_010456369.1| PREDICTED: elongation factor 1-alpha 1 isoform X6 [Camelina sativa]
 ref|XP_010488164.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010488173.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010505603.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Camelina sativa]
 ref|XP_010505604.1| PREDICTED: elongation factor 1-alpha 1 isoform X2 [Camelina sativa]
 ref|XP_010509026.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010517279.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010443836.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010443839.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010458006.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010458008.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Camelina sativa]
 ref|XP_010458009.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Camelina sativa]
 ref|XP_010475572.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010475573.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010475574.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010483684.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010483687.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 gb|EOA13357.1| hypothetical protein CARUB_v10026391mg [Capsella rubella]
 gb|EOA37389.1| hypothetical protein CARUB_v10011249mg [Capsella rubella]
Length=449

 Score =   322 bits (824),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FT QVI
Sbjct  274  TTEVKSVEMHHESLLEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM 
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMT  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>ref|XP_010032227.1| PREDICTED: elongation factor 1-alpha-like [Eucalyptus grandis]
 gb|KCW51630.1| hypothetical protein EUGRSUZ_J01121 [Eucalyptus grandis]
Length=447

 Score =   322 bits (824),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            P+KPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  394  PSKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>dbj|BAF02151.1| elongation factor 1-alpha [Arabidopsis thaliana]
Length=449

 Score =   322 bits (824),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FT QVI
Sbjct  274  TTEVKSVEMHHESLLEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM 
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMT  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>gb|AAK82537.1| At1g07930/T6D22_3 [Arabidopsis thaliana]
Length=449

 Score =   322 bits (824),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FT QVI
Sbjct  274  TTEVKSVEMHHESLLEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM 
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMT  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>ref|XP_009148045.1| PREDICTED: elongation factor 1-alpha 1 [Brassica rapa]
 ref|XP_009110915.1| PREDICTED: elongation factor 1-alpha 1 [Brassica rapa]
 ref|XP_009118409.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Brassica rapa]
 ref|XP_009118410.1| PREDICTED: elongation factor 1-alpha 1 isoform X2 [Brassica rapa]
 ref|XP_009118411.1| PREDICTED: elongation factor 1-alpha 1 isoform X3 [Brassica rapa]
 ref|XP_009120571.1| PREDICTED: elongation factor 1-alpha 1 [Brassica rapa]
 gb|ACS68201.1| elongation factor 1 alpha [Brassica napus]
 gb|AGK07381.1| elongation factor 1-alpha protein [Brassica oleracea var. botrytis]
Length=449

 Score =   322 bits (824),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FT QVI
Sbjct  274  TTEVKSVEMHHESLVEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM 
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMT  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>emb|CAA34456.1| elongation factor 1-alpha [Arabidopsis thaliana]
Length=449

 Score =   322 bits (824),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FT QVI
Sbjct  274  TTEVKSVEMHHESLLEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM 
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMT  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>gb|AAK32834.1|AF361822_1 At1g07930/T6D22_3 [Arabidopsis thaliana]
 gb|AAL15385.1| At1g07930/T6D22_3 [Arabidopsis thaliana]
Length=449

 Score =   322 bits (824),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FT QVI
Sbjct  274  TTEVKSVEMHHESLLEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM 
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMT  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>ref|XP_008790814.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
Length=447

 Score =   321 bits (823),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 155/163 (95%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTAQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAG+VKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGLVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_011089874.1| PREDICTED: elongation factor 1-alpha [Sesamum indicum]
Length=449

 Score =   321 bits (823),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEA+QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT QVI
Sbjct  274  TTEVKSVEMHHEAMQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG+VKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGLVKMV  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDP+G
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPSG  436



>ref|XP_011089339.1| PREDICTED: elongation factor 1-alpha isoform X1 [Sesamum indicum]
 ref|XP_011089346.1| PREDICTED: elongation factor 1-alpha-like [Sesamum indicum]
Length=449

 Score =   321 bits (823),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEA+QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT QVI
Sbjct  274  TTEVKSVEMHHEAMQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG+VKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGLVKMV  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDP+G
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPSG  436



>gb|AAK25877.1|AF360167_1 putative translation elongation factor eEF-1 alpha chain A4 [Arabidopsis 
thaliana]
Length=449

 Score =   321 bits (823),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FT QVI
Sbjct  274  TTEVKSVEMHHESLLEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM 
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMT  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>ref|XP_004309880.1| PREDICTED: elongation factor 1-alpha [Fragaria vesca subsp. vesca]
Length=447

 Score =   321 bits (823),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 155/163 (95%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT QVI
Sbjct  274  TTEVKSVEMHHEALPEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF E+LTKIDRRSGKELEKEPKFLKNGDAGMVKML
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFGEILTKIDRRSGKELEKEPKFLKNGDAGMVKML  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDP+G
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPSG  436



>gb|ABA12220.1| translation elongation factor 1A-4 [Gossypium hirsutum]
 gb|KJB62497.1| hypothetical protein B456_009G420000 [Gossypium raimondii]
 gb|KJB62498.1| hypothetical protein B456_009G420000 [Gossypium raimondii]
 gb|KJB62499.1| hypothetical protein B456_009G420100 [Gossypium raimondii]
 gb|KJB62500.1| hypothetical protein B456_009G420100 [Gossypium raimondii]
Length=447

 Score =   321 bits (823),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFT QVI
Sbjct  274  TTEVKSVEMHHEALSEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF+ELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDAGMIKMV  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_009126609.1| PREDICTED: elongation factor 1-alpha 1-like [Brassica rapa]
Length=449

 Score =   321 bits (823),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FT QVI
Sbjct  274  TTEVKSVEMHHESLVEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM 
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMT  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>ref|XP_010067278.1| PREDICTED: elongation factor 1-alpha-like [Eucalyptus grandis]
Length=447

 Score =   321 bits (823),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPA+ AASF  QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAASFASQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF+ELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDAGMVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|ABA12217.1| translation elongation factor 1A-1 [Gossypium hirsutum]
Length=447

 Score =   321 bits (823),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFT QVI
Sbjct  274  TTEVKSVEMHHEALSEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF+ELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDAGMIKMV  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|NP_001288407.1| elongation factor 1-alpha-like [Zea mays]
 gb|ACF87009.1| unknown [Zea mays]
Length=447

 Score =   321 bits (823),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSV+MHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFT QVI
Sbjct  274  TTEVKSVKMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AAL69396.1| elongation factor 1-alpha [Elaeis oleifera]
Length=447

 Score =   321 bits (822),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 155/163 (95%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+F  QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFIAQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKML
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGFVKML  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>sp|Q41803.1|EF1A_MAIZE RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Zea 
mays]
 dbj|BAA08249.1| alpha subunit of tlanslation elongation factor 1 [Zea mays]
Length=447

 Score =   321 bits (822),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 155/163 (95%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVAS SKDDPAK AASFT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASGSKDDPAKEAASFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGMVKMV  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_009358244.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
 ref|XP_009338285.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
Length=447

 Score =   321 bits (822),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KK+PTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKEPTG  436



>gb|ABA12218.1| translation elongation factor 1A-2 [Gossypium hirsutum]
 gb|KHG05237.1| Elongation factor 1-alpha [Gossypium arboreum]
 gb|KJB14364.1| hypothetical protein B456_002G121500 [Gossypium raimondii]
Length=447

 Score =   321 bits (822),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FT QVI
Sbjct  274  TTEVKSVEMHHEALTEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_004157309.1| PREDICTED: elongation factor 1-alpha-like [Cucumis sativus]
Length=449

 Score =   321 bits (822),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF E+LTKIDRRSGKELEKEPKFLKNGDAG VKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFGEILTKIDRRSGKELEKEPKFLKNGDAGFVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_008358325.1| PREDICTED: elongation factor 1-alpha [Malus domestica]
 ref|XP_008385282.1| PREDICTED: elongation factor 1-alpha [Malus domestica]
Length=447

 Score =   320 bits (821),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KK+PTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKEPTG  436



>gb|KDP29084.1| hypothetical protein JCGZ_16473 [Jatropha curcas]
Length=399

 Score =   319 bits (817),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FT QVI
Sbjct  226  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVI  285

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+
Sbjct  286  IMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMI  345

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  346  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  388



>gb|ABA12219.1| translation elongation factor 1A-3 [Gossypium hirsutum]
Length=448

 Score =   320 bits (821),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMV  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KJB48746.1| hypothetical protein B456_008G084000 [Gossypium raimondii]
Length=400

 Score =   319 bits (817),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDD AK AA+FT QVI
Sbjct  226  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDLAKEAANFTSQVI  285

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+
Sbjct  286  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMV  345

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  346  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  388



>ref|XP_008792073.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
Length=447

 Score =   320 bits (821),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>emb|CDX93604.1| BnaA06g04440D [Brassica napus]
Length=460

 Score =   321 bits (822),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FT QVI
Sbjct  285  TTEVKSVEMHHESLVEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVI  344

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM 
Sbjct  345  IMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMT  404

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  405  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  447



>gb|AAD56020.1|AF181492_1 elongation factor-1 alpha 3 [Lilium longiflorum]
Length=447

 Score =   320 bits (821),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FT QVI
Sbjct  274  TTEVKSVEMHHEALLEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  394  PTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>ref|XP_010032225.1| PREDICTED: elongation factor 1-alpha-like [Eucalyptus grandis]
Length=448

 Score =   320 bits (821),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF+EL+TKIDRRSGKE+EKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKEIEKEPKFLKNGDAGMVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_006424629.1| hypothetical protein CICLE_v10028446mg [Citrus clementina]
 ref|XP_006424632.1| hypothetical protein CICLE_v10028445mg [Citrus clementina]
 ref|XP_006488147.1| PREDICTED: elongation factor 1-alpha isoform X1 [Citrus sinensis]
 ref|XP_006488148.1| PREDICTED: elongation factor 1-alpha-like [Citrus sinensis]
 gb|ESR37869.1| hypothetical protein CICLE_v10028446mg [Citrus clementina]
 gb|ESR37872.1| hypothetical protein CICLE_v10028445mg [Citrus clementina]
Length=447

 Score =   320 bits (820),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPA+ AA+FT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF+EL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  394  PTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>ref|XP_002518073.1| elongation factor 1-alpha, putative [Ricinus communis]
 ref|XP_002518074.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF44206.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF44207.1| elongation factor 1-alpha, putative [Ricinus communis]
Length=449

 Score =   320 bits (821),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTE+KSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT QVI
Sbjct  274  TTEIKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_007205199.1| hypothetical protein PRUPE_ppa005718mg [Prunus persica]
 gb|EMJ06398.1| hypothetical protein PRUPE_ppa005718mg [Prunus persica]
Length=447

 Score =   320 bits (820),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>emb|CDX95108.1| BnaC05g05630D [Brassica napus]
Length=487

 Score =   321 bits (823),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FT QVI
Sbjct  295  TTEVKSVEMHHESLVEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVI  354

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM 
Sbjct  355  IMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMT  414

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  415  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  457



>gb|ABA12223.1| translation elongation factor 1A-7 [Gossypium hirsutum]
Length=448

 Score =   320 bits (820),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FT Q I
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQGI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMV  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|NP_001290506.1| elongation factor 1-alpha [Elaeis guineensis]
 ref|XP_010922532.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
 gb|AAT45847.1| elongation factor 1-alpha 1 [Elaeis guineensis]
Length=447

 Score =   320 bits (819),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  394  PTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_007151789.1| hypothetical protein PHAVU_004G075100g [Phaseolus vulgaris]
 gb|ESW23783.1| hypothetical protein PHAVU_004G075100g [Phaseolus vulgaris]
Length=447

 Score =   320 bits (819),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT QVI
Sbjct  274  TTEVKSVEMHHEALTEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_009392715.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009392716.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   320 bits (819),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETF++YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PTKPMVVETFAQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KJB48747.1| hypothetical protein B456_008G084000 [Gossypium raimondii]
Length=427

 Score =   319 bits (818),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDD AK AA+FT QVI
Sbjct  253  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDLAKEAANFTSQVI  312

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+
Sbjct  313  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMV  372

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  373  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  415



>ref|XP_008380545.1| PREDICTED: elongation factor 1-alpha-like [Malus domestica]
 ref|XP_008365661.1| PREDICTED: elongation factor 1-alpha [Malus domestica]
 ref|XP_009374568.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
 ref|XP_009374577.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
Length=447

 Score =   320 bits (819),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKML
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFGEILTKIDRRSGKEIEKEPKFLKNGDAGMVKML  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_008789061.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
 ref|XP_008789062.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
 ref|XP_008789063.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
Length=447

 Score =   320 bits (819),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAG VKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGFVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AEI29162.1| EF1a-like protein [Phalaenopsis hybrid cultivar]
Length=398

 Score =   318 bits (815),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FT QVI
Sbjct  225  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVI  284

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAG VKM+
Sbjct  285  IMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGFVKMI  344

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  345  PTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  387



>ref|XP_011026992.1| PREDICTED: elongation factor 1-alpha isoform X2 [Populus euphratica]
 ref|XP_011026993.1| PREDICTED: elongation factor 1-alpha isoform X2 [Populus euphratica]
 ref|XP_011026995.1| PREDICTED: elongation factor 1-alpha isoform X2 [Populus euphratica]
 ref|XP_011026996.1| PREDICTED: elongation factor 1-alpha isoform X3 [Populus euphratica]
Length=449

 Score =   320 bits (819),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPA+ AA+FT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMIKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_004489551.1| PREDICTED: elongation factor 1-alpha-like [Cicer arietinum]
 ref|XP_004489552.1| PREDICTED: elongation factor 1-alpha-like [Cicer arietinum]
Length=447

 Score =   320 bits (819),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FT QVI
Sbjct  274  TTEVKSVEMHHEALTEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAG+VKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGLVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_007009751.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007009752.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY18561.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY18562.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
Length=449

 Score =   320 bits (819),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHT HIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTCHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMV  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIKNV+KKDP+G
Sbjct  394  PTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKNVEKKDPSG  436



>ref|XP_011031783.1| PREDICTED: elongation factor 1-alpha-like [Populus euphratica]
 ref|XP_011040944.1| PREDICTED: elongation factor 1-alpha-like isoform X1 [Populus 
euphratica]
 ref|XP_011040945.1| PREDICTED: elongation factor 1-alpha-like isoform X1 [Populus 
euphratica]
Length=449

 Score =   320 bits (819),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPA+ AA+FT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMIKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_010043711.1| PREDICTED: elongation factor 1-alpha [Eucalyptus grandis]
 gb|KCW85696.1| hypothetical protein EUGRSUZ_B02473 [Eucalyptus grandis]
Length=449

 Score =   320 bits (819),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTE+KSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT QVI
Sbjct  274  TTEIKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAATFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAG VKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGFVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_011026991.1| PREDICTED: elongation factor 1-alpha isoform X1 [Populus euphratica]
 ref|XP_011026997.1| PREDICTED: elongation factor 1-alpha [Populus euphratica]
 ref|XP_011040951.1| PREDICTED: elongation factor 1-alpha [Populus euphratica]
Length=449

 Score =   320 bits (819),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPA+ AA+FT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMIKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_011031786.1| PREDICTED: elongation factor 1-alpha-like [Populus euphratica]
Length=340

 Score =   316 bits (809),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 151/162 (93%), Positives = 159/162 (98%), Gaps = 0/162 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FT QVI
Sbjct  165  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVI  224

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+
Sbjct  225  IMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMIKMI  284

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPT  202
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD +
Sbjct  285  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDAS  326



>gb|AAN31833.1| putative translation elongation factor eEF-1 alpha chain (gene 
A4) [Arabidopsis thaliana]
Length=449

 Score =   320 bits (819),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHE+L EALPGDNVGFNVKN AVKDLKRGYVASNSKDDPAKGAA+FT QVI
Sbjct  274  TTEVKSVEMHHESLLEALPGDNVGFNVKNFAVKDLKRGYVASNSKDDPAKGAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM 
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMT  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>ref|XP_010939624.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
 ref|XP_010939625.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
Length=447

 Score =   319 bits (818),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF+ELL+KIDRRSGKELEKEPKFLKNGDAG VKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFSELLSKIDRRSGKELEKEPKFLKNGDAGFVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEY PLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PTKPMVVETFSEYSPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KHG01531.1| Elongation factor 1-alpha [Gossypium arboreum]
 gb|KJB63252.1| hypothetical protein B456_010G2044001 [Gossypium raimondii]
Length=447

 Score =   319 bits (818),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FT QVI
Sbjct  274  TTEVKSVEMHHEALSEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAG++KM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGLIKMV  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>gb|ABS10822.1| elongation factor 1-alpha [Phaseolus vulgaris]
Length=201

 Score =   310 bits (795),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 150/161 (93%), Positives = 157/161 (98%), Gaps = 0/161 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FT QVI
Sbjct  38   TTEVKSVEMHHEALLEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVI  97

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKE+EKEPKFLKNGDAG VKM+
Sbjct  98   IMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKEIEKEPKFLKNGDAGYVKMI  157

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDP  205
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP
Sbjct  158  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDP  198



>dbj|BAH19898.1| AT1G07930 [Arabidopsis thaliana]
Length=449

 Score =   319 bits (818),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FT QVI
Sbjct  274  TTEVKSVEMHHESLLEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMV M 
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVMMT  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>sp|P29521.1|EF1A1_DAUCA RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Daucus 
carota]
 emb|CAA42843.1| elongation factor 1A [Daucus carota]
Length=449

 Score =   319 bits (818),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 155/163 (95%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHE+L EALPGDNVGFNVKNV+VKDLKRGYVASNSKDDPAKGAASFT QVI
Sbjct  274  TTEVKSVEMHHESLLEALPGDNVGFNVKNVSVKDLKRGYVASNSKDDPAKGAASFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETF+EYPPLGRFAVR MRQTVAVGVIK V+KKDPTG
Sbjct  394  PTKPMVVETFAEYPPLGRFAVRVMRQTVAVGVIKAVEKKDPTG  436



>ref|NP_001105565.1| elongation factor alpha5 [Zea mays]
 gb|AAF42979.1| elongation factor 1 alpha [Zea mays]
Length=447

 Score =   319 bits (818),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDL RG+VASNSKDDPAK AASFT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLNRGFVASNSKDDPAKEAASFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKNGDAGMVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFS+YPPLGRFAV DMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PTKPMVVETFSQYPPLGRFAVLDMRQTVAVGVIKSVEKKDPTG  436



>gb|KDP29083.1| hypothetical protein JCGZ_16472 [Jatropha curcas]
Length=447

 Score =   319 bits (818),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_006858667.1| hypothetical protein AMTR_s00066p00072310 [Amborella trichopoda]
 gb|ERN20134.1| hypothetical protein AMTR_s00066p00072310 [Amborella trichopoda]
Length=447

 Score =   319 bits (818),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_008783722.1| PREDICTED: elongation factor 1-alpha isoform X1 [Phoenix dactylifera]
Length=447

 Score =   319 bits (817),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAG VKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGFVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  394  PTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_010920912.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
Length=447

 Score =   319 bits (817),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|ABA12224.1| translation elongation factor 1A-8 [Gossypium hirsutum]
Length=449

 Score =   319 bits (817),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMV  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  394  PTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_002528028.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF34346.1| elongation factor 1-alpha, putative [Ricinus communis]
Length=449

 Score =   319 bits (817),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_004307410.1| PREDICTED: elongation factor 1-alpha [Fragaria vesca subsp. vesca]
Length=447

 Score =   319 bits (817),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTAQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF E+LTKIDRRSGKELEKEPKFLKNGDAG VKML
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFGEILTKIDRRSGKELEKEPKFLKNGDAGFVKML  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK V+KKDP+G
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKAVEKKDPSG  436



>ref|XP_003547695.1| PREDICTED: elongation factor 1-alpha isoform 2 [Glycine max]
 gb|KHN27573.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   319 bits (817),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKE+EKEPKFLKNGDAG VKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKEIEKEPKFLKNGDAGYVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_007222129.1| hypothetical protein PRUPE_ppa005702mg [Prunus persica]
 ref|XP_008224523.1| PREDICTED: elongation factor 1-alpha-like [Prunus mume]
 gb|EMJ23328.1| hypothetical protein PRUPE_ppa005702mg [Prunus persica]
Length=447

 Score =   319 bits (817),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPA+ AA+FT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKML
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFGEILTKIDRRSGKEIEKEPKFLKNGDAGMVKML  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_010937804.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
 ref|XP_010937805.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
Length=447

 Score =   319 bits (817),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK A SFT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAGSFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>emb|CAA65453.1| elongation factor [Narcissus pseudonarcissus]
Length=242

 Score =   311 bits (798),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 150/163 (92%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHE+L EA PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT QVI
Sbjct  69   TTEVKSVEMHHESLLEAHPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTAQVI  128

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAV+FAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  129  IMNHPGQIGNGYAPVLDCHTSHIAVRFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMI  188

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETF+EYPP+GRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  189  PTKPMVVETFAEYPPMGRFAVRDMRQTVAVGVIKSVEKKDPTG  231



>gb|ACS68200.1| elongation factor 1 alpha [Brassica napus]
Length=449

 Score =   319 bits (817),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGYVASN KDDPAKGAA+FT QVI
Sbjct  274  TTEVKSVEMHHESLVEALPGDNVGFNVKNVAVKDLKRGYVASNPKDDPAKGAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM 
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMT  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>emb|CDY58828.1| BnaAnng15460D [Brassica napus]
Length=568

 Score =   322 bits (826),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FT QVI
Sbjct  252  TTEVKSVEMHHESLVEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVI  311

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM 
Sbjct  312  IMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMT  371

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  372  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  414



>gb|KEH43533.1| GTP-binding elongation factor Tu family protein [Medicago truncatula]
Length=347

 Score =   315 bits (808),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 151/163 (93%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT QVI
Sbjct  173  TTEVKSVEMHHEALTEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVI  232

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKE+EKEPKFLKNGDAG++KM+
Sbjct  233  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKEIEKEPKFLKNGDAGIIKMI  292

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK V+KKDP+G
Sbjct  293  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKAVEKKDPSG  335



>ref|XP_008224543.1| PREDICTED: elongation factor 1-alpha [Prunus mume]
Length=447

 Score =   318 bits (816),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEA PGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FT QVI
Sbjct  274  TTEVKSVEMHHEALQEAFPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KDP29086.1| hypothetical protein JCGZ_16475 [Jatropha curcas]
Length=447

 Score =   318 bits (816),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|NP_001105935.1| elongation factor alpha8 [Zea mays]
 gb|AAF42982.1| elongation factor 1 alpha [Zea mays]
Length=447

 Score =   318 bits (816),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLK+GDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKELEKEPKFLKDGDAGMVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFS +PPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PTKPMVVETFSAFPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_003553292.1| PREDICTED: elongation factor 1-alpha isoform 1 [Glycine max]
Length=447

 Score =   318 bits (816),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FT QVI
Sbjct  274  TTEVKSVEMHHEALTEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGMVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KGN51228.1| Elongation factor 1-alpha [Cucumis sativus]
Length=402

 Score =   317 bits (812),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFT QVI
Sbjct  227  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTSQVI  286

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IM HPGQIGNGYAPVLDCHTSHIAVKF E+LTKIDRRSGKELEKEPKFLKNGDAG VKM+
Sbjct  287  IMKHPGQIGNGYAPVLDCHTSHIAVKFGEILTKIDRRSGKELEKEPKFLKNGDAGFVKMI  346

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  347  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  389



>ref|XP_006424633.1| hypothetical protein CICLE_v10028443mg [Citrus clementina]
 ref|XP_006488149.1| PREDICTED: elongation factor 1-alpha-like [Citrus sinensis]
 gb|ESR37873.1| hypothetical protein CICLE_v10028443mg [Citrus clementina]
Length=447

 Score =   318 bits (816),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPA+ AA+FT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF+EL+TKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELEKEPKFLKNGDAGMVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_009126611.1| PREDICTED: elongation factor 1-alpha 1-like [Brassica rapa]
 ref|XP_009126612.1| PREDICTED: elongation factor 1-alpha 1-like [Brassica rapa]
Length=449

 Score =   318 bits (816),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FT QVI
Sbjct  274  TTEVKSVEMHHESLVEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM 
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMT  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKK PTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKHPTG  436



>gb|KHG28979.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=447

 Score =   318 bits (815),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AASFT QVI
Sbjct  274  TTEVKSVEMHHEALSEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAASFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVK +ELLTKIDRRSGKELEKEPKFLKNGDAGM+KM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKVSELLTKIDRRSGKELEKEPKFLKNGDAGMIKMV  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|ABD66072.1| elongation factor 1-alpha [Phoenix dactylifera]
Length=245

 Score =   311 bits (797),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 150/161 (93%), Positives = 158/161 (98%), Gaps = 0/161 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT QVI
Sbjct  85   TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVI  144

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LT+IDRRSGKELEKEPKFLK+GDAG VKM+
Sbjct  145  IMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTEIDRRSGKELEKEPKFLKSGDAGFVKMI  204

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDP  205
            PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKDP
Sbjct  205  PTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDP  245



>ref|XP_007207457.1| hypothetical protein PRUPE_ppa005717mg [Prunus persica]
 gb|EMJ08656.1| hypothetical protein PRUPE_ppa005717mg [Prunus persica]
Length=447

 Score =   318 bits (815),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHE+LQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT QVI
Sbjct  274  TTEVKSVEMHHESLQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTAQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIG GYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+
Sbjct  334  IMNHPGQIGQGYAPVLDCHTSHIAVKFAEMLTKIDRRSGKELEKEPKFLKNGDAGFVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KHN42761.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   318 bits (815),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FT QVI
Sbjct  274  TTEVKSVEMHHEALTEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGMVKMV  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|ACI96243.1| elongation factor 1-alpha [Prunus persica]
Length=447

 Score =   318 bits (815),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPA+ AA+FT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKML
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFGEILTKIDRRSGKEIEKEPKFLKNGDAGMVKML  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>gb|KHN14872.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   318 bits (815),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FT QVI
Sbjct  274  TTEVKSVEMHHEALTEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGMVKMV  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AFP44110.1| elongation factor 1-alpha [Lycoris longituba]
Length=447

 Score =   318 bits (815),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMV  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            P+KPMVVETFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PSKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AFJ04514.1| elongation factor 1-alpha, partial [Vernicia fordii]
Length=438

 Score =   318 bits (814),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FT QVI
Sbjct  273  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVI  332

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAG VKM+
Sbjct  333  IMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGFVKMI  392

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  393  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  435



>gb|ABB72813.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
Length=448

 Score =   318 bits (815),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 153/162 (94%), Positives = 158/162 (98%), Gaps = 0/162 (0%)
 Frame = -3

Query  684  TEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVII  505
            TEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAKGAASFT QVII
Sbjct  275  TEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKGAASFTAQVII  334

Query  504  MNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKMLP  325
            MNHPGQIGNGYAPVLDC  SHIAVKFAE+LTKIDRRSGKELEKE KFLKNGDAGMVKM+P
Sbjct  335  MNHPGQIGNGYAPVLDCTLSHIAVKFAEILTKIDRRSGKELEKEAKFLKNGDAGMVKMIP  394

Query  324  TKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            TKPMVVETF+EYPPLGRFAVRDMRQTVAVGV+KNVDKKDPTG
Sbjct  395  TKPMVVETFAEYPPLGRFAVRDMRQTVAVGVVKNVDKKDPTG  436



>ref|XP_011089340.1| PREDICTED: elongation factor 1-alpha isoform X2 [Sesamum indicum]
 ref|XP_011089341.1| PREDICTED: elongation factor 1-alpha isoform X3 [Sesamum indicum]
 ref|XP_011089342.1| PREDICTED: elongation factor 1-alpha isoform X4 [Sesamum indicum]
 ref|XP_011089875.1| PREDICTED: elongation factor 1-alpha [Sesamum indicum]
Length=449

 Score =   318 bits (815),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHE++QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT QVI
Sbjct  274  TTEVKSVEMHHESMQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGFVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>dbj|BAC22125.1| eukaryotic elongation factor 1A [Bruguiera sexangula]
Length=449

 Score =   318 bits (815),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 151/163 (93%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNV+VKDLKRGYVASNSKDDPAK A+SFT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVSVKDLKRGYVASNSKDDPAKEASSFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAG VKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGFVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KK+P+G
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKEPSG  436



>gb|ADR70875.1| eukaryotic translation elongation factor 1-alpha [Hevea brasiliensis]
Length=449

 Score =   318 bits (814),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PTKPMVVETFSTYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_009388387.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   318 bits (814),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEA PGDNVGFNVKNVAVKDLKRG+VASNSK+DP K AASFT QVI
Sbjct  274  TTEVKSVEMHHEALQEAFPGDNVGFNVKNVAVKDLKRGFVASNSKEDPTKEAASFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAG VKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGFVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|ADW83729.1| elongation factor 1-alpha [Musa acuminata AAA Group]
Length=191

 Score =   308 bits (790),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 150/163 (92%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNV VKDLKRGYVASNSK DP K AASFT QVI
Sbjct  18   TTEVKSVEMHHEALQEALPGDNVGFNVKNVDVKDLKRGYVASNSKADPTKEAASFTSQVI  77

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIG GYAPVLDCH SHIAVKFAELLTKIDRRSGK LEKEPKFLKNGDAG VKM+
Sbjct  78   IMNHPGQIGIGYAPVLDCHASHIAVKFAELLTKIDRRSGKALEKEPKFLKNGDAGFVKMI  137

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            P+KPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  138  PSKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  180



>gb|KGN51227.1| hypothetical protein Csa_5G495940 [Cucumis sativus]
Length=344

 Score =   314 bits (805),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 157/163 (96%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT QVI
Sbjct  169  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVI  228

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+
Sbjct  229  IMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMI  288

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK V+KKD +G
Sbjct  289  PTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKAVEKKDASG  331



>gb|AAL32631.1| putative elongation factor 1-a [Arabidopsis thaliana]
 gb|AAM47970.1| putative elongation factor 1-a [Arabidopsis thaliana]
Length=449

 Score =   318 bits (814),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAA+FT QVI
Sbjct  274  TTEVKSVEMHHESLLEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKM 
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEKEPKFLKNGDAGMVKMT  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTV V VIK+VDKKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVTVSVIKSVDKKDPTG  436



>ref|XP_004309883.1| PREDICTED: elongation factor 1-alpha-like [Fragaria vesca subsp. 
vesca]
Length=447

 Score =   318 bits (814),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FT QVI
Sbjct  274  TTEVKSVEMHHEALLEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF E+LTKIDRRSGKE+EKEPKFLKNGD+GMVKML
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFGEILTKIDRRSGKEIEKEPKFLKNGDSGMVKML  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDP+G
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPSG  436



>ref|XP_006600131.1| PREDICTED: elongation factor-1A isoform X1 [Glycine max]
 gb|KHN40184.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   317 bits (813),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHE+L EA PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT QVI
Sbjct  274  TTEVKSVEMHHESLTEAHPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTAQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>ref|NP_001183947.1| uncharacterized protein LOC100502553 [Zea mays]
 gb|ACF84684.1| unknown [Zea mays]
Length=399

 Score =   316 bits (809),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 157/163 (96%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHE +QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFT QVI
Sbjct  226  TTEVKSVEMHHETMQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTAQVI  285

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF+ELLTKIDRRSGKELE  PKFLKNGDAG VKM+
Sbjct  286  IMNHPGQIGNGYAPVLDCHTSHIAVKFSELLTKIDRRSGKELESAPKFLKNGDAGFVKMI  345

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  346  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  388



>gb|KHG24249.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=401

 Score =   316 bits (809),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT QVI
Sbjct  226  TTEVKSVEMHHESLPEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVI  285

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+
Sbjct  286  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGFVKMI  345

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  346  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  388



>ref|NP_001237425.1| elongation factor-1A [Glycine max]
 gb|ACI42861.1| elongation factor-1A [Glycine max]
Length=447

 Score =   317 bits (813),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHE+L EA PGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT QVI
Sbjct  274  TTEVKSVEMHHESLTEAHPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTAQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELEKEPKFLKNGDAGFVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>gb|ADR70874.1| eukaryotic translation elongation factor 1-alpha [Hevea brasiliensis]
Length=449

 Score =   317 bits (813),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PTKPMVVETFSGYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KGN47308.1| hypothetical protein Csa_6G290890 [Cucumis sativus]
Length=295

 Score =   312 bits (799),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 148/163 (91%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHE+L EA+PGDNVGFNVKNVAVKDLKRG+VASNSKDDPA+ AA+FT QVI
Sbjct  120  TTEVKSVEMHHESLPEAVPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAREAANFTSQVI  179

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+
Sbjct  180  IMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMIKMI  239

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  240  PTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  282



>gb|AIZ68131.1| translation elongation factor 1-alpha [Ornithogalum saundersiae]
Length=447

 Score =   317 bits (812),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT QVI
Sbjct  274  TTEVKSVEMHHEALLEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMV  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>sp|O24534.1|EF1A_VICFA RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Vicia 
faba]
 emb|CAA10847.1| elongation factor 1-alpha (EF1-a) [Vicia faba]
Length=447

 Score =   317 bits (812),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FT QVI
Sbjct  274  TTEVKSVEMHHEALTEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKE+EKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKEIEKEPKFLKNGDAGMVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KHG27341.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=449

 Score =   317 bits (812),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT QVI
Sbjct  274  TTEVKSVEMHHESLPEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGFVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AHB86963.1| elongation factor 1-alpha [Sedum alfredii]
Length=447

 Score =   317 bits (812),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FT QVI
Sbjct  274  TTEVKSVEMHHEALLEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTAQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMIKMV  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_009403341.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   317 bits (812),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAG VKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGFVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  394  PTKPMVVETFSGYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_009381507.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009381508.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009381509.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   317 bits (812),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGFVKMV  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PTKPMVVETFSTYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>emb|CAN71914.1| hypothetical protein VITISV_026485 [Vitis vinifera]
Length=226

 Score =   309 bits (792),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 149/163 (91%), Positives = 157/163 (96%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHE+L E LPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FT QVI
Sbjct  53   TTEVKSVEMHHESLVEGLPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTAQVI  112

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAE+ TKIDRRSGKELEKEPKFLKNGDAG VKM+
Sbjct  113  IMNHPGQIGNGYAPVLDCHTSHIAVKFAEITTKIDRRSGKELEKEPKFLKNGDAGFVKMI  172

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  173  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  215



>gb|AAY56337.1| elongation factor-1 alpha [Musa acuminata]
Length=447

 Score =   317 bits (812),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEA PGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FT QVI
Sbjct  274  TTEVKSVEMHHEALQEAFPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAG+VKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGLVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETF+EY PLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PTKPMVVETFAEYSPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AEQ75495.1| elongation factor 1-alpha [Rosa multiflora]
Length=447

 Score =   317 bits (812),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FT QVI
Sbjct  274  TTEVKSVEMHHEALLEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKML
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFGEILTKIDRRSGKEIEKEPKFLKNGDAGMVKML  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>gb|AAV92325.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92326.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92327.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92328.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92329.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92330.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92331.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92332.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92333.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92334.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92335.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92336.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92337.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92338.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92339.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92340.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92341.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii]
 gb|AAV92342.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92343.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92344.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92345.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92346.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92347.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii 
var. menziesii]
 gb|AAV92348.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii]
 gb|AAV92349.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii]
 gb|AAV92350.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii]
 gb|AAV92351.1| translation elongation factor-1 alpha, partial [Pseudotsuga menziesii]
Length=247

 Score =   310 bits (793),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 148/163 (91%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVAS+SK+DPAK AA+FT QVI
Sbjct  74   TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASDSKNDPAKEAANFTAQVI  133

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHT HIAVKF+E++TK+DRRSGKELEKEPKFLKNGDAG VKM+
Sbjct  134  IMNHPGQIGNGYAPVLDCHTCHIAVKFSEIMTKVDRRSGKELEKEPKFLKNGDAGFVKMI  193

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGVIK V+KKDPTG
Sbjct  194  PTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKAVEKKDPTG  236



>ref|XP_009403064.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   317 bits (812),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEA PGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FT QVI
Sbjct  274  TTEVKSVEMHHEALQEAFPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAG+VKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGLVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETF+EY PLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PTKPMVVETFAEYSPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_009342345.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
Length=447

 Score =   317 bits (811),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEA+QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT QVI
Sbjct  274  TTEVKSVEMHHEAMQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTAQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIG GYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELE+EPKFLKNGDAG VKM+
Sbjct  334  IMNHPGQIGQGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEREPKFLKNGDAGFVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|ABA12222.1| translation elongation factor 1A-6 [Gossypium hirsutum]
 gb|KHG08414.1| Elongation factor 1-alpha [Gossypium arboreum]
 gb|KJB16823.1| hypothetical protein B456_002G249600 [Gossypium raimondii]
 gb|KJB16824.1| hypothetical protein B456_002G249600 [Gossypium raimondii]
 gb|KJB16825.1| hypothetical protein B456_002G249600 [Gossypium raimondii]
Length=447

 Score =   317 bits (811),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHE+L EA PGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FT QVI
Sbjct  274  TTEVKSVEMHHESLPEAFPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF+ELLTKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFSELLTKIDRRSGKELEKEPKFLKNGDAGMVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_008380544.1| PREDICTED: elongation factor 1-alpha-like [Malus domestica]
Length=447

 Score =   317 bits (811),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 151/163 (93%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTAQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQI NGYAPVLDCHTSHIAV+F E+LTKIDRRSGKE+EKEPKFLKNGDAGMVKML
Sbjct  334  IMNHPGQISNGYAPVLDCHTSHIAVRFGEILTKIDRRSGKEIEKEPKFLKNGDAGMVKML  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_009420035.1| PREDICTED: elongation factor 1-alpha [Musa acuminata subsp. malaccensis]
 ref|XP_009420036.1| PREDICTED: elongation factor 1-alpha [Musa acuminata subsp. malaccensis]
Length=447

 Score =   317 bits (811),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 151/163 (93%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTE+KSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSK+DPAK AA+FT QVI
Sbjct  274  TTEIKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKEDPAKEAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AAD56019.1|AF181491_1 elongation factor-1 alpha 2 [Lilium longiflorum]
Length=447

 Score =   317 bits (811),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FT QVI
Sbjct  274  TTEVKSVEMHHEALVEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF E+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFNEILTKIDRRSGKELEKEPKFLKNGDAGMIKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KK+PTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKEPTG  436



>gb|AAX54511.1| elongation factor 1 alpha [Actinidia deliciosa]
Length=447

 Score =   317 bits (811),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEAL EA PGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FT QVI
Sbjct  274  TTEVKSVEMHHEALLEASPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGD+GMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDSGMVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AGI15328.1| elongation factor 1 [Aegiceras corniculatum]
Length=449

 Score =   317 bits (811),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK A+SFT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEASSFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKELEKEPKFLKNGDAGMVKM 
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKELEKEPKFLKNGDAGMVKMN  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK+V+KK+PTG
Sbjct  394  PTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKEPTG  436



>gb|KGN61480.1| hypothetical protein Csa_2G139820 [Cucumis sativus]
Length=330

 Score =   313 bits (801),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 151/163 (93%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHE+L EALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FT QVI
Sbjct  157  TTEVKSVEMHHESLPEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVI  216

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRS KELEKEPKFLKNGDAGMVKM+
Sbjct  217  IMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSAKELEKEPKFLKNGDAGMVKMI  276

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  277  PTKPMVVETFSTYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  319



>ref|NP_001280807.1| elongation factor 1-alpha-like [Malus domestica]
 ref|XP_008349742.1| PREDICTED: elongation factor 1-alpha isoform X1 [Malus domestica]
 ref|XP_008366354.1| PREDICTED: elongation factor 1-alpha [Malus domestica]
 emb|CAA11705.1| elongation factor 1 alpha subunit [Malus domestica]
Length=447

 Score =   317 bits (811),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEA+QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+F  QVI
Sbjct  274  TTEVKSVEMHHEAMQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFIAQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIG GYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELEKEPKFLKNGDAG VKML
Sbjct  334  IMNHPGQIGQGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELEKEPKFLKNGDAGFVKML  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_006846237.1| hypothetical protein AMTR_s00012p00237190 [Amborella trichopoda]
 gb|ERN07912.1| hypothetical protein AMTR_s00012p00237190 [Amborella trichopoda]
Length=447

 Score =   317 bits (811),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTAQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHT HIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAG VKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTCHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGFVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK V+KKDP+G
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKAVEKKDPSG  436



>ref|XP_003604823.1| Elongation factor 1-alpha [Medicago truncatula]
Length=448

 Score =   317 bits (811),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 151/163 (93%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEAL EALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AA+FT QVI
Sbjct  274  TTEVKSVEMHHEALTEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKE+EKEPKFLKNGDAG++KM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKEIEKEPKFLKNGDAGIIKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK V+KKDP+G
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKGVEKKDPSG  436



>dbj|BAM13874.1| elongation factor 1 alpha [Symplocarpus renifolius]
Length=447

 Score =   316 bits (810),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 151/163 (93%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHE LQEA PGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FT QVI
Sbjct  274  TTEVKSVEMHHETLQEAFPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHT HIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGMVKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTCHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_002311107.1| ADR12-2 family protein [Populus trichocarpa]
 gb|ABK93463.1| unknown [Populus trichocarpa]
 gb|EEE88474.1| ADR12-2 family protein [Populus trichocarpa]
Length=449

 Score =   316 bits (810),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 151/162 (93%), Positives = 158/162 (98%), Gaps = 0/162 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRG+VASNSKDDPAK AA+FT QVI
Sbjct  274  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGFVASNSKDDPAKEAANFTSQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHT HIAVKFAE+LTKIDRRSGKELEKEPKFLKNGDAGM+KM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTCHIAVKFAEILTKIDRRSGKELEKEPKFLKNGDAGMIKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPT  202
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKD +
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDAS  435



>ref|XP_002460859.1| hypothetical protein SORBIDRAFT_02g036420 [Sorghum bicolor]
 gb|EER97380.1| hypothetical protein SORBIDRAFT_02g036420 [Sorghum bicolor]
Length=447

 Score =   316 bits (810),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = -3

Query  687  TTEVKSVEMHHEALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKGAASFTPQVI  508
            TTEVKSVEMHHE++QEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAK AASFT QVI
Sbjct  274  TTEVKSVEMHHESMQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAASFTAQVI  333

Query  507  IMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMVKML  328
            IMNHPGQIGNGYAPVLDCHTSHIAVKF+ELLTKIDRRSGKELE  PKFLKNGDAG VKM+
Sbjct  334  IMNHPGQIGNGYAPVLDCHTSHIAVKFSELLTKIDRRSGKELESAPKFLKNGDAGFVKMI  393

Query  327  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  199
            PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  394  PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1144913349700