BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF008D12

Length=671
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002293701.1|  histone H3                                         154   4e-62   Thalassiosira pseudonana CCMP1335
ref|XP_002181134.1|  H3.3                                               154   5e-62   Phaeodactylum tricornutum CCAP 1055/1
ref|NP_496899.1|  Protein HIS-42                                        155   1e-61   Caenorhabditis elegans [roundworm]
ref|XP_004002474.1|  PREDICTED: histone H3.2-like                       154   3e-61   
sp|P08898.4|H3_CAEEL  RecName: Full=Histone H3                          153   5e-61   Caenorhabditis elegans [roundworm]
gb|ADF58427.1|  histone H3                                              150   9e-61   Oryza sativa Indica Group [Indian rice]
ref|XP_007177446.1|  PREDICTED: histone H3.1-like                       149   3e-60   Balaenoptera acutorostrata scammoni
gb|ACO15640.1|  Histone H3.3                                            147   8e-60   Caligus clemensi
ref|XP_009129719.1|  PREDICTED: histone H3.2-like                       153   2e-59   Brassica rapa
ref|XP_006192498.1|  PREDICTED: histone H3.3-like                       143   2e-57   Camelus ferus
gb|EJK48130.1|  hypothetical protein THAOC_33105                        156   3e-57   Thalassiosira oceanica
ref|XP_003733588.1|  PREDICTED: histone H3.3-like                       139   2e-56   Callithrix jacchus [common marmoset]
ref|XP_001096527.1|  PREDICTED: histone H3.3-like isoform 2             142   1e-55   
ref|XP_005441359.1|  PREDICTED: histone H3.2-like                       151   9e-55   Falco cherrug
emb|CDQ94543.1|  unnamed protein product                                147   4e-54   Oncorhynchus mykiss
ref|XP_003638893.1|  PREDICTED: histone H3.3-like                       141   4e-54   
ref|XP_004136113.1|  PREDICTED: uncharacterized protein LOC101209420    128   8e-54   
gb|AAW48000.1|  histone 3                                               130   9e-54   Opisthocosmia tenuis
ref|XP_005958418.1|  PREDICTED: histone H3.3-like                       132   1e-53   Pantholops hodgsonii [Tibetan antelope]
dbj|BAD90782.1|  histone 3                                              134   5e-53   Conocephalum conicum
emb|CBY20523.1|  unnamed protein product                                142   4e-52   Oikopleura dioica
ref|XP_004778825.1|  PREDICTED: histone H3-like                         126   5e-52   
gb|EMS47381.1|  Histone H3.2                                            135   5e-51   Triticum urartu
ref|XP_005414641.1|  PREDICTED: LOW QUALITY PROTEIN: histone H3-l...    134   7e-51   Chinchilla lanigera
ref|XP_010202813.1|  PREDICTED: LOW QUALITY PROTEIN: histone H3.3...    138   1e-50   Colius striatus
gb|ADB45640.1|  histone H3                                              124   2e-50   Koebelia grossa
ref|XP_004638294.1|  PREDICTED: uncharacterized protein LOC101560363    136   3e-50   
emb|CAF87474.1|  unnamed protein product                                171   4e-50   Tetraodon nigroviridis
gb|ADF58428.1|  histone H3                                              128   6e-50   Oryza sativa Indica Group [Indian rice]
emb|CAA24131.1|  unnamed protein product                                130   7e-50   Mus musculus [mouse]
ref|XP_010978514.1|  PREDICTED: uncharacterized protein LOC105089201    152   3e-49   Camelus dromedarius [camel]
gb|EEE65134.1|  hypothetical protein OsJ_20207                          171   3e-49   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010498414.1|  PREDICTED: LOW QUALITY PROTEIN: histone H3.3       139   6e-49   
ref|XP_008761077.1|  PREDICTED: histone H3.3-like                       130   2e-48   
ref|XP_006894195.1|  PREDICTED: histone H3.3-like                       127   3e-48   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_009980138.1|  PREDICTED: LOW QUALITY PROTEIN: histone H3-like    140   5e-48   Tauraco erythrolophus
gb|EPQ18970.1|  Histone H3.3 type 1                                     164   1e-47   Myotis brandtii
emb|CBI18192.3|  unnamed protein product                                124   2e-47   Vitis vinifera
ref|XP_008773935.1|  PREDICTED: serine/arginine repetitive matrix...    130   3e-47   
ref|XP_005441371.1|  PREDICTED: histone H3.2-like                       154   4e-47   
emb|CBI37601.3|  unnamed protein product                                123   4e-47   Vitis vinifera
ref|XP_005972769.1|  PREDICTED: histone H3.3-like                       117   5e-47   Pantholops hodgsonii [Tibetan antelope]
gb|AHY03477.1|  histone                                                 125   7e-47   Alternaria tenuissima
emb|CAN70652.1|  hypothetical protein VITISV_010022                     162   1e-46   Vitis vinifera
gb|ACG38891.1|  histone H3                                              162   1e-46   Zea mays [maize]
ref|XP_010480248.1|  PREDICTED: histone H3.3-like                       162   1e-46   Camelina sativa [gold-of-pleasure]
ref|WP_039311726.1|  hypothetical protein                               162   1e-46   Paenibacillus sp. IHB B 3415
gb|AIY27744.1|  histone H3 protein                                      162   1e-46   Betula luminifera [liang ye hua]
ref|XP_010466628.1|  PREDICTED: histone H3.3-like                       162   1e-46   Camelina sativa [gold-of-pleasure]
gb|KDO60696.1|  hypothetical protein CISIN_1g032645mg                   162   1e-46   Citrus sinensis [apfelsine]
gb|AFW86017.1|  histone H3                                              165   1e-46   
ref|XP_010471674.1|  PREDICTED: histone H3.3-like                       162   1e-46   Camelina sativa [gold-of-pleasure]
gb|EYU30980.1|  hypothetical protein MIMGU_mgv1a014700mg                164   1e-46   Erythranthe guttata [common monkey flower]
ref|XP_010447175.1|  PREDICTED: histone H3.3-like                       162   1e-46   Camelina sativa [gold-of-pleasure]
gb|AAB36495.1|  histone H3.2                                            162   1e-46   Medicago sativa [alfalfa]
sp|P06353.1|H33_HORVU  RecName: Full=Histone H3.3                       160   1e-46   Hordeum vulgare [barley]
emb|CBI23573.3|  unnamed protein product                                162   1e-46   Vitis vinifera
gb|EMT02210.1|  Histone H3.3                                            162   1e-46   
emb|CDY68223.1|  BnaCnng58100D                                          162   2e-46   Brassica napus [oilseed rape]
gb|KFK25377.1|  hypothetical protein AALP_AA8G105500                    162   2e-46   Arabis alpina [alpine rockcress]
emb|CAA31967.1|  histone H3 (AA 1-120)                                  161   2e-46   Medicago sativa [alfalfa]
ref|XP_003596591.1|  Histone H3                                         162   2e-46   Medicago truncatula
gb|AAB36496.1|  histone H3.2 precursor                                  161   2e-46   Medicago sativa [alfalfa]
gb|KHG25391.1|  Histone H3.3                                            161   2e-46   Gossypium arboreum [tree cotton]
ref|XP_010428586.1|  PREDICTED: histone H3.3-like                       162   2e-46   Camelina sativa [gold-of-pleasure]
ref|XP_002883719.1|  hypothetical protein ARALYDRAFT_480202             162   2e-46   
dbj|BAN42603.1|  putative histone H3                                    160   2e-46   Pyrus pyrifolia var. culta [Asian pear]
tpg|DAA45653.1|  TPA: hypothetical protein ZEAMMB73_730567              161   2e-46   
gb|KDP46711.1|  hypothetical protein JCGZ_06499                         161   2e-46   Jatropha curcas
gb|EAW79707.1|  hCG1639761                                              135   2e-46   Homo sapiens [man]
ref|XP_002985522.1|  hypothetical protein SELMODRAFT_269004             161   2e-46   Selaginella moellendorffii
gb|AAD23951.1|AF093108_1  histone H3                                    161   2e-46   Syntrichia ruralis
ref|XP_002872367.1|  histone H3.2                                       161   2e-46   
ref|XP_006288773.1|  hypothetical protein CARUB_v10002094mg             163   2e-46   
ref|XP_009556897.1|  PREDICTED: histone H3-like                         130   2e-46   Cuculus canorus
gb|AAZ04893.1|  histone H3                                              116   2e-46   Deveximentum sp. Philippines
ref|XP_010456479.1|  PREDICTED: histone H3.3                            160   2e-46   
ref|XP_010106281.1|  Histone                                            162   2e-46   
gb|EMS66058.1|  Histone H3.3                                            160   2e-46   Triticum urartu
ref|XP_002452319.1|  hypothetical protein SORBIDRAFT_04g023645          160   2e-46   
ref|XP_001786509.1|  histone H3                                         160   3e-46   
gb|AFW71933.1|  histone H3                                              162   3e-46   
gb|KDP36960.1|  hypothetical protein JCGZ_08251                         160   3e-46   Jatropha curcas
ref|XP_006411806.1|  hypothetical protein EUTSA_v10026962mg             161   3e-46   
gb|AFW86019.1|  hypothetical protein ZEAMMB73_433257                    161   3e-46   
gb|KGN53214.1|  hypothetical protein Csa_4G026900                       160   3e-46   Cucumis sativus [cucumbers]
ref|NP_001078516.1|  Histone H3.3                                       162   3e-46   Arabidopsis thaliana [mouse-ear cress]
gb|AES90732.2|  core histone H2A/H2B/H3/H4                              162   3e-46   Medicago truncatula
gb|AFW75389.1|  hypothetical protein ZEAMMB73_083576                    160   3e-46   
gb|EMS58296.1|  Histone H3.3                                            160   3e-46   Triticum urartu
ref|XP_006425525.1|  hypothetical protein CICLE_v10026741mg             161   4e-46   Citrus clementina [clementine]
emb|CAC27454.1|  histone H3                                             160   4e-46   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006851804.1|  hypothetical protein AMTR_s00041p00020660          161   4e-46   Amborella trichopoda
gb|AAL78367.1|AF467728_1  disease-resistent-related protein             161   4e-46   Oryza sativa [red rice]
ref|XP_008803321.1|  PREDICTED: histone H3.3-like                       161   4e-46   Phoenix dactylifera
tpg|DAA45649.1|  TPA: histone H3                                        162   4e-46   
ref|XP_004623761.1|  PREDICTED: meprin A subunit beta                   107   4e-46   
gb|ACG48841.1|  histone H3                                              161   4e-46   Zea mays [maize]
ref|NP_001281232.1|  60S ribosomal protein L32                          161   4e-46   Zea mays [maize]
ref|NP_177690.1|  histone H3-like 3                                     160   5e-46   Arabidopsis thaliana [mouse-ear cress]
gb|EMS58978.1|  Histone H3.3                                            160   5e-46   Triticum urartu
ref|XP_003057560.1|  histone H3                                         160   5e-46   Micromonas pusilla CCMP1545
gb|KJB17320.1|  hypothetical protein B456_003G041300                    161   5e-46   Gossypium raimondii
ref|XP_010488359.1|  PREDICTED: histone H3.3-like                       160   7e-46   Camelina sativa [gold-of-pleasure]
ref|XP_010916709.1|  PREDICTED: histone H3.3-like                       160   7e-46   Elaeis guineensis
ref|XP_010919158.1|  PREDICTED: histone H3.3-like                       160   8e-46   Elaeis guineensis
gb|AAX92698.1|  histone 3                                               160   8e-46   Picea abies
gb|EMS66053.1|  Histone H3.3                                            159   9e-46   Triticum urartu
ref|XP_007513760.1|  histone H3                                         160   1e-45   Bathycoccus prasinos
gb|EMS65981.1|  Histone H3.3                                            160   1e-45   Triticum urartu
gb|ACG25088.1|  histone H3                                              160   1e-45   Zea mays [maize]
gb|KHG25392.1|  Histone H3.3                                            160   1e-45   Gossypium arboreum [tree cotton]
ref|XP_007163668.1|  hypothetical protein PHAVU_001G253800g             162   1e-45   Phaseolus vulgaris [French bean]
sp|Q2Z2F4.3|H33B_LILLO  RecName: Full=Histone H3.3b; AltName: Ful...    159   1e-45   Lilium longiflorum [Easter lily]
dbj|BAE48434.1|  histone soH3-1                                         159   1e-45   Lilium longiflorum [Easter lily]
gb|EYU36764.1|  hypothetical protein MIMGU_mgv1a020663mg                157   2e-45   Erythranthe guttata [common monkey flower]
gb|ADN10257.1|  histone 3a                                              115   2e-45   Selenops mexicanus
ref|XP_005843780.1|  hypothetical protein CHLNCDRAFT_59160              159   2e-45   Chlorella variabilis
ref|XP_005852293.1|  hypothetical protein CHLNCDRAFT_28967              159   2e-45   Chlorella variabilis
ref|XP_001690671.1|  histone H3                                         159   2e-45   Chlamydomonas reinhardtii
ref|XP_003552025.2|  PREDICTED: histone H3.3-like                       161   2e-45   Glycine max [soybeans]
gb|KHN31394.1|  Histone H3.3                                            161   2e-45   Glycine soja [wild soybean]
gb|AFK39648.1|  unknown                                                 159   2e-45   Medicago truncatula
ref|XP_001780239.1|  histone H3                                         159   2e-45   
emb|CDR95560.1|  HISTONE fold protein,putative                          159   2e-45   Babesia bigemina
gb|EMP31825.1|  Histone H3                                              158   2e-45   Chelonia mydas [green seaturtle]
ref|XP_001609713.1|  Histone H3                                         159   2e-45   Babesia bovis T2Bo
gb|EGT34514.1|  hypothetical protein CAEBREN_26300                      159   2e-45   Caenorhabditis brenneri
emb|CDR95028.1|  Histone H3, putative                                   159   2e-45   Babesia bigemina
ref|XP_004830908.1|  histone H3, putative                               159   2e-45   Theileria equi strain WA
ref|XP_008381582.1|  PREDICTED: histone H3.3-like                       159   2e-45   Malus domestica [apple tree]
gb|AFN20174.1|  histone H3                                              120   2e-45   Gliocladiopsis irregularis
ref|XP_001698188.1|  histone H3                                         159   3e-45   Chlamydomonas reinhardtii
ref|XP_002868941.1|  F10A5.19                                           162   3e-45   
ref|XP_002962371.1|  hypothetical protein SELMODRAFT_78992              159   3e-45   Selaginella moellendorffii
gb|EGT58309.1|  hypothetical protein CAEBREN_11605                      159   3e-45   Caenorhabditis brenneri
ref|XP_005843095.1|  histone H3                                         158   3e-45   Chlorella variabilis
gb|EGT36252.1|  hypothetical protein CAEBREN_03846                      159   3e-45   Caenorhabditis brenneri
gb|EGT58275.1|  hypothetical protein CAEBREN_10531                      159   3e-45   Caenorhabditis brenneri
gb|EGT42707.1|  hypothetical protein CAEBREN_09337                      159   3e-45   Caenorhabditis brenneri
ref|XP_003113948.1|  hypothetical protein CRE_27089                     159   3e-45   Caenorhabditis remanei
ref|XP_003088464.1|  hypothetical protein CRE_05346                     159   3e-45   Caenorhabditis remanei
gb|AFW86016.1|  histone H3                                              162   3e-45   
ref|XP_003109235.1|  hypothetical protein CRE_08233                     159   3e-45   Caenorhabditis remanei
gb|ELK06006.1|  Histone H3.2                                            158   3e-45   Pteropus alecto
gb|EGT34501.1|  hypothetical protein CAEBREN_26308                      158   3e-45   Caenorhabditis brenneri
ref|XP_005043075.1|  PREDICTED: histone H3.3 isoform X1                 158   3e-45   
ref|XP_001862696.1|  Histone H3c                                        159   4e-45   Culex quinquefasciatus
ref|XP_001640436.1|  predicted protein                                  158   4e-45   Nematostella vectensis
ref|XP_001753449.1|  histone H3                                         158   4e-45   
sp|P22843.2|H3_ACRFO  RecName: Full=Histone H3                          158   4e-45   Acropora formosa
sp|Q42681.1|H31_CHLRE  RecName: Full=Histone H3 type 1                  158   4e-45   Chlamydomonas reinhardtii
ref|XP_002954719.1|  histone H3                                         158   4e-45   Volvox carteri f. nagariensis
gb|EGT34515.1|  hypothetical protein CAEBREN_26315                      158   4e-45   Caenorhabditis brenneri
ref|XP_003110265.1|  hypothetical protein CRE_05546                     158   5e-45   Caenorhabditis remanei
ref|XP_005970819.1|  PREDICTED: histone H3.2-like                       148   5e-45   Pantholops hodgsonii [Tibetan antelope]
ref|XP_001892001.1|  histone H3                                         158   5e-45   Brugia malayi [agent of lymphatic filariasis]
emb|CCF73041.1|  unnamed protein product                                158   5e-45   Babesia microti strain RI
gb|AEW46685.1|  histone type 2                                          158   5e-45   Ulva linza
gb|AAF87128.1|AC006434_24  F10A5.19                                     161   5e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009361038.1|  PREDICTED: histone H3.3-like                       158   5e-45   Pyrus x bretschneideri [bai li]
emb|CBN79887.1|  conserved unknown protein                              158   5e-45   Ectocarpus siliculosus
sp|Q402E2.3|H33A_LILLO  RecName: Full=Histone H3.3a; AltName: Ful...    158   5e-45   Lilium longiflorum [Easter lily]
ref|XP_010621397.1|  PREDICTED: histone H3-like                         159   5e-45   Fukomys damarensis [Damara mole rat]
ref|XP_001865500.1|  histone H3.3 type 2                                159   5e-45   Culex quinquefasciatus
gb|AAK21963.1|  histone H3                                              158   6e-45   Trichinella spiralis
dbj|BAE48436.1|  histone soH3-2                                         158   6e-45   Lilium longiflorum [Easter lily]
ref|XP_002887605.1|  F10A5.19                                           161   6e-45   
ref|XP_002045506.1|  GM11653                                            158   6e-45   Drosophila sechellia
ref|XP_001419259.1|  predicted protein                                  158   6e-45   Ostreococcus lucimarinus CCE9901
ref|XP_006125960.1|  PREDICTED: histone H3.2-like isoform X3            158   6e-45   
ref|XP_010621400.1|  PREDICTED: histone H3.3-like                       158   6e-45   Fukomys damarensis [Damara mole rat]
ref|XP_005949462.1|  PREDICTED: histone H3.2-like isoform X2            158   6e-45   Haplochromis burtoni
ref|XP_010710352.1|  PREDICTED: histone H3.3                            156   6e-45   Meleagris gallopavo [common turkey]
ref|XP_001418070.1|  predicted protein                                  158   6e-45   Ostreococcus lucimarinus CCE9901
ref|XP_005519548.1|  PREDICTED: histone H3.2-like isoform X1            158   6e-45   
ref|XP_005843648.1|  histone H3.2 precursor                             158   6e-45   Chlorella variabilis
ref|XP_008929842.1|  PREDICTED: histone H3-like                         158   6e-45   
ref|XP_006125961.1|  PREDICTED: histone H3.2-like isoform X4            158   6e-45   
ref|XP_006024249.1|  PREDICTED: histone H3.2-like                       158   6e-45   
ref|XP_005527779.1|  PREDICTED: histone H3.2-like isoform X1            158   7e-45   
emb|CEF62715.1|  Histone H3                                             158   7e-45   Strongyloides ratti
ref|XP_004898149.1|  PREDICTED: histone H3.2-like                       158   7e-45   
ref|XP_007064114.1|  PREDICTED: histone H3.2-like isoform X2            158   7e-45   
gb|KFV65812.1|  Histone H3                                              158   7e-45   Picoides pubescens
ref|XP_009059617.1|  hypothetical protein LOTGIDRAFT_176845             158   7e-45   Lottia gigantea
ref|XP_009084844.1|  PREDICTED: histone H3-like                         158   7e-45   Serinus canaria [canary]
gb|AAI27043.1|  Hist1h3e protein                                        157   7e-45   Mus musculus [mouse]
ref|XP_010167429.1|  PREDICTED: histone H3                              157   7e-45   Antrostomus carolinensis
ref|XP_002943219.2|  PREDICTED: histone H3.2-like                       157   7e-45   
ref|XP_004670887.1|  PREDICTED: histone H3.2-like                       157   7e-45   
gb|AFY26267.1|  histone H3                                              157   7e-45   Plectorhinchus mediterraneus
gb|KFO33880.1|  Histone H3                                              158   7e-45   Fukomys damarensis [Damara mole rat]
gb|EMC89182.1|  Histone H3                                              157   7e-45   
ref|XP_001505987.1|  PREDICTED: histone H3-like                         157   7e-45   
ref|XP_002422654.1|  histone H3, putative                               158   7e-45   Pediculus humanus corporis [human body lice]
gb|ACO12509.1|  Histone H3                                              157   7e-45   Lepeophtheirus salmonis
ref|XP_002602751.1|  hypothetical protein BRAFLDRAFT_97692              157   7e-45   Branchiostoma floridae
ref|XP_610495.1|  PREDICTED: histone H3                                 157   7e-45   
dbj|BAA93627.1|  histone H3                                             157   7e-45   Drosophila erecta
sp|Q64400.3|H32_CRILO  RecName: Full=Histone H3.2                       157   7e-45   Cricetulus longicaudatus [lesser long-tailed hamster]
gb|ABW81367.1|  histone H3                                              112   7e-45   Crypticerya rosae
gb|KGN66469.1|  hypothetical protein Csa_1G612925                       159   7e-45   Cucumis sativus [cucumbers]
ref|XP_003145584.1|  histone type 2                                     158   7e-45   
gb|KFQ96138.1|  Histone H3                                              157   7e-45   Nipponia nippon
ref|XP_002635330.1|  Hypothetical protein CBG01499                      157   7e-45   Caenorhabditis briggsae
ref|XP_010994987.1|  PREDICTED: histone H3-like                         157   7e-45   Camelus dromedarius [camel]
emb|CAP53901.1|  histone H3                                             157   7e-45   Xenoturbella bocki
ref|XP_007064113.1|  PREDICTED: histone H3.2-like isoform X1            157   7e-45   
ref|XP_002045560.1|  GM19670                                            157   8e-45   Drosophila sechellia
ref|NP_038576.1|  histone H3.2                                          157   8e-45   Mus musculus [mouse]
ref|XP_001691008.1|  histone H3                                         157   8e-45   Chlamydomonas reinhardtii
ref|XP_307081.3|  Anopheles gambiae str. PEST AGAP012709-PA             157   8e-45   Anopheles gambiae str. PEST
ref|XP_008172413.1|  PREDICTED: histone H3-like                         158   8e-45   
gb|EKC28040.1|  Histone H3                                              158   8e-45   Crassostrea gigas
ref|XP_002045012.1|  GM24194                                            157   8e-45   Drosophila sechellia
ref|XP_002633139.1|  Hypothetical protein CBG05838                      157   8e-45   Caenorhabditis briggsae
ref|XP_002502604.1|  histone H3                                         157   8e-45   Micromonas commoda
ref|XP_008830105.1|  PREDICTED: histone H3-like                         157   8e-45   Nannospalax galili
ref|XP_002077397.1|  GD13199                                            157   8e-45   
dbj|BAD02413.1|  histone 3                                              157   8e-45   Drosophila pseudoobscura
emb|CBI16419.3|  unnamed protein product                                127   8e-45   Vitis vinifera
ref|XP_002045405.1|  GM13629                                            157   8e-45   Drosophila sechellia
ref|XP_004900740.1|  PREDICTED: uncharacterized protein LOC101700900    157   8e-45   
gb|KHJ92628.1|  core histone H2A/H2B/H3/H4                              157   9e-45   Oesophagostomum dentatum [nodule worm]
ref|XP_001983086.1|  GG16350                                            157   9e-45   
gb|AFY26274.1|  histone H3                                              157   9e-45   Plectorhinchus mediterraneus
pdb|3AV1|A  Chain A, The Human Nucleosome Structure Containing Th...    157   9e-45   Homo sapiens [man]
ref|XP_002028918.1|  GL16975                                            157   9e-45   
ref|XP_004831868.1|  histone H3, putative                               157   9e-45   Theileria equi strain WA
gb|AAI29431.1|  Zgc:113984 protein                                      157   9e-45   Danio rerio [leopard danio]
gb|EMS49486.1|  Histone H3.2                                            156   9e-45   Triticum urartu
gb|EGI60526.1|  Histone H3                                              157   9e-45   Acromyrmex echinatior
gb|EJK60530.1|  hypothetical protein THAOC_19093                        158   9e-45   Thalassiosira oceanica
ref|XP_002002986.1|  GI10040                                            157   9e-45   
emb|CAP53898.1|  histone H3                                             157   9e-45   Xenoturbella bocki
gb|ELU17516.1|  hypothetical protein CAPTEDRAFT_212232                  157   9e-45   Capitella teleta
ref|XP_008634735.1|  PREDICTED: histone H3-like                         157   9e-45   Corvus brachyrhynchos
ref|XP_002422632.1|  histone H3, putative                               158   9e-45   Pediculus humanus corporis [human body lice]
gb|KGL82468.1|  Histone H3                                              157   1e-44   Tinamus guttatus
gb|KFW77903.1|  Histone H3                                              157   1e-44   Manacus vitellinus
ref|XP_005108567.1|  PREDICTED: histone H3-like                         157   1e-44   
ref|XP_003768750.1|  PREDICTED: histone H3.2-like                       157   1e-44   
gb|EMS51112.1|  Histone H3.2                                            156   1e-44   Triticum urartu
ref|XP_001862683.1|  histone H3.1t                                      158   1e-44   Culex quinquefasciatus
emb|CBM82435.1|  histone H3-I protein                                   157   1e-44   Rhabdopleura compacta
ref|XP_008313557.1|  PREDICTED: histone H3-like                         157   1e-44   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_005150559.1|  PREDICTED: histone H3.2-like                       158   1e-44   
ref|XP_006125958.1|  PREDICTED: histone H3.2-like isoform X1            157   1e-44   
ref|XP_004576699.1|  PREDICTED: histone H3.2-like                       157   1e-44   
ref|XP_009912037.1|  PREDICTED: histone H3                              155   1e-44   Haliaeetus albicilla
ref|XP_008433578.1|  PREDICTED: histone H3-like                         157   1e-44   Poecilia reticulata
ref|XP_001620157.1|  hypothetical protein NEMVEDRAFT_v1g148952          157   1e-44   Nematostella vectensis
ref|XP_004076085.2|  PREDICTED: histone H3-like                         158   1e-44   
ref|XP_009470014.1|  PREDICTED: histone H3.3                            156   1e-44   Nipponia nippon
ref|XP_006301260.1|  hypothetical protein CARUB_v10021660mg             158   1e-44   
gb|ACG25071.1|  histone H3                                              157   1e-44   Zea mays [maize]
gb|KFV82673.1|  Histone H3                                              157   1e-44   Struthio camelus australis
gb|KHN41576.1|  Histone H3.2                                            157   1e-44   Glycine soja [wild soybean]
gb|EPY79586.1|  histone H3.2-like protein                               157   1e-44   Camelus ferus
ref|XP_009345124.1|  PREDICTED: histone H3.2-like                       157   1e-44   Pyrus x bretschneideri [bai li]
ref|NP_189372.1|  histone H3                                            157   1e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001998017.1|  GH23206                                            157   1e-44   Drosophila grimshawi
ref|XP_002164221.1|  PREDICTED: histone H3-like                         157   1e-44   Hydra vulgaris
tpg|DAA55311.1|  TPA: histone H3.2                                      160   1e-44   
ref|XP_004933313.1|  PREDICTED: histone H3-like                         157   1e-44   Bombyx mori [silk moth]
ref|XP_003768748.1|  PREDICTED: histone H3.2-like                       157   1e-44   Sarcophilus harrisii
ref|XP_010978487.1|  PREDICTED: histone H3.3-like                       156   1e-44   Camelus dromedarius [camel]
gb|EPQ05781.1|  Histone H3.1                                            157   1e-44   Myotis brandtii
emb|CEF66838.1|  Histone H3                                             157   1e-44   Strongyloides ratti
ref|XP_005237430.1|  PREDICTED: histone H3.2-like                       157   1e-44   
ref|XP_003977328.1|  PREDICTED: histone H3.2-like                       158   1e-44   
ref|XP_004570179.1|  PREDICTED: histone H3.2-like                       157   1e-44   
ref|XP_005756396.1|  putative histone H3                                157   1e-44   Emiliania huxleyi CCMP1516
ref|XP_010830869.1|  PREDICTED: histone H3.3                            155   1e-44   Bison bison bison
gb|KFP93543.1|  Histone H3.2                                            155   1e-44   Haliaeetus albicilla
gb|ABW36754.1|  histone H3                                              112   1e-44   Brachymyrmex sp. CS0108
gb|EMP31854.1|  Histone H3                                              157   1e-44   Chelonia mydas [green seaturtle]
ref|XP_009084841.1|  PREDICTED: histone H3.3                            156   1e-44   
ref|XP_002045656.1|  GM16279                                            156   1e-44   
ref|XP_004917040.1|  PREDICTED: histone H3.2-like isoform X2            157   1e-44   
gb|KFO61366.1|  Histone H3                                              156   1e-44   
gb|ELT93431.1|  hypothetical protein CAPTEDRAFT_94036                   156   1e-44   
emb|CAR63687.1|  Putative protein similar to H3 histone, family 2...    157   1e-44   
ref|XP_005696796.1|  PREDICTED: histone H3.1-like                       157   1e-44   
ref|XP_010847950.1|  PREDICTED: histone H3.3-like                       155   1e-44   
ref|NP_001238509.1|  uncharacterized protein LOC100306416               157   1e-44   
ref|XP_005422023.1|  PREDICTED: histone H3.2-like                       158   1e-44   
sp|P08903.2|H32_ENCAL  RecName: Full=Histone H3.2                       157   1e-44   
ref|XP_007555402.1|  PREDICTED: histone H3-like                         155   1e-44   
ref|XP_001619752.1|  hypothetical protein NEMVEDRAFT_v1g231526          157   1e-44   
emb|CAA32434.1|  H3 histone                                             157   1e-44   
ref|XP_001618471.1|  hypothetical protein NEMVEDRAFT_v1g154474          155   1e-44   
ref|XP_004934142.1|  PREDICTED: histone H3-like                         156   1e-44   
prf||1202289A  histone H3                                               157   1e-44
ref|XP_002733142.1|  PREDICTED: histone H3-like                         156   1e-44   
gb|EFZ22370.1|  hypothetical protein SINV_16114                         157   1e-44   
ref|XP_005711872.1|  Histone H3                                         157   1e-44   
ref|XP_002365267.1|  histone H3                                         157   1e-44   
ref|XP_010220529.1|  PREDICTED: histone H3-like                         157   1e-44   
gb|KGL76540.1|  Histone H3                                              157   1e-44   
ref|XP_004167986.1|  PREDICTED: histone H3.2-like                       155   1e-44   
ref|XP_009321207.1|  PREDICTED: histone H3-like                         155   1e-44   
ref|XP_001628766.1|  predicted protein                                  156   1e-44   
ref|XP_006656664.1|  PREDICTED: histone H3.2-like                       157   1e-44   
gb|EFB20876.1|  hypothetical protein PANDA_018573                       157   1e-44   
gb|KFW61157.1|  Histone H3                                              156   2e-44   
ref|XP_005422027.1|  PREDICTED: histone H3.2-like                       157   2e-44   
ref|XP_002045794.1|  GM16173                                            156   2e-44   
ref|XP_009988190.1|  PREDICTED: histone H3                              157   2e-44   
ref|XP_001862674.1|  histone H3 type 2                                  157   2e-44   
gb|EGV94279.1|  Histone H3.1                                            157   2e-44   
ref|XP_005424625.1|  PREDICTED: histone H3.3-like                       149   2e-44   
ref|XP_009944032.1|  PREDICTED: LOW QUALITY PROTEIN: histone H3.3...    155   2e-44   
gb|KFR05907.1|  Histone H3                                              156   2e-44   
ref|XP_006755785.1|  PREDICTED: histone H3.2-like                       155   2e-44   
gb|KDP29737.1|  hypothetical protein JCGZ_18672                         157   2e-44   
gb|AFI61666.1|  histone 3                                               157   2e-44   
ref|XP_004286162.1|  PREDICTED: histone H3.1-like                       157   2e-44   
ref|NP_001104686.1|  histone cluster 3, H3                              157   2e-44   
ref|XP_003770651.1|  PREDICTED: histone H3.2-like                       157   2e-44   
ref|XP_010978463.1|  PREDICTED: LOW QUALITY PROTEIN: histone H3.3...    155   2e-44   
ref|XP_008706493.1|  PREDICTED: LOW QUALITY PROTEIN: histone H3.1       157   2e-44   
emb|CDP18134.1|  unnamed protein product                                157   2e-44   
ref|XP_001862705.1|  histone H3.2                                       157   2e-44   
ref|XP_003110648.1|  hypothetical protein CRE_05744                     156   2e-44   
ref|XP_005066350.1|  PREDICTED: histone H3.2-like                       157   2e-44   
pdb|3AYW|A  Chain A, Crystal Structure Of Human Nucleosome Core P...    157   2e-44   
gb|AFY26266.1|  histone H3                                              157   2e-44   
gb|EGT42493.1|  hypothetical protein CAEBREN_30654                      157   2e-44   
gb|AAM00267.1|AF361949_1  histone 3                                     157   2e-44   
ref|XP_009675891.1|  PREDICTED: histone H3-like                         157   2e-44   
ref|XP_009938486.1|  PREDICTED: histone H3.3-like                       156   2e-44   
ref|XP_006388737.1|  hypothetical protein POPTR_0108s00230g             155   2e-44   
ref|XP_003502247.1|  PREDICTED: histone H3.1 isoform X1                 157   2e-44   
emb|CAA34274.1|  unnamed protein product                                157   2e-44   
ref|XP_005701746.1|  PREDICTED: histone H3.1-like                       157   2e-44   
ref|XP_004562239.1|  PREDICTED: histone H3.2-like                       157   2e-44   
ref|XP_006024237.1|  PREDICTED: histone H3.2-like isoform X1            157   2e-44   
gb|AAI07286.1|  Hist1h3h protein                                        156   2e-44   
gb|EFB20866.1|  hypothetical protein PANDA_018563                       157   2e-44   
ref|XP_006162722.1|  PREDICTED: histone H3.1-like                       156   2e-44   
ref|XP_003246588.2|  PREDICTED: histone H3-like                         155   2e-44   
ref|XP_002930251.1|  PREDICTED: histone H3.1                            156   2e-44   
gb|EGT47763.1|  hypothetical protein CAEBREN_10789                      156   2e-44   
ref|XP_004899302.1|  PREDICTED: histone H3.2-like                       156   2e-44   
ref|XP_001745925.1|  hypothetical protein                               156   2e-44   
dbj|BAD90754.1|  histone 3                                              156   2e-44   
ref|XP_010708157.1|  PREDICTED: histone H3-like                         157   2e-44   
ref|XP_005863133.1|  PREDICTED: histone H3.1-like                       156   2e-44   
ref|XP_002999294.1|  histone, putative                                  156   2e-44   
gb|AAA75395.1|  histone H3                                              156   2e-44   
ref|NP_003520.1|  histone H3.1                                          156   2e-44   
gb|EHH52805.1|  Histone H3/a                                            156   2e-44   
ref|XP_001928622.1|  PREDICTED: histone H3.1-like                       156   2e-44   
gb|KFV41420.1|  Histone H3                                              155   2e-44   
gb|KFV20106.1|  Histone H3                                              155   2e-44   
gb|AAI07288.1|  Hist1h3i protein                                        156   2e-44   
gb|EFB20869.1|  hypothetical protein PANDA_018566                       156   2e-44   
ref|XP_005710238.1|  Histone H3                                         156   2e-44   
gb|EFB20847.1|  hypothetical protein PANDA_018538                       156   2e-44   
pdb|3AFA|A  Chain A, The Human Nucleosome Structure                     156   2e-44   
ref|XP_003082036.1|  Histones H3 and H4 (ISS)                           157   2e-44   
ref|XP_005537302.1|  histone H3                                         156   2e-44   
ref|XP_004920646.1|  PREDICTED: histone H3.2-like                       156   2e-44   
ref|NP_001091119.1|  histone cluster 1, H3g protein                     156   2e-44   
gb|KJB71213.1|  hypothetical protein B456_011G110600                    158   2e-44   
ref|XP_009973307.1|  PREDICTED: histone H3                              155   2e-44   
ref|NP_172794.1|  histone H3                                            156   2e-44   
ref|XP_008260696.1|  PREDICTED: histone H3.1-like                       156   2e-44   
ref|XP_006832340.1|  PREDICTED: histone H3.3 type 2-like                115   2e-44   
emb|CAA31966.1|  histone H3 (AA 1-123)                                  156   2e-44   
gb|EPQ05801.1|  Histone H3.1                                            155   2e-44   
ref|XP_010853314.1|  PREDICTED: histone H3.1-like                       155   2e-44   
gb|KFD60221.1|  hypothetical protein M514_27591                         156   2e-44   
ref|XP_007971657.1|  PREDICTED: histone H3.1-like                       156   2e-44   
ref|XP_004019074.1|  PREDICTED: histone H3.1-like                       156   2e-44   
gb|AEY84988.1|  histone H3                                              156   2e-44   
ref|XP_003770631.1|  PREDICTED: histone H3.2-like                       157   2e-44   
pdb|3KXB|A  Chain A, Structural Characterization Of H3k56q Nucleo...    156   2e-44   
ref|XP_008663191.1|  PREDICTED: histone H3.2-like                       157   2e-44   
ref|XP_003885797.1|  Histone H3.3, related                              156   2e-44   
gb|AFI61667.1|  histone 3                                               156   2e-44   
gb|EAY99520.1|  hypothetical protein OsI_21490                          163   2e-44   
gb|AAM63756.1|  histone H3 protein, putative                            156   2e-44   
gb|AAI57347.1|  Unknown (protein for MGC:147886)                        156   3e-44   
dbj|BAF95851.1|  histon H3 protein                                      156   3e-44   
ref|XP_008513087.1|  PREDICTED: LOW QUALITY PROTEIN: histone H3         158   3e-44   
gb|AAZ72657.1|  histone H3.3                                            156   3e-44   
gb|ELU16492.1|  hypothetical protein CAPTEDRAFT_90093                   156   3e-44   
ref|XP_001619077.1|  hypothetical protein NEMVEDRAFT_v1g227757          156   3e-44   
ref|XP_001964816.1|  GF22233                                            157   3e-44   
gb|AAO06264.1|  histone protein Hist2h3c1                               157   3e-44   
ref|XP_004252600.1|  PREDICTED: histone H3.2-like                       156   3e-44   
ref|XP_003384122.1|  PREDICTED: histone H3-like                         156   3e-44   
ref|XP_005863141.1|  PREDICTED: histone H3.1-like                       156   3e-44   
ref|XP_004229367.1|  PREDICTED: histone H3.2-like                       156   3e-44   
gb|EFB20863.1|  hypothetical protein PANDA_018558                       156   3e-44   
gb|KGB36001.1|  Histone H3                                              156   3e-44   
emb|CCD60248.1|  histone H3, putative                                   156   3e-44   
ref|XP_001618260.1|  hypothetical protein NEMVEDRAFT_v1g196043          156   3e-44   
dbj|BAJ92605.1|  predicted protein                                      156   3e-44   
ref|XP_003259196.1|  PREDICTED: histone H3.2-like isoform 1             156   3e-44   
gb|KCW51227.1|  hypothetical protein EUGRSUZ_J00806                     157   3e-44   
ref|XP_004717866.1|  PREDICTED: histone H3.2-like                       156   3e-44   
ref|XP_001599416.1|  PREDICTED: histone H3-like                         157   3e-44   
ref|XP_003979651.1|  PREDICTED: histone H3.2-like                       155   3e-44   
ref|XP_003769946.1|  PREDICTED: histone H3.2-like                       158   3e-44   
emb|CBH32561.1|  histone H3, expressed                                  156   3e-44   
ref|XP_005982811.1|  PREDICTED: histone H3.1-like                       156   3e-44   
gb|EFB21581.1|  hypothetical protein PANDA_016834                       156   3e-44   
dbj|BAA20144.1|  Histone H3                                             156   3e-44   
ref|XP_005441415.1|  PREDICTED: histone H3.2-like                       155   3e-44   
ref|XP_005855528.1|  histone H3                                         156   3e-44   
ref|XP_003608535.1|  Histone H3                                         163   3e-44   
ref|XP_005337122.1|  PREDICTED: histone H3.2-like                       156   3e-44   
ref|XP_011496732.1|  PREDICTED: histone H3-like                         156   3e-44   
ref|XP_006162733.1|  PREDICTED: histone H3.1-like                       157   3e-44   
emb|CDW60007.1|  Histone H3                                             156   3e-44   
ref|XP_005643646.1|  histone H3                                         156   3e-44   
ref|XP_006304375.1|  hypothetical protein CARUB_v10010862mg             156   3e-44   
emb|CDI80171.1|  Histone H3, related                                    156   3e-44   
gb|AFY26276.1|  histone H3                                              156   3e-44   
gb|EFB21789.1|  hypothetical protein PANDA_020659                       155   3e-44   
ref|XP_007177425.1|  PREDICTED: histone H3.1-like isoform X1            156   3e-44   
gb|KGB39314.1|  Histone H3                                              156   3e-44   
ref|XP_008364567.1|  PREDICTED: histone H3.3-like                       156   3e-44   
ref|XP_002045486.1|  GM19351                                            156   3e-44   
ref|XP_005869066.1|  PREDICTED: histone H3.1-like                       155   3e-44   
gb|AGS78028.1|  histone H3                                              156   3e-44   
gb|KHN47212.1|  Histone H3.2                                            155   3e-44   
gb|EPQ09443.1|  Histone H3.1                                            155   3e-44   
ref|XP_001696558.1|  histone H3                                         156   3e-44   
ref|XP_001618856.1|  hypothetical protein NEMVEDRAFT_v1g153121          154   3e-44   
ref|XP_008331672.1|  PREDICTED: histone H3-like                         157   3e-44   
ref|XP_009032312.1|  histone 3                                          156   3e-44   
ref|XP_001608833.1|  histone H3                                         156   3e-44   
ref|XP_001657153.1|  AAEL003685-PA                                      156   3e-44   
ref|XP_007179125.1|  PREDICTED: histone H3.1-like                       156   3e-44   
ref|XP_009623382.1|  PREDICTED: histone H3.2-like                       156   3e-44   
ref|XP_006923340.1|  PREDICTED: histone H3.1-like                       156   3e-44   
ref|XP_011384484.1|  PREDICTED: histone H3                              156   3e-44   
ref|XP_002045602.1|  GM25125                                            156   3e-44   
ref|XP_004712543.1|  PREDICTED: histone H3.2-like                       156   3e-44   
emb|CAA56575.1|  histone H3.2 protein                                   156   3e-44   
ref|XP_008992030.1|  PREDICTED: histone H3.1                            156   3e-44   
ref|XP_784508.1|  PREDICTED: histone H3, embryonic-like                 155   3e-44   
ref|XP_011347776.1|  PREDICTED: histone H3-like                         157   3e-44   
ref|XP_005461835.1|  PREDICTED: histone H3.2-like isoform X2            159   3e-44   
gb|ADP36955.1|  hypothetical protein                                    154   3e-44   
gb|ELK02696.1|  Histone H3.1                                            156   3e-44   
ref|XP_001982927.1|  GG13017                                            155   4e-44   
emb|CBM82483.1|  histone H3-II protein                                  155   4e-44   
emb|CEF65438.1|  Histone H3                                             156   4e-44   
gb|AFI61670.1|  histone 3                                               156   4e-44   
ref|XP_007150394.1|  hypothetical protein PHAVU_005G149600g             155   4e-44   
ref|XP_001177217.2|  PREDICTED: histone H3, embryonic-like              156   4e-44   
gb|EFB20850.1|  hypothetical protein PANDA_018542                       156   4e-44   
gb|EMS58979.1|  Histone H3.3                                            158   4e-44   
gb|ELU15169.1|  hypothetical protein CAPTEDRAFT_138532                  156   4e-44   
ref|XP_002832980.2|  PREDICTED: histone H3.1-like                       155   4e-44   
gb|KJB27089.1|  hypothetical protein B456_004G277300                    157   4e-44   
ref|XP_008691176.1|  PREDICTED: histone H3.1-like                       158   4e-44   
gb|EHB12220.1|  Histone H3                                              155   4e-44   
ref|XP_008669425.1|  PREDICTED: histone H3.2-like                       157   4e-44   
ref|XP_001632617.1|  predicted protein                                  159   4e-44   
ref|XP_006162710.1|  PREDICTED: histone H3.1-like                       157   4e-44   
ref|XP_003980021.1|  PREDICTED: uncharacterized protein LOC101068669    160   4e-44   
gb|KHN13559.1|  Histone H3.2                                            155   4e-44   
ref|XP_001967747.1|  GF18982                                            155   4e-44   
gb|AAP94665.1|  histone H3                                              155   4e-44   
ref|XP_003724461.1|  PREDICTED: histone H3, embryonic-like              155   4e-44   
ref|XP_010634570.1|  PREDICTED: histone H3.1-like                       157   4e-44   
ref|XP_008608072.1|  histone H3                                         154   4e-44   
ref|XP_009782179.1|  PREDICTED: histone H3.2-like                       155   4e-44   
ref|XP_001743988.1|  hypothetical protein                               155   4e-44   
ref|XP_002586488.1|  hypothetical protein BRAFLDRAFT_75126              157   4e-44   
ref|XP_004899304.1|  PREDICTED: histone H1.5-like                       159   4e-44   
gb|KFO33867.1|  Histone H3                                              160   4e-44   
ref|XP_010555793.1|  PREDICTED: histone H3.2-like                       154   4e-44   
ref|XP_320335.2|  AGAP012197-PA                                         155   4e-44   
ref|XP_007483400.1|  PREDICTED: histone H3.2-like                       157   4e-44   
ref|XP_002261569.1|  Histone H3                                         155   4e-44   
ref|XP_006222460.1|  PREDICTED: histone H3-like                         157   4e-44   
emb|CDJ65783.1|  histone H3, putative                                   155   4e-44   
ref|XP_002370614.1|  histone H3.3 variant                               155   4e-44   
gb|KHN25265.1|  Histone H3.2                                            155   4e-44   
ref|XP_009382271.1|  PREDICTED: histone H3.3-like                       155   4e-44   
ref|XP_008539398.1|  PREDICTED: histone H3.1-like                       156   4e-44   
pdb|3W98|A  Chain A, Crystal Structure Of Human Nucleosome Core P...    155   4e-44   
dbj|GAA57010.1|  histone H3                                             156   5e-44   
gb|ELK33073.1|  Histone H3.1                                            156   5e-44   
ref|XP_009556891.1|  PREDICTED: histone H3-like                         129   5e-44   
gb|ACN40064.1|  unknown                                                 155   5e-44   
ref|XP_005830219.1|  histone H3                                         155   5e-44   
ref|XP_724814.1|  histone 3                                             155   5e-44   
ref|XP_001082339.1|  PREDICTED: histone H3.1t-like isoform 1            155   5e-44   
ref|XP_009598129.1|  PREDICTED: histone H3.2-like                       155   5e-44   
gb|AAY90124.1|  histone 3                                               155   5e-44   
ref|XP_008615723.1|  histone H3                                         155   5e-44   



>ref|XP_002293701.1| histone H3 [Thalassiosira pseudonana CCMP1335]
 gb|EED88710.1| histone H3 [Thalassiosira pseudonana CCMP1335]
Length=136

 Score =   154 bits (390),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 75/80 (94%), Positives = 78/80 (98%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +ST+LLIRK PFQRLVREIAQDFKTDLRFQS AVLALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTDLLIRKAPFQRLVREIAQDFKTDLRFQSTAVLALQEASEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   111 bits (277),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 56/62 (90%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAPT GGVKKPHRYRPGTVALREIRKYQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPTAGGVKKPHRYRPGTVALREIRKYQKSTD  60

Query  409  SL  404
             L
Sbjct  61   LL  62



>ref|XP_002181134.1| H3.3 [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC47057.1| H3.3 [Phaeodactylum tricornutum CCAP 1055/1]
Length=136

 Score =   154 bits (389),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 75/80 (94%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRK PFQRLVREIAQDFK DLRFQS AVLALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKAPFQRLVREIAQDFKNDLRFQSTAVLALQEASEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   111 bits (277),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 56/62 (90%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAPT GGVKKPHRYRPGTVALREIRKYQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPTAGGVKKPHRYRPGTVALREIRKYQKSTE  60

Query  409  SL  404
             L
Sbjct  61   LL  62



>ref|NP_496899.1| Protein HIS-42 [Caenorhabditis elegans]
 ref|NP_496894.1| Protein HIS-9 [Caenorhabditis elegans]
 ref|NP_496890.1| Protein HIS-13 [Caenorhabditis elegans]
 ref|NP_496895.1| Protein HIS-25 [Caenorhabditis elegans]
 ref|NP_502134.1| Protein HIS-45 [Caenorhabditis elegans]
 ref|NP_502153.1| Protein HIS-63 [Caenorhabditis elegans]
 ref|NP_502138.1| Protein HIS-55 [Caenorhabditis elegans]
 ref|NP_501204.1| Protein HIS-59 [Caenorhabditis elegans]
 ref|NP_501407.1| Protein HIS-32 [Caenorhabditis elegans]
 ref|NP_505276.1| Protein HIS-49 [Caenorhabditis elegans]
 ref|NP_505199.1| Protein HIS-6 [Caenorhabditis elegans]
 ref|NP_505297.1| Protein HIS-17 [Caenorhabditis elegans]
 ref|NP_505292.1| Protein HIS-27 [Caenorhabditis elegans]
 ref|NP_507033.1| Protein HIS-2 [Caenorhabditis elegans]
 ref|NP_001263958.1| Protein HIS-40 [Caenorhabditis elegans]
 gb|AAG50235.1|AF304122_1 histone H3 [Caenorhabditis elegans]
 emb|CAA33644.1| Histone protein [Caenorhabditis elegans]
 emb|CAA97411.1| HIS-45 [Caenorhabditis elegans]
 emb|CAB04057.1| HIS-42 [Caenorhabditis elegans]
 emb|CAA92733.1| HIS-63 [Caenorhabditis elegans]
 emb|CAB05209.1| HIS-55 [Caenorhabditis elegans]
 emb|CAB07653.1| HIS-2 [Caenorhabditis elegans]
 emb|CAB05831.1| HIS-25 [Caenorhabditis elegans]
 emb|CAB05833.1| HIS-9 [Caenorhabditis elegans]
 emb|CAB05834.1| HIS-13 [Caenorhabditis elegans]
 emb|CCD68531.1| HIS-32 [Caenorhabditis elegans]
 emb|CCD68868.1| HIS-49 [Caenorhabditis elegans]
 emb|CCD69390.1| HIS-59 [Caenorhabditis elegans]
 emb|CCD70027.1| HIS-6 [Caenorhabditis elegans]
 emb|CCD72363.1| HIS-17 [Caenorhabditis elegans]
 emb|CCD72373.1| HIS-27 [Caenorhabditis elegans]
 emb|CCD72545.2| HIS-40 [Caenorhabditis elegans]
Length=136

 Score =   155 bits (392),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 75/80 (94%), Positives = 78/80 (98%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIR+ PFQRLVREIAQDFKTDLRFQS AV+ALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRRAPFQRLVREIAQDFKTDLRFQSSAVMALQEAAEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   108 bits (270),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAP +GGVKKPHRYRPGTVALREIR+YQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPASGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  409  SL  404
             L
Sbjct  61   LL  62



>ref|XP_004002474.1| PREDICTED: histone H3.2-like [Ovis aries]
Length=139

 Score =   154 bits (388),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 74/83 (89%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = -1

Query  431  QVSESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI  252
            + +   ELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAI
Sbjct  57   KSTNPPELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAI  116

Query  251  HAKRVTIMPKDIQLARRIRGERA  183
            HAKRVTIMPKDIQLARRIRGERA
Sbjct  117  HAKRVTIMPKDIQLARRIRGERA  139


 Score =   109 bits (272),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 54/58 (93%), Positives = 57/58 (98%), Gaps = 0/58 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRA  416
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHRYRPGTVALREIR+YQ++
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKS  58



>sp|P08898.4|H3_CAEEL RecName: Full=Histone H3 [Caenorhabditis elegans]
Length=136

 Score =   153 bits (387),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 74/80 (93%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIR+ PFQRLVREIAQDFKTDLRFQS AV+ALQEA EAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRRAPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   108 bits (270),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAP +GGVKKPHRYRPGTVALREIR+YQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPASGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  409  SL  404
             L
Sbjct  61   LL  62



>gb|ADF58427.1| histone H3 [Oryza sativa Indica Group]
Length=136

 Score =   150 bits (380),  Expect(2) = 9e-61, Method: Compositional matrix adjust.
 Identities = 75/80 (94%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKL FQRLVREIAQDF TDLRFQS AV ALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLRFQRLVREIAQDFNTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   110 bits (275),  Expect(2) = 9e-61, Method: Compositional matrix adjust.
 Identities = 55/62 (89%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHR+RPGTVALREIRKYQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  60

Query  409  SL  404
             L
Sbjct  61   LL  62



>ref|XP_007177446.1| PREDICTED: histone H3.1-like [Balaenoptera acutorostrata scammoni]
Length=136

 Score =   149 bits (376),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 74/80 (93%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKL FQRLVREIAQDFKTDLRFQS AV+ALQEA EAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLLFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLAR IRGERA
Sbjct  117  RVTIMPKDIQLARHIRGERA  136


 Score =   110 bits (275),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 55/62 (89%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHRYRPGTVALREIR+YQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  409  SL  404
             L
Sbjct  61   LL  62



>gb|ACO15640.1| Histone H3.3 [Caligus clemensi]
Length=136

 Score =   147 bits (371),  Expect(2) = 8e-60, Method: Compositional matrix adjust.
 Identities = 72/80 (90%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIR+L FQRLVREIAQDFKTDLRFQS A+ ALQEA+EAYLVGLFEDT+LCAIHAK
Sbjct  57   KSTELLIRRLSFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTDLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   110 bits (276),  Expect(2) = 8e-60, Method: Compositional matrix adjust.
 Identities = 55/62 (89%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPGTVALREIR+YQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  409  SL  404
             L
Sbjct  61   LL  62



>ref|XP_009129719.1| PREDICTED: histone H3.2-like [Brassica rapa]
Length=136

 Score =   153 bits (386),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 75/80 (94%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +S EL IRKLPFQRLVREIAQDFKTDLRFQS AV ALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  57   KSPELPIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   103 bits (258),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 52/58 (90%), Positives = 55/58 (95%), Gaps = 0/58 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRA  416
            MARTKQTARKSTGGKAPRKQLATKAARKSAP  GGVKKPHR+RPGTVALREIRK Q++
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPAAGGVKKPHRFRPGTVALREIRKSQKS  58



>ref|XP_006192498.1| PREDICTED: histone H3.3-like [Camelus ferus]
 gb|EQB79038.1| histone H3.3-like protein [Camelus ferus]
Length=136

 Score =   143 bits (361),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 71/80 (89%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKL FQR VREIAQDFKTDL FQS A+ ALQEA +AYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLSFQRQVREIAQDFKTDLHFQSAAIGALQEARKAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   107 bits (266),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTK TARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPGTVALREIR+YQ++  
Sbjct  1    MARTKPTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  409  SL  404
             L
Sbjct  61   LL  62



>gb|EJK48130.1| hypothetical protein THAOC_33105 [Thalassiosira oceanica]
Length=172

 Score =   156 bits (395),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 78/80 (98%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRK PFQRLVREIAQDFKTDLRFQS AVLALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  93   KSTELLIRKAPFQRLVREIAQDFKTDLRFQSTAVLALQEASEAYLVGLFEDTNLCAIHAK  152

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  153  RVTIMPKDIQLARRIRGERA  172


 Score = 92.8 bits (229),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 58/98 (59%), Gaps = 36/98 (37%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQ------------------------------------LATK  518
            MARTKQTARKSTGGKAPRKQ                                    LATK
Sbjct  1    MARTKQTARKSTGGKAPRKQVSAPMAVTGGDTFASTGRAALEYPGAGAVCTARTPVLATK  60

Query  517  AARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALSSL  404
            AARKSAPT GGVKKPHRYRPGTVALREIRKYQ++   L
Sbjct  61   AARKSAPTAGGVKKPHRYRPGTVALREIRKYQKSTELL  98



>ref|XP_003733588.1| PREDICTED: histone H3.3-like [Callithrix jacchus]
Length=136

 Score =   139 bits (351),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 69/79 (87%), Positives = 73/79 (92%), Gaps = 0/79 (0%)
 Frame = -1

Query  419  STELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKR  240
            STEL IRK  FQRL++EIAQDFKTDLRFQS A+ ALQEA+EAYLVGLFEDTNLCAIHAKR
Sbjct  58   STELPIRKSSFQRLMQEIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKR  117

Query  239  VTIMPKDIQLARRIRGERA  183
            VTIMPKDIQLA RIRGERA
Sbjct  118  VTIMPKDIQLACRIRGERA  136


 Score =   107 bits (267),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 56/56 (100%), Gaps = 0/56 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQ  422
            MARTKQTARKS+GGKAPRKQLATKAARKSAP+TGGVK+PHRYRPGTVALREIR+YQ
Sbjct  1    MARTKQTARKSSGGKAPRKQLATKAARKSAPSTGGVKEPHRYRPGTVALREIRRYQ  56



>ref|XP_001096527.1| PREDICTED: histone H3.3-like isoform 2 [Macaca mulatta]
Length=136

 Score =   142 bits (359),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 71/80 (89%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKL FQ LVREIAQDFKTDLRFQS A+ ALQEA+E YLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLAFQPLVREIAQDFKTDLRFQSAAIGALQEASEPYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLA RIRGERA
Sbjct  117  RVTIMPKDIQLACRIRGERA  136


 Score =   101 bits (252),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTA KST GKAPRKQ ATKAARKSAP+TGGVKKPHRYRPGTVALREIR+YQ++  
Sbjct  1    MARTKQTACKSTSGKAPRKQPATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  409  SL  404
             L
Sbjct  61   LL  62



>ref|XP_005441359.1| PREDICTED: histone H3.2-like [Falco cherrug]
Length=133

 Score =   151 bits (381),  Expect(2) = 9e-55, Method: Compositional matrix adjust.
 Identities = 73/76 (96%), Positives = 75/76 (99%), Gaps = 0/76 (0%)
 Frame = -1

Query  410  LLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTI  231
            LLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct  58   LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI  117

Query  230  MPKDIQLARRIRGERA  183
            MPKDIQLARRIRGERA
Sbjct  118  MPKDIQLARRIRGERA  133


 Score = 89.7 bits (221),  Expect(2) = 9e-55, Method: Compositional matrix adjust.
 Identities = 45/46 (98%), Positives = 45/46 (98%), Gaps = 0/46 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGT  452
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHRYRPGT
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGT  46



>emb|CDQ94543.1| unnamed protein product [Oncorhynchus mykiss]
Length=139

 Score =   147 bits (370),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 72/80 (90%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKL FQRLVREI QDFKTD RFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  60   KSTELLIRKLAFQRLVREIGQDFKTDPRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  119

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIM KDIQLARRIRGERA
Sbjct  120  RVTIMSKDIQLARRIRGERA  139


 Score = 92.4 bits (228),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -2

Query  574  QTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALSSL  404
            +T+RKSTGGKAPRKQLATKAARKSAP T GVKKPHRYRPGTVALREIR YQ++   L
Sbjct  9    KTSRKSTGGKAPRKQLATKAARKSAPATRGVKKPHRYRPGTVALREIRGYQKSTELL  65



>ref|XP_003638893.1| PREDICTED: histone H3.3-like [Canis lupus familiaris]
Length=202

 Score =   141 bits (355),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 70/80 (88%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIR L FQRLVRE AQDFKTDLRFQS A+ ALQEA+EAY VGLFEDTNLCAIHAK
Sbjct  123  KSTELLIRTLSFQRLVRETAQDFKTDLRFQSAAIGALQEASEAYPVGLFEDTNLCAIHAK  182

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLAR IRGERA
Sbjct  183  RVTIMPKDIQLARCIRGERA  202


 Score = 97.8 bits (242),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = -2

Query  586  ARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQR  419
            ART QTARKSTGG+APRKQLATKAARKSAP+TGGV+KPHRYRP TVALREIR+ +R
Sbjct  65   ARTTQTARKSTGGEAPRKQLATKAARKSAPSTGGVRKPHRYRPATVALREIRQIRR  120



>ref|XP_004136113.1| PREDICTED: uncharacterized protein LOC101209420 [Cucumis sativus]
Length=274

 Score =   128 bits (322),  Expect(2) = 8e-54, Method: Compositional matrix adjust.
 Identities = 62/64 (97%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  REIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIR  195
            REIAQDFKTDLRFQS AV ALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIR
Sbjct  211  REIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIR  270

Query  194  GERA  183
            GERA
Sbjct  271  GERA  274


 Score =   109 bits (273),  Expect(2) = 8e-54, Method: Compositional matrix adjust.
 Identities = 54/58 (93%), Positives = 57/58 (98%), Gaps = 0/58 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRA  416
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHR+RPGTVALREIRKYQ++
Sbjct  139  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKS  196


 Score =   156 bits (394),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 77/79 (97%), Gaps = 0/79 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV ALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGER  186
            RVTIMPKDIQLARRIRGER
Sbjct  117  RVTIMPKDIQLARRIRGER  135


 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHR+RPGTVALREIRKYQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>gb|AAW48000.1| histone 3 [Opisthocosmia tenius]
Length=125

 Score =   130 bits (328),  Expect(2) = 9e-54, Method: Compositional matrix adjust.
 Identities = 62/69 (90%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STEL IRKLPF RLVREIAQDFKTDLRF S AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELXIRKLPFXRLVREIAQDFKTDLRFXSSAVMALQEASEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDI  216
            RVTIMPKDI
Sbjct  117  RVTIMPKDI  125


 Score =   107 bits (266),  Expect(2) = 9e-54, Method: Compositional matrix adjust.
 Identities = 53/58 (91%), Positives = 56/58 (97%), Gaps = 0/58 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRA  416
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHRYRPGTVALREIR+Y ++
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYXKS  58



>ref|XP_005958418.1| PREDICTED: histone H3.3-like [Pantholops hodgsonii]
Length=136

 Score =   132 bits (332),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLI KL  Q LV EIA DFKTDLRFQS A+ ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLILKLSIQHLVWEIAHDFKTDLRFQSAAIDALQEASEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLA  IRGERA
Sbjct  117  RVTIMPKDIQLAHYIRGERA  136


 Score =   105 bits (261),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARK TG KAPRKQLATKAARKSAP+TGGVKKPHRYRPGTVALREIR YQ++  
Sbjct  1    MARTKQTARKLTGHKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRCYQKSTE  60

Query  409  SL  404
             L
Sbjct  61   LL  62



>dbj|BAD90782.1| histone 3 [Conocephalum conicum]
Length=134

 Score =   134 bits (336),  Expect(2) = 5e-53, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 70/79 (89%), Gaps = 0/79 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            EST+L IRKLPFQRLVREIA DFK+DLRFQS A+ A QE+ E+YLV LFEDTNLCAIHAK
Sbjct  55   ESTDLHIRKLPFQRLVREIAHDFKSDLRFQSSAIGAFQESVESYLVSLFEDTNLCAIHAK  114

Query  242  RVTIMPKDIQLARRIRGER  186
            RVTI  KDIQLARR+RGER
Sbjct  115  RVTIQSKDIQLARRLRGER  133


 Score =   101 bits (252),  Expect(2) = 5e-53, Method: Compositional matrix adjust.
 Identities = 51/56 (91%), Positives = 55/56 (98%), Gaps = 1/56 (2%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQ  422
            MARTKQTARKSTGGKAPRKQLA+KAARKSAP+TGGVKKPHRY PGTVALREIR+Y+
Sbjct  1    MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRY-PGTVALREIRRYE  55



>emb|CBY20523.1| unnamed protein product [Oikopleura dioica]
Length=132

 Score =   142 bits (357),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 75/97 (77%), Gaps = 19/97 (20%)
 Frame = -1

Query  473  PSLSSWNCCSP*NPQVSESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEA  294
            PS SS +C                   PFQRLVREIAQDFKTDLRFQS AV+ALQEA+EA
Sbjct  55   PSFSSESC-------------------PFQRLVREIAQDFKTDLRFQSSAVMALQEASEA  95

Query  293  YLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA  183
            YLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct  96   YLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA  132


 Score = 90.9 bits (224),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 45/46 (98%), Positives = 45/46 (98%), Gaps = 0/46 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGT  452
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHRYRPGT
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGT  46



>ref|XP_004778825.1| PREDICTED: histone H3-like [Mustela putorius furo]
Length=136

 Score =   126 bits (317),  Expect(2) = 5e-52, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = -1

Query  416  TELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRV  237
            T++L+    FQR + +IAQ F+ DLRFQS AV+ALQEA EAYLVGLFEDTNLCAIHAKRV
Sbjct  59   TQMLLWAACFQRTLGQIAQAFQVDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRV  118

Query  236  TIMPKDIQLARRIRGERA  183
            TIMPKDIQLARRIRGERA
Sbjct  119  TIMPKDIQLARRIRGERA  136


 Score =   105 bits (262),  Expect(2) = 5e-52, Method: Compositional matrix adjust.
 Identities = 52/56 (93%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQ  422
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHRYRPGTVALREI  +Q
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIECWQ  56



>gb|EMS47381.1| Histone H3.2 [Triticum urartu]
Length=113

 Score =   135 bits (339),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 66/70 (94%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = -1

Query  392  PFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQ  213
            P  RLVREIAQDFKTDLRFQS AV ALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQ
Sbjct  44   PGTRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQ  103

Query  212  LARRIRGERA  183
            LARRIRGERA
Sbjct  104  LARRIRGERA  113


 Score = 94.0 bits (232),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 47/52 (90%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREI  434
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHR+RPGT  +REI
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTRLVREI  52



>ref|XP_005414641.1| PREDICTED: LOW QUALITY PROTEIN: histone H3-like centromeric protein 
CSE4-like [Chinchilla lanigera]
Length=283

 Score =   134 bits (336),  Expect(2) = 7e-51, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STEL I+KL FQRLVREIAQDFKT +RFQS A  ALQEA+EAYLVG+FEDTNLCA HA+
Sbjct  204  KSTELPIQKLSFQRLVREIAQDFKTPMRFQSAATGALQEASEAYLVGIFEDTNLCASHAE  263

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIM KDIQLARRIRGERA
Sbjct  264  RVTIMSKDIQLARRIRGERA  283


 Score = 94.4 bits (233),  Expect(2) = 7e-51, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -2

Query  586  ARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRA  416
            ARTKQTARK+TGGKAPRKQ ATKAARKSAP+TGGVKKPHR  PGTVALREI +YQ++
Sbjct  149  ARTKQTARKATGGKAPRKQRATKAARKSAPSTGGVKKPHRCGPGTVALREIHRYQKS  205



>ref|XP_010202813.1| PREDICTED: LOW QUALITY PROTEIN: histone H3.3-like, partial [Colius 
striatus]
Length=140

 Score =   138 bits (347),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 71/80 (89%), Positives = 74/80 (93%), Gaps = 3/80 (4%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRK    RLVREIAQDFKTDLRFQS A+ ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  45   KSTELLIRK---XRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAK  101

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  102  RVTIMPKDIQLARRIRGERA  121


 Score = 89.7 bits (221),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -2

Query  553  GGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALSSL  404
            GGKAPRKQLATKAARKSAP+TGGVKKPHRYRPGTVALREIR+YQ++   L
Sbjct  1    GGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELL  50



>gb|ADB45640.1| histone H3, partial [Koebelia grossa]
Length=117

 Score =   124 bits (312),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 59/65 (91%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STEL IR LPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  53   KSTELXIRXLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  112

Query  242  RVTIM  228
            RVTIM
Sbjct  113  RVTIM  117


 Score =   102 bits (253),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 50/54 (93%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = -2

Query  577  KQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRA  416
            KQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHRYRPGTVALREIR+YQ++
Sbjct  1    KQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKS  54



>ref|XP_004638294.1| PREDICTED: uncharacterized protein LOC101560363 [Octodon degus]
Length=303

 Score =   136 bits (342),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 67/77 (87%), Positives = 72/77 (94%), Gaps = 0/77 (0%)
 Frame = -1

Query  413  ELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVT  234
            +LLIRKLPFQRLVREIAQDFKT+LRFQS AV A+Q A+EAYLVGLFEDTNLCAIHAK VT
Sbjct  227  QLLIRKLPFQRLVREIAQDFKTELRFQSAAVGAVQVASEAYLVGLFEDTNLCAIHAKWVT  286

Query  233  IMPKDIQLARRIRGERA  183
            +MPKDIQLARRI GERA
Sbjct  287  VMPKDIQLARRICGERA  303


 Score = 90.1 bits (222),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = -2

Query  571  TARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALSSL  404
            TARKSTGGKAP KQLATKAARKSAP+ GGV+KPHRY PGTVALREIR+YQ  +  L
Sbjct  178  TARKSTGGKAPGKQLATKAARKSAPSIGGVRKPHRYGPGTVALREIRRYQLLIRKL  233



>emb|CAF87474.1| unnamed protein product, partial [Tetraodon nigroviridis]
 emb|CAF87576.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=122

 Score =   171 bits (432),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 97/122 (80%), Gaps = 0/122 (0%)
 Frame = -1

Query  548  KGSEEAACYEGCPEISPYHWWSEEAPSLSSWNCCSP*NPQVSESTELLIRKLPFQRLVRE  369
            K S EAA ++G  +  P H   EEA  L + +       +  +STELLIRKLPFQRLVRE
Sbjct  1    KSSPEAAGHQGGAQERPGHGRREEASPLPARHVALREIRRYQKSTELLIRKLPFQRLVRE  60

Query  368  IAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGE  189
            IAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGE
Sbjct  61   IAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGE  120

Query  188  RA  183
            RA
Sbjct  121  RA  122



>gb|ADF58428.1| histone H3 [Oryza sativa Indica Group]
Length=136

 Score =   128 bits (321),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 63/70 (90%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = -1

Query  392  PFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQ  213
            PFQRLVREIAQDFKTDLRFQS AV ALQEAAEAYL GLFED NLCAIHAKRVTIMPKDIQ
Sbjct  67   PFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLGGLFEDRNLCAIHAKRVTIMPKDIQ  126

Query  212  LARRIRGERA  183
            LARR+  ERA
Sbjct  127  LARRMNRERA  136


 Score = 97.1 bits (240),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQ    STGGKAPRKQ ATKAARKSAP TGGVKKPHR+RPGTVALREIRKYQ+++ 
Sbjct  1    MARTKQRRAMSTGGKAPRKQKATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSIK  60

Query  409  S  407
            +
Sbjct  61   A  61



>emb|CAA24131.1| unnamed protein product [Mus musculus]
Length=135

 Score =   130 bits (327),  Expect(2) = 7e-50, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
             STELLI KLPFQRLV+EIAQDFKTDLRFQS A+ ALQEA+EA  VGLFEDTNLCAIHAK
Sbjct  56   HSTELLIHKLPFQRLVQEIAQDFKTDLRFQSAAIGALQEASEANRVGLFEDTNLCAIHAK  115

Query  242  RVTIMPKDIQLARRIRGERA  183
             VT++PKDIQLA  I GERA
Sbjct  116  CVTVIPKDIQLAHSILGERA  135


 Score = 94.7 bits (234),  Expect(2) = 7e-50, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQ  422
            MA TKQTARKST GKAPRKQLATKAA KSAP+TGGVKK HRYRP TVAL EIR+Y 
Sbjct  1    MAHTKQTARKSTCGKAPRKQLATKAAXKSAPSTGGVKKSHRYRPDTVALLEIRRYH  56



>ref|XP_010978514.1| PREDICTED: uncharacterized protein LOC105089201 [Camelus dromedarius]
Length=1288

 Score =   152 bits (384),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 74/78 (95%), Positives = 76/78 (97%), Gaps = 0/78 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA EAYLVGLFEDTNLCAIHAK
Sbjct  562  KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAK  621

Query  242  RVTIMPKDIQLARRIRGE  189
            RVTIMPKDIQLARRIRGE
Sbjct  622  RVTIMPKDIQLARRIRGE  639


 Score = 70.5 bits (171),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKK  476
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGV+K
Sbjct  524  MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVRK  561


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 58/115 (50%), Gaps = 32/115 (28%)
 Frame = +3

Query  261  QVGVLKQTN*VCFRSLLEREHSMTLEPQISLEVLGNLTDKPLEGKLADKELSAL*YLRIS  440
             VGVL++ + V    LL+R H   LE Q+ LEVL +LT +PLE +LAD++L         
Sbjct  174  HVGVLEEPHQVGLARLLQRHHGRALEAQVGLEVLRDLTHQPLERQLADQQL---------  224

Query  441  RRATVPGR*RWGFFTPPVVGADFRAAFVASCFLGAFPPVDLRAVCLVRAISSDYQ  605
                                   R   VA+   GA PPVDLRAVCLVRAI+  ++
Sbjct  225  -----------------------RGLLVAADLGGALPPVDLRAVCLVRAITKHHK  256



>gb|EEE65134.1| hypothetical protein OsJ_20207 [Oryza sativa Japonica Group]
Length=217

 Score =   171 bits (434),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 99/127 (78%), Gaps = 1/127 (1%)
 Frame = -1

Query  560  VYRWKGSEEAACYEGCPEISPYHWWSEEAPSLSSWNCC-SP*NPQVSESTELLIRKLPFQ  384
            V+R +G+EEAA  +G  ++   H   EEA  L +     S  +     +TELLIRKLPFQ
Sbjct  91   VHRREGAEEAAGDQGGAQVGAGHRRREEAAPLQAGAPSRSVRSASTRRATELLIRKLPFQ  150

Query  383  RLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLAR  204
            RLVREIAQDFKTDLRFQS AV ALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLAR
Sbjct  151  RLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLAR  210

Query  203  RIRGERA  183
            RIRGERA
Sbjct  211  RIRGERA  217



>ref|XP_010498414.1| PREDICTED: LOW QUALITY PROTEIN: histone H3.3 [Camelina sativa]
Length=142

 Score =   139 bits (351),  Expect(2) = 6e-49, Method: Compositional matrix adjust.
 Identities = 67/71 (94%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = -1

Query  395  LPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDI  216
            LPFQRLVREIAQD K DLRFQSHA+LALQEAAEAYLVGLFEDTNLCA+HAKRVTIMPKDI
Sbjct  72   LPFQRLVREIAQDHKVDLRFQSHAILALQEAAEAYLVGLFEDTNLCALHAKRVTIMPKDI  131

Query  215  QLARRIRGERA  183
            QLARRIRGERA
Sbjct  132  QLARRIRGERA  142


 Score = 82.0 bits (201),  Expect(2) = 6e-49, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 47/57 (82%), Gaps = 2/57 (4%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSA--PTTGGVKKPHRYRPGTVALREIRKY  425
            MARTKQTARKSTGGK PRKQLATKAARK+   P  GG+KK HR+RPGTVALR +  +
Sbjct  1    MARTKQTARKSTGGKGPRKQLATKAARKTPRRPYNGGIKKAHRFRPGTVALRXVSVF  57



>ref|XP_008761077.1| PREDICTED: histone H3.3-like [Rattus norvegicus]
Length=152

 Score =   130 bits (326),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 72/80 (90%), Gaps = 1/80 (1%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STEL IR LPFQRLVREIAQ+FKTDLRFQ  A+ ALQ+A+EA+LVGLFEDT+LCAIHAK
Sbjct  74   KSTEL-IRTLPFQRLVREIAQNFKTDLRFQRAAIGALQKASEAHLVGLFEDTSLCAIHAK  132

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLA   RGERA
Sbjct  133  RVTIMPKDIQLAHHTRGERA  152


 Score = 89.7 bits (221),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = -2

Query  598  SEDMARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQR  419
             E  A TKQTA KST GK PRKQLATK A KS  +TGGVKKPH YRPGTVALREIR+YQ+
Sbjct  15   CECQAHTKQTAGKSTCGKTPRKQLATKTAHKSTTSTGGVKKPHHYRPGTVALREIRRYQK  74

Query  418  A  416
            +
Sbjct  75   S  75



>ref|XP_006894195.1| PREDICTED: histone H3.3-like [Elephantulus edwardii]
Length=138

 Score =   127 bits (320),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +S E +IRKL FQ LVREIAQDFKTDLRFQ  A+ ALQEA+EAYLVGLFEDTNLCAIH K
Sbjct  59   KSPEFMIRKLFFQHLVREIAQDFKTDLRFQRAAIGALQEASEAYLVGLFEDTNLCAIHVK  118

Query  242  RVTIMPKDIQLARRIRGERA  183
             VT MPKDI+LA RIRGERA
Sbjct  119  CVTTMPKDIELACRIRGERA  138


 Score = 91.7 bits (226),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -2

Query  586  ARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRA  416
            AR K TARKSTGGKAPRKQL TKAA KSA +TGGVKKPHRYR GTVALREIR+YQ++
Sbjct  4    ARAKPTARKSTGGKAPRKQLETKAAHKSALSTGGVKKPHRYRHGTVALREIRRYQKS  60



>ref|XP_009980138.1| PREDICTED: LOW QUALITY PROTEIN: histone H3-like [Tauraco erythrolophus]
Length=133

 Score =   140 bits (354),  Expect(2) = 5e-48, Method: Compositional matrix adjust.
 Identities = 67/70 (96%), Positives = 69/70 (99%), Gaps = 0/70 (0%)
 Frame = -1

Query  392  PFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQ  213
            PFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAKRVTIMPKDIQ
Sbjct  64   PFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQ  123

Query  212  LARRIRGERA  183
            LARRIRGERA
Sbjct  124  LARRIRGERA  133


 Score = 78.2 bits (191),  Expect(2) = 5e-48, Method: Compositional matrix adjust.
 Identities = 41/45 (91%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPG  455
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGG KKPHRY  G
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGGKKPHRYPAG  45



>gb|EPQ18970.1| Histone H3.3 type 1 [Myotis brandtii]
Length=114

 Score =   164 bits (415),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/109 (76%), Positives = 90/109 (83%), Gaps = 0/109 (0%)
 Frame = -1

Query  509  EISPYHWWSEEAPSLSSWNCCSP*NPQVSESTELLIRKLPFQRLVREIAQDFKTDLRFQS  330
            E  P +   EEAPSL + +       +  +STELLIRKLPFQRLVREIAQDFKTDLRFQS
Sbjct  6    EKRPLYRRGEEAPSLQARDVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS  65

Query  329  HAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA  183
             A+ ALQEA+EAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct  66   AAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA  114



>emb|CBI18192.3| unnamed protein product [Vitis vinifera]
Length=108

 Score =   124 bits (312),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 60/62 (97%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = -1

Query  368  IAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGE  189
            IAQDFKTDLRFQS AV ALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGE
Sbjct  47   IAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGE  106

Query  188  RA  183
            RA
Sbjct  107  RA  108


 Score = 92.0 bits (227),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 45/48 (94%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVA  446
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHR+RPGT+A
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTIA  48



>ref|XP_008773935.1| PREDICTED: serine/arginine repetitive matrix protein 2-like [Rattus 
norvegicus]
Length=393

 Score =   130 bits (328),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 72/80 (90%), Gaps = 1/80 (1%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STEL IR LPFQRLVREIAQ+FKTDLRFQ  A+ ALQ+A+EA+LVGLFEDT+LCAIHAK
Sbjct  315  KSTEL-IRTLPFQRLVREIAQNFKTDLRFQRAAIGALQKASEAHLVGLFEDTSLCAIHAK  373

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLA   RGERA
Sbjct  374  RVTIMPKDIQLAHHTRGERA  393


 Score = 85.1 bits (209),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -2

Query  586  ARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRA  416
            A TKQTA KST GK PRKQLATK A KS  +TGGVKKPH YRPGTVALREIR+YQ++
Sbjct  260  AHTKQTAGKSTCGKTPRKQLATKTAHKSTTSTGGVKKPHHYRPGTVALREIRRYQKS  316



>ref|XP_005441371.1| PREDICTED: histone H3.2-like [Falco cherrug]
Length=110

 Score =   154 bits (388),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 74/81 (91%), Positives = 78/81 (96%), Gaps = 0/81 (0%)
 Frame = -1

Query  425  SESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA  246
            + +T LLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHA
Sbjct  30   APATXLLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHA  89

Query  245  KRVTIMPKDIQLARRIRGERA  183
            KRVTIMPKDIQLARRIRGERA
Sbjct  90   KRVTIMPKDIQLARRIRGERA  110


 Score = 61.6 bits (148),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTT  491
            MARTKQTARKSTGGKAPRKQLATKAARKSAP T
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPAT  33



>emb|CBI37601.3| unnamed protein product [Vitis vinifera]
Length=127

 Score =   123 bits (309),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 60/62 (97%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = -1

Query  368  IAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGE  189
            IAQDFKTDLRFQS AV ALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGE
Sbjct  66   IAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGE  125

Query  188  RA  183
            RA
Sbjct  126  RA  127


 Score = 92.4 bits (228),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 45/48 (94%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVA  446
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHR+RPGT+A
Sbjct  20   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTIA  67



>ref|XP_005972769.1| PREDICTED: histone H3.3-like [Pantholops hodgsonii]
Length=133

 Score =   117 bits (294),  Expect(2) = 5e-47, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 68/80 (85%), Gaps = 2/80 (3%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STEL++ KLPFQRLV EIAQDFKTDL FQS A+ AL EA+EAYLVGLF   NLCAI AK
Sbjct  56   KSTELIL-KLPFQRLVWEIAQDFKTDLHFQSAAIGALLEASEAYLVGLFSH-NLCAIQAK  113

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLAR IRGE A
Sbjct  114  RVTIMPKDIQLARSIRGECA  133


 Score = 97.8 bits (242),  Expect(2) = 5e-47, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = -2

Query  577  KQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRA  416
            KQTARKSTGGKAPRKQLATKAARKSAP+TGG KKPHRYRPGTVAL EIR+YQ++
Sbjct  4    KQTARKSTGGKAPRKQLATKAARKSAPSTGGAKKPHRYRPGTVALCEIRRYQKS  57



>gb|AHY03477.1| histone, partial [Alternaria tenuissima]
Length=119

 Score =   125 bits (314),  Expect(2) = 7e-47, Method: Compositional matrix adjust.
 Identities = 61/73 (84%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            + TEL IRKLPFQRLVREIAQDFK+DLRFQS A+ ALQE+ EAYLV LFEDTNLCAIHAK
Sbjct  47   KPTELPIRKLPFQRLVREIAQDFKSDLRFQSSAIGALQESVEAYLVSLFEDTNLCAIHAK  106

Query  242  RVTIMPKDIQLAR  204
            RVTI  KDIQLAR
Sbjct  107  RVTIQSKDIQLAR  119


 Score = 89.7 bits (221),  Expect(2) = 7e-47, Method: Compositional matrix adjust.
 Identities = 42/47 (89%), Positives = 47/47 (100%), Gaps = 0/47 (0%)
 Frame = -2

Query  559  STGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQR  419
            STGGKAPRKQLA+KAARKSAP+TGGVKKPHRY+PGTVALREIR+YQ+
Sbjct  1    STGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRYQK  47



>emb|CAN70652.1| hypothetical protein VITISV_010022 [Vitis vinifera]
Length=137

 Score =   162 bits (411),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  58   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  117

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  118  RVTIMPKDIQLARRIRGERA  137


 Score =   114 bits (286),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQ++  
Sbjct  2    MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTE  61

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  62   LLIRKLPFQRL  72



>gb|ACG38891.1| histone H3 [Zea mays]
Length=136

 Score =   162 bits (410),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   112 bits (280),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTK TARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQ++  
Sbjct  1    MARTKXTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>ref|XP_010480248.1| PREDICTED: histone H3.3-like [Camelina sativa]
Length=136

 Score =   162 bits (410),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   111 bits (277),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKS GGKAP+KQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQ++  
Sbjct  1    MARTKQTARKSHGGKAPKKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>ref|WP_039311726.1| hypothetical protein [Paenibacillus sp. IHB B 3415]
 ref|NP_195713.1| Histone H3.3 [Arabidopsis thaliana]
 ref|NP_196659.1| histone H3.3 [Arabidopsis thaliana]
 ref|NP_849529.1| histone H3  [Arabidopsis thaliana]
 ref|NP_001031816.1| histone H3  [Arabidopsis thaliana]
 ref|NP_001050276.1| Os03g0390600 [Oryza sativa Japonica Group]
 ref|NP_001056693.1| Os06g0130900 [Oryza sativa Japonica Group]
 ref|NP_001078517.1| Histone H3.3 [Arabidopsis thaliana]
 ref|NP_001131417.1| uncharacterized LOC100192746 [Zea mays]
 ref|NP_001234218.1| histone H3 variant H3.3 [Solanum lycopersicum]
 ref|NP_001235785.1| uncharacterized protein LOC100305466 [Glycine max]
 ref|NP_001268032.1| histone H3.3 [Vitis vinifera]
 ref|XP_001752178.1| histone H3 [Physcomitrella patens]
 ref|XP_001752234.1| histone H3 [Physcomitrella patens]
 ref|XP_001752318.1| histone H3 [Physcomitrella patens]
 ref|XP_002300726.1| hypothetical protein POPTR_0002s02830g [Populus trichocarpa]
 ref|XP_002306294.1| hypothetical protein POPTR_0005s07340g [Populus trichocarpa]
 ref|XP_002307702.1| histone H3-D family protein [Populus trichocarpa]
 ref|XP_002309961.1| hypothetical protein POPTR_0007s05050g [Populus trichocarpa]
 ref|XP_002310848.1| hypothetical protein POPTR_0007s13920g [Populus trichocarpa]
 ref|XP_002270349.1| PREDICTED: histone H3.3 [Vitis vinifera]
 ref|XP_002278809.1| PREDICTED: histone H3.3 [Vitis vinifera]
 ref|XP_002278833.1| PREDICTED: histone H3.3 [Vitis vinifera]
 ref|XP_002467760.1| hypothetical protein SORBIDRAFT_01g033550 [Sorghum bicolor]
 ref|XP_002437756.1| hypothetical protein SORBIDRAFT_10g002040 [Sorghum bicolor]
 ref|XP_002510489.1| histone h3, putative [Ricinus communis]
 ref|XP_002510490.1| histone h3, putative [Ricinus communis]
 ref|XP_002513959.1| histone h3, putative [Ricinus communis]
 ref|XP_002531518.1| histone h3, putative [Ricinus communis]
 ref|XP_002873489.1| histone H3.2 [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002977792.1| hypothetical protein SELMODRAFT_176603 [Selaginella moellendorffii]
 ref|XP_002986910.1| hypothetical protein SELMODRAFT_182771 [Selaginella moellendorffii]
 ref|XP_003538608.1| PREDICTED: histone H3.3-like isoformX1 [Glycine max]
 ref|XP_003538611.1| PREDICTED: histone H3.3-like [Glycine max]
 ref|XP_003545047.1| PREDICTED: histone H3.3-like [Glycine max]
 ref|XP_003550410.1| PREDICTED: histone H3.3-like [Glycine max]
 ref|XP_003557131.1| PREDICTED: histone H3.3 [Brachypodium distachyon]
 ref|XP_003557133.1| PREDICTED: histone H3.3 [Brachypodium distachyon]
 ref|XP_003579868.1| PREDICTED: histone H3.3 [Brachypodium distachyon]
 ref|XP_003589384.1| Histone H3 [Medicago truncatula]
 ref|XP_003628560.1| Histone H3 [Medicago truncatula]
 ref|XP_003635681.1| PREDICTED: histone H3.3 [Vitis vinifera]
 ref|XP_004146875.1| PREDICTED: histone H3.3-like [Cucumis sativus]
 ref|XP_004152625.1| PREDICTED: histone H3.3-like isoform 1 [Cucumis sativus]
 ref|XP_004152626.1| PREDICTED: histone H3.3-like isoform 2 [Cucumis sativus]
 ref|XP_004162225.1| PREDICTED: histone H3.3-like isoform 1 [Cucumis sativus]
 ref|XP_004162226.1| PREDICTED: histone H3.3-like isoform 2 [Cucumis sativus]
 ref|XP_004168241.1| PREDICTED: histone H3.3-like [Cucumis sativus]
 ref|XP_004237940.1| PREDICTED: histone H3.3 [Solanum lycopersicum]
 ref|XP_004238326.1| PREDICTED: histone H3.3 [Solanum lycopersicum]
 ref|XP_004250115.1| PREDICTED: histone H3.3 [Solanum lycopersicum]
 ref|XP_004287213.1| PREDICTED: histone H3.3 [Fragaria vesca subsp. vesca]
 ref|XP_004288164.1| PREDICTED: histone H3.3 [Fragaria vesca subsp. vesca]
 ref|XP_004288400.1| PREDICTED: histone H3.3 [Fragaria vesca subsp. vesca]
 ref|XP_004299672.1| PREDICTED: histone H3.3 [Fragaria vesca subsp. vesca]
 ref|XP_004499230.1| PREDICTED: histone H3.3-like [Cicer arietinum]
 ref|XP_004509059.1| PREDICTED: histone H3.3-like [Cicer arietinum]
 ref|XP_004952850.1| PREDICTED: histone H3.3-like [Setaria italica]
 ref|XP_004964429.1| PREDICTED: histone H3.3-like [Setaria italica]
 ref|XP_004975802.1| PREDICTED: histone H3.3-like [Setaria italica]
 ref|XP_004984150.1| PREDICTED: histone H3.3-like isoform X1 [Setaria italica]
 ref|XP_004984151.1| PREDICTED: histone H3.3-like isoform X2 [Setaria italica]
 ref|XP_006342014.1| PREDICTED: histone H3.3-like [Solanum tuberosum]
 ref|XP_006353204.1| PREDICTED: histone H3.3-like [Solanum tuberosum]
 ref|XP_006363289.1| PREDICTED: histone H3.3-like [Solanum tuberosum]
 ref|XP_006366221.1| PREDICTED: histone H3.3-like isoform X1 [Solanum tuberosum]
 ref|XP_006366222.1| PREDICTED: histone H3.3-like isoform X2 [Solanum tuberosum]
 ref|XP_006284722.1| hypothetical protein CARUB_v10005986mg [Capsella rubella]
 ref|XP_006284727.1| hypothetical protein CARUB_v10005990mg [Capsella rubella]
 ref|XP_006302978.1| hypothetical protein CARUB_v10021126mg [Capsella rubella]
 ref|XP_006382893.1| hypothetical protein POPTR_0005s07340g [Populus trichocarpa]
 ref|XP_006380404.1| hypothetical protein POPTR_0007s05050g [Populus trichocarpa]
 ref|XP_006390289.1| hypothetical protein EUTSA_v10019309mg [Eutrema salsugineum]
 ref|XP_006399597.1| hypothetical protein EUTSA_v10014984mg [Eutrema salsugineum]
 ref|XP_006426330.1| hypothetical protein CICLE_v10026739mg [Citrus clementina]
 ref|XP_006426331.1| hypothetical protein CICLE_v10026739mg [Citrus clementina]
 ref|XP_006435124.1| hypothetical protein CICLE_v10002817mg [Citrus clementina]
 ref|XP_006466265.1| PREDICTED: histone H3.3-like [Citrus sinensis]
 ref|XP_006473607.1| PREDICTED: histone H3.3-like [Citrus sinensis]
 ref|XP_006591489.1| PREDICTED: histone H3.3-like isoform X2 [Glycine max]
 ref|XP_006650156.1| PREDICTED: histone H3.3-like isoform X1 [Oryza brachyantha]
 ref|XP_006650157.1| PREDICTED: histone H3.3-like isoform X2 [Oryza brachyantha]
 ref|XP_006652345.1| PREDICTED: histone H3.3-like [Oryza brachyantha]
 ref|XP_006655750.1| PREDICTED: histone H3.3-like [Oryza brachyantha]
 ref|XP_006827997.1| hypothetical protein AMTR_s00008p00237320 [Amborella trichopoda]
 ref|XP_006838082.1| hypothetical protein AMTR_s00225p00023630 [Amborella trichopoda]
 ref|XP_006849278.1| hypothetical protein AMTR_s00027p00248560 [Amborella trichopoda]
 ref|XP_007047866.1| Histone superfamily protein [Theobroma cacao]
 ref|XP_007160694.1| hypothetical protein PHAVU_001G009100g [Phaseolus vulgaris]
 ref|XP_007163667.1| hypothetical protein PHAVU_001G253700g [Phaseolus vulgaris]
 ref|XP_007207357.1| hypothetical protein PRUPE_ppa013166mg [Prunus persica]
 ref|XP_007223801.1| hypothetical protein PRUPE_ppa013185mg [Prunus persica]
 ref|XP_007226054.1| hypothetical protein PRUPE_ppa013183mg [Prunus persica]
 ref|XP_008235104.1| PREDICTED: histone H3.3 [Prunus mume]
 ref|XP_008219337.1| PREDICTED: histone H3.3 [Prunus mume]
 ref|XP_008221310.1| PREDICTED: histone H3.3 [Prunus mume]
 ref|XP_008372995.1| PREDICTED: histone H3.3 [Malus domestica]
 ref|XP_008386124.1| PREDICTED: histone H3.3 [Malus domestica]
 ref|XP_008338566.1| PREDICTED: histone H3.3 [Malus domestica]
 ref|XP_008343325.1| PREDICTED: histone H3.3 [Malus domestica]
 ref|XP_008444859.1| PREDICTED: histone H3.3 [Cucumis melo]
 ref|XP_008453806.1| PREDICTED: histone H3.3 [Cucumis melo]
 ref|XP_008645852.1| PREDICTED: histone H3.3 [Zea mays]
 ref|XP_008645853.1| PREDICTED: histone H3.3 [Zea mays]
 ref|XP_008645854.1| PREDICTED: histone H3.3 [Zea mays]
 ref|XP_008645855.1| PREDICTED: histone H3.3 [Zea mays]
 ref|XP_008659340.1| PREDICTED: histone H3.3 [Zea mays]
 ref|XP_008779899.1| PREDICTED: histone H3.3 [Phoenix dactylifera]
 ref|XP_008790920.1| PREDICTED: histone H3.3 [Phoenix dactylifera]
 ref|XP_008790921.1| PREDICTED: histone H3.3 [Phoenix dactylifera]
 ref|XP_008810061.1| PREDICTED: histone H3.3 [Phoenix dactylifera]
 ref|XP_008777683.1| PREDICTED: histone H3.3 [Phoenix dactylifera]
 ref|XP_009130061.1| PREDICTED: histone H3.3 [Brassica rapa]
 ref|XP_009125263.1| PREDICTED: histone H3.3 [Brassica rapa]
 ref|XP_009131189.1| PREDICTED: histone H3.3 [Brassica rapa]
 ref|XP_009104699.1| PREDICTED: histone H3.3 [Brassica rapa]
 ref|XP_009373084.1| PREDICTED: histone H3.3 [Pyrus x bretschneideri]
 ref|XP_009365825.1| PREDICTED: histone H3.3 [Pyrus x bretschneideri]
 ref|XP_009339588.1| PREDICTED: histone H3.3 [Pyrus x bretschneideri]
 ref|XP_009348044.1| PREDICTED: histone H3.3 [Pyrus x bretschneideri]
 ref|XP_009383133.1| PREDICTED: histone H3.3 [Musa acuminata subsp. malaccensis]
 ref|XP_009391324.1| PREDICTED: histone H3.3 [Musa acuminata subsp. malaccensis]
 ref|XP_009391325.1| PREDICTED: histone H3.3 [Musa acuminata subsp. malaccensis]
 ref|XP_009417592.1| PREDICTED: histone H3.3 [Musa acuminata subsp. malaccensis]
 ref|XP_009418322.1| PREDICTED: histone H3.3 [Musa acuminata subsp. malaccensis]
 ref|XP_009622923.1| PREDICTED: histone H3.3 [Nicotiana tomentosiformis]
 ref|XP_009623907.1| PREDICTED: histone H3.3 [Nicotiana tomentosiformis]
 ref|XP_009589379.1| PREDICTED: histone H3.3 [Nicotiana tomentosiformis]
 ref|XP_009799309.1| PREDICTED: histone H3.3 [Nicotiana sylvestris]
 ref|XP_009799310.1| PREDICTED: histone H3.3 [Nicotiana sylvestris]
 ref|XP_009771876.1| PREDICTED: histone H3.3 [Nicotiana sylvestris]
 ref|XP_010061026.1| PREDICTED: histone H3.3 [Eucalyptus grandis]
 ref|XP_010027928.1| PREDICTED: histone H3.3 [Eucalyptus grandis]
 ref|XP_010105254.1| Histone [Morus notabilis]
 ref|XP_010267031.1| PREDICTED: histone H3.3 [Nelumbo nucifera]
 ref|XP_010267040.1| PREDICTED: histone H3.3 [Nelumbo nucifera]
 ref|XP_010272988.1| PREDICTED: histone H3.3 [Nelumbo nucifera]
 ref|XP_010272989.1| PREDICTED: histone H3.3 [Nelumbo nucifera]
 ref|XP_010272990.1| PREDICTED: histone H3.3 [Nelumbo nucifera]
 ref|XP_010239970.1| PREDICTED: histone H3.3 [Brachypodium distachyon]
 ref|XP_010321293.1| PREDICTED: histone H3 variant H3.3 isoform X1 [Solanum lycopersicum]
 ref|XP_010419651.1| PREDICTED: histone H3.3 [Camelina sativa]
 ref|XP_010431986.1| PREDICTED: histone H3.3 [Camelina sativa]
 ref|XP_010431987.1| PREDICTED: histone H3.3 [Camelina sativa]
 ref|XP_010431988.1| PREDICTED: histone H3.3 [Camelina sativa]
 ref|XP_010437129.1| PREDICTED: histone H3.3 [Camelina sativa]
 ref|XP_010446577.1| PREDICTED: histone H3.3 [Camelina sativa]
 ref|XP_010446578.1| PREDICTED: histone H3.3 [Camelina sativa]
 ref|XP_010453132.1| PREDICTED: histone H3.3 [Camelina sativa]
 ref|XP_010491788.1| PREDICTED: histone H3.3 [Camelina sativa]
 ref|XP_010533621.1| PREDICTED: histone H3.3 [Tarenaya hassleriana]
 ref|XP_010533631.1| PREDICTED: histone H3.3 [Tarenaya hassleriana]
 ref|XP_010533639.1| PREDICTED: histone H3.3 [Tarenaya hassleriana]
 ref|XP_010536364.1| PREDICTED: histone H3.3 [Tarenaya hassleriana]
 ref|XP_010539857.1| PREDICTED: histone H3.3 [Tarenaya hassleriana]
 ref|XP_010539858.1| PREDICTED: histone H3.3 [Tarenaya hassleriana]
 ref|XP_010526662.1| PREDICTED: histone H3.3 [Tarenaya hassleriana]
 ref|XP_010526992.1| PREDICTED: histone H3.3 [Tarenaya hassleriana]
 ref|XP_010679856.1| PREDICTED: histone H3.3 [Beta vulgaris subsp. vulgaris]
 ref|XP_010681007.1| PREDICTED: histone H3.3 [Beta vulgaris subsp. vulgaris]
 ref|XP_011016807.1| PREDICTED: histone H3.3 [Populus euphratica]
 ref|XP_011022826.1| PREDICTED: histone H3.3 [Populus euphratica]
 ref|XP_011022827.1| PREDICTED: histone H3.3 [Populus euphratica]
 ref|XP_011025928.1| PREDICTED: histone H3.3 [Populus euphratica]
 ref|XP_010939695.1| PREDICTED: histone H3.3 [Elaeis guineensis]
 ref|XP_011028962.1| PREDICTED: histone H3.3 [Populus euphratica]
 ref|XP_010940939.1| PREDICTED: histone H3.3 [Elaeis guineensis]
 ref|XP_010909579.1| PREDICTED: histone H3.3 [Elaeis guineensis]
 ref|XP_011045138.1| PREDICTED: histone H3.3 [Populus euphratica]
 ref|XP_011013190.1| PREDICTED: histone H3.3 [Populus euphratica]
 ref|XP_011074645.1| PREDICTED: histone H3.3 [Sesamum indicum]
 ref|XP_011097534.1| PREDICTED: histone H3.3 [Sesamum indicum]
 ref|XP_011100034.1| PREDICTED: histone H3.3 [Sesamum indicum]
 ref|XP_011459532.1| PREDICTED: histone H3.3 [Fragaria vesca subsp. vesca]
 sp|P59169.2|H33_ARATH RecName: Full=Histone H3.3; AltName: Full=Histone H3.2 [Arabidopsis 
thaliana]
 sp|Q71V89.3|H33_GOSHI RecName: Full=Histone H3.3 [Gossypium hirsutum]
 sp|P69245.2|H33_LOLTE RecName: Full=Histone H3.3 [Lolium temulentum]
 sp|P69244.2|H33_MEDSA RecName: Full=Histone H3.3; AltName: Full=Histone H3.2; AltName: 
Full=Minor histone H3 [Medicago sativa]
 sp|Q71H73.3|H33_VITVI RecName: Full=Histone H3.3 [Vitis vinifera]
 sp|Q6RUR1.3|H33_CAPAN RecName: Full=Histone H3.3 [Capsicum annuum]
 sp|Q71U98.3|H33_ORYCO RecName: Full=Histone H3.3 [Oryza coarctata]
 sp|Q711T2.3|H33_PINPS RecName: Full=Histone H3.3 [Pinus pinaster]
 sp|Q76N23.1|H33_TOBAC RecName: Full=Histone H3.3 [Nicotiana tabacum]
 sp|Q3C2E5.3|H33_LOLMU RecName: Full=Histone H3.3; AltName: Full=Replacement histone 
H3 [Lolium multiflorum]
 sp|A2XHJ3.1|H33_ORYSI RecName: Full=Histone H3.3; AltName: Full=H3.2 [Oryza sativa 
Indica Group]
 sp|Q0JCT1.2|H33_ORYSJ RecName: Full=Histone H3.3; AltName: Full=H3.2 [Oryza sativa 
Japonica Group]
 gb|AAK60325.1|AF385735_1 AT4g40030/T5J17_200 [Arabidopsis thaliana]
 emb|CAA42957.1| histone H3.3 like protein [Arabidopsis thaliana]
 emb|CAA42958.1| histone H3.3 like protein [Arabidopsis thaliana]
 gb|AAB49538.1| histone H3.2 [Medicago sativa]
 gb|AAB36493.1| histone H3.2 [Medicago sativa]
 gb|AAB36494.1| histone H3.2 [Medicago sativa]
 gb|AAB36497.1| histone H3.2 [Medicago sativa]
 gb|AAB36498.1| histone H3.2 [Medicago sativa]
 emb|CAA56153.1| histone H3 [Lolium temulentum]
 emb|CAA58445.1| histone H3 variant H3.3 [Solanum lycopersicum]
 gb|AAB97162.1| histone 3 [Gossypium hirsutum]
 dbj|BAA31218.1| histone H3 [Nicotiana tabacum]
 gb|AAC78105.1| histone H3 [Oryza sativa Japonica Group]
 gb|AAC97380.1| histone H3 [Oryza coarctata]
 emb|CAB38916.1| histone H3.3 [Arabidopsis thaliana]
 emb|CAB38917.1| Histon H3 [Arabidopsis thaliana]
 dbj|BAA84794.1| histone H3 [Oryza sativa Japonica Group]
 emb|CAB80666.1| histone H3.3 [Arabidopsis thaliana]
 emb|CAB80667.1| Histon H3 [Arabidopsis thaliana]
 emb|CAB96853.1| histon H3 protein [Arabidopsis thaliana]
 gb|AAL50088.1| AT5g10980/T30N20_250 [Arabidopsis thaliana]
 gb|AAL77728.1| AT4g40030/T5J17_200 [Arabidopsis thaliana]
 gb|AAM19891.1| AT5g10980/T30N20_250 [Arabidopsis thaliana]
 gb|AAM63725.1| histon H3 protein [Arabidopsis thaliana]
 gb|AAO00751.1| Histon H3 [Arabidopsis thaliana]
 gb|AAO29945.1| Histone H3 [Arabidopsis thaliana]
 emb|CAC84678.1| putative histone H3 [Pinus pinaster]
 gb|AAP30739.1| histone H3.3 [Vitis vinifera]
 gb|AAR06361.1| histone H3.2 protein [Oryza sativa Japonica Group]
 gb|AAR84425.1| histone H3-like protein [Capsicum annuum]
 gb|AAS19511.1| putative histone H3 [Oryza sativa Japonica Group]
 gb|AAX92697.1| histone 3 [Picea abies]
 gb|AAZ72655.1| histone H3.1 [Craterostigma plantagineum]
 gb|AAZ72656.1| histone H3.2 [Craterostigma plantagineum]
 dbj|BAE47073.1| replacement histone H3 [Lolium multiflorum]
 gb|ABF58917.1| At4g40040 [Arabidopsis thaliana]
 emb|CAJ38369.1| histin H3 [Plantago major]
 gb|ABF96358.1| Histone H3, putative, expressed [Oryza sativa Japonica Group]
 gb|ABF96359.1| Histone H3, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF12190.1| Os03g0390600 [Oryza sativa Japonica Group]
 dbj|BAF18607.1| Os06g0130900 [Oryza sativa Japonica Group]
 gb|ABI97039.1| histone H3 [Robinia pseudoacacia]
 emb|CAH67105.1| H0818E04.22 [Oryza sativa Indica Group]
 emb|CAH67180.1| H0815C01.1 [Oryza sativa Indica Group]
 gb|ABK21404.1| unknown [Picea sitchensis]
 gb|ABK21875.1| unknown [Picea sitchensis]
 gb|ABK23002.1| unknown [Picea sitchensis]
 gb|ABK23658.1| unknown [Picea sitchensis]
 gb|ABK94527.1| unknown [Populus trichocarpa]
 gb|ABK94627.1| unknown [Populus trichocarpa]
 gb|ABK94832.1| unknown [Populus trichocarpa]
 gb|ABK96416.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EAY90303.1| hypothetical protein OsI_11878 [Oryza sativa Indica Group]
 gb|EAZ30915.1| hypothetical protein OsJ_14996 [Oryza sativa Japonica Group]
 gb|EAZ35710.1| hypothetical protein OsJ_19999 [Oryza sativa Japonica Group]
 gb|ABP04114.1| histone 3 [Lemna minor]
 emb|CAN70615.1| hypothetical protein VITISV_004842 [Vitis vinifera]
 emb|CAN80736.1| hypothetical protein VITISV_034858 [Vitis vinifera]
 emb|CAN81972.1| hypothetical protein VITISV_011984 [Vitis vinifera]
 gb|ABR16042.1| unknown [Picea sitchensis]
 gb|ABR16186.1| unknown [Picea sitchensis]
 gb|ABR16666.1| unknown [Picea sitchensis]
 gb|ABR16974.1| unknown [Picea sitchensis]
 gb|ABR16987.1| unknown [Picea sitchensis]
 gb|ABR17024.1| unknown [Picea sitchensis]
 gb|ABR18384.1| unknown [Picea sitchensis]
 gb|ABS11142.1| histone H3 [Solanum lycopersicum]
 gb|ABS83501.1| U box domain-containing protein [Oryza sativa Japonica Group]
 gb|EDQ82911.1| histone H3 [Physcomitrella patens]
 gb|EDQ82967.1| histone H3 [Physcomitrella patens]
 gb|EDQ83051.1| histone H3 [Physcomitrella patens]
 gb|ACA50511.1| histone H3 [Oryza sativa Japonica Group]
 gb|ACF79815.1| unknown [Zea mays]
 gb|ACF87291.1| unknown [Zea mays]
 gb|ACF88473.1| unknown [Zea mays]
 gb|ACG24535.1| histone H3 [Zea mays]
 gb|ACG24932.1| histone H3 [Zea mays]
 gb|ACG25002.1| histone H3 [Zea mays]
 gb|ACG25605.1| histone H3 [Zea mays]
 gb|ACG31041.1| histone H3 [Zea mays]
 gb|ACG31048.1| histone H3 [Zea mays]
 gb|ACG46136.1| histone H3 [Zea mays]
 dbj|BAG88589.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97018.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC77374.1| hypothetical protein OsI_16104 [Oryza sativa Indica Group]
 dbj|BAH19936.1| AT4G40040 [Arabidopsis thaliana]
 dbj|BAH20155.1| AT4G40040 [Arabidopsis thaliana]
 gb|EEE59182.1| hypothetical protein OsJ_11116 [Oryza sativa Japonica Group]
 gb|EEE79999.1| hypothetical protein POPTR_0002s02830g [Populus trichocarpa]
 gb|EEE90411.1| hypothetical protein POPTR_0007s05050g [Populus trichocarpa]
 gb|EEE91298.1| hypothetical protein POPTR_0007s13920g [Populus trichocarpa]
 gb|EEE93290.1| hypothetical protein POPTR_0005s07340g [Populus trichocarpa]
 gb|EEE94698.1| histone H3-D family protein [Populus trichocarpa]
 gb|EEF30872.1| histone h3, putative [Ricinus communis]
 gb|EEF48542.1| histone h3, putative [Ricinus communis]
 gb|EEF52676.1| histone h3, putative [Ricinus communis]
 gb|EEF52677.1| histone h3, putative [Ricinus communis]
 gb|ACN40144.1| unknown [Picea sitchensis]
 gb|ACN41024.1| unknown [Picea sitchensis]
 gb|ACN65412.1| histone 3.2 [Pteris vittata]
 gb|ACR37697.1| unknown [Zea mays]
 gb|EER89123.1| hypothetical protein SORBIDRAFT_10g002040 [Sorghum bicolor]
 gb|EER94758.1| hypothetical protein SORBIDRAFT_01g033550 [Sorghum bicolor]
 gb|ACU13139.1| unknown [Glycine max]
 gb|ADE77894.1| unknown [Picea sitchensis]
 gb|ADF59039.1| histone H3.2 [Jatropha curcas]
 gb|EFH49748.1| histone H3.2 [Arabidopsis lyrata subsp. lyrata]
 emb|CBI17398.3| unnamed protein product [Vitis vinifera]
 emb|CBI33143.3| unnamed protein product [Vitis vinifera]
 gb|ADI87404.1| histone H3 [Oryza sativa]
 gb|ADI87405.1| histone H3 [Oryza sativa]
 gb|ADI87407.1| histone H3 [Oryza sativa]
 gb|EFJ11992.1| hypothetical protein SELMODRAFT_182771 [Selaginella moellendorffii]
 gb|EFJ21130.1| hypothetical protein SELMODRAFT_176603 [Selaginella moellendorffii]
 emb|CBI19808.3| unnamed protein product [Vitis vinifera]
 gb|ADR30795.1| histone H3.2 [Hevea brasiliensis]
 gb|ADV77197.1| histone H3, partial [Cladophora coelothrix]
 dbj|BAJ86347.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK06635.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87590.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|AED91617.1| histone H3.3 [Arabidopsis thaliana]
 gb|AEE87155.1| Histone H3.3 [Arabidopsis thaliana]
 gb|AEE87157.1| Histone H3.3 [Arabidopsis thaliana]
 gb|AEE87158.1| histone H3 [Arabidopsis thaliana]
 gb|AEE87159.1| histone H3 [Arabidopsis thaliana]
 dbj|BAL04972.1| histone H3 [Zoysia japonica]
 gb|AES59635.1| core histone H2A/H2B/H3/H4 [Medicago truncatula]
 gb|AET03036.1| core histone H2A/H2B/H3/H4 [Medicago truncatula]
 gb|AEZ52395.1| histone H3 [Wolffia australiana]
 gb|AFC88829.1| histone H23-like protein, partial [Miscanthus sinensis]
 gb|AFK33416.1| unknown [Lotus japonicus]
 gb|AFK38785.1| unknown [Medicago truncatula]
 gb|AFM30053.1| histone H3 [Chimonanthus praecox]
 gb|AFP44115.1| histone H3 [Lycoris longituba]
 gb|AFR23066.1| hypothetical protein [Oryza sativa]
 gb|AFW71934.1| histone H3 isoform 1 [Zea mays]
 gb|AFW71935.1| histone H3 isoform 2 [Zea mays]
 gb|AFW71936.1| histone H3 isoform 3 [Zea mays]
 gb|AFW75390.1| histone H3 [Zea mays]
 gb|AFW86018.1| histone H3 [Zea mays]
 tpg|DAA45651.1| TPA: histone H3 isoform 1 [Zea mays]
 tpg|DAA45652.1| TPA: histone H3 isoform 2 [Zea mays]
 gb|AFZ93649.1| histone H3 [Euphorbia lathyris]
 gb|EMJ08556.1| hypothetical protein PRUPE_ppa013166mg [Prunus persica]
 gb|EMJ25000.1| hypothetical protein PRUPE_ppa013185mg [Prunus persica]
 gb|EMJ27253.1| hypothetical protein PRUPE_ppa013183mg [Prunus persica]
 gb|EOA17620.1| hypothetical protein CARUB_v10005986mg [Capsella rubella]
 gb|EOA17625.1| hypothetical protein CARUB_v10005990mg [Capsella rubella]
 gb|EOA35876.1| hypothetical protein CARUB_v10021126mg [Capsella rubella]
 gb|EOX92023.1| Histone superfamily protein [Theobroma cacao]
 gb|AGN12774.1| histone H3 [Leavenworthia alabamica]
 gb|AGN12775.1| histone H3 [Leavenworthia alabamica]
 gb|AGN12782.1| histone H3 [Leavenworthia alabamica]
 gb|AGN12783.1| histone H3 [Leavenworthia alabamica]
 gb|AGN12800.1| histone H3 [Leavenworthia alabamica]
 gb|AGN12801.1| histone H3 [Leavenworthia alabamica]
 gb|EPS60563.1| hypothetical protein M569_14240 [Genlisea aurea]
 gb|EPS61796.1| hypothetical protein M569_12997 [Genlisea aurea]
 gb|AGS80253.1| histone variant H3.3 [Prunus persica]
 gb|AGS80254.1| histone variant H3.3 [Prunus persica]
 gb|AGT16456.1| histone H3 [Saccharum hybrid cultivar R570]
 gb|AGT17152.1| histone H3 [Saccharum hybrid cultivar R570]
 gb|AGV54183.1| histone H3 [Phaseolus vulgaris]
 gb|AGW30401.1| histone 3 [Oryza sativa]
 gb|ERM95413.1| hypothetical protein AMTR_s00008p00237320 [Amborella trichopoda]
 gb|ERN00651.1| hypothetical protein AMTR_s00225p00023630 [Amborella trichopoda]
 gb|ERN10859.1| hypothetical protein AMTR_s00027p00248560 [Amborella trichopoda]
 gb|ERP58201.1| hypothetical protein POPTR_0007s05050g [Populus trichocarpa]
 gb|ERP60690.1| hypothetical protein POPTR_0005s07340g [Populus trichocarpa]
 gb|ESQ27575.1| hypothetical protein EUTSA_v10019309mg [Eutrema salsugineum]
 gb|ESQ41050.1| hypothetical protein EUTSA_v10014984mg [Eutrema salsugineum]
 gb|ESR39570.1| hypothetical protein CICLE_v10026739mg [Citrus clementina]
 gb|ESR39571.1| hypothetical protein CICLE_v10026739mg [Citrus clementina]
 gb|ESR48364.1| hypothetical protein CICLE_v10002817mg [Citrus clementina]
 gb|ESW32688.1| hypothetical protein PHAVU_001G009100g [Phaseolus vulgaris]
 gb|ESW35661.1| hypothetical protein PHAVU_001G253700g [Phaseolus vulgaris]
 gb|EXC04189.1| Histone [Morus notabilis]
 gb|EYU21874.1| hypothetical protein MIMGU_mgv1a016051mg [Erythranthe guttata]
 gb|EYU30983.1| hypothetical protein MIMGU_mgv1a016034mg [Erythranthe guttata]
 gb|KCW54575.1| hypothetical protein EUGRSUZ_I00535 [Eucalyptus grandis]
 gb|KCW54576.1| hypothetical protein EUGRSUZ_I00535 [Eucalyptus grandis]
 gb|KCW67925.1| hypothetical protein EUGRSUZ_F01627 [Eucalyptus grandis]
 gb|KCW67926.1| hypothetical protein EUGRSUZ_F01627 [Eucalyptus grandis]
 gb|AHZ58484.1| histone H3 [Syntrichia caninervis]
 gb|KDO60693.1| hypothetical protein CISIN_1g032645mg [Citrus sinensis]
 gb|KDO60694.1| hypothetical protein CISIN_1g032645mg [Citrus sinensis]
 gb|KDO60695.1| hypothetical protein CISIN_1g032645mg [Citrus sinensis]
 gb|KDO84768.1| hypothetical protein CISIN_1g032662mg [Citrus sinensis]
 gb|KDP41416.1| hypothetical protein JCGZ_15823 [Jatropha curcas]
 gb|KEH31536.1| core histone H2A/H2B/H3/H4 [Medicago truncatula]
 emb|CDP07429.1| unnamed protein product [Coffea canephora]
 emb|CDP01510.1| unnamed protein product [Coffea canephora]
 emb|CDP01921.1| unnamed protein product [Coffea canephora]
 gb|KFK32443.1| hypothetical protein AALP_AA6G242400 [Arabis alpina]
 gb|KFK41993.1| hypothetical protein AALP_AA2G198300 [Arabis alpina]
 emb|CDY69490.1| BnaCnng63830D [Brassica napus]
 emb|CDY68289.1| BnaAnng26750D [Brassica napus]
 emb|CDY39044.1| BnaA02g17330D [Brassica napus]
 emb|CDY13557.1| BnaC02g23680D [Brassica napus]
 emb|CDX85906.1| BnaC06g22280D [Brassica napus]
 emb|CDX85735.1| BnaA02g00780D [Brassica napus]
 emb|CDX78406.1| BnaA03g03180D [Brassica napus]
 emb|CDX70375.1| BnaC03g04590D [Brassica napus]
 emb|CDX69362.1| BnaC01g00910D [Brassica napus]
 emb|CDX68121.1| BnaA07g21610D [Brassica napus]
 gb|KGN62710.1| hypothetical protein Csa_2G369110 [Cucumis sativus]
 gb|KHG29682.1| Histone H3.3 [Gossypium arboreum]
 gb|KHL91128.1| hypothetical protein QW71_36435 [Paenibacillus sp. IHB B 3415]
 gb|KHN12662.1| Histone H3.3 [Glycine soja]
 gb|KHN31393.1| Histone H3.3 [Glycine soja]
 gb|KHN44355.1| Histone H3.3 [Glycine soja]
 gb|KHN44356.1| Histone H3.3 [Glycine soja]
 gb|KJB17321.1| hypothetical protein B456_003G041300 [Gossypium raimondii]
 gb|KJB17322.1| hypothetical protein B456_003G041300 [Gossypium raimondii]
 gb|KJB17323.1| hypothetical protein B456_003G041300 [Gossypium raimondii]
 gb|KJB17324.1| hypothetical protein B456_003G041300 [Gossypium raimondii]
 gb|KJB17325.1| hypothetical protein B456_003G041300 [Gossypium raimondii]
 gb|KJB17326.1| hypothetical protein B456_003G041300 [Gossypium raimondii]
 gb|KJB17328.1| hypothetical protein B456_003G041300 [Gossypium raimondii]
 gb|KJB27557.1| hypothetical protein B456_005G111200 [Gossypium raimondii]
 gb|KJB27558.1| hypothetical protein B456_005G111200 [Gossypium raimondii]
 gb|KJB27559.1| hypothetical protein B456_005G111200 [Gossypium raimondii]
 gb|KJB58990.1| hypothetical protein B456_009G234200 [Gossypium raimondii]
Length=136

 Score =   162 bits (410),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   114 bits (286),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>gb|AIY27744.1| histone H3 protein [Betula luminifera]
Length=136

 Score =   162 bits (410),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   113 bits (283),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTAR+STGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQ++  
Sbjct  1    MARTKQTARRSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>ref|XP_010466628.1| PREDICTED: histone H3.3-like [Camelina sativa]
Length=136

 Score =   162 bits (410),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   111 bits (277),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKS GGKAPRKQLATKAARKSAPT+GGVKKPHRYRPGTVALREIRKYQ++  
Sbjct  1    MARTKQTARKSHGGKAPRKQLATKAARKSAPTSGGVKKPHRYRPGTVALREIRKYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>gb|KDO60696.1| hypothetical protein CISIN_1g032645mg [Citrus sinensis]
Length=132

 Score =   162 bits (410),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  53   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  112

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  113  RVTIMPKDIQLARRIRGERA  132


 Score =   103 bits (256),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 58/71 (82%), Gaps = 4/71 (6%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATK    SAPTTGGVKKPHRYRPGTVALREIRKYQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATK----SAPTTGGVKKPHRYRPGTVALREIRKYQKSTE  56

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  57   LLIRKLPFQRL  67



>gb|AFW86017.1| histone H3 [Zea mays]
Length=227

 Score =   165 bits (418),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  148  KSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  207

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  208  RVTIMPKDIQLARRIRGERA  227


 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/73 (82%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = -2

Query  595  EDMARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRA  416
            E MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQ++
Sbjct  90   EKMARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKS  149

Query  415  LSSLSASFPSRGL  377
               L    P + L
Sbjct  150  TELLIRKLPFQRL  162



>ref|XP_010471674.1| PREDICTED: histone H3.3-like [Camelina sativa]
Length=136

 Score =   162 bits (410),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   112 bits (280),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKS GGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQ++  
Sbjct  1    MARTKQTARKSHGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>gb|EYU30980.1| hypothetical protein MIMGU_mgv1a014700mg [Erythranthe guttata]
Length=181

 Score =   164 bits (414),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  102  KSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  161

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  162  RVTIMPKDIQLARRIRGERA  181


 Score =   115 bits (288),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -2

Query  598  SEDMARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQR  419
            S  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQ+
Sbjct  43   SSKMARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQK  102

Query  418  ALSSLSASFP  389
            +   L    P
Sbjct  103  STELLIRKLP  112



>ref|XP_010447175.1| PREDICTED: histone H3.3-like [Camelina sativa]
Length=136

 Score =   162 bits (410),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 81/83 (98%), Gaps = 0/83 (0%)
 Frame = -1

Query  431  QVSESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI  252
            +  +STELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI
Sbjct  54   KYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI  113

Query  251  HAKRVTIMPKDIQLARRIRGERA  183
            HAKRVTIMPKDIQLARRIRGERA
Sbjct  114  HAKRVTIMPKDIQLARRIRGERA  136


 Score =   110 bits (276),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKS GGKAPRKQLATKAARKSAPT GGVKKPHRYRPGTVALREIRKYQ++  
Sbjct  1    MARTKQTARKSHGGKAPRKQLATKAARKSAPTNGGVKKPHRYRPGTVALREIRKYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>gb|AAB36495.1| histone H3.2 [Medicago sativa]
Length=127

 Score =   162 bits (409),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  48   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  107

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  108  RVTIMPKDIQLARRIRGERA  127


 Score = 98.2 bits (243),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -2

Query  562  KSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALSSLSASFPSR  383
            KSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQ++   L    P +
Sbjct  1    KSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQ  60

Query  382  GL  377
             L
Sbjct  61   RL  62



>sp|P06353.1|H33_HORVU RecName: Full=Histone H3.3, partial [Hordeum vulgare]
 gb|AAA32965.1| histone H3 protein, partial [Hordeum vulgare]
 prf||1301219A histone H3
Length=80

 Score =   160 bits (405),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  1    KSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  60

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  61   RVTIMPKDIQLARRIRGERA  80



>emb|CBI23573.3| unnamed protein product [Vitis vinifera]
Length=147

 Score =   162 bits (411),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 81/83 (98%), Gaps = 0/83 (0%)
 Frame = -1

Query  431  QVSESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI  252
            +  +STELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI
Sbjct  65   KYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI  124

Query  251  HAKRVTIMPKDIQLARRIRGERA  183
            HAKRVTIMPKDIQLARRIRGERA
Sbjct  125  HAKRVTIMPKDIQLARRIRGERA  147


 Score =   114 bits (286),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQ++  
Sbjct  12   MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTE  71

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  72   LLIRKLPFQRL  82



>gb|EMT02210.1| Histone H3.3 [Aegilops tauschii]
Length=150

 Score =   162 bits (411),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  71   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  130

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  131  RVTIMPKDIQLARRIRGERA  150


 Score =   114 bits (284),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQ++  
Sbjct  15   MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTE  74

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  75   LLIRKLPFQRL  85



>emb|CDY68223.1| BnaCnng58100D [Brassica napus]
Length=131

 Score =   162 bits (409),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 81/83 (98%), Gaps = 0/83 (0%)
 Frame = -1

Query  431  QVSESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI  252
            +  +STELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI
Sbjct  49   KYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI  108

Query  251  HAKRVTIMPKDIQLARRIRGERA  183
            HAKRVTIMPKDIQLARRIRGERA
Sbjct  109  HAKRVTIMPKDIQLARRIRGERA  131


 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 55/71 (77%), Gaps = 5/71 (7%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKST GKAPRKQLATKAARK APTTGGVKKPHRYRPGT     IRKYQ++  
Sbjct  1    MARTKQTARKSTRGKAPRKQLATKAARKCAPTTGGVKKPHRYRPGT-----IRKYQKSTE  55

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  56   LLIRKLPFQRL  66



>gb|KFK25377.1| hypothetical protein AALP_AA8G105500 [Arabis alpina]
Length=136

 Score =   162 bits (409),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKD+QLARRIRGERA
Sbjct  117  RVTIMPKDVQLARRIRGERA  136


 Score =   112 bits (280),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHR++PGTVALREIRKYQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRFKPGTVALREIRKYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>emb|CAA31967.1| histone H3 (AA 1-120) [Medicago sativa]
Length=119

 Score =   161 bits (407),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 81/83 (98%), Gaps = 0/83 (0%)
 Frame = -1

Query  431  QVSESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI  252
            +  +STELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI
Sbjct  37   KYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI  96

Query  251  HAKRVTIMPKDIQLARRIRGERA  183
            HAKRVTIMPKDIQLARRIRGERA
Sbjct  97   HAKRVTIMPKDIQLARRIRGERA  119


 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = -2

Query  538  RKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALSSLSASFPSRGL  377
            RKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQ++   L    P + L
Sbjct  1    RKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL  54



>ref|XP_003596591.1| Histone H3 [Medicago truncatula]
 gb|AES66842.1| core histone H2A/H2B/H3/H4 [Medicago truncatula]
Length=146

 Score =   162 bits (410),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 81/83 (98%), Gaps = 0/83 (0%)
 Frame = -1

Query  431  QVSESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI  252
            +  +STELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI
Sbjct  64   KYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI  123

Query  251  HAKRVTIMPKDIQLARRIRGERA  183
            HAKRVTIMPKDIQLARRIRGERA
Sbjct  124  HAKRVTIMPKDIQLARRIRGERA  146


 Score = 84.3 bits (207),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 54/81 (67%), Gaps = 10/81 (12%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGG----------VKKPHRYRPGTVALR  440
            MARTKQTARKSTGGKAPRK+LATK AR      GG          VKKPHR+R GTVALR
Sbjct  1    MARTKQTARKSTGGKAPRKELATKVARAPRAKGGGKSMRKMREGHVKKPHRFRCGTVALR  60

Query  439  EIRKYQRALSSLSASFPSRGL  377
            EIRKYQ++   L    P + L
Sbjct  61   EIRKYQKSTELLIRKLPFQRL  81



>gb|AAB36496.1| histone H3.2 precursor [Medicago sativa]
Length=124

 Score =   161 bits (408),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 81/83 (98%), Gaps = 0/83 (0%)
 Frame = -1

Query  431  QVSESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI  252
            +  +STELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI
Sbjct  42   KYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI  101

Query  251  HAKRVTIMPKDIQLARRIRGERA  183
            HAKRVTIMPKDIQLARRIRGERA
Sbjct  102  HAKRVTIMPKDIQLARRIRGERA  124


 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = -2

Query  553  GGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALSSLSASFPSRGL  377
            GGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQ++   L    P + L
Sbjct  1    GGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL  59



>gb|KHG25391.1| Histone H3.3 [Gossypium arboreum]
Length=116

 Score =   161 bits (407),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  37   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  96

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  97   RVTIMPKDIQLARRIRGERA  116


 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -2

Query  529  LATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALSSLSASFPSRGL  377
            +   AARKSAPTTGGVKKPHRYRPGTVALREIRKYQ++   L    P + L
Sbjct  1    MIISAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL  51



>ref|XP_010428586.1| PREDICTED: histone H3.3-like [Camelina sativa]
Length=136

 Score =   162 bits (409),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKD+QLARRIRGERA
Sbjct  117  RVTIMPKDVQLARRIRGERA  136


 Score =   111 bits (277),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKS GGKAPRKQLATKAARKSAPT+GGVKKPHRYRPGTVALREIRKYQ++  
Sbjct  1    MARTKQTARKSHGGKAPRKQLATKAARKSAPTSGGVKKPHRYRPGTVALREIRKYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>ref|XP_002883719.1| hypothetical protein ARALYDRAFT_480202 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59978.1| hypothetical protein ARALYDRAFT_480202 [Arabidopsis lyrata subsp. 
lyrata]
Length=136

 Score =   162 bits (409),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKD+QLARRIRGERA
Sbjct  117  RVTIMPKDVQLARRIRGERA  136


 Score =   108 bits (269),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKS GGKAPRK LATKAARKSAP+TGGVKKPHRYRPGTVALREIRKYQ++  
Sbjct  1    MARTKQTARKSHGGKAPRKLLATKAARKSAPSTGGVKKPHRYRPGTVALREIRKYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>dbj|BAN42603.1| putative histone H3, partial [Pyrus pyrifolia var. culta]
 dbj|BAN42604.1| putative histone H3, partial [Pyrus pyrifolia var. culta]
Length=86

 Score =   160 bits (404),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 81/83 (98%), Gaps = 0/83 (0%)
 Frame = -1

Query  431  QVSESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI  252
            +  +STELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI
Sbjct  4    KYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI  63

Query  251  HAKRVTIMPKDIQLARRIRGERA  183
            HAKRVTIMPKDIQLARRIRGERA
Sbjct  64   HAKRVTIMPKDIQLARRIRGERA  86



>tpg|DAA45653.1| TPA: hypothetical protein ZEAMMB73_730567 [Zea mays]
 gb|KHG30283.1| Histone H3.3 [Gossypium arboreum]
Length=113

 Score =   161 bits (407),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 81/83 (98%), Gaps = 0/83 (0%)
 Frame = -1

Query  431  QVSESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI  252
            +  +STELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI
Sbjct  31   KYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI  90

Query  251  HAKRVTIMPKDIQLARRIRGERA  183
            HAKRVTIMPKDIQLARRIRGERA
Sbjct  91   HAKRVTIMPKDIQLARRIRGERA  113


 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -2

Query  517  AARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALSSLSASFPSRGL  377
            AARKSAPTTGGVKKPHRYRPGTVALREIRKYQ++   L    P + L
Sbjct  2    AARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL  48



>gb|KDP46711.1| hypothetical protein JCGZ_06499 [Jatropha curcas]
Length=131

 Score =   161 bits (408),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  52   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  111

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  112  RVTIMPKDIQLARRIRGERA  131


 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -2

Query  517  AARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALSSLSASFPSRGL  377
            AARKSAPTTGGVKKPHRYRPGTVALREIRKYQ++   L    P + L
Sbjct  20   AARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL  66



>gb|EAW79707.1| hCG1639761, partial [Homo sapiens]
Length=122

 Score =   135 bits (341),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            ++TELLIRKL FQRLV+EIAQD KTDLRFQS A+ ALQEA+EAYLVGLFED+NLCAIHAK
Sbjct  43   KATELLIRKLRFQRLVQEIAQDLKTDLRFQSAAIGALQEASEAYLVGLFEDSNLCAIHAK  102

Query  242  RVTIMPKDIQLARRIRGERA  183
            R+TIMPK+IQLARRI+G+RA
Sbjct  103  RLTIMPKEIQLARRIQGKRA  122


 Score = 77.4 bits (189),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = -2

Query  547  KAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALSSL  404
            KA RKQL TKAA KSAP+TGGVKKPH YRPGTVALREIR+YQ+A   L
Sbjct  1    KAARKQLGTKAAHKSAPSTGGVKKPHHYRPGTVALREIRRYQKATELL  48



>ref|XP_002985522.1| hypothetical protein SELMODRAFT_269004 [Selaginella moellendorffii]
 ref|XP_002987048.1| hypothetical protein SELMODRAFT_229248 [Selaginella moellendorffii]
 ref|XP_007018714.1| Histone superfamily protein [Theobroma cacao]
 gb|EFJ11891.1| hypothetical protein SELMODRAFT_229248 [Selaginella moellendorffii]
 gb|EFJ13396.1| hypothetical protein SELMODRAFT_269004 [Selaginella moellendorffii]
 gb|EOY15939.1| Histone superfamily protein [Theobroma cacao]
Length=136

 Score =   161 bits (408),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQD+KTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDYKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   114 bits (286),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>gb|AAD23951.1|AF093108_1 histone H3 [Syntrichia ruralis]
Length=117

 Score =   161 bits (407),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 81/83 (98%), Gaps = 0/83 (0%)
 Frame = -1

Query  431  QVSESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI  252
            +  +STELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI
Sbjct  35   KYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI  94

Query  251  HAKRVTIMPKDIQLARRIRGERA  183
            HAKRVTIMPKDIQLARRIRGERA
Sbjct  95   HAKRVTIMPKDIQLARRIRGERA  117


 Score = 76.3 bits (186),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -2

Query  526  ATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALSSLSASFPSRGL  377
            ATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQ++   L    P + L
Sbjct  3    ATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL  52



>ref|XP_002872367.1| histone H3.2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48626.1| histone H3.2 [Arabidopsis lyrata subsp. lyrata]
Length=136

 Score =   161 bits (408),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKD+QLARRIRGERA
Sbjct  117  RVTIMPKDVQLARRIRGERA  136


 Score =   112 bits (280),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKS GGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQ++  
Sbjct  1    MARTKQTARKSHGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>ref|XP_006288773.1| hypothetical protein CARUB_v10002094mg, partial [Capsella rubella]
 gb|EOA21671.1| hypothetical protein CARUB_v10002094mg, partial [Capsella rubella]
Length=175

 Score =   163 bits (412),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  96   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  155

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  156  RVTIMPKDIQLARRIRGERA  175


 Score =   115 bits (287),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQ++  
Sbjct  40   MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTE  99

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  100  LLIRKLPFQRL  110



>ref|XP_009556897.1| PREDICTED: histone H3-like [Cuculus canorus]
Length=113

 Score =   130 bits (326),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 62/70 (89%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = -1

Query  392  PFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQ  213
            P     REIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAKRVTIMPKDIQ
Sbjct  44   PXXXXXREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQ  103

Query  212  LARRIRGERA  183
            LARRIRGERA
Sbjct  104  LARRIRGERA  113


 Score = 83.2 bits (204),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 44/52 (85%), Positives = 44/52 (85%), Gaps = 0/52 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREI  434
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKP RY P     REI
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPKRYPPXXXXXREI  52



>gb|AAZ04893.1| histone H3, partial [Secutor sp. Philippines]
Length=110

 Score =   116 bits (290),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 56/61 (92%), Positives = 59/61 (97%), Gaps = 0/61 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKL FQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  50   KSTELLIRKLAFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  109

Query  242  R  240
            R
Sbjct  110  R  110


 Score = 97.1 bits (240),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = -2

Query  568  ARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALSSL  404
            ARKSTGGKAPRKQLATKAARKSAP TGGVKKPHRYRPGTVALREIR+YQ++   L
Sbjct  1    ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELL  55



>ref|XP_010456479.1| PREDICTED: histone H3.3, partial [Camelina sativa]
Length=114

 Score =   160 bits (406),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  35   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  94

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  95   RVTIMPKDIQLARRIRGERA  114


 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -2

Query  523  TKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALSSLSASFPSRGL  377
             +AARKSAPTTGGVKKPHRYRPGTVALREIRKYQ++   L    P + L
Sbjct  1    IQAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL  49



>ref|XP_010106281.1| Histone [Morus notabilis]
 gb|EXC09698.1| Histone [Morus notabilis]
Length=159

 Score =   162 bits (410),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 81/83 (98%), Gaps = 0/83 (0%)
 Frame = -1

Query  431  QVSESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI  252
            +  +STELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI
Sbjct  77   KYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI  136

Query  251  HAKRVTIMPKDIQLARRIRGERA  183
            HAKRVTIMPKDIQLARRIRGERA
Sbjct  137  HAKRVTIMPKDIQLARRIRGERA  159


 Score =   114 bits (286),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQ++  
Sbjct  24   MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTE  83

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  84   LLIRKLPFQRL  94



>gb|EMS66058.1| Histone H3.3 [Triticum urartu]
Length=94

 Score =   160 bits (404),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 81/83 (98%), Gaps = 0/83 (0%)
 Frame = -1

Query  431  QVSESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI  252
            +  +STELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI
Sbjct  12   KYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI  71

Query  251  HAKRVTIMPKDIQLARRIRGERA  183
            HAKRVTIMPKDIQLARRIRGERA
Sbjct  72   HAKRVTIMPKDIQLARRIRGERA  94



>ref|XP_002452319.1| hypothetical protein SORBIDRAFT_04g023645 [Sorghum bicolor]
 dbj|BAF76882.1| histone H3.2 [Nicotiana tabacum]
 gb|EES05295.1| hypothetical protein SORBIDRAFT_04g023645 [Sorghum bicolor]
Length=112

 Score =   160 bits (406),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 81/83 (98%), Gaps = 0/83 (0%)
 Frame = -1

Query  431  QVSESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI  252
            +  +STELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI
Sbjct  30   KYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI  89

Query  251  HAKRVTIMPKDIQLARRIRGERA  183
            HAKRVTIMPKDIQLARRIRGERA
Sbjct  90   HAKRVTIMPKDIQLARRIRGERA  112


 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -2

Query  517  AARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALSSLSASFPSRGL  377
            AARKSAPTTGGVKKPHRYRPGTVALREIRKYQ++   L    P + L
Sbjct  1    AARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL  47



>ref|XP_001786509.1| histone H3 [Physcomitrella patens]
 gb|EDQ48679.1| histone H3 [Physcomitrella patens]
Length=96

 Score =   160 bits (405),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 81/83 (98%), Gaps = 0/83 (0%)
 Frame = -1

Query  431  QVSESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI  252
            +  +STELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI
Sbjct  14   KYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI  73

Query  251  HAKRVTIMPKDIQLARRIRGERA  183
            HAKRVTIMPKDIQLARRIRGERA
Sbjct  74   HAKRVTIMPKDIQLARRIRGERA  96



>gb|AFW71933.1| histone H3, partial [Zea mays]
Length=171

 Score =   162 bits (411),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   114 bits (286),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>gb|KDP36960.1| hypothetical protein JCGZ_08251 [Jatropha curcas]
Length=118

 Score =   160 bits (406),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 81/83 (98%), Gaps = 0/83 (0%)
 Frame = -1

Query  431  QVSESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI  252
            +  +STELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI
Sbjct  36   KYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI  95

Query  251  HAKRVTIMPKDIQLARRIRGERA  183
            HAKRVTIMPKDIQLARRIRGERA
Sbjct  96   HAKRVTIMPKDIQLARRIRGERA  118


 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -2

Query  520  KAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALSSLSASFPSRGL  377
            +AARKSAPTTGGVKKPHRYRPGTVALREIRKYQ++   L    P + L
Sbjct  6    RAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL  53



>ref|XP_006411806.1| hypothetical protein EUTSA_v10026962mg [Eutrema salsugineum]
 gb|ESQ53259.1| hypothetical protein EUTSA_v10026962mg [Eutrema salsugineum]
Length=125

 Score =   161 bits (407),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 81/83 (98%), Gaps = 0/83 (0%)
 Frame = -1

Query  431  QVSESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI  252
            +  +STELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI
Sbjct  43   KYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI  102

Query  251  HAKRVTIMPKDIQLARRIRGERA  183
            HAKRVTIMPKDIQLARRIRGERA
Sbjct  103  HAKRVTIMPKDIQLARRIRGERA  125


 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = -2

Query  529  LATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALSSLSASFPSRGL  377
            + T+AARKSAPTTGGVKKPHRYRPGTVALREIRKYQ++   L    P + L
Sbjct  10   IQTQAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL  60



>gb|AFW86019.1| hypothetical protein ZEAMMB73_433257, partial [Zea mays]
Length=125

 Score =   161 bits (407),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  46   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  105

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  106  RVTIMPKDIQLARRIRGERA  125


 Score = 72.8 bits (177),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = -2

Query  553  GGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALSSLSASFPSRGL  377
            G  A    +  +AARKSAPTTGGVKKPHRYRPGTVALREIRKYQ++   L    P + L
Sbjct  2    GADAAAVVVLLQAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL  60



>gb|KGN53214.1| hypothetical protein Csa_4G026900 [Cucumis sativus]
Length=119

 Score =   160 bits (406),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 81/83 (98%), Gaps = 0/83 (0%)
 Frame = -1

Query  431  QVSESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI  252
            +  +STELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI
Sbjct  37   KYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI  96

Query  251  HAKRVTIMPKDIQLARRIRGERA  183
            HAKRVTIMPKDIQLARRIRGERA
Sbjct  97   HAKRVTIMPKDIQLARRIRGERA  119


 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -2

Query  517  AARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALSSLSASFPSRGL  377
            AARKSAPTTGGVKKPHRYRPGTVALREIRKYQ++   L    P + L
Sbjct  8    AARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL  54



>ref|NP_001078516.1| Histone H3.3 [Arabidopsis thaliana]
 gb|AEE87156.1| Histone H3.3 [Arabidopsis thaliana]
Length=164

 Score =   162 bits (410),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  85   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  144

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  145  RVTIMPKDIQLARRIRGERA  164


 Score =   115 bits (287),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQ++  
Sbjct  29   MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTE  88

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  89   LLIRKLPFQRL  99



>gb|AES90732.2| core histone H2A/H2B/H3/H4 [Medicago truncatula]
Length=177

 Score =   162 bits (411),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 81/83 (98%), Gaps = 0/83 (0%)
 Frame = -1

Query  431  QVSESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI  252
            +  +STELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI
Sbjct  95   KYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI  154

Query  251  HAKRVTIMPKDIQLARRIRGERA  183
            HAKRVTIMPKDIQLARRIRGERA
Sbjct  155  HAKRVTIMPKDIQLARRIRGERA  177


 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRK LATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQ++  
Sbjct  42   MARTKQTARKSTGGKAPRKPLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTE  101

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  102  LLIRKLPFQRL  112



>gb|AFW75389.1| hypothetical protein ZEAMMB73_083576, partial [Zea mays]
Length=122

 Score =   160 bits (406),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  43   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  102

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  103  RVTIMPKDIQLARRIRGERA  122


 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = -2

Query  547  KAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALSSLSASFPSRGL  377
             AP   L  +AARKSAPTTGGVKKPHRYRPGTVALREIRKYQ++   L    P + L
Sbjct  1    DAPAVVLWLQAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL  57



>gb|EMS58296.1| Histone H3.3 [Triticum urartu]
Length=124

 Score =   160 bits (406),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  45   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  104

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  105  RVTIMPKDIQLARRIRGERA  124



>ref|XP_006425525.1| hypothetical protein CICLE_v10026741mg [Citrus clementina]
 ref|XP_006466922.1| PREDICTED: histone H3.3-like [Citrus sinensis]
 ref|XP_007046734.1| Histone superfamily protein [Theobroma cacao]
 gb|EOX90891.1| Histone superfamily protein [Theobroma cacao]
 gb|ESR38765.1| hypothetical protein CICLE_v10026741mg [Citrus clementina]
 gb|KDO71133.1| hypothetical protein CISIN_1g032654mg [Citrus sinensis]
 gb|KDO71134.1| hypothetical protein CISIN_1g032654mg [Citrus sinensis]
Length=136

 Score =   161 bits (407),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHA+
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAR  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   114 bits (286),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>emb|CAC27454.1| histone H3 [Beta vulgaris subsp. vulgaris]
Length=98

 Score =   160 bits (404),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 81/83 (98%), Gaps = 0/83 (0%)
 Frame = -1

Query  431  QVSESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI  252
            +  +STELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI
Sbjct  16   KYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI  75

Query  251  HAKRVTIMPKDIQLARRIRGERA  183
            HAKRVTIMPKDIQLARRIRGERA
Sbjct  76   HAKRVTIMPKDIQLARRIRGERA  98



>ref|XP_006851804.1| hypothetical protein AMTR_s00041p00020660 [Amborella trichopoda]
 gb|ERN13271.1| hypothetical protein AMTR_s00041p00020660 [Amborella trichopoda]
Length=136

 Score =   161 bits (407),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKD+QLARRIRGERA
Sbjct  117  RVTIMPKDMQLARRIRGERA  136


 Score =   113 bits (283),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHR+RPGTVALREIRKYQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRFRPGTVALREIRKYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>gb|AAL78367.1|AF467728_1 disease-resistent-related protein [Oryza sativa]
Length=136

 Score =   161 bits (407),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDI+LARRIRGERA
Sbjct  117  RVTIMPKDIKLARRIRGERA  136


 Score =   114 bits (286),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>ref|XP_008803321.1| PREDICTED: histone H3.3-like [Phoenix dactylifera]
Length=136

 Score =   161 bits (407),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +ST+LLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTDLLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   114 bits (284),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLAT+AARKSAPTTGGVKKPHRYRPGTVALREIRKYQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATQAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTD  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>tpg|DAA45649.1| TPA: histone H3 [Zea mays]
Length=165

 Score =   162 bits (409),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  86   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  145

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  146  RVTIMPKDIQLARRIRGERA  165


 Score =   114 bits (286),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQ++  
Sbjct  30   MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTE  89

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  90   LLIRKLPFQRL  100



>ref|XP_004623761.1| PREDICTED: meprin A subunit beta [Octodon degus]
Length=908

 Score =   107 bits (267),  Expect(2) = 4e-46, Method: Composition-based stats.
 Identities = 52/62 (84%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTA KSTGGKAPRKQLATKA RKSAP+TGGVKKPHRYRPG VALREIR+YQ++  
Sbjct  1    MARTKQTAGKSTGGKAPRKQLATKAPRKSAPSTGGVKKPHRYRPGIVALREIRRYQKSTE  60

Query  409  SL  404
             L
Sbjct  61   LL  62


 Score =   104 bits (260),  Expect(2) = 4e-46, Method: Composition-based stats.
 Identities = 51/63 (81%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLI KL FQ LV+EIAQDFKTDLRFQS A+ A+QEA EAYLVGLFEDTN+CAIHAK
Sbjct  57   KSTELLIHKLLFQCLVQEIAQDFKTDLRFQSAAISAVQEAGEAYLVGLFEDTNVCAIHAK  116

Query  242  RVT  234
            R T
Sbjct  117  RPT  119



>gb|ACG48841.1| histone H3 [Zea mays]
Length=136

 Score =   161 bits (407),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            ++TELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  57   KNTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   114 bits (285),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQ+   
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKNTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>ref|NP_001281232.1| 60S ribosomal protein L32 [Zea mays]
 gb|ACG27450.1| histone H3 [Zea mays]
 gb|ACG31205.1| histone H3 [Zea mays]
 gb|AFK42091.1| unknown [Medicago truncatula]
 tpg|DAA37541.1| TPA: histone H3 isoform 1 [Zea mays]
 tpg|DAA37542.1| TPA: histone H3 isoform 2 [Zea mays]
 gb|KEH21219.1| core histone H2A/H2B/H3/H4 [Medicago truncatula]
Length=136

 Score =   161 bits (407),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +ST+LLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTDLLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   115 bits (287),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTD  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>ref|NP_177690.1| histone H3-like 3 [Arabidopsis thaliana]
 sp|Q9LR02.3|H3L3_ARATH RecName: Full=Histone H3-like 3 [Arabidopsis thaliana]
 gb|AEE35737.1| histone H3-like 3 [Arabidopsis thaliana]
Length=136

 Score =   160 bits (406),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQD+KTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDYKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKD+QLARRIRGERA
Sbjct  117  RVTIMPKDVQLARRIRGERA  136


 Score =   107 bits (266),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKS GGKAPR  LATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQ++  
Sbjct  1    MARTKQTARKSHGGKAPRTLLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>gb|EMS58978.1| Histone H3.3 [Triticum urartu]
 gb|EMT03998.1| Histone H3.3 [Aegilops tauschii]
 gb|EMT03999.1| Histone H3.3 [Aegilops tauschii]
Length=137

 Score =   160 bits (406),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +ST+LLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  58   KSTDLLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  117

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  118  RVTIMPKDIQLARRIRGERA  137


 Score =   108 bits (269),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 58/72 (81%), Positives = 61/72 (85%), Gaps = 1/72 (1%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATK-AARKSAPTTGGVKKPHRYRPGTVALREIRKYQRAL  413
            MARTKQTARKSTGGKAPRKQLAT  AARKSAPTTGGVKKPHRYRPGTVALREIRKYQ++ 
Sbjct  1    MARTKQTARKSTGGKAPRKQLATTIAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKST  60

Query  412  SSLSASFPSRGL  377
              L    P + L
Sbjct  61   DLLIRKLPFQRL  72



>ref|XP_003057560.1| histone H3 [Micromonas pusilla CCMP1545]
 gb|EEH57511.1| histone H3 [Micromonas pusilla CCMP1545]
Length=136

 Score =   160 bits (406),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQSHA+LALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAILALQEASEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   114 bits (286),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>gb|KJB17320.1| hypothetical protein B456_003G041300 [Gossypium raimondii]
Length=153

 Score =   161 bits (407),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 81/83 (98%), Gaps = 0/83 (0%)
 Frame = -1

Query  431  QVSESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI  252
            +  +STELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI
Sbjct  71   KYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI  130

Query  251  HAKRVTIMPKDIQLARRIRGERA  183
            HAKRVTIMPKDIQLARRIRGERA
Sbjct  131  HAKRVTIMPKDIQLARRIRGERA  153


 Score =   116 bits (291),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = -2

Query  592  DMARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRAL  413
            +MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQ++ 
Sbjct  17   EMARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKST  76

Query  412  SSLSASFPSRGL  377
              L    P + L
Sbjct  77   ELLIRKLPFQRL  88



>ref|XP_010488359.1| PREDICTED: histone H3.3-like [Camelina sativa]
Length=136

 Score =   160 bits (405),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVT MPKDIQLARRIRGERA
Sbjct  117  RVTTMPKDIQLARRIRGERA  136


 Score =   112 bits (280),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKS GGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQ++  
Sbjct  1    MARTKQTARKSHGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>ref|XP_010916709.1| PREDICTED: histone H3.3-like [Elaeis guineensis]
Length=136

 Score =   160 bits (405),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREI+QD+KTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREISQDYKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   113 bits (283),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHR+RPGTVALREIRKYQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRFRPGTVALREIRKYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>ref|XP_010919158.1| PREDICTED: histone H3.3-like [Elaeis guineensis]
Length=136

 Score =   160 bits (405),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAE YLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEVYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   113 bits (283),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHR+RPGTVALREIRKYQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRFRPGTVALREIRKYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>gb|AAX92698.1| histone 3 [Picea abies]
Length=136

 Score =   160 bits (405),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKD QLARRIRGERA
Sbjct  117  RVTIMPKDXQLARRIRGERA  136


 Score =   114 bits (286),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>gb|EMS66053.1| Histone H3.3 [Triticum urartu]
Length=114

 Score =   159 bits (402),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEA EAYLVGLFEDTNLCAIHAK
Sbjct  35   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAVEAYLVGLFEDTNLCAIHAK  94

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  95   RVTIMPKDIQLARRIRGERA  114


 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = -2

Query  520  KAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALSSLSASFPSRGL  377
            +AARKSAPTTGGVKKPHRYRP TVALREIRKYQ++   L    P + L
Sbjct  2    QAARKSAPTTGGVKKPHRYRPRTVALREIRKYQKSTELLIRKLPFQRL  49



>ref|XP_007513760.1| histone H3 [Bathycoccus prasinos]
 emb|CCO16285.1| histone H3 [Bathycoccus prasinos]
Length=136

 Score =   160 bits (404),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEA+EAYL GLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEASEAYLTGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   114 bits (286),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>gb|EMS65981.1| Histone H3.3 [Triticum urartu]
Length=141

 Score =   160 bits (404),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLP QRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  62   KSTELLIRKLPLQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  121

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  122  RVTIMPKDIQLARRIRGERA  141


 Score = 71.6 bits (174),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -2

Query  517  AARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALSSLSASFPSRGL  377
            AARKSAPTTGGVKKPHRYRPGTVALREIRKYQ++   L    P + L
Sbjct  30   AARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPLQRL  76



>gb|ACG25088.1| histone H3 [Zea mays]
Length=161

 Score =   160 bits (406),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/83 (94%), Positives = 81/83 (98%), Gaps = 0/83 (0%)
 Frame = -1

Query  431  QVSESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI  252
            +  +ST+LLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI
Sbjct  54   KYQKSTDLLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI  113

Query  251  HAKRVTIMPKDIQLARRIRGERA  183
            HAKRVTIMPKDIQLARRIRGERA
Sbjct  114  HAKRVTIMPKDIQLARRIRGERA  136


 Score =   115 bits (288),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTD  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>gb|KHG25392.1| Histone H3.3 [Gossypium arboreum]
Length=156

 Score =   160 bits (405),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 81/83 (98%), Gaps = 0/83 (0%)
 Frame = -1

Query  431  QVSESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI  252
            +  +STELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI
Sbjct  74   KYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI  133

Query  251  HAKRVTIMPKDIQLARRIRGERA  183
            HAKRVTIMPKDIQLARRIRGERA
Sbjct  134  HAKRVTIMPKDIQLARRIRGERA  156


 Score = 71.6 bits (174),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -2

Query  517  AARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALSSLSASFPSRGL  377
            AARKSAPTTGGVKKPHRYRPGTVALREIRKYQ++   L    P + L
Sbjct  45   AARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL  91



>ref|XP_007163668.1| hypothetical protein PHAVU_001G253800g [Phaseolus vulgaris]
 gb|ESW35662.1| hypothetical protein PHAVU_001G253800g [Phaseolus vulgaris]
Length=202

 Score =   162 bits (409),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 81/83 (98%), Gaps = 0/83 (0%)
 Frame = -1

Query  431  QVSESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI  252
            +  +STELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI
Sbjct  120  KYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI  179

Query  251  HAKRVTIMPKDIQLARRIRGERA  183
            HAKRVTIMPKDIQLARRIRGERA
Sbjct  180  HAKRVTIMPKDIQLARRIRGERA  202


 Score =   118 bits (295),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 60/73 (82%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = -2

Query  595  EDMARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRA  416
            E MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQ++
Sbjct  65   EQMARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKS  124

Query  415  LSSLSASFPSRGL  377
               L    P + L
Sbjct  125  TELLIRKLPFQRL  137



>sp|Q2Z2F4.3|H33B_LILLO RecName: Full=Histone H3.3b; AltName: Full=Histone soH3-1; AltName: 
Full=Somatic-like histone H3-1 [Lilium longiflorum]
 dbj|BAE48433.1| histone soH3-1 [Lilium longiflorum]
Length=137

 Score =   159 bits (403),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQD+KTDLRFQSHAVLALQE AEAYLVG+FEDTNLCAIHAK
Sbjct  58   KSTELLIRKLPFQRLVREIAQDYKTDLRFQSHAVLALQEGAEAYLVGIFEDTNLCAIHAK  117

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  118  RVTIMPKDIQLARRIRGERA  137


 Score =   100 bits (248),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 59/72 (82%), Gaps = 1/72 (1%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPT-TGGVKKPHRYRPGTVALREIRKYQRAL  413
            MARTKQTARKSTGGKAPRKQLATKAARKS PT  GG+K+P RYRPGTVALREIRKYQ++ 
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSIPTGMGGMKRPRRYRPGTVALREIRKYQKST  60

Query  412  SSLSASFPSRGL  377
              L    P + L
Sbjct  61   ELLIRKLPFQRL  72



>dbj|BAE48434.1| histone soH3-1 [Lilium longiflorum]
Length=135

 Score =   159 bits (403),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQD+KTDLRFQSHAVLALQE AEAYLVG+FEDTNLCAIHAK
Sbjct  56   KSTELLIRKLPFQRLVREIAQDYKTDLRFQSHAVLALQEGAEAYLVGIFEDTNLCAIHAK  115

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  116  RVTIMPKDIQLARRIRGERA  135


 Score = 95.9 bits (237),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 57/70 (81%), Gaps = 1/70 (1%)
 Frame = -2

Query  583  RTKQTARKSTGGKAPRKQLATKAARKSAPT-TGGVKKPHRYRPGTVALREIRKYQRALSS  407
            RTKQTARKSTGGKAPRKQLATKAARKS PT  GG+K+P RYRPGTVALREIRKYQ++   
Sbjct  1    RTKQTARKSTGGKAPRKQLATKAARKSIPTGMGGMKRPRRYRPGTVALREIRKYQKSTEL  60

Query  406  LSASFPSRGL  377
            L    P + L
Sbjct  61   LIRKLPFQRL  70



>gb|EYU36764.1| hypothetical protein MIMGU_mgv1a020663mg, partial [Erythranthe 
guttata]
Length=86

 Score =   157 bits (398),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLR QSHAVLALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  7    KSTELLIRKLPFQRLVREIAQDFKTDLRIQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  66

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  67   RVTIMPKDIQLARRIRGERA  86



>gb|ADN10257.1| histone 3a, partial [Selenops mexicanus]
Length=109

 Score =   115 bits (289),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 55/61 (90%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STEL IRKLPF RLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  49   KSTELXIRKLPFXRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  108

Query  242  R  240
            R
Sbjct  109  R  109


 Score = 94.7 bits (234),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 49/50 (98%), Gaps = 0/50 (0%)
 Frame = -2

Query  565  RKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRA  416
            RKSTGGKAPRKQLATKAARKSAP TGGVKKPHRYRPGTVALREIR+YQ++
Sbjct  1    RKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKS  50



>ref|XP_005843780.1| hypothetical protein CHLNCDRAFT_59160 [Chlorella variabilis]
 gb|EFN51678.1| hypothetical protein CHLNCDRAFT_59160 [Chlorella variabilis]
Length=136

 Score =   159 bits (403),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AVLALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVLALQEAAEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   114 bits (286),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>ref|XP_005852293.1| hypothetical protein CHLNCDRAFT_28967 [Chlorella variabilis]
 ref|XP_005843099.1| hypothetical protein CHLNCDRAFT_141512 [Chlorella variabilis]
 ref|XP_005843639.1| hypothetical protein CHLNCDRAFT_27828 [Chlorella variabilis]
 ref|XP_005843701.1| hypothetical protein CHLNCDRAFT_27880 [Chlorella variabilis]
 ref|XP_005847128.1| hypothetical protein CHLNCDRAFT_24354 [Chlorella variabilis]
 ref|XP_005847291.1| hypothetical protein CHLNCDRAFT_48847 [Chlorella variabilis]
 gb|EFN50577.1| hypothetical protein CHLNCDRAFT_28967 [Chlorella variabilis]
 gb|EFN50997.1| hypothetical protein CHLNCDRAFT_141512 [Chlorella variabilis]
 gb|EFN51537.1| hypothetical protein CHLNCDRAFT_27828 [Chlorella variabilis]
 gb|EFN51599.1| hypothetical protein CHLNCDRAFT_27880 [Chlorella variabilis]
 gb|EFN55026.1| hypothetical protein CHLNCDRAFT_24354 [Chlorella variabilis]
 gb|EFN55189.1| hypothetical protein CHLNCDRAFT_48847 [Chlorella variabilis]
 gb|KIZ01084.1| Histone H3 [Monoraphidium neglectum]
Length=136

 Score =   159 bits (403),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AVLALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVLALQEAAEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   112 bits (281),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHRYRPGTVALREIRKYQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRKYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>ref|XP_001690671.1| histone H3 [Chlamydomonas reinhardtii]
 ref|XP_001690683.1| histone H3 [Chlamydomonas reinhardtii]
 ref|XP_001690723.1| histone H3 [Chlamydomonas reinhardtii]
 ref|XP_001690808.1| histone H3 [Chlamydomonas reinhardtii]
 ref|XP_001690819.1| histone H3 [Chlamydomonas reinhardtii]
 ref|XP_001690829.1| histone H3 [Chlamydomonas reinhardtii]
 ref|XP_001690998.1| histone H3 [Chlamydomonas reinhardtii]
 ref|XP_001691548.1| histone H3 [Chlamydomonas reinhardtii]
 ref|XP_001691674.1| histone H3 [Chlamydomonas reinhardtii]
 ref|XP_001691692.1| histone H3 [Chlamydomonas reinhardtii]
 ref|XP_001692371.1| histone H3 [Chlamydomonas reinhardtii]
 ref|XP_001693721.1| histone H3 [Chlamydomonas reinhardtii]
 ref|XP_001696185.1| histone H3 [Chlamydomonas reinhardtii]
 ref|XP_001696188.1| histone H3 [Chlamydomonas reinhardtii]
 ref|XP_001696189.1| histone H3 [Chlamydomonas reinhardtii]
 ref|XP_001696219.1| histone H3 [Chlamydomonas reinhardtii]
 ref|XP_001696244.1| histone H3 [Chlamydomonas reinhardtii]
 ref|XP_001696249.1| histone H3 [Chlamydomonas reinhardtii]
 ref|XP_001696281.1| histone H3 [Chlamydomonas reinhardtii]
 ref|XP_001696445.1| histone H3 [Chlamydomonas reinhardtii]
 ref|XP_001696539.1| histone H3 [Chlamydomonas reinhardtii]
 ref|XP_001696548.1| histone H3 [Chlamydomonas reinhardtii]
 ref|XP_001696551.1| histone H3 [Chlamydomonas reinhardtii]
 ref|XP_001698170.1| histone H3 [Chlamydomonas reinhardtii]
 ref|XP_001698249.1| histone H3 [Chlamydomonas reinhardtii]
 ref|XP_001698957.1| histone H3 [Chlamydomonas reinhardtii]
 ref|XP_001700404.1| histone H3 [Chlamydomonas reinhardtii]
 ref|XP_001700449.1| histone H3 [Chlamydomonas reinhardtii]
 ref|XP_001700460.1| histone H3 [Chlamydomonas reinhardtii]
 ref|XP_001700474.1| histone H3 [Chlamydomonas reinhardtii]
 ref|XP_001702089.1| histone H3 [Chlamydomonas reinhardtii]
 ref|XP_001702224.1| histone H3 [Chlamydomonas reinhardtii]
 ref|XP_001702965.1| histone H3 [Chlamydomonas reinhardtii]
 ref|XP_001703062.1| histone H3 [Chlamydomonas reinhardtii]
 ref|XP_002946112.1| histone H3 [Volvox carteri f. nagariensis]
 ref|XP_002946114.1| histone H3 [Volvox carteri f. nagariensis]
 ref|XP_002947277.1| histone H3 [Volvox carteri f. nagariensis]
 ref|XP_002947411.1| histone H3 [Volvox carteri f. nagariensis]
 ref|XP_002947524.1| histone H3 [Volvox carteri f. nagariensis]
 ref|XP_002947836.1| histone H3 [Volvox carteri f. nagariensis]
 ref|XP_002953084.1| histone H3 [Volvox carteri f. nagariensis]
 ref|XP_002953085.1| histone H3 [Volvox carteri f. nagariensis]
 ref|XP_002956797.1| histone H3 [Volvox carteri f. nagariensis]
 ref|XP_002956851.1| histone H3 [Volvox carteri f. nagariensis]
 sp|P08437.2|H3_VOLCA RecName: Full=Histone H3 [Volvox carteri]
 sp|Q6LCW8.1|H32_CHLRE RecName: Full=Histone H3 type 2 [Chlamydomonas reinhardtii]
 pir||S59581 histone H3 (clones CH-II and CH-III) - Chlamydomonas reinhardtii
 emb|CAA30035.1| put. histone H3 [Volvox carteri f. nagariensis]
 emb|CAA30037.1| put. histone H3 [Volvox carteri f. nagariensis]
 gb|AAA98444.1| histone H3 [Chlamydomonas reinhardtii]
 gb|AAA98448.1| histone H3 [Chlamydomonas reinhardtii]
 gb|EDO95706.1| histone H3 [Chlamydomonas reinhardtii]
 gb|EDO95787.1| histone H3 [Chlamydomonas reinhardtii]
 gb|EDO95842.1| histone H3 [Chlamydomonas reinhardtii]
 gb|EDO95851.1| histone H3 [Chlamydomonas reinhardtii]
 gb|EDO95889.1| histone H3 [Chlamydomonas reinhardtii]
 gb|EDO95911.1| histone H3 [Chlamydomonas reinhardtii]
 gb|EDO95979.1| histone H3 [Chlamydomonas reinhardtii]
 gb|EDO96246.1| histone H3 [Chlamydomonas reinhardtii]
 gb|EDO96258.1| histone H3 [Chlamydomonas reinhardtii]
 gb|EDO98093.1| histone H3 [Chlamydomonas reinhardtii]
 gb|EDO98138.1| histone H3 [Chlamydomonas reinhardtii]
 gb|EDO98149.1| histone H3 [Chlamydomonas reinhardtii]
 gb|EDO98163.1| histone H3 [Chlamydomonas reinhardtii]
 gb|EDO99455.1| histone H3 [Chlamydomonas reinhardtii]
 gb|EDO99534.1| histone H3 [Chlamydomonas reinhardtii]
 gb|EDP04656.1| histone H3 [Chlamydomonas reinhardtii]
 gb|EDP04782.1| histone H3 [Chlamydomonas reinhardtii]
 gb|EDP04800.1| histone H3 [Chlamydomonas reinhardtii]
 gb|EDP05254.1| histone H3 [Chlamydomonas reinhardtii]
 gb|EDP05265.1| histone H3 [Chlamydomonas reinhardtii]
 gb|EDP05275.1| histone H3 [Chlamydomonas reinhardtii]
 gb|EDP05444.1| histone H3 [Chlamydomonas reinhardtii]
 gb|EDP08162.1| histone H3 [Chlamydomonas reinhardtii]
 gb|EDP08165.1| histone H3 [Chlamydomonas reinhardtii]
 gb|EDP08166.1| histone H3 [Chlamydomonas reinhardtii]
 gb|EDP08196.1| histone H3 [Chlamydomonas reinhardtii]
 gb|EDP08221.1| histone H3 [Chlamydomonas reinhardtii]
 gb|EDP08226.1| histone H3 [Chlamydomonas reinhardtii]
 gb|EDP08258.1| histone H3 [Chlamydomonas reinhardtii]
 gb|EDP08422.1| histone H3 [Chlamydomonas reinhardtii]
 gb|EDP08516.1| histone H3 [Chlamydomonas reinhardtii]
 gb|EDP08525.1| histone H3 [Chlamydomonas reinhardtii]
 gb|EDP08528.1| histone H3 [Chlamydomonas reinhardtii]
 gb|EDP08975.1| histone H3 [Chlamydomonas reinhardtii]
 gb|EFJ42100.1| histone H3 [Volvox carteri f. nagariensis]
 gb|EFJ42154.1| histone H3 [Volvox carteri f. nagariensis]
 gb|EFJ46006.1| histone H3 [Volvox carteri f. nagariensis]
 gb|EFJ46007.1| histone H3 [Volvox carteri f. nagariensis]
 gb|EFJ50824.1| histone H3 [Volvox carteri f. nagariensis]
 gb|EFJ51459.1| histone H3 [Volvox carteri f. nagariensis]
 gb|EFJ51572.1| histone H3 [Volvox carteri f. nagariensis]
 gb|EFJ51867.1| histone H3 [Volvox carteri f. nagariensis]
 gb|EFJ53107.1| histone H3 [Volvox carteri f. nagariensis]
 gb|EFJ53109.1| histone H3 [Volvox carteri f. nagariensis]
Length=135

 Score =   159 bits (402),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AVLALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  56   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSQAVLALQEAAEAYLVGLFEDTNLCAIHAK  115

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  116  RVTIMPKDIQLARRIRGERA  135


 Score =   105 bits (263),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 60/71 (85%), Gaps = 1/71 (1%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARK+ P TGGVKKPHRYRPGTVALREIRKYQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKT-PATGGVKKPHRYRPGTVALREIRKYQKSTE  59

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  60   LLIRKLPFQRL  70



>ref|XP_003552025.2| PREDICTED: histone H3.3-like [Glycine max]
Length=186

 Score =   161 bits (407),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 81/83 (98%), Gaps = 0/83 (0%)
 Frame = -1

Query  431  QVSESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI  252
            +  +STELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI
Sbjct  104  KYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI  163

Query  251  HAKRVTIMPKDIQLARRIRGERA  183
            HAKRVTIMPKDIQLARRIRGERA
Sbjct  164  HAKRVTIMPKDIQLARRIRGERA  186


 Score =   116 bits (290),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = -2

Query  592  DMARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRAL  413
            +MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQ++ 
Sbjct  50   EMARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKST  109

Query  412  SSLSASFPSRGL  377
              L    P + L
Sbjct  110  ELLIRKLPFQRL  121



>gb|KHN31394.1| Histone H3.3 [Glycine soja]
Length=186

 Score =   161 bits (407),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 81/83 (98%), Gaps = 0/83 (0%)
 Frame = -1

Query  431  QVSESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI  252
            +  +STELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI
Sbjct  104  KYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI  163

Query  251  HAKRVTIMPKDIQLARRIRGERA  183
            HAKRVTIMPKDIQLARRIRGERA
Sbjct  164  HAKRVTIMPKDIQLARRIRGERA  186


 Score =   116 bits (291),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = -2

Query  592  DMARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRAL  413
            +MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQ++ 
Sbjct  50   EMARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKST  109

Query  412  SSLSASFPSRGL  377
              L    P + L
Sbjct  110  ELLIRKLPFQRL  121



>gb|AFK39648.1| unknown [Medicago truncatula]
Length=136

 Score =   159 bits (402),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AVLALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVLALQEAAEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   111 bits (278),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHR+RPGTVALREIRKYQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>ref|XP_001780239.1| histone H3 [Physcomitrella patens]
 gb|EDQ54903.1| histone H3 [Physcomitrella patens]
Length=137

 Score =   159 bits (402),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKT LRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  58   KSTELLIRKLPFQRLVREIAQDFKTGLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  117

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  118  RVTIMPKDIQLARRIRGERA  137


 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 49/72 (68%), Gaps = 1/72 (1%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALRE-IRKYQRAL  413
            MARTKQTARKSTGGKAPRKQLATKAARKS PTT G++      P  +   + IRK+Q++ 
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSIPTTEGLRNLIAIAPVQLLCGDGIRKFQKST  60

Query  412  SSLSASFPSRGL  377
              L    P + L
Sbjct  61   ELLIRKLPFQRL  72



>emb|CDR95560.1| HISTONE fold protein,putative [Babesia bigemina]
 emb|CDR95565.1| HISTONE fold protein,putative [Babesia bigemina]
Length=136

 Score =   159 bits (402),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AVLALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSQAVLALQEAAEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   108 bits (270),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARK+AP T G+KKPHRYRPGTVALREIRK+Q++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKAAPVTAGIKKPHRYRPGTVALREIRKFQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>gb|EMP31825.1| Histone H3 [Chelonia mydas]
Length=118

 Score =   158 bits (400),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  39   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  98

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  99   RVTIMPKDIQLARRIRGERA  118


 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 50/66 (76%), Gaps = 5/66 (8%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKK    +   + +R++  +QR + 
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKK----KSTELLIRKL-PFQRLVR  55

Query  409  SLSASF  392
             ++  F
Sbjct  56   EIAQDF  61



>ref|XP_001609713.1| Histone H3 [Babesia bovis T2Bo]
 gb|EDO06145.1| Histone H3, putative [Babesia bovis]
Length=136

 Score =   159 bits (402),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AVLALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVLALQEAAEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   109 bits (273),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAP  GG+KKPHRYRPGTVALREIR+YQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPVAGGIKKPHRYRPGTVALREIRRYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>gb|EGT34514.1| hypothetical protein CAEBREN_26300 [Caenorhabditis brenneri]
 gb|EGT34528.1| hypothetical protein CAEBREN_26306 [Caenorhabditis brenneri]
 gb|EGT34552.1| hypothetical protein CAEBREN_26311 [Caenorhabditis brenneri]
 gb|EGT38824.1| hypothetical protein CAEBREN_24214 [Caenorhabditis brenneri]
 gb|EGT42378.1| hypothetical protein CAEBREN_28645 [Caenorhabditis brenneri]
Length=138

 Score =   159 bits (402),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  59   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEAAEAYLVGLFEDTNLCAIHAK  118

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  119  RVTIMPKDIQLARRIRGERA  138


 Score =   100 bits (250),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 53/73 (73%), Positives = 60/73 (82%), Gaps = 2/73 (3%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPT--TGGVKKPHRYRPGTVALREIRKYQRA  416
            MARTKQTARKSTGGKAPRKQLATKAARK+  +  +GGVKKPHRYRPGTVALREIR+YQ++
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKNVASKVSGGVKKPHRYRPGTVALREIRRYQKS  60

Query  415  LSSLSASFPSRGL  377
               L    P + L
Sbjct  61   TELLIRKLPFQRL  73



>emb|CDR95028.1| Histone H3, putative [Babesia bigemina]
Length=136

 Score =   159 bits (402),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AVLALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVLALQEAAEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   111 bits (278),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGG+KKPHRYRPGTVALREIR+YQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPVTGGIKKPHRYRPGTVALREIRRYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>ref|XP_004830908.1| histone H3, putative [Babesia equi]
 gb|AFZ81242.1| histone H3, putative [Babesia equi strain WA]
Length=136

 Score =   159 bits (402),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AVLALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVLALQEAAEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   109 bits (272),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLA+KAARK+AP TGG+KKPHRYRPGTVALREIR+YQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLASKAARKTAPVTGGIKKPHRYRPGTVALREIRRYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>ref|XP_008381582.1| PREDICTED: histone H3.3-like [Malus domestica]
 ref|XP_009357146.1| PREDICTED: histone H3.3-like [Pyrus x bretschneideri]
 ref|XP_009357147.1| PREDICTED: histone H3.3-like [Pyrus x bretschneideri]
Length=136

 Score =   159 bits (402),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 75/83 (90%), Positives = 81/83 (98%), Gaps = 0/83 (0%)
 Frame = -1

Query  431  QVSESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI  252
            +  +STELLIRKLPFQRLVRE+AQD+KTDLRFQSHA+LALQEAAEAYLVGLFEDTNLCAI
Sbjct  54   KYQKSTELLIRKLPFQRLVRELAQDYKTDLRFQSHAILALQEAAEAYLVGLFEDTNLCAI  113

Query  251  HAKRVTIMPKDIQLARRIRGERA  183
            HAKRVTIMPKD+QLARRIRGERA
Sbjct  114  HAKRVTIMPKDVQLARRIRGERA  136


 Score =   108 bits (269),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRK LA KAARKS PTTGGVKKPHRYRPGTVALREIRKYQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKSLAFKAARKSTPTTGGVKKPHRYRPGTVALREIRKYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>gb|AFN20174.1| histone H3, partial [Gliocladiopsis irregularis]
Length=118

 Score =   120 bits (300),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 63/71 (89%), Gaps = 0/71 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STEL IRKLPF RLVREIAQDFK+DLRFQS A+ ALQE+ E+YLV LFEDTNLCAIHAK
Sbjct  48   KSTELEIRKLPFPRLVREIAQDFKSDLRFQSSAIGALQESVESYLVSLFEDTNLCAIHAK  107

Query  242  RVTIMPKDIQL  210
            RVTI  KDIQL
Sbjct  108  RVTIQSKDIQL  118


 Score = 89.7 bits (221),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = -2

Query  562  KSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRA  416
            +STGGKAPRKQLA+KAARKSAP+TGGVKKPHRY PGTVALREIR+YQ++
Sbjct  1    RSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYMPGTVALREIRRYQKS  49



>ref|XP_001698188.1| histone H3 [Chlamydomonas reinhardtii]
 gb|EDO99473.1| histone H3 [Chlamydomonas reinhardtii]
Length=135

 Score =   159 bits (401),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AVLALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  56   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSQAVLALQEAAEAYLVGLFEDTNLCAIHAK  115

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARR+RGERA
Sbjct  116  RVTIMPKDIQLARRVRGERA  135


 Score =   105 bits (263),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 60/71 (85%), Gaps = 1/71 (1%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARK+ P TGGVKKPHRYRPGTVALREIRKYQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKT-PATGGVKKPHRYRPGTVALREIRKYQKSTE  59

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  60   LLIRKLPFQRL  70



>ref|XP_002868941.1| F10A5.19 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45200.1| F10A5.19 [Arabidopsis lyrata subsp. lyrata]
Length=229

 Score =   162 bits (409),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 79/83 (95%), Positives = 81/83 (98%), Gaps = 0/83 (0%)
 Frame = -1

Query  431  QVSESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI  252
            +  +STELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI
Sbjct  147  KYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI  206

Query  251  HAKRVTIMPKDIQLARRIRGERA  183
            HAKRVTIMPKDIQLARRIRGERA
Sbjct  207  HAKRVTIMPKDIQLARRIRGERA  229


 Score =   124 bits (312),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 60/65 (92%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = -1

Query  431  QVSESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI  252
            +  +STELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI
Sbjct  54   KYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI  113

Query  251  HAKRV  237
            HAKR 
Sbjct  114  HAKRA  118


 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71


 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 40/50 (80%), Gaps = 0/50 (0%)
 Frame = -2

Query  526  ATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALSSLSASFPSRGL  377
            A +AARKSAPTTGGVKKPHRYRPGTVALREIRKYQ++   L    P + L
Sbjct  115  AKRAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL  164



>ref|XP_002962371.1| hypothetical protein SELMODRAFT_78992 [Selaginella moellendorffii]
 ref|XP_002962905.1| hypothetical protein SELMODRAFT_438193 [Selaginella moellendorffii]
 ref|XP_002973738.1| hypothetical protein SELMODRAFT_99535 [Selaginella moellendorffii]
 ref|XP_002975787.1| hypothetical protein SELMODRAFT_103546 [Selaginella moellendorffii]
 gb|EFJ23416.1| hypothetical protein SELMODRAFT_103546 [Selaginella moellendorffii]
 gb|EFJ25398.1| hypothetical protein SELMODRAFT_99535 [Selaginella moellendorffii]
 gb|EFJ35834.1| hypothetical protein SELMODRAFT_78992 [Selaginella moellendorffii]
 gb|EFJ36368.1| hypothetical protein SELMODRAFT_438193 [Selaginella moellendorffii]
Length=136

 Score =   159 bits (401),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEAAEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   112 bits (281),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHRYRPGTVALREIRKYQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRKYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>gb|EGT58309.1| hypothetical protein CAEBREN_11605 [Caenorhabditis brenneri]
Length=138

 Score =   159 bits (401),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  59   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEAAEAYLVGLFEDTNLCAIHAK  118

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  119  RVTIMPKDIQLARRIRGERA  138


 Score =   103 bits (257),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 60/73 (82%), Gaps = 2/73 (3%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPT--TGGVKKPHRYRPGTVALREIRKYQRA  416
            MARTKQTARKSTGGKAPRKQLATKAARK+  T  TGGVKKPHRYRPGTVALREIR+YQ++
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKNVATKGTGGVKKPHRYRPGTVALREIRRYQKS  60

Query  415  LSSLSASFPSRGL  377
               L    P + L
Sbjct  61   TELLIRKLPFQRL  73



>ref|XP_005843095.1| histone H3 [Chlorella variabilis]
 gb|EFN50993.1| histone H3 [Chlorella variabilis]
Length=127

 Score =   158 bits (400),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AVLALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  48   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVLALQEAAEAYLVGLFEDTNLCAIHAK  107

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  108  RVTIMPKDIQLARRIRGERA  127


 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 52/71 (73%), Gaps = 9/71 (13%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKA     P     +KPHRYRPGTVALREIRKYQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAR----P-----QKPHRYRPGTVALREIRKYQKSTE  51

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  52   LLIRKLPFQRL  62



>gb|EGT36252.1| hypothetical protein CAEBREN_03846 [Caenorhabditis brenneri]
 gb|EGT47370.1| hypothetical protein CAEBREN_18343 [Caenorhabditis brenneri]
 gb|EGT47683.1| hypothetical protein CAEBREN_28519 [Caenorhabditis brenneri]
 gb|EGT51277.1| hypothetical protein CAEBREN_29925 [Caenorhabditis brenneri]
 gb|EGT58737.1| hypothetical protein CAEBREN_01741 [Caenorhabditis brenneri]
Length=136

 Score =   159 bits (401),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEAAEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   107 bits (266),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSA   GGVKKPHRYRPGTVALREIR+YQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSATVAGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>gb|EGT58275.1| hypothetical protein CAEBREN_10531 [Caenorhabditis brenneri]
Length=138

 Score =   159 bits (401),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  59   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEAAEAYLVGLFEDTNLCAIHAK  118

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  119  RVTIMPKDIQLARRIRGERA  138


 Score =   103 bits (257),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 60/73 (82%), Gaps = 2/73 (3%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPT--TGGVKKPHRYRPGTVALREIRKYQRA  416
            MARTKQTARKSTGGKAPRKQLATKAARK+  T  TGGVKKPHRYRPGTVALREIR+YQ++
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKNVATKVTGGVKKPHRYRPGTVALREIRRYQKS  60

Query  415  LSSLSASFPSRGL  377
               L    P + L
Sbjct  61   TELLIRKLPFQRL  73



>gb|EGT42707.1| hypothetical protein CAEBREN_09337 [Caenorhabditis brenneri]
Length=136

 Score =   159 bits (401),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEAAEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   110 bits (274),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKS P TGGVKKPHRYRPGTVALREIR+YQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSTPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>ref|XP_003113948.1| hypothetical protein CRE_27089 [Caenorhabditis remanei]
 ref|XP_003114519.1| hypothetical protein CRE_27393 [Caenorhabditis remanei]
 ref|XP_003115561.1| hypothetical protein CRE_18972 [Caenorhabditis remanei]
 ref|XP_003748083.1| PREDICTED: histone H3-like [Metaseiulus occidentalis]
 gb|EFP00049.1| hypothetical protein CRE_18972 [Caenorhabditis remanei]
 gb|EFP05286.1| hypothetical protein CRE_27089 [Caenorhabditis remanei]
 gb|EFP05857.1| hypothetical protein CRE_27393 [Caenorhabditis remanei]
 gb|ETN68913.1| core histone H2A/H2B/H3/H4 [Necator americanus]
 gb|ETN81277.1| core histone H2A/H2B/H3/H4 [Necator americanus]
 gb|ETN85399.1| core histone H2A/H2B/H3/H4 [Necator americanus]
Length=136

 Score =   159 bits (401),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEAAEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   111 bits (278),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHRYRPGTVALREIR+YQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>ref|XP_003088464.1| hypothetical protein CRE_05346 [Caenorhabditis remanei]
 ref|XP_003107753.1| hypothetical protein CRE_12684 [Caenorhabditis remanei]
 ref|XP_003107968.1| hypothetical protein CRE_12510 [Caenorhabditis remanei]
 gb|EFO91168.1| hypothetical protein CRE_05346 [Caenorhabditis remanei]
 gb|EFO93652.1| hypothetical protein CRE_12684 [Caenorhabditis remanei]
 gb|EFO93867.1| hypothetical protein CRE_12510 [Caenorhabditis remanei]
Length=136

 Score =   159 bits (401),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEAAEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   110 bits (274),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAP +GGVKKPHRYRPGTVALREIR+YQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPASGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>gb|AFW86016.1| histone H3 [Zea mays]
Length=247

 Score =   162 bits (410),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 79/80 (99%), Positives = 80/80 (100%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  168  KSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  227

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  228  RVTIMPKDIQLARRIRGERA  247


 Score =   114 bits (286),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 60/73 (82%), Positives = 63/73 (86%), Gaps = 0/73 (0%)
 Frame = -2

Query  595  EDMARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRA  416
            E MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQ++
Sbjct  110  EKMARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKS  169

Query  415  LSSLSASFPSRGL  377
               L    P + L
Sbjct  170  TELLIRKLPFQRL  182



>ref|XP_003109235.1| hypothetical protein CRE_08233 [Caenorhabditis remanei]
 ref|XP_003109240.1| hypothetical protein CRE_08027 [Caenorhabditis remanei]
 gb|EFO90600.1| hypothetical protein CRE_08233 [Caenorhabditis remanei]
 gb|EFO90605.1| hypothetical protein CRE_08027 [Caenorhabditis remanei]
Length=136

 Score =   159 bits (401),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEAAEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   109 bits (273),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAP  GGVKKPHRYRPGTVALREIR+YQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPAAGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>gb|ELK06006.1| Histone H3.2 [Pteropus alecto]
Length=130

 Score =   158 bits (400),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 83/103 (81%), Positives = 87/103 (84%), Gaps = 5/103 (5%)
 Frame = -1

Query  476  APSLSSWN---CCSP*NP--QVSESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLAL  312
             P L S     CCS   P  +  +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+AL
Sbjct  28   GPGLRSCAPPLCCSARVPIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMAL  87

Query  311  QEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA  183
            QEA+EAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct  88   QEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA  130



>gb|EGT34501.1| hypothetical protein CAEBREN_26308 [Caenorhabditis brenneri]
 gb|EGT34540.1| hypothetical protein CAEBREN_26304 [Caenorhabditis brenneri]
 gb|EGT34547.1| hypothetical protein CAEBREN_26299 [Caenorhabditis brenneri]
 gb|EGT34556.1| hypothetical protein CAEBREN_26298 [Caenorhabditis brenneri]
 gb|EGT38823.1| hypothetical protein CAEBREN_29320 [Caenorhabditis brenneri]
 gb|EGT39015.1| hypothetical protein CAEBREN_00141 [Caenorhabditis brenneri]
 gb|EGT60010.1| hypothetical protein CAEBREN_32615 [Caenorhabditis brenneri]
Length=136

 Score =   158 bits (400),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEAAEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   108 bits (271),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARK+ P TGGVKKPHRYRPGTVALREIR+YQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKNTPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>ref|XP_005043075.1| PREDICTED: histone H3.3 isoform X1 [Ficedula albicollis]
Length=135

 Score =   158 bits (400),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 82/108 (76%), Positives = 87/108 (81%), Gaps = 8/108 (7%)
 Frame = -1

Query  482  EEAPSLSS--WNCCSP*NPQVSE------STELLIRKLPFQRLVREIAQDFKTDLRFQSH  327
            + APS     +NC  P    + E      STELLIRKLPFQRLVREIAQDFKTDLRFQS 
Sbjct  28   KSAPSTGGVVFNCNRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSA  87

Query  326  AVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA  183
            A+ ALQEA+EAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct  88   AIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA  135


 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 57/71 (80%), Gaps = 1/71 (1%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGV   +  RPGTVALREIR+YQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGV-VFNCNRPGTVALREIRRYQKSTE  59

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  60   LLIRKLPFQRL  70



>ref|XP_001862696.1| Histone H3c [Culex quinquefasciatus]
 gb|EDS37388.1| Histone H3c [Culex quinquefasciatus]
Length=169

 Score =   159 bits (403),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  90   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  149

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  150  RVTIMPKDIQLARRIRGERA  169


 Score =   111 bits (278),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHRYRPGTVALREIR+YQ++  
Sbjct  34   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  93

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  94   LLIRKLPFQRL  104



>ref|XP_001640436.1| predicted protein [Nematostella vectensis]
 ref|XP_002613950.1| hypothetical protein BRAFLDRAFT_67487 [Branchiostoma floridae]
 ref|XP_006813652.1| PREDICTED: histone H3-like [Saccoglossus kowalevskii]
 gb|EDO48373.1| predicted protein [Nematostella vectensis]
 gb|EEN69959.1| hypothetical protein BRAFLDRAFT_67487 [Branchiostoma floridae]
 emb|CBM82512.1| histone H3 protein [Balanoglossus clavigerus]
Length=136

 Score =   158 bits (400),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRL+REIAQDFKTDLRFQS AVLALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLIREIAQDFKTDLRFQSSAVLALQEAAEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   111 bits (278),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHRYRPGTVALREIR+YQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>ref|XP_001753449.1| histone H3 [Physcomitrella patens]
 ref|XP_001754164.1| histone H3 [Physcomitrella patens]
 ref|XP_001755072.1| histone H3 [Physcomitrella patens]
 ref|XP_001759106.1| histone H3 [Physcomitrella patens]
 ref|XP_001767746.1| histone H3 [Physcomitrella patens]
 ref|XP_001772912.1| histone H3 [Physcomitrella patens]
 ref|XP_001773579.1| histone H3 [Physcomitrella patens]
 ref|XP_001784559.1| histone H3 [Physcomitrella patens]
 ref|XP_001785890.1| histone H3 [Physcomitrella patens]
 gb|EDQ49299.1| histone H3 [Physcomitrella patens]
 gb|EDQ50624.1| histone H3 [Physcomitrella patens]
 gb|EDQ61617.1| histone H3 [Physcomitrella patens]
 gb|EDQ62314.1| histone H3 [Physcomitrella patens]
 gb|EDQ67497.1| histone H3 [Physcomitrella patens]
 gb|EDQ76175.1| histone H3 [Physcomitrella patens]
 gb|EDQ80016.1| histone H3 [Physcomitrella patens]
 gb|EDQ81065.1| histone H3 [Physcomitrella patens]
 gb|EDQ81672.1| histone H3 [Physcomitrella patens]
Length=136

 Score =   158 bits (400),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AVLALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVLALQEASEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   112 bits (281),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHRYRPGTVALREIRKYQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRKYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>sp|P22843.2|H3_ACRFO RecName: Full=Histone H3 [Acropora formosa]
 gb|AAA64958.1| histone H3 protein [Acropora formosa]
 gb|AAC37352.1| histone H3 [Acropora formosa]
 gb|AAB28736.1| histone H3 [Acropora formosa]
 prf||1920342A histone H3
Length=136

 Score =   158 bits (400),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AVLALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVLALQEASEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   108 bits (270),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAA KSAP TGGVKKPHRYRPGTVALREIR+YQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAAAKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>sp|Q42681.1|H31_CHLRE RecName: Full=Histone H3 type 1 [Chlamydomonas reinhardtii]
 gb|AAA98455.1| histone H3 [Chlamydomonas reinhardtii]
Length=135

 Score =   158 bits (400),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STEL+IRKLPFQRLVREIAQDFKTDLRFQS AVLALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  56   KSTELVIRKLPFQRLVREIAQDFKTDLRFQSQAVLALQEAAEAYLVGLFEDTNLCAIHAK  115

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  116  RVTIMPKDIQLARRIRGERA  135


 Score =   104 bits (259),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 60/71 (85%), Gaps = 1/71 (1%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARK+ P TGGVKKPHRYRPGTVALREIRKYQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKT-PATGGVKKPHRYRPGTVALREIRKYQKSTE  59

Query  409  SLSASFPSRGL  377
             +    P + L
Sbjct  60   LVIRKLPFQRL  70



>ref|XP_002954719.1| histone H3 [Volvox carteri f. nagariensis]
 gb|EFJ44125.1| histone H3 [Volvox carteri f. nagariensis]
Length=135

 Score =   158 bits (400),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQ+ AVLALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  56   KSTELLIRKLPFQRLVREIAQDFKTDLRFQTQAVLALQEAAEAYLVGLFEDTNLCAIHAK  115

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  116  RVTIMPKDIQLARRIRGERA  135


 Score =   105 bits (263),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 60/71 (85%), Gaps = 1/71 (1%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARK+ P TGGVKKPHRYRPGTVALREIRKYQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKT-PATGGVKKPHRYRPGTVALREIRKYQKSTE  59

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  60   LLIRKLPFQRL  70



>gb|EGT34515.1| hypothetical protein CAEBREN_26315 [Caenorhabditis brenneri]
 gb|EGT34542.1| hypothetical protein CAEBREN_26301 [Caenorhabditis brenneri]
Length=136

 Score =   158 bits (400),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEAAEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   103 bits (258),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 53/71 (75%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARK     GGVKKPHRYRPGTVALREIR+YQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKDVKVPGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>ref|XP_003110265.1| hypothetical protein CRE_05546 [Caenorhabditis remanei]
 gb|EFO87558.1| hypothetical protein CRE_05546 [Caenorhabditis remanei]
Length=145

 Score =   158 bits (400),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  66   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEAAEAYLVGLFEDTNLCAIHAK  125

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  126  RVTIMPKDIQLARRIRGERA  145


 Score = 95.1 bits (235),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 58/80 (73%), Gaps = 9/80 (11%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLA---------TKAARKSAPTTGGVKKPHRYRPGTVALRE  437
            MARTKQTARKSTGGKA   +LA         TKAARKSAP TGGVKKPHRYRPGTVALRE
Sbjct  1    MARTKQTARKSTGGKAQESELAHPRLPATRATKAARKSAPATGGVKKPHRYRPGTVALRE  60

Query  436  IRKYQRALSSLSASFPSRGL  377
            IR+YQ++   L    P + L
Sbjct  61   IRRYQKSTELLIRKLPFQRL  80



>ref|XP_005970819.1| PREDICTED: histone H3.2-like [Pantholops hodgsonii]
Length=107

 Score =   148 bits (374),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 70/80 (88%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +S   ++R LPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  28   KSAPAMVRNLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  87

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  88   RVTIMPKDIQLARRIRGERA  107


 Score = 60.5 bits (145),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 31/31 (100%), Positives = 31/31 (100%), Gaps = 0/31 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAP  497
            MARTKQTARKSTGGKAPRKQLATKAARKSAP
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAP  31



>ref|XP_001892001.1| histone H3 [Brugia malayi]
 gb|AFI61664.1| histone 3 [Ruditapes philippinarum]
 gb|AFI61668.1| histone 3 [Ruditapes philippinarum]
 gb|AFI61669.1| histone 3 [Ruditapes philippinarum]
 gb|AFI61671.1| histone 3 [Ruditapes variegatus]
 gb|AFI61672.1| histone 3 [Ruditapes variegatus]
 gb|AFI61673.1| histone 3 [Ruditapes variegatus]
 gb|AFI61674.1| histone 3 [Ruditapes variegatus]
 gb|EFO18482.2| histone H3 [Loa loa]
 gb|EJW80937.1| histone H3 [Wuchereria bancrofti]
 gb|ERG81775.1| histone h3 [Ascaris suum]
 emb|CDP93712.1| Protein Bm3425 [Brugia malayi]
 gb|KHN75672.1| Histone H3 [Toxocara canis]
 gb|KHN83108.1| Histone H3 [Toxocara canis]
Length=136

 Score =   158 bits (399),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AVLALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVLALQEASEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   111 bits (278),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHRYRPGTVALREIR+YQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>emb|CCF73041.1| unnamed protein product [Babesia microti strain RI]
Length=136

 Score =   158 bits (399),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AVLALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVLALQEAAEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGER+
Sbjct  117  RVTIMPKDIQLARRIRGERS  136


 Score =   110 bits (274),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLA+KAARKSAP TGG+KKPHRYRPGTVALREIR+YQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLASKAARKSAPITGGIKKPHRYRPGTVALREIRRYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>gb|AEW46685.1| histone type 2 [Ulva linza]
Length=136

 Score =   158 bits (399),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQD+KTDLRFQS AVLALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDYKTDLRFQSSAVLALQEAAEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKD+QLARRIRGERA
Sbjct  117  RVTIMPKDVQLARRIRGERA  136


 Score =   112 bits (281),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHRYRPGTVALREIRKYQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRKYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>gb|AAF87128.1|AC006434_24 F10A5.19 [Arabidopsis thaliana]
Length=236

 Score =   161 bits (408),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 78/83 (94%), Positives = 81/83 (98%), Gaps = 0/83 (0%)
 Frame = -1

Query  431  QVSESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI  252
            +  +STELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI
Sbjct  154  KYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI  213

Query  251  HAKRVTIMPKDIQLARRIRGERA  183
            HAKRVTIMPKD+QLARRIRGERA
Sbjct  214  HAKRVTIMPKDVQLARRIRGERA  236


 Score =   139 bits (349),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/71 (93%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = -1

Query  431  QVSESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI  252
            +  +STELLIRKLPFQRLVREIAQD+KTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI
Sbjct  54   KYQKSTELLIRKLPFQRLVREIAQDYKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI  113

Query  251  HAKRVTIMPKD  219
            HAKRVTIMPKD
Sbjct  114  HAKRVTIMPKD  124


 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKS GGKAPR  LATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQ++  
Sbjct  1    MARTKQTARKSHGGKAPRTLLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71


 Score = 71.6 bits (174),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -2

Query  517  AARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALSSLSASFPSRGL  377
            AARKSAPTTGGVKKPHRYRPGTVALREIRKYQ++   L    P + L
Sbjct  125  AARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL  171



>ref|XP_009361038.1| PREDICTED: histone H3.3-like [Pyrus x bretschneideri]
Length=136

 Score =   158 bits (399),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 76/83 (92%), Positives = 79/83 (95%), Gaps = 0/83 (0%)
 Frame = -1

Query  431  QVSESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI  252
            +  +STELLIR LPFQRLVREIAQDFKTDLRFQSHAV ALQEAAEAYLVGLFEDTNLCAI
Sbjct  54   KYQKSTELLIRNLPFQRLVREIAQDFKTDLRFQSHAVFALQEAAEAYLVGLFEDTNLCAI  113

Query  251  HAKRVTIMPKDIQLARRIRGERA  183
            HAKRVTIMPKD+QLARRIRGERA
Sbjct  114  HAKRVTIMPKDVQLARRIRGERA  136


 Score =   106 bits (265),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLA    RK+APTTGGVKKPHRYRPGTVALREIRKYQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLAATIYRKAAPTTGGVKKPHRYRPGTVALREIRKYQKSTE  60

Query  409  SLSASFPSRGL  377
             L  + P + L
Sbjct  61   LLIRNLPFQRL  71



>emb|CBN79887.1| conserved unknown protein [Ectocarpus siliculosus]
Length=136

 Score =   158 bits (399),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS A+LALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSTAILALQEAAEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   111 bits (278),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAPT GGVKKPHRYRPGTVALREIR+YQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPTAGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>sp|Q402E2.3|H33A_LILLO RecName: Full=Histone H3.3a; AltName: Full=Histone soH3-2; AltName: 
Full=Somatic-like histone H3-2 [Lilium longiflorum]
 dbj|BAE20249.1| histone H3 [Lilium longiflorum]
 dbj|BAE48435.1| histone soH3-2 [Lilium longiflorum]
Length=136

 Score =   158 bits (399),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +ST+LLIRKLPFQRLVREIAQD+K DLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTDLLIRKLPFQRLVREIAQDYKADLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   115 bits (287),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTD  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>ref|XP_010621397.1| PREDICTED: histone H3-like [Fukomys damarensis]
Length=158

 Score =   159 bits (401),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  79   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  138

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  139  RVTIMPKDIQLARRIRGERA  158


 Score =   101 bits (252),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -2

Query  574  QTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALSSLSAS  395
            QTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHRYRPGTVALREIR+YQ++   L   
Sbjct  28   QTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRK  87

Query  394  FP  389
             P
Sbjct  88   LP  89



>ref|XP_001865500.1| histone H3.3 type 2 [Culex quinquefasciatus]
 gb|EDS41772.1| histone H3.3 type 2 [Culex quinquefasciatus]
Length=158

 Score =   159 bits (401),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  79   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  138

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  139  RVTIMPKDIQLARRIRGERA  158


 Score =   112 bits (280),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHRYRPGTVALREIR+YQ++  
Sbjct  23   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  82

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  83   LLIRKLPFQRL  93



>gb|AAK21963.1| histone H3 [Trichinella spiralis]
Length=136

 Score =   158 bits (399),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVRE+AQD+KTDLRFQS AVLALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREVAQDYKTDLRFQSSAVLALQEAAEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   110 bits (274),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAP+ GGVKKPHRYRPGTVALREIR+YQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPSAGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>dbj|BAE48436.1| histone soH3-2 [Lilium longiflorum]
Length=134

 Score =   158 bits (399),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +ST+LLIRKLPFQRLVREIAQD+K DLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  55   KSTDLLIRKLPFQRLVREIAQDYKADLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  114

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  115  RVTIMPKDIQLARRIRGERA  134


 Score =   107 bits (267),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 56/69 (81%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = -2

Query  583  RTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALSSL  404
            RTKQTARKSTGGKAPRKQLATKAARKSA TTGGVKKPHRYRPGTVALREIRKYQ++   L
Sbjct  1    RTKQTARKSTGGKAPRKQLATKAARKSALTTGGVKKPHRYRPGTVALREIRKYQKSTDLL  60

Query  403  SASFPSRGL  377
                P + L
Sbjct  61   IRKLPFQRL  69



>ref|XP_002887605.1| F10A5.19 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63864.1| F10A5.19 [Arabidopsis lyrata subsp. lyrata]
Length=236

 Score =   161 bits (407),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 78/83 (94%), Positives = 81/83 (98%), Gaps = 0/83 (0%)
 Frame = -1

Query  431  QVSESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI  252
            +  +STELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI
Sbjct  154  KYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI  213

Query  251  HAKRVTIMPKDIQLARRIRGERA  183
            HAKRVTIMPKD+QLARRIRGERA
Sbjct  214  HAKRVTIMPKDVQLARRIRGERA  236


 Score =   139 bits (351),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/71 (94%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = -1

Query  431  QVSESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI  252
            +  +STELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI
Sbjct  54   KYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAI  113

Query  251  HAKRVTIMPKD  219
            HAKRVTIMPKD
Sbjct  114  HAKRVTIMPKD  124


 Score =   109 bits (273),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKS GGKAPRK LATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQ++  
Sbjct  1    MARTKQTARKSHGGKAPRKLLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71


 Score = 71.6 bits (174),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -2

Query  517  AARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALSSLSASFPSRGL  377
            AARKSAPTTGGVKKPHRYRPGTVALREIRKYQ++   L    P + L
Sbjct  125  AARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL  171



>ref|XP_002045506.1| GM11653 [Drosophila sechellia]
 gb|EDW51008.1| GM11653 [Drosophila sechellia]
Length=136

 Score =   158 bits (399),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   108 bits (271),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSA  TGGVKKPHRYRPGTVALREIR+YQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSASATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>ref|XP_001419259.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97552.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 emb|CEG01325.1| Histone core [Ostreococcus tauri]
Length=136

 Score =   158 bits (399),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AVLALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSTAVLALQEASEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   114 bits (286),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>ref|XP_006125960.1| PREDICTED: histone H3.2-like isoform X3 [Pelodiscus sinensis]
Length=139

 Score =   158 bits (399),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  60   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  119

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  120  RVTIMPKDIQLARRIRGERA  139


 Score =   106 bits (265),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 62/74 (84%), Gaps = 3/74 (4%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPT---TGGVKKPHRYRPGTVALREIRKYQR  419
            MARTKQTARKSTGGKAPRKQLATKAARKSAP+   TGGVKKPHRYRPGTVALREIR+YQ+
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPSAPATGGVKKPHRYRPGTVALREIRRYQK  60

Query  418  ALSSLSASFPSRGL  377
            +   L    P + L
Sbjct  61   STELLIRKLPFQRL  74



>ref|XP_010621400.1| PREDICTED: histone H3.3-like [Fukomys damarensis]
Length=148

 Score =   158 bits (400),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 78/80 (98%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            ESTELLIRKLPFQRLVREIAQDFKTD RFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  69   ESTELLIRKLPFQRLVREIAQDFKTDFRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  128

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  129  RVTIMPKDIQLARRIRGERA  148


 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 50/73 (68%), Gaps = 3/73 (4%)
 Frame = -2

Query  586  ARTKQTARKSTGGK---APRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRA  416
            AR K   R S  G    APRKQLATKAARKSAP TGGVKKP RYRPGTVALREIR+YQ +
Sbjct  11   ARAKAKTRSSRAGLQFPAPRKQLATKAARKSAPATGGVKKPQRYRPGTVALREIRRYQES  70

Query  415  LSSLSASFPSRGL  377
               L    P + L
Sbjct  71   TELLIRKLPFQRL  83



>ref|XP_005949462.1| PREDICTED: histone H3.2-like isoform X2 [Haplochromis burtoni]
Length=136

 Score =   158 bits (399),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   106 bits (264),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAP T GVKKPHRYRP TVALREIR+YQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATRGVKKPHRYRPSTVALREIRRYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>ref|XP_010710352.1| PREDICTED: histone H3.3 [Meleagris gallopavo]
Length=88

 Score =   156 bits (395),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  9    KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  68

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  69   RVTIMPKDIQLARRIRGERA  88



>ref|XP_001418070.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 ref|XP_001420504.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 ref|XP_007509458.1| histone H3 [Bathycoccus prasinos]
 ref|XP_007509586.1| histone H3 [Bathycoccus prasinos]
 ref|XP_007514322.1| histone H3 [Bathycoccus prasinos]
 gb|ABO96363.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98797.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 emb|CCO19261.1| histone H3 [Bathycoccus prasinos]
 emb|CCO19389.1| histone H3 [Bathycoccus prasinos]
 emb|CCO15759.1| histone H3 [Bathycoccus prasinos]
 emb|CEF99669.1| Histone core [Ostreococcus tauri]
 emb|CEF98083.1| Histone core [Ostreococcus tauri]
Length=136

 Score =   158 bits (399),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AVLALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVLALQEASEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKD+QLARRIRGERA
Sbjct  117  RVTIMPKDVQLARRIRGERA  136


 Score =   112 bits (281),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHRYRPGTVALREIRKYQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRKYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>ref|XP_005519548.1| PREDICTED: histone H3.2-like isoform X1 [Pseudopodoces humilis]
Length=140

 Score =   158 bits (399),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  61   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  120

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  121  RVTIMPKDIQLARRIRGERA  140


 Score =   111 bits (278),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHRYRPGTVALREIR+YQ++  
Sbjct  5    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  64

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  65   LLIRKLPFQRL  75



>ref|XP_005843648.1| histone H3.2 precursor [Chlorella variabilis]
 gb|EFN51546.1| histone H3.2 precursor [Chlorella variabilis]
Length=144

 Score =   158 bits (399),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 78/80 (98%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AVLALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  65   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVLALQEAAEAYLVGLFEDTNLCAIHAK  124

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  125  RVTIMPKDIQLARRIRGERA  144


 Score = 90.5 bits (223),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = -2

Query  553  GGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALSSLSASFPSRGL  377
            GGKAPRKQLATKAARKSAP TGGVKKPHRYRPGTVALREIRKYQ++   L    P + L
Sbjct  21   GGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRL  79



>ref|XP_008929842.1| PREDICTED: histone H3-like [Manacus vitellinus]
Length=147

 Score =   158 bits (400),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  68   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  127

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  128  RVTIMPKDIQLARRIRGERA  147


 Score =   107 bits (266),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -2

Query  598  SEDMARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQR  419
            S +M RTKQT RKS GGKAPRKQLATKAARKSAP TGGVKKPHRYRPGTVALREIR+YQ+
Sbjct  9    SLNMGRTKQTWRKSPGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQK  68

Query  418  ALSSLSASFPSRGL  377
            +   L    P + L
Sbjct  69   STELLIRKLPFQRL  82



>ref|XP_006125961.1| PREDICTED: histone H3.2-like isoform X4 [Pelodiscus sinensis]
Length=137

 Score =   158 bits (399),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  58   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  117

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  118  RVTIMPKDIQLARRIRGERA  137


 Score =   107 bits (266),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 57/72 (79%), Positives = 61/72 (85%), Gaps = 1/72 (1%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKS-APTTGGVKKPHRYRPGTVALREIRKYQRAL  413
            MARTKQTARKSTGGKAPRKQLATKAARKS AP TGGVKKPHRYRPGTVALREIR+YQ++ 
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSSAPATGGVKKPHRYRPGTVALREIRRYQKST  60

Query  412  SSLSASFPSRGL  377
              L    P + L
Sbjct  61   ELLIRKLPFQRL  72



>ref|XP_006024249.1| PREDICTED: histone H3.2-like [Alligator sinensis]
Length=136

 Score =   158 bits (399),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   110 bits (275),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHRYRPGTVALRE+R+YQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREMRRYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>ref|XP_005527779.1| PREDICTED: histone H3.2-like isoform X1 [Pseudopodoces humilis]
Length=138

 Score =   158 bits (399),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  59   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  118

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  119  RVTIMPKDIQLARRIRGERA  138


 Score =   111 bits (278),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHRYRPGTVALREIR+YQ++  
Sbjct  3    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  62

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  63   LLIRKLPFQRL  73



>emb|CEF62715.1| Histone H3 [Strongyloides ratti]
 emb|CEF62882.1| Histone H3 [Strongyloides ratti]
Length=136

 Score =   158 bits (399),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQE+AEAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQESAEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   112 bits (281),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHRYRPGTVALREIRKYQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRKYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>ref|XP_004898149.1| PREDICTED: histone H3.2-like [Heterocephalus glaber]
 gb|EHB11500.1| Histone H3 [Heterocephalus glaber]
Length=143

 Score =   158 bits (399),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  64   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  123

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  124  RVTIMPKDIQLARRIRGERA  143


 Score = 99.4 bits (246),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 60/78 (77%), Gaps = 7/78 (9%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSA-------PTTGGVKKPHRYRPGTVALREIR  431
            MARTKQTARKSTGGKAPRKQLATKAA+ +A       P TGGVKKPHRYRPGTVALREIR
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAAKSAAPATGGVPPATGGVKKPHRYRPGTVALREIR  60

Query  430  KYQRALSSLSASFPSRGL  377
            +YQ++   L    P + L
Sbjct  61   RYQKSTELLIRKLPFQRL  78



>ref|XP_007064114.1| PREDICTED: histone H3.2-like isoform X2 [Chelonia mydas]
Length=141

 Score =   158 bits (399),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  62   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  121

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  122  RVTIMPKDIQLARRIRGERA  141


 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 54/72 (75%), Gaps = 5/72 (7%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTG-----GVKKPHRYRPGTVALREIRKY  425
            MARTKQTARKSTGGKAPRKQLATKAARK A   G     G KKPHRYRPGTVALREIR+ 
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKGARGRGQRSLLGGKKPHRYRPGTVALREIRRS  60

Query  424  QRALSSLSASFP  389
            Q++   L    P
Sbjct  61   QKSTELLIRKLP  72



>gb|KFV65812.1| Histone H3 [Picoides pubescens]
Length=136

 Score =   158 bits (399),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   110 bits (275),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGK+PRKQLATKAARKSAP TGGVKKPHRYRPGTVALREIR+YQ++  
Sbjct  1    MARTKQTARKSTGGKSPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>ref|XP_009059617.1| hypothetical protein LOTGIDRAFT_176845 [Lottia gigantea]
 gb|ESO89696.1| hypothetical protein LOTGIDRAFT_176845 [Lottia gigantea]
Length=136

 Score =   158 bits (399),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   108 bits (270),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKA RKQLATKAARKSAP TGGVKKPHRYRPGTVALREIR+YQ++  
Sbjct  1    MARTKQTARKSTGGKAXRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>ref|XP_009084844.1| PREDICTED: histone H3-like [Serinus canaria]
Length=138

 Score =   158 bits (399),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  59   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  118

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  119  RVTIMPKDIQLARRIRGERA  138


 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 56/73 (77%), Gaps = 2/73 (3%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGV--KKPHRYRPGTVALREIRKYQRA  416
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGV       YRPGTVALREIR+YQ++
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVXXXXXXXYRPGTVALREIRRYQKS  60

Query  415  LSSLSASFPSRGL  377
               L    P + L
Sbjct  61   TELLIRKLPFQRL  73



>gb|AAI27043.1| Hist1h3e protein, partial [Mus musculus]
Length=133

 Score =   157 bits (398),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  54   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  113

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  114  RVTIMPKDIQLARRIRGERA  133


 Score =   105 bits (263),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = -2

Query  580  TKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALSSLS  401
            TKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHRYRPGTVALREIR+YQ++   L 
Sbjct  1    TKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLI  60

Query  400  ASFPSRGL  377
               P + L
Sbjct  61   RKLPFQRL  68



>ref|XP_010167429.1| PREDICTED: histone H3, partial [Caprimulgus carolinensis]
Length=134

 Score =   157 bits (398),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  55   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  114

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  115  RVTIMPKDIQLARRIRGERA  134


 Score =   105 bits (263),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = -2

Query  583  RTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALSSL  404
            +TKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHRYRPGTVALREIR+YQ++   L
Sbjct  1    KTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELL  60

Query  403  SASFPSRGL  377
                P + L
Sbjct  61   IRKLPFQRL  69



>ref|XP_002943219.2| PREDICTED: histone H3.2-like [Xenopus (Silurana) tropicalis]
Length=136

 Score =   157 bits (398),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   108 bits (270),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHRYRPGTVALR IR+YQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALRVIRRYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>ref|XP_004670887.1| PREDICTED: histone H3.2-like [Jaculus jaculus]
Length=136

 Score =   157 bits (398),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   104 bits (259),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHRYRPGT AL EIR+YQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTGALPEIRRYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>gb|AFY26267.1| histone H3, partial [Plectorhinchus mediterraneus]
Length=135

 Score =   157 bits (398),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  56   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  115

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  116  RVTIMPKDIQLARRIRGERA  135


 Score =   106 bits (265),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -2

Query  586  ARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALSS  407
            ARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHRYRPGT ALREIR+YQ++   
Sbjct  1    ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTAALREIRRYQKSTEL  60

Query  406  LSASFPSRGL  377
            L    P + L
Sbjct  61   LIRKLPFQRL  70



>gb|KFO33880.1| Histone H3 [Fukomys damarensis]
Length=151

 Score =   158 bits (400),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 78/80 (98%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            ESTELLIRKLPFQRLVREIAQDFKTD RFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  72   ESTELLIRKLPFQRLVREIAQDFKTDFRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  131

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  132  RVTIMPKDIQLARRIRGERA  151


 Score = 83.2 bits (204),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = -2

Query  550  GKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALSSLSASFPSRGL  377
            G+APRKQLATKAARKSAP TGGVKKP RYRPGTVALREIR+YQ +   L    P + L
Sbjct  29   GRAPRKQLATKAARKSAPATGGVKKPQRYRPGTVALREIRRYQESTELLIRKLPFQRL  86



>gb|EMC89182.1| Histone H3, partial [Columba livia]
 gb|EOB06698.1| Histone H3, partial [Anas platyrhynchos]
 gb|EOB06725.1| Histone H3, partial [Anas platyrhynchos]
Length=137

 Score =   157 bits (398),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  58   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  117

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  118  RVTIMPKDIQLARRIRGERA  137


 Score =   111 bits (278),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHRYRPGTVALREIR+YQ++  
Sbjct  2    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  61

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  62   LLIRKLPFQRL  72



>ref|XP_001505987.1| PREDICTED: histone H3-like [Ornithorhynchus anatinus]
Length=136

 Score =   157 bits (398),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   110 bits (275),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPR QLATKAARKSAP TGGVKKPHRYRPGTVALREIR+YQ++  
Sbjct  1    MARTKQTARKSTGGKAPRNQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>ref|XP_002422654.1| histone H3, putative [Pediculus humanus corporis]
 gb|EEB09916.1| histone H3, putative [Pediculus humanus corporis]
Length=156

 Score =   158 bits (400),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  77   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  136

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  137  RVTIMPKDIQLARRIRGERA  156


 Score =   111 bits (278),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHRYRPGTVALREIR+YQ++  
Sbjct  21   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  80

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  81   LLIRKLPFQRL  91



>gb|ACO12509.1| Histone H3 [Lepeophtheirus salmonis]
Length=136

 Score =   157 bits (398),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   113 bits (283),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIR+YQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>ref|XP_002602751.1| hypothetical protein BRAFLDRAFT_97692 [Branchiostoma floridae]
 gb|EEN58763.1| hypothetical protein BRAFLDRAFT_97692 [Branchiostoma floridae]
Length=136

 Score =   157 bits (398),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   110 bits (274),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKS P TGGVKKPHRYRPGTVALREIR+YQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSTPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>ref|XP_610495.1| PREDICTED: histone H3 [Bos taurus]
 ref|XP_002685546.1| PREDICTED: histone H3 [Bos taurus]
 tpg|DAA32518.1| TPA: histone cluster 2, H3c2-like [Bos taurus]
Length=136

 Score =   157 bits (398),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   110 bits (274),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            M RTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHRYRPGTVALREIR+YQ++  
Sbjct  1    MTRTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>dbj|BAA93627.1| histone H3 [Drosophila erecta]
Length=136

 Score =   157 bits (398),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   110 bits (274),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQT RKSTGGKAPRKQLATKAARKSAP TGGVKKPHRYRPGTVALREIR+YQ++  
Sbjct  1    MARTKQTTRKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>sp|Q64400.3|H32_CRILO RecName: Full=Histone H3.2 [Cricetulus longicaudatus]
 emb|CAA56580.1| histone H3.2 [Cricetulus longicaudatus]
Length=136

 Score =   157 bits (398),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   110 bits (274),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHRYRPGTV LREIR+YQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVTLREIRRYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>gb|ABW81367.1| histone H3, partial [Crypticerya rosae]
Length=110

 Score =   112 bits (280),  Expect(2) = 7e-45, Method: Compositional matrix adjust.
 Identities = 55/61 (90%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKL FQRLVREI QDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  50   KSTELLIRKLLFQRLVREIDQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  109

Query  242  R  240
            R
Sbjct  110  R  110


 Score = 95.9 bits (237),  Expect(2) = 7e-45, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = -2

Query  568  ARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALSSL  404
            ARKSTGGKAPRKQLATKAAR+SAP TGGVKKPHRYRPGTVALREIR+YQ++   L
Sbjct  1    ARKSTGGKAPRKQLATKAARRSAPATGGVKKPHRYRPGTVALREIRRYQKSTELL  55



>gb|KGN66469.1| hypothetical protein Csa_1G612925 [Cucumis sativus]
Length=171

 Score =   159 bits (401),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 78/80 (98%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV ALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  92   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAK  151

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  152  RVTIMPKDIQLARRIRGERA  171


 Score =   111 bits (278),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHR+RPGTVALREIRKYQ++  
Sbjct  36   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTE  95

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  96   LLIRKLPFQRL  106



>ref|XP_003145584.1| histone type 2 [Loa loa]
Length=160

 Score =   158 bits (400),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AVLALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  81   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVLALQEASEAYLVGLFEDTNLCAIHAK  140

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  141  RVTIMPKDIQLARRIRGERA  160


 Score =   111 bits (278),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHRYRPGTVALREIR+YQ++  
Sbjct  25   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  84

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  85   LLIRKLPFQRL  95



>gb|KFQ96138.1| Histone H3 [Nipponia nippon]
Length=136

 Score =   157 bits (398),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   107 bits (268),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHRYRPGT ALREIR+YQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTGALREIRRYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>ref|XP_002635330.1| Hypothetical protein CBG01499 [Caenorhabditis briggsae]
 ref|XP_002635334.1| Hypothetical protein CBG01505 [Caenorhabditis briggsae]
 emb|CAP22751.1| Protein CBG01505 [Caenorhabditis briggsae]
 emb|CAP22755.1| Protein CBG01499 [Caenorhabditis briggsae]
Length=136

 Score =   157 bits (398),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQE+AEAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQESAEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   109 bits (273),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAP  GGVKKPHRYRPGTVALREIR+YQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPAQGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>ref|XP_010994987.1| PREDICTED: histone H3-like [Camelus dromedarius]
Length=135

 Score =   157 bits (398),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  56   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  115

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  116  RVTIMPKDIQLARRIRGERA  135


 Score =   105 bits (262),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 60/71 (85%), Gaps = 1/71 (1%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGV KPHRYRPGTVALREIR+YQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGV-KPHRYRPGTVALREIRRYQKSTE  59

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  60   LLIRKLPFQRL  70



>emb|CAP53901.1| histone H3 [Xenoturbella bocki]
Length=136

 Score =   157 bits (398),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   109 bits (272),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHRYRPGTVALREIR+Y+++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYRKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>ref|XP_007064113.1| PREDICTED: histone H3.2-like isoform X1 [Chelonia mydas]
Length=135

 Score =   157 bits (398),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  56   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  115

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  116  RVTIMPKDIQLARRIRGERA  135


 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 55/71 (77%), Gaps = 1/71 (1%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARK     GG KKPHRYRPGTVALREIR+ Q++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKGRSLLGG-KKPHRYRPGTVALREIRRSQKSTE  59

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  60   LLIRKLPFQRL  70



>ref|XP_002045560.1| GM19670 [Drosophila sechellia]
 ref|XP_002045750.1| GM26661 [Drosophila sechellia]
 gb|EDW52706.1| GM19670 [Drosophila sechellia]
 gb|EDW55905.1| GM26661 [Drosophila sechellia]
Length=136

 Score =   157 bits (398),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   110 bits (274),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQ ARKSTGGKAPRKQLATKAARKSAP TGGVKKPHRYRPGTVALREIR+YQ++  
Sbjct  1    MARTKQNARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>ref|NP_038576.1| histone H3.2 [Mus musculus]
 ref|NP_473386.1| histone H3.2 [Mus musculus]
 ref|NP_724345.1| histone H3 [Drosophila melanogaster]
 ref|NP_835511.1| histone H3.2 [Mus musculus]
 ref|NP_835510.1| histone H3.2 [Mus musculus]
 ref|NP_835512.1| histone H3.2 [Mus musculus]
 ref|NP_835587.1| histone H3.2 [Mus musculus]
 ref|NP_783584.1| histone H3.2 [Mus musculus]
 ref|NP_066403.2| histone H3.2 [Homo sapiens]
 ref|NP_001005464.1| histone H3.2 [Homo sapiens]
 ref|NP_001016636.1| histone H3.2 [Xenopus (Silurana) tropicalis]
 ref|NP_001020347.1| histone [Danio rerio]
 ref|NP_001027285.1| histone H3 [Drosophila melanogaster]
 ref|NP_001027289.1| histone H3 [Drosophila melanogaster]
 ref|NP_001027294.1| histone H3 [Drosophila melanogaster]
 ref|NP_001027298.1| histone H3 [Drosophila melanogaster]
 ref|NP_001027303.1| histone H3 [Drosophila melanogaster]
 ref|NP_001027308.1| histone H3 [Drosophila melanogaster]
 ref|NP_001027313.1| histone H3 [Drosophila melanogaster]
 ref|NP_001027318.1| histone H3 [Drosophila melanogaster]
 ref|NP_001027323.1| histone H3 [Drosophila melanogaster]
 ref|NP_001027328.1| histone H3 [Drosophila melanogaster]
 ref|NP_001027333.1| histone H3 [Drosophila melanogaster]
 ref|NP_001027338.1| histone H3 [Drosophila melanogaster]
 ref|NP_001027343.1| histone H3 [Drosophila melanogaster]
 ref|NP_001027348.1| histone H3 [Drosophila melanogaster]
 ref|NP_001027353.1| histone H3 [Drosophila melanogaster]
 ref|NP_001027358.1| histone H3 [Drosophila melanogaster]
 ref|NP_001027363.1| histone H3 [Drosophila melanogaster]
 ref|NP_001027368.1| histone H3 [Drosophila melanogaster]
 ref|NP_001027373.1| histone H3 [Drosophila melanogaster]
 ref|NP_001027378.1| histone H3 [Drosophila melanogaster]
 ref|NP_001027383.1| histone H3 [Drosophila melanogaster]
 ref|NP_001027387.1| histone H3 [Drosophila melanogaster]
 ref|NP_001040399.1| histone H3 [Bombyx mori]
 ref|NP_001091428.1| histone H3.2 [Xenopus laevis]
 ref|NP_001093643.1| H3 histone, family 2-like [Danio rerio]
 ref|NP_001101168.1| histone cluster 2, H3c2 [Rattus norvegicus]
 ref|NP_001116847.1| histone H3.2 [Homo sapiens]
 ref|NP_001160041.1| histone H3.2 [Bos taurus]
 ref|NP_835734.2| histone H3.2 [Mus musculus]
 ref|NP_001231571.1| histone H3.2 [Sus scrofa]
 ref|NP_001268409.1| histone H3.2-like [Gallus gallus]
 ref|NP_001268438.1| histone H3.2-like [Gallus gallus]
 ref|XP_969677.1| PREDICTED: histone H3 [Tribolium castaneum]
 ref|XP_969597.1| PREDICTED: histone H3 [Tribolium castaneum]
 ref|XP_975418.1| PREDICTED: histone H3 [Tribolium castaneum]
 ref|XP_966487.1| PREDICTED: histone H3 [Tribolium castaneum]
 ref|XP_001084245.1| PREDICTED: histone H3.2-like isoform 1 [Macaca mulatta]
 ref|XP_001120132.1| PREDICTED: histone H3-like [Apis mellifera]
 ref|XP_001232833.1| PREDICTED: histone H3.2-like [Gallus gallus]
 ref|XP_001233028.1| PREDICTED: histone H3.2-like [Gallus gallus]
 ref|XP_416193.2| PREDICTED: histone H3.2-like [Gallus gallus]
 ref|XP_001335303.1| PREDICTED: histone H3 [Danio rerio]
 ref|XP_001364839.1| PREDICTED: histone H3.2-like [Monodelphis domestica]
 ref|XP_001514437.1| PREDICTED: histone H3 [Ornithorhynchus anatinus]
 ref|XP_001506572.1| PREDICTED: histone H3 [Ornithorhynchus anatinus]
 ref|XP_001513360.1| PREDICTED: histone H3 [Ornithorhynchus anatinus]
 ref|XP_001509264.1| PREDICTED: histone H3 [Ornithorhynchus anatinus]
 ref|XP_001500143.1| PREDICTED: histone H3.2-like [Equus caballus]
 ref|XP_001618211.1| hypothetical protein NEMVEDRAFT_v1g227799 [Nematostella vectensis]
 ref|XP_001618631.1| hypothetical protein NEMVEDRAFT_v1g227782 [Nematostella vectensis]
 ref|XP_001619112.1| hypothetical protein NEMVEDRAFT_v1g196006 [Nematostella vectensis]
 ref|XP_001619731.1| hypothetical protein NEMVEDRAFT_v1g227739 [Nematostella vectensis]
 ref|XP_001619868.1| hypothetical protein NEMVEDRAFT_v1g227737 [Nematostella vectensis]
 ref|XP_001622884.1| predicted protein [Nematostella vectensis]
 ref|XP_001622885.1| predicted protein [Nematostella vectensis]
 ref|XP_001628765.1| predicted protein [Nematostella vectensis]
 ref|XP_001628767.1| predicted protein [Nematostella vectensis]
 ref|XP_001632610.1| predicted protein [Nematostella vectensis]
 ref|XP_001633293.1| predicted protein [Nematostella vectensis]
 ref|XP_001638461.1| predicted protein [Nematostella vectensis]
 ref|XP_001638527.1| predicted protein [Nematostella vectensis]
 ref|XP_001639376.1| predicted protein [Nematostella vectensis]
 ref|XP_001640345.1| predicted protein [Nematostella vectensis]
 ref|XP_001640368.1| predicted protein [Nematostella vectensis]
 ref|XP_001640467.1| predicted protein [Nematostella vectensis]
 ref|XP_001640469.1| predicted protein [Nematostella vectensis]
 ref|XP_001608284.1| PREDICTED: histone H3 [Nasonia vitripennis]
 ref|XP_001599673.1| PREDICTED: histone H3 [Nasonia vitripennis]
 ref|XP_001603659.1| PREDICTED: histone H3 [Nasonia vitripennis]
 ref|XP_001607608.1| PREDICTED: histone H3 [Nasonia vitripennis]
 ref|XP_001607935.1| PREDICTED: histone H3 [Nasonia vitripennis]
 ref|XP_001607330.1| PREDICTED: histone H3 [Nasonia vitripennis]
 ref|XP_001608235.1| PREDICTED: histone H3 [Nasonia vitripennis]
 ref|XP_001608238.1| PREDICTED: histone H3 [Nasonia vitripennis]
 ref|XP_001599561.1| PREDICTED: histone H3 [Nasonia vitripennis]
 ref|XP_001599419.1| PREDICTED: histone H3 [Nasonia vitripennis]
 ref|XP_001618759.1| hypothetical protein NEMVEDRAFT_v1g227772 [Nematostella vectensis]
 ref|XP_001618804.1| hypothetical protein NEMVEDRAFT_v1g227771 [Nematostella vectensis]
 ref|XP_001662236.1| AAEL012072-PA [Aedes aegypti]
 ref|XP_001656985.1| AAEL000492-PA [Aedes aegypti]
 ref|XP_001656989.1| AAEL000482-PA [Aedes aegypti]
 ref|XP_001656993.1| AAEL000506-PA [Aedes aegypti]
 ref|XP_001657156.1| AAEL003659-PA [Aedes aegypti]
 ref|XP_001657265.1| AAEL003852-PA [Aedes aegypti]
 ref|XP_001657268.1| AAEL003850-PA [Aedes aegypti]
 ref|XP_001657272.1| AAEL003856-PA [Aedes aegypti]
 ref|XP_001657274.1| AAEL003828-PA [Aedes aegypti]
 ref|XP_001657279.1| AAEL003836-PA [Aedes aegypti]
 ref|XP_305996.3| Anopheles gambiae str. PEST AGAP012559-PA [Anopheles gambiae 
str. PEST]
 ref|XP_307601.3| AGAP005025-PA [Anopheles gambiae str. PEST]
 ref|XP_307606.3| Anopheles gambiae str. PEST AGAP012572-PA [Anopheles gambiae 
str. PEST]
 ref|XP_560604.5| Anopheles gambiae str. PEST AGAP012573-PA [Anopheles gambiae 
str. PEST]
 ref|XP_315130.3| AGAP005024-PA [Anopheles gambiae str. PEST]
 ref|XP_318362.3| AGAP003910-PA [Anopheles gambiae str. PEST]
 ref|XP_001847464.1| histone H3.1t [Culex quinquefasciatus]
 ref|XP_001862655.1| histone H3.3 type 2 [Culex quinquefasciatus]
 ref|XP_001862660.1| histone H3.2 [Culex quinquefasciatus]
 ref|XP_001862665.1| histone H3.2 [Culex quinquefasciatus]
 ref|XP_001862670.1| histone H3.1t [Culex quinquefasciatus]
 ref|XP_001862678.1| histone H3.3 type 2 [Culex quinquefasciatus]
 ref|XP_001862687.1| histone H3 type 2 [Culex quinquefasciatus]
 ref|XP_001862694.1| histone H3 type 2 [Culex quinquefasciatus]
 ref|XP_001862700.1| histone H3.1t [Culex quinquefasciatus]
 ref|XP_001865169.1| histone H3.1t [Culex quinquefasciatus]
 ref|XP_001865497.1| histone H3.2 [Culex quinquefasciatus]
 ref|XP_001950199.1| PREDICTED: histone H3 [Acyrthosiphon pisum]
 ref|XP_001964806.1| GF22293 [Drosophila ananassae]
 ref|XP_001964811.1| GF22265 [Drosophila ananassae]
 ref|XP_001964821.1| GF22200 [Drosophila ananassae]
 ref|XP_001967678.1| GF15887 [Drosophila ananassae]
 ref|XP_001967729.1| GF15922 [Drosophila ananassae]
 ref|XP_001967755.1| GF20380 [Drosophila ananassae]
 ref|XP_001967758.1| GF20359 [Drosophila ananassae]
 ref|XP_001967770.1| GF21522 [Drosophila ananassae]
 ref|XP_001967787.1| GF20165 [Drosophila ananassae]
 ref|XP_001967819.1| GF22855 [Drosophila ananassae]
 ref|XP_001967879.1| GF21669 [Drosophila ananassae]
 ref|XP_001967892.1| GF21608 [Drosophila ananassae]
 ref|XP_001973986.1| GG21334 [Drosophila erecta]
 ref|XP_001973988.1| GG21333 [Drosophila erecta]
 ref|XP_001973993.1| GG21330 [Drosophila erecta]
 ref|XP_001973998.1| GG21326 [Drosophila erecta]
 ref|XP_001974003.1| GG21323 [Drosophila erecta]
 ref|XP_001974008.1| GG21320 [Drosophila erecta]
 ref|XP_001974013.1| GG21316 [Drosophila erecta]
 ref|XP_001974018.1| GG21313 [Drosophila erecta]
 ref|XP_001974023.1| GG21310 [Drosophila erecta]
 ref|XP_001974028.1| GG21307 [Drosophila erecta]
 ref|XP_001982893.1| GG11010 [Drosophila erecta]
 ref|XP_001982898.1| GG11007 [Drosophila erecta]
 ref|XP_001982903.1| GG11004 [Drosophila erecta]
 ref|XP_001982908.1| GG11000 [Drosophila erecta]
 ref|XP_001982917.1| GG13024 [Drosophila erecta]
 ref|XP_001982922.1| GG13020 [Drosophila erecta]
 ref|XP_001982932.1| GG13014 [Drosophila erecta]
 ref|XP_001982948.1| GG12579 [Drosophila erecta]
 ref|XP_001982953.1| GG12575 [Drosophila erecta]
 ref|XP_001983005.1| GG19850 [Drosophila erecta]
 ref|XP_001983022.1| GG18243 [Drosophila erecta]
 ref|XP_001983043.1| GG12955 [Drosophila erecta]
 ref|XP_001983061.1| GG16369 [Drosophila erecta]
 ref|XP_001983067.1| GG19830 [Drosophila erecta]
 ref|XP_001983092.1| GG12990 [Drosophila erecta]
 ref|XP_001983100.1| GG19806 [Drosophila erecta]
 ref|XP_001983110.1| GG19816 [Drosophila erecta]
 ref|XP_001983112.1| GG16357 [Drosophila erecta]
 ref|XP_001983115.1| GG19791 [Drosophila erecta]
 ref|XP_001983116.1| GG13062 [Drosophila erecta]
 ref|XP_001983139.1| GG12995 [Drosophila erecta]
 ref|XP_001983140.1| GG13008 [Drosophila erecta]
 ref|XP_001996376.1| GH25148 [Drosophila grimshawi]
 ref|XP_001996381.1| GH25152 [Drosophila grimshawi]
 ref|XP_001996386.1| GH25155 [Drosophila grimshawi]
 ref|XP_001996391.1| GH25158 [Drosophila grimshawi]
 ref|XP_001996395.1| GH25160 [Drosophila grimshawi]
 ref|XP_001996399.1| GH25162 [Drosophila grimshawi]
 ref|XP_001996404.1| GH25165 [Drosophila grimshawi]
 ref|XP_001996409.1| GH25168 [Drosophila grimshawi]
 ref|XP_001996414.1| GH25173 [Drosophila grimshawi]
 ref|XP_001996419.1| GH25176 [Drosophila grimshawi]
 ref|XP_001996422.1| GH25177 [Drosophila grimshawi]
 ref|XP_001996426.1| GH25179 [Drosophila grimshawi]
 ref|XP_001996431.1| GH25183 [Drosophila grimshawi]
 ref|XP_001996435.1| GH25185 [Drosophila grimshawi]
 ref|XP_001996798.1| GH23344 [Drosophila grimshawi]
 ref|XP_001996804.1| GH23339 [Drosophila grimshawi]
 ref|XP_001996813.1| GH23334 [Drosophila grimshawi]
 ref|XP_001996816.1| GH23332 [Drosophila grimshawi]
 ref|XP_001997180.1| GH23876 [Drosophila grimshawi]
 ref|XP_001997205.1| GH10171 [Drosophila grimshawi]
 ref|XP_001997209.1| GH10149 [Drosophila grimshawi]
 ref|XP_001997410.1| GH23765 [Drosophila grimshawi]
 ref|XP_001997414.1| GH23762 [Drosophila grimshawi]
 ref|XP_001997685.1| GH23504 [Drosophila grimshawi]
 ref|XP_001997736.1| GH13936 [Drosophila grimshawi]
 ref|XP_001997787.1| GH23513 [Drosophila grimshawi]
 ref|XP_001997839.1| GH25000 [Drosophila grimshawi]
 ref|XP_001997901.1| GH23749 [Drosophila grimshawi]
 ref|XP_001997983.1| GH23469 [Drosophila grimshawi]
 ref|XP_001997993.1| GH23572 [Drosophila grimshawi]
 ref|XP_001998117.1| GH24949 [Drosophila grimshawi]
 ref|XP_001998773.1| GI23446 [Drosophila mojavensis]
 ref|XP_001998779.1| GI23442 [Drosophila mojavensis]
 ref|XP_001998783.1| GI23440 [Drosophila mojavensis]
 ref|XP_001998787.1| GI23438 [Drosophila mojavensis]
 ref|XP_002002201.1| GI17251 [Drosophila mojavensis]
 ref|XP_002002205.1| GI17253 [Drosophila mojavensis]
 ref|XP_002002209.1| GI17255 [Drosophila mojavensis]
 ref|XP_002002990.1| GI24857 [Drosophila mojavensis]
 ref|XP_002012537.1| GI16893 [Drosophila mojavensis]
 ref|XP_002012558.1| GI21876 [Drosophila mojavensis]
 ref|XP_002012640.1| GI11258 [Drosophila mojavensis]
 ref|XP_002012683.1| GI12713 [Drosophila mojavensis]
 ref|XP_002013119.1| GL23951 [Drosophila persimilis]
 ref|XP_002013125.1| GL23955 [Drosophila persimilis]
 ref|XP_002013130.1| GL23958 [Drosophila persimilis]
 ref|XP_002013135.1| GL23961 [Drosophila persimilis]
 ref|XP_002029055.1| GL17801 [Drosophila persimilis]
 ref|XP_002029392.1| GL22373 [Drosophila persimilis]
 ref|XP_002029490.1| GL19701 [Drosophila persimilis]
 ref|XP_002044743.1| GM19709 [Drosophila sechellia]
 ref|XP_002044746.1| GM19711 [Drosophila sechellia]
 ref|XP_002044756.1| GM19719 [Drosophila sechellia]
 ref|XP_002044761.1| GM19722 [Drosophila sechellia]
 ref|XP_002044765.1| GM19726 [Drosophila sechellia]
 ref|XP_002044770.1| GM19729 [Drosophila sechellia]
 ref|XP_002044955.1| GM13193 [Drosophila sechellia]
 ref|XP_002044960.1| GM13196 [Drosophila sechellia]
 ref|XP_002045027.1| GM11711 [Drosophila sechellia]
 ref|XP_002045032.1| GM11708 [Drosophila sechellia]
 ref|XP_002045046.1| GM13543 [Drosophila sechellia]
 ref|XP_002045054.1| GM22103 [Drosophila sechellia]
 ref|XP_002045058.1| GM21950 [Drosophila sechellia]
 ref|XP_002045092.1| GM19738 [Drosophila sechellia]
 ref|XP_002045256.1| GM13582 [Drosophila sechellia]
 ref|XP_002045356.1| GM11166 [Drosophila sechellia]
 ref|XP_002045363.1| GM12074 [Drosophila sechellia]
 ref|XP_002045368.1| GM12385 [Drosophila sechellia]
 ref|XP_002045378.1| GM19759 [Drosophila sechellia]
 ref|XP_002045385.1| GM11184 [Drosophila sechellia]
 ref|XP_002045390.1| GM11181 [Drosophila sechellia]
 ref|XP_002045409.1| GM13626 [Drosophila sechellia]
 ref|XP_002045494.1| GM19325 [Drosophila sechellia]
 ref|XP_002045512.1| GM19753 [Drosophila sechellia]
 ref|XP_002045517.1| GM18735 [Drosophila sechellia]
 ref|XP_002045522.1| GM16232 [Drosophila sechellia]
 ref|XP_002045595.1| GM16108 [Drosophila sechellia]
 ref|XP_002045615.1| GM19311 [Drosophila sechellia]
 ref|XP_002045619.1| GM17398 [Drosophila sechellia]
 ref|XP_002045639.1| GM13124 [Drosophila sechellia]
 ref|XP_002045689.1| GM26727 [Drosophila sechellia]
 ref|XP_002045695.1| GM13179 [Drosophila sechellia]
 ref|XP_002045699.1| GM19314 [Drosophila sechellia]
 ref|XP_002045729.1| GM10805 [Drosophila sechellia]
 ref|XP_002045779.1| GM18805 [Drosophila sechellia]
 ref|XP_002045782.1| GM15453 [Drosophila sechellia]
 ref|XP_002045809.1| GM11148 [Drosophila sechellia]
 ref|XP_002045812.1| GM16280 [Drosophila sechellia]
 ref|XP_002045829.1| GM24967 [Drosophila sechellia]
 ref|XP_002045835.1| GM19343 [Drosophila sechellia]
 ref|XP_002045863.1| GM17442 [Drosophila sechellia]
 ref|XP_002045876.1| GM19655 [Drosophila sechellia]
 ref|XP_002045918.1| GM16397 [Drosophila sechellia]
 ref|XP_002045937.1| GM13139 [Drosophila sechellia]
 ref|XP_002045949.1| GM23425 [Drosophila sechellia]
 ref|XP_002045972.1| GM15133 [Drosophila sechellia]
 ref|XP_002045990.1| GM11042 [Drosophila sechellia]
 ref|XP_002046018.1| GM19648 [Drosophila sechellia]
 ref|XP_002046072.1| GM16257 [Drosophila sechellia]
 ref|XP_002052265.1| GJ22585 [Drosophila virilis]
 ref|XP_002052270.1| GJ22552 [Drosophila virilis]
 ref|XP_002052273.1| GJ22537 [Drosophila virilis]
 ref|XP_002053092.1| GJ23692 [Drosophila virilis]
 ref|XP_002053096.1| GJ23694 [Drosophila virilis]
 ref|XP_002053101.1| GJ23698 [Drosophila virilis]
 ref|XP_002053106.1| GJ23701 [Drosophila virilis]
 ref|XP_002053110.1| GJ23703 [Drosophila virilis]
 ref|XP_002053117.1| GJ23707 [Drosophila virilis]
 ref|XP_002053122.1| GJ23711 [Drosophila virilis]
 ref|XP_002060410.1| GJ15448 [Drosophila virilis]
 ref|XP_002060424.1| GJ16344 [Drosophila virilis]
 ref|XP_002060427.1| GJ16346 [Drosophila virilis]
 ref|XP_002060451.1| GJ19811 [Drosophila virilis]
 ref|XP_002060477.1| GJ18401 [Drosophila virilis]
 ref|XP_002060488.1| GJ15165 [Drosophila virilis]
 ref|XP_002060513.1| GJ18405 [Drosophila virilis]
 ref|XP_002060514.1| GJ18585 [Drosophila virilis]
 ref|XP_002060537.1| GJ17075 [Drosophila virilis]
 ref|XP_002060571.1| GJ16113 [Drosophila virilis]
 ref|XP_002060604.1| GK19157 [Drosophila willistoni]
 ref|XP_002069210.1| GK10380 [Drosophila willistoni]
 ref|XP_002069215.1| GK18893 [Drosophila willistoni]
 ref|XP_002075740.1| GK19237 [Drosophila willistoni]
 ref|XP_002076069.1| GK21132 [Drosophila willistoni]
 ref|XP_002077254.1| GD21986 [Drosophila simulans]
 ref|XP_002077334.1| GD11866 [Drosophila simulans]
 ref|XP_002077350.1| GD11987 [Drosophila simulans]
 ref|XP_002077373.1| GD12595 [Drosophila simulans]
 ref|XP_002077379.1| GD12699 [Drosophila simulans]
 ref|XP_002077391.1| GD13036 [Drosophila simulans]
 ref|XP_002077396.1| GD19005 [Drosophila simulans]
 ref|XP_002077467.1| GD17998 [Drosophila simulans]
 ref|XP_002077482.1| GD14456 [Drosophila simulans]
 ref|XP_002077497.1| GD13666 [Drosophila simulans]
 ref|XP_002077505.1| GD14852 [Drosophila simulans]
 ref|XP_002077522.1| GD15113 [Drosophila simulans]
 ref|XP_002077545.1| GD15434 [Drosophila simulans]
 ref|XP_002077567.1| GD15753 [Drosophila simulans]
 ref|XP_002112565.1| conserved hypothetical protein [Trichoplax adhaerens]
 ref|XP_002128382.1| PREDICTED: histone H3 [Ciona intestinalis]
 ref|XP_002129014.1| PREDICTED: histone H3 [Ciona intestinalis]
 ref|XP_002194141.1| PREDICTED: histone H3.2-like [Taeniopygia guttata]
 ref|XP_002193332.1| PREDICTED: histone H3.2-like [Taeniopygia guttata]
 ref|XP_002430909.1| histone H3 [Pediculus humanus corporis]
 ref|XP_002430918.1| histone H3 [Pediculus humanus corporis]
 ref|XP_002586356.1| hypothetical protein BRAFLDRAFT_62634 [Branchiostoma floridae]
 ref|XP_002586365.1| hypothetical protein BRAFLDRAFT_62637 [Branchiostoma floridae]
 ref|XP_002595648.1| hypothetical protein BRAFLDRAFT_64784 [Branchiostoma floridae]
 ref|XP_002595666.1| hypothetical protein BRAFLDRAFT_64800 [Branchiostoma floridae]
 ref|XP_002595678.1| hypothetical protein BRAFLDRAFT_64812 [Branchiostoma floridae]
 ref|XP_002595709.1| hypothetical protein BRAFLDRAFT_56969 [Branchiostoma floridae]
 ref|XP_002595710.1| hypothetical protein BRAFLDRAFT_56970 [Branchiostoma floridae]
 ref|XP_002595719.1| hypothetical protein BRAFLDRAFT_56975 [Branchiostoma floridae]
 ref|XP_002595735.1| hypothetical protein BRAFLDRAFT_64865 [Branchiostoma floridae]
 ref|XP_002731238.1| PREDICTED: histone H3-like [Saccoglossus kowalevskii]
 ref|XP_002732482.1| PREDICTED: histone H3-like [Saccoglossus kowalevskii]
 ref|XP_002732963.1| PREDICTED: histone H3-like [Saccoglossus kowalevskii]
 ref|XP_002733415.1| PREDICTED: histone H3-like [Saccoglossus kowalevskii]
 ref|XP_002736572.1| PREDICTED: histone H3-like [Saccoglossus kowalevskii]
 ref|XP_002737855.1| PREDICTED: histone H3-like [Saccoglossus kowalevskii]
 ref|XP_002738083.1| PREDICTED: histone H3-like [Saccoglossus kowalevskii]
 ref|XP_002738089.1| PREDICTED: histone H3-like [Saccoglossus kowalevskii]
 ref|XP_002738203.1| PREDICTED: histone H3-like [Saccoglossus kowalevskii]
 ref|XP_002740695.1| PREDICTED: histone H3-like [Saccoglossus kowalevskii]
 ref|XP_002741072.1| PREDICTED: histone H3-like [Saccoglossus kowalevskii]
 ref|XP_002741741.1| PREDICTED: histone H3-like [Saccoglossus kowalevskii]
 ref|XP_002741826.1| PREDICTED: histone H3-like [Saccoglossus kowalevskii]
 ref|XP_002666951.1| PREDICTED: histone H3 [Danio rerio]
 ref|XP_002941390.1| PREDICTED: histone H3.2-like isoform X1 [Xenopus (Silurana) tropicalis]
 ref|XP_002942339.1| PREDICTED: histone H3.2-like [Xenopus (Silurana) tropicalis]
 ref|XP_002943524.1| PREDICTED: histone H3.2-like [Xenopus (Silurana) tropicalis]
 ref|XP_002944659.1| PREDICTED: histone H3.2-like [Xenopus (Silurana) tropicalis]
 ref|XP_002944964.1| PREDICTED: histone H3.2-like isoform 2 [Xenopus (Silurana) tropicalis]
 ref|XP_002944966.1| PREDICTED: histone H3.2-like [Xenopus (Silurana) tropicalis]
 ref|XP_002945363.1| PREDICTED: histone H3.2-like [Xenopus (Silurana) tropicalis]
 ref|XP_003221089.1| PREDICTED: histone H3 [Anolis carolinensis]
 ref|XP_003224524.1| PREDICTED: histone H3 [Anolis carolinensis]
 ref|XP_003227268.1| PREDICTED: histone H3 [Anolis carolinensis]
 ref|XP_001952101.2| PREDICTED: histone H3 [Acyrthosiphon pisum]
 ref|XP_003248421.1| PREDICTED: histone H3 [Acyrthosiphon pisum]
 ref|XP_003251619.1| PREDICTED: histone H3-like isoform 1 [Apis mellifera]
 ref|XP_003259200.1| PREDICTED: histone H3.2-like [Nomascus leucogenys]
 ref|XP_003355255.1| PREDICTED: histone H3.2-like [Sus scrofa]
 ref|XP_003391250.1| PREDICTED: histone H3 [Amphimedon queenslandica]
 ref|XP_003392965.1| PREDICTED: histone H3-like [Bombus terrestris]
 ref|XP_003392969.1| PREDICTED: histone H3-like [Bombus terrestris]
 ref|XP_003409561.1| PREDICTED: histone H3 [Loxodonta africana]
 ref|XP_003409565.1| PREDICTED: histone H3 [Loxodonta africana]
 ref|XP_001508660.2| PREDICTED: histone H3 [Ornithorhynchus anatinus]
 ref|XP_003424487.1| PREDICTED: histone H3 [Nasonia vitripennis]
 ref|XP_001599179.2| PREDICTED: histone H3 [Nasonia vitripennis]
 ref|XP_003425535.1| PREDICTED: histone H3 [Nasonia vitripennis]
 ref|XP_540285.2| PREDICTED: histone H3.2-like [Canis lupus familiaris]
 ref|XP_540290.2| PREDICTED: histone H3.2-like [Canis lupus familiaris]
 ref|XP_003451202.1| PREDICTED: histone H3.2-like [Oreochromis niloticus]
 ref|XP_003451214.1| PREDICTED: histone H3.2-like [Oreochromis niloticus]
 ref|XP_003457066.1| PREDICTED: histone H3.2-like isoform X1 [Oreochromis niloticus]
 ref|XP_003459141.1| PREDICTED: histone H3.2-like [Oreochromis niloticus]
 ref|XP_003459144.1| PREDICTED: histone H3.2-like [Oreochromis niloticus]
 ref|XP_003459573.1| PREDICTED: histone H3.2-like [Oreochromis niloticus]
 ref|XP_003460246.1| PREDICTED: histone H3.2-like [Oreochromis niloticus]
 ref|XP_003460381.1| PREDICTED: histone H3.2-like [Oreochromis niloticus]
 ref|XP_003463260.1| PREDICTED: histone H3.2-like [Cavia porcellus]
 ref|XP_003468833.1| PREDICTED: histone H3.2-like isoform X1 [Cavia porcellus]
 ref|XP_003478903.1| PREDICTED: histone H3.2-like [Cavia porcellus]
 ref|XP_003489849.1| PREDICTED: histone H3-like [Bombus impatiens]
 ref|XP_003489853.1| PREDICTED: histone H3-like [Bombus impatiens]
 ref|XP_003492166.1| PREDICTED: histone H3-like [Bombus impatiens]
 ref|XP_003502222.1| PREDICTED: histone H3 [Cricetulus griseus]
 ref|XP_003697960.1| PREDICTED: histone H3-like [Apis florea]
 ref|XP_003697994.1| PREDICTED: histone H3-like [Apis florea]
 ref|XP_003697995.1| PREDICTED: histone H3-like isoform 1 [Apis florea]
 ref|XP_003697996.1| PREDICTED: histone H3-like isoform 2 [Apis florea]
 ref|XP_003703729.1| PREDICTED: histone H3-like [Megachile rotundata]
 ref|XP_003703731.1| PREDICTED: histone H3-like [Megachile rotundata]
 ref|XP_003707914.1| PREDICTED: histone H3-like [Megachile rotundata]
 ref|XP_003768756.1| PREDICTED: histone H3.2-like [Sarcophilus harrisii]
 ref|XP_002834873.2| PREDICTED: histone H3 [Pongo abelii]
 ref|XP_003800470.1| PREDICTED: histone H3.2-like [Otolemur garnettii]
 ref|XP_003803809.1| PREDICTED: histone H3.2-like [Otolemur garnettii]
 ref|XP_003803812.1| PREDICTED: histone H3.2-like [Otolemur garnettii]
 ref|XP_003808846.1| PREDICTED: histone H3 [Pan paniscus]
 ref|XP_003942033.1| PREDICTED: histone H3 [Saimiri boliviensis boliviensis]
 ref|XP_003967841.1| PREDICTED: histone H3.2-like [Takifugu rubripes]
 ref|XP_003967881.1| PREDICTED: histone H3.2-like [Takifugu rubripes]
 ref|XP_003972552.1| PREDICTED: histone H3.2-like [Takifugu rubripes]
 ref|XP_003976988.1| PREDICTED: histone H3.2-like [Takifugu rubripes]
 ref|XP_003979103.1| PREDICTED: histone H3.2-like [Takifugu rubripes]
 ref|XP_003979222.1| PREDICTED: histone H3.2-like [Takifugu rubripes]
 ref|XP_003979633.1| PREDICTED: histone H3.2-like [Takifugu rubripes]
 ref|XP_003979798.1| PREDICTED: histone H3.2-like [Takifugu rubripes]
 ref|XP_003979802.1| PREDICTED: histone H3.2-like [Takifugu rubripes]
 ref|XP_004002478.1| PREDICTED: histone H3.2-like [Ovis aries]
 ref|XP_004026580.1| PREDICTED: histone H3.2-like isoform 1 [Gorilla gorilla gorilla]
 ref|XP_004026581.1| PREDICTED: histone H3.2-like isoform 2 [Gorilla gorilla gorilla]
 ref|XP_004026585.1| PREDICTED: histone H3.2-like [Gorilla gorilla gorilla]
 ref|XP_004026595.1| PREDICTED: histone H3.2-like [Gorilla gorilla gorilla]
 ref|XP_004076082.1| PREDICTED: histone H3 [Oryzias latipes]
 ref|XP_004175929.1| PREDICTED: histone H3.2-like [Taeniopygia guttata]
 ref|XP_004285166.1| PREDICTED: histone H3.2-like [Orcinus orca]
 ref|XP_004285171.1| PREDICTED: histone H3.2-like [Orcinus orca]
 ref|XP_004389662.1| PREDICTED: histone H3.2-like [Trichechus manatus latirostris]
 ref|XP_004404232.1| PREDICTED: histone H3.2-like [Odobenus rosmarus divergens]
 ref|XP_004461694.1| PREDICTED: histone H3.2-like [Dasypus novemcinctus]
 ref|XP_004461699.1| PREDICTED: histone H3.2-like [Dasypus novemcinctus]
 ref|XP_004556917.1| PREDICTED: histone H3.2-like [Maylandia zebra]
 ref|XP_004556983.1| PREDICTED: histone H3.2-like [Maylandia zebra]
 ref|XP_004564943.1| PREDICTED: histone H3.2-like [Maylandia zebra]
 ref|XP_004576159.1| PREDICTED: histone H3.2-like [Maylandia zebra]
 ref|XP_004588885.1| PREDICTED: histone H3.2-like [Ochotona princeps]
 ref|XP_004588887.1| PREDICTED: histone H3.2-like [Ochotona princeps]
 ref|XP_004588890.1| PREDICTED: histone H3.2-like [Ochotona princeps]
 ref|XP_004670879.1| PREDICTED: histone H3.2-like [Jaculus jaculus]
 ref|XP_004670895.1| PREDICTED: histone H3.2-like [Jaculus jaculus]
 ref|XP_004628473.1| PREDICTED: histone H3.2-like [Octodon degus]
 ref|XP_004628479.1| PREDICTED: histone H3.2-like [Octodon degus]
 ref|XP_004632476.1| PREDICTED: histone H3.2-like [Octodon degus]
 ref|XP_004640161.1| PREDICTED: histone H3.2-like [Octodon degus]
 ref|XP_004640166.1| PREDICTED: histone H3.2-like [Octodon degus]
 ref|XP_004640178.1| PREDICTED: histone H3.2-like [Octodon degus]
 ref|XP_004716622.1| PREDICTED: histone H3.2-like [Echinops telfairi]
 ref|XP_004782631.1| PREDICTED: histone H3.2-like [Mustela putorius furo]
 ref|XP_004821252.1| PREDICTED: histone H3.2-like [Mustela putorius furo]
 ref|XP_002943900.2| PREDICTED: histone H3.2-like [Xenopus (Silurana) tropicalis]
 ref|XP_004913874.1| PREDICTED: histone H3.2-like [Xenopus (Silurana) tropicalis]
 ref|XP_004913911.1| PREDICTED: histone H3.2-like [Xenopus (Silurana) tropicalis]
 ref|XP_004913918.1| PREDICTED: histone H3.2-like [Xenopus (Silurana) tropicalis]
 ref|XP_004913923.1| PREDICTED: histone H3.2-like [Xenopus (Silurana) tropicalis]
 ref|XP_004913929.1| PREDICTED: histone H3.2-like [Xenopus (Silurana) tropicalis]
 ref|XP_004915673.1| PREDICTED: histone H3.2-like [Xenopus (Silurana) tropicalis]
 ref|XP_004917039.1| PREDICTED: histone H3.2-like isoform X1 [Xenopus (Silurana) tropicalis]
 ref|XP_002945479.2| PREDICTED: histone H3.2-like [Xenopus (Silurana) tropicalis]
 ref|XP_004919085.1| PREDICTED: histone H3.2-like isoform X2 [Xenopus (Silurana) tropicalis]
 ref|XP_004919101.1| PREDICTED: histone H3.2-like [Xenopus (Silurana) tropicalis]
 ref|XP_002945274.2| PREDICTED: histone H3.2-like [Xenopus (Silurana) tropicalis]
 ref|XP_004919124.1| PREDICTED: histone H3.2-like [Xenopus (Silurana) tropicalis]
 ref|XP_004919171.1| PREDICTED: histone H3.2-like [Xenopus (Silurana) tropicalis]
 ref|XP_004919181.1| PREDICTED: histone H3.2-like [Xenopus (Silurana) tropicalis]
 ref|XP_004919334.1| PREDICTED: histone H3.2-like [Xenopus (Silurana) tropicalis]
 ref|XP_002944235.2| PREDICTED: histone H3.2-like [Xenopus (Silurana) tropicalis]
 ref|XP_004934098.1| PREDICTED: histone H3-like [Bombyx mori]
 ref|XP_004934117.1| PREDICTED: histone H3-like [Bombyx mori]
 ref|XP_004934133.1| PREDICTED: histone H3-like [Bombyx mori]
 ref|XP_004934172.1| PREDICTED: histone H3-like [Bombyx mori]
 ref|XP_004934194.1| PREDICTED: histone H3-like [Bombyx mori]
 ref|XP_004847622.1| PREDICTED: histone H3.2-like [Heterocephalus glaber]
 ref|XP_004847875.1| PREDICTED: histone H3.2-like [Heterocephalus glaber]
 ref|XP_004853987.1| PREDICTED: histone H3.2-like [Heterocephalus glaber]
 ref|XP_004853991.1| PREDICTED: histone H3.2-like [Heterocephalus glaber]
 ref|XP_004937729.1| PREDICTED: histone H3.2-like [Gallus gallus]
 ref|XP_005003349.1| PREDICTED: histone H3.2-like isoform X2 [Cavia porcellus]
 ref|XP_005007814.1| PREDICTED: histone H3.2-like [Cavia porcellus]
 ref|XP_005007816.1| PREDICTED: histone H3.2-like [Cavia porcellus]
 ref|XP_005012214.1| PREDICTED: histone H3.2-like [Anas platyrhynchos]
 ref|XP_005012216.1| PREDICTED: histone H3.2-like [Anas platyrhynchos]
 ref|XP_005012224.1| PREDICTED: histone H3.2-like [Anas platyrhynchos]
 ref|XP_005012227.1| PREDICTED: histone H3.2-like isoform X1 [Anas platyrhynchos]
 ref|XP_005012228.1| PREDICTED: histone H3.2-like isoform X2 [Anas platyrhynchos]
 ref|XP_005012229.1| PREDICTED: histone H3.2-like [Anas platyrhynchos]
 ref|XP_005012232.1| PREDICTED: histone H3.2-like [Anas platyrhynchos]
 ref|XP_005110442.1| PREDICTED: histone H3-like [Aplysia californica]
 ref|XP_005066529.1| PREDICTED: histone H3.2-like [Mesocricetus auratus]
 ref|XP_005039661.1| PREDICTED: histone H3.2-like [Ficedula albicollis]
 ref|XP_005039662.1| PREDICTED: histone H3.2-like [Ficedula albicollis]
 ref|XP_005039665.1| PREDICTED: histone H3.2-like [Ficedula albicollis]
 ref|XP_005039667.1| PREDICTED: histone H3.2-like [Ficedula albicollis]
 ref|XP_005039673.1| PREDICTED: histone H3.2-like [Ficedula albicollis]
 ref|XP_005062980.1| PREDICTED: histone H3.2-like [Ficedula albicollis]
 ref|XP_005150321.1| PREDICTED: histone H3.2-like [Melopsittacus undulatus]
 ref|XP_005150329.1| PREDICTED: histone H3.2-like isoform X1 [Melopsittacus undulatus]
 ref|XP_005150330.1| PREDICTED: histone H3.2-like isoform X2 [Melopsittacus undulatus]
 ref|XP_005150332.1| PREDICTED: histone H3.2-like [Melopsittacus undulatus]
 ref|XP_002666952.2| PREDICTED: histone H3 [Danio rerio]
 ref|XP_005308989.1| PREDICTED: histone H3 [Chrysemys picta bellii]
 ref|XP_005355003.1| PREDICTED: histone H3.2-like [Microtus ochrogaster]
 ref|XP_005355005.1| PREDICTED: histone H3.2-like [Microtus ochrogaster]
 ref|XP_005331191.1| PREDICTED: histone H3.2-like [Ictidomys tridecemlineatus]
 ref|XP_005331196.1| PREDICTED: histone H3.2-like [Ictidomys tridecemlineatus]
 ref|XP_005337112.1| PREDICTED: histone H3.2-like [Ictidomys tridecemlineatus]
 ref|XP_005399005.1| PREDICTED: histone H3.2-like [Chinchilla lanigera]
 ref|XP_005403357.1| PREDICTED: histone H3.2-like [Chinchilla lanigera]
 ref|XP_005403365.1| PREDICTED: histone H3.2-like [Chinchilla lanigera]
 ref|XP_005403367.1| PREDICTED: histone H3.2-like [Chinchilla lanigera]
 ref|XP_005441372.1| PREDICTED: histone H3.2-like [Falco cherrug]
 ref|XP_005480799.1| PREDICTED: histone H3.2-like [Zonotrichia albicollis]
 ref|XP_005455907.1| PREDICTED: histone H3.2-like [Oreochromis niloticus]
 ref|XP_005459205.1| PREDICTED: histone H3.2-like [Oreochromis niloticus]
 ref|XP_005462224.1| PREDICTED: histone H3.2-like [Oreochromis niloticus]
 ref|XP_005463512.1| PREDICTED: histone H3.2-like [Oreochromis niloticus]
 ref|XP_005519546.1| PREDICTED: histone H3.2-like isoform X1 [Pseudopodoces humilis]
 ref|XP_005519547.1| PREDICTED: histone H3.2-like isoform X2 [Pseudopodoces humilis]
 ref|XP_005519549.1| PREDICTED: histone H3.2-like isoform X2 [Pseudopodoces humilis]
 ref|XP_005519556.1| PREDICTED: histone H3.2-like [Pseudopodoces humilis]
 ref|XP_005519557.1| PREDICTED: histone H3.2-like [Pseudopodoces humilis]
 ref|XP_005527767.1| PREDICTED: histone H3.2-like [Pseudopodoces humilis]
 ref|XP_005527780.1| PREDICTED: histone H3.2-like isoform X2 [Pseudopodoces humilis]
 ref|XP_005527783.1| PREDICTED: histone H3.2-like [Pseudopodoces humilis]
 ref|XP_005505469.1| PREDICTED: histone H3.2-like [Columba livia]
 ref|XP_005515111.1| PREDICTED: histone H3.2-like [Columba livia]
 ref|XP_005515112.1| PREDICTED: histone H3.2-like [Columba livia]
 ref|XP_005515115.1| PREDICTED: histone H3.2-like [Columba livia]
 ref|XP_005515124.1| PREDICTED: histone H3.2-like [Columba livia]
 ref|XP_005515125.1| PREDICTED: histone H3.2-like [Columba livia]
 ref|XP_005542115.1| PREDICTED: histone H3.2-like [Macaca fascicularis]
 ref|XP_005630793.1| PREDICTED: histone H3.2-like [Canis lupus familiaris]
 ref|XP_005663570.1| PREDICTED: histone H3.2-like isoform X1 [Sus scrofa]
 ref|XP_005663571.1| PREDICTED: histone H3.2-like isoform X2 [Sus scrofa]
 ref|XP_005734222.1| PREDICTED: histone H3.2-like [Pundamilia nyererei]
 ref|XP_005750283.1| PREDICTED: histone H3.2-like [Pundamilia nyererei]
 ref|XP_005751312.1| PREDICTED: histone H3.2-like [Pundamilia nyererei]
 ref|XP_005755872.1| PREDICTED: histone H3.2-like [Pundamilia nyererei]
 ref|XP_005811245.1| PREDICTED: histone H3.2-like [Xiphophorus maculatus]
 ref|XP_005815223.1| PREDICTED: histone H3.2-like [Xiphophorus maculatus]
 ref|XP_005817667.1| PREDICTED: histone H3.2-like [Xiphophorus maculatus]
 ref|XP_005817698.1| PREDICTED: histone H3.2-like [Xiphophorus maculatus]
 ref|XP_005937149.1| PREDICTED: histone H3.2-like [Haplochromis burtoni]
 ref|XP_005949985.1| PREDICTED: histone H3.2-like [Haplochromis burtoni]
 ref|XP_005959640.1| PREDICTED: histone H3.2-like [Pantholops hodgsonii]
 ref|XP_006014939.1| PREDICTED: histone H3.2-like [Alligator sinensis]
 ref|XP_006014941.1| PREDICTED: histone H3.2-like [Alligator sinensis]
 ref|XP_006024238.1| PREDICTED: histone H3.2-like isoform X2 [Alligator sinensis]
 ref|XP_006095231.1| PREDICTED: histone H3.2-like [Myotis lucifugus]
 ref|XP_006125953.1| PREDICTED: histone H3.2-like [Pelodiscus sinensis]
 ref|XP_006125959.1| PREDICTED: histone H3.2-like isoform X2 [Pelodiscus sinensis]
 ref|XP_006125973.1| PREDICTED: histone H3.2-like [Pelodiscus sinensis]
 ref|XP_006128691.1| PREDICTED: histone H3.2-like [Pelodiscus sinensis]
 ref|XP_006186635.1| PREDICTED: histone H3.2-like [Camelus ferus]
 ref|XP_006195501.1| PREDICTED: histone H3.2-like [Camelus ferus]
 ref|XP_006216974.1| PREDICTED: histone H3.2-like [Vicugna pacos]
 ref|XP_006219813.1| PREDICTED: histone H3.2-like [Vicugna pacos]
 ref|XP_006268900.1| PREDICTED: histone H3.2-like [Alligator mississippiensis]
 ref|XP_006269558.1| PREDICTED: histone H3.2-like [Alligator mississippiensis]
 ref|XP_006222468.1| PREDICTED: histone H3 [Rattus norvegicus]
 ref|XP_006254052.1| PREDICTED: histone H3 [Rattus norvegicus]
 ref|XP_006570899.1| PREDICTED: histone H3-like [Apis mellifera]
 ref|XP_006618073.1| PREDICTED: histone H3-like [Apis dorsata]
 ref|XP_006621110.1| PREDICTED: histone H3-like [Apis dorsata]
 ref|XP_006621124.1| PREDICTED: histone H3-like [Apis dorsata]
 ref|XP_006665102.1| PREDICTED: histone H3-like [Oryza brachyantha]
 ref|XP_006781035.1| PREDICTED: histone H3.2-like [Neolamprologus brichardi]
 ref|XP_006781085.1| PREDICTED: histone H3.2-like [Neolamprologus brichardi]
 ref|XP_006781097.1| PREDICTED: histone H3.2-like [Neolamprologus brichardi]
 ref|XP_006808339.1| PREDICTED: histone H3.2-like [Neolamprologus brichardi]
 ref|XP_006750234.1| PREDICTED: histone H3.2-like [Leptonychotes weddellii]
 ref|XP_006750238.1| PREDICTED: histone H3.2-like [Leptonychotes weddellii]
 ref|XP_006820299.1| PREDICTED: histone H3-like [Saccoglossus kowalevskii]
 ref|XP_006902296.1| PREDICTED: histone H3.2-like [Elephantulus edwardii]
 ref|XP_006902299.1| PREDICTED: histone H3.2-like [Elephantulus edwardii]
 ref|XP_006861408.1| PREDICTED: histone H3.2-like isoform X1 [Chrysochloris asiatica]
 ref|XP_006861409.1| PREDICTED: histone H3.2-like isoform X2 [Chrysochloris asiatica]
 ref|XP_006982638.1| PREDICTED: histone H3.2-like [Peromyscus maniculatus bairdii]
 ref|XP_006993207.1| PREDICTED: histone H3.2-like [Peromyscus maniculatus bairdii]
 ref|XP_006993210.1| PREDICTED: histone H3.2-like [Peromyscus maniculatus bairdii]
 ref|XP_006993226.1| PREDICTED: histone H3.2-like [Peromyscus maniculatus bairdii]
 ref|XP_007070175.1| PREDICTED: histone H3.2-like [Chelonia mydas]
 ref|XP_007064098.1| PREDICTED: histone H3.2-like isoform X1 [Chelonia mydas]
 ref|XP_007064099.1| PREDICTED: histone H3.2-like isoform X2 [Chelonia mydas]
 ref|XP_006049258.1| PREDICTED: histone H3.2-like [Bubalus bubalis]
 ref|XP_006049260.1| PREDICTED: histone H3.2-like [Bubalus bubalis]
 ref|XP_007178006.1| PREDICTED: histone H3.2-like [Balaenoptera acutorostrata scammoni]
 ref|XP_007423264.1| PREDICTED: histone H3.2-like isoform X1 [Python bivittatus]
 ref|XP_007423265.1| PREDICTED: histone H3.2-like isoform X2 [Python bivittatus]
 ref|XP_007427782.1| PREDICTED: histone H3.2-like [Python bivittatus]
 ref|XP_007445389.1| PREDICTED: histone H3.2-like [Python bivittatus]
 ref|XP_007483142.1| PREDICTED: histone H3.2-like [Monodelphis domestica]
 ref|XP_007555955.1| PREDICTED: histone H3 [Poecilia formosa]
 ref|XP_007561740.1| PREDICTED: histone H3 [Poecilia formosa]
 ref|XP_007561744.1| PREDICTED: histone H3 [Poecilia formosa]
 ref|XP_007574072.1| PREDICTED: histone H3 [Poecilia formosa]
 ref|XP_007575250.1| PREDICTED: histone H3 [Poecilia formosa]
 ref|XP_007541924.1| PREDICTED: histone H3 [Poecilia formosa]
 ref|XP_007531637.1| PREDICTED: histone H3 [Erinaceus europaeus]
 ref|XP_007534740.1| PREDICTED: histone H3 [Erinaceus europaeus]
 ref|XP_007640990.1| PREDICTED: histone H3 [Cricetulus griseus]
 ref|XP_007634641.1| PREDICTED: histone H3 [Cricetulus griseus]
 ref|XP_007634657.1| PREDICTED: histone H3 isoform X2 [Cricetulus griseus]
 ref|XP_007883034.1| PREDICTED: histone H3 [Callorhinchus milii]
 ref|XP_007949167.1| PREDICTED: histone H3 [Orycteropus afer afer]
 ref|XP_007949170.1| PREDICTED: histone H3 [Orycteropus afer afer]
 ref|XP_008018003.1| PREDICTED: histone H3 [Chlorocebus sabaeus]
 ref|XP_008115366.1| PREDICTED: histone H3 [Anolis carolinensis]
 ref|XP_008190047.1| PREDICTED: histone H3 [Acyrthosiphon pisum]
 ref|XP_008190048.1| PREDICTED: histone H3 [Acyrthosiphon pisum]
 ref|XP_008172411.1| PREDICTED: histone H3 [Chrysemys picta bellii]
 ref|XP_008262731.1| PREDICTED: LOW QUALITY PROTEIN: histone H3-like [Oryctolagus 
cuniculus]
 ref|XP_008278491.1| PREDICTED: histone H3 [Stegastes partitus]
 ref|XP_008292395.1| PREDICTED: histone H3 [Stegastes partitus]
 ref|XP_008294073.1| PREDICTED: histone H3 [Stegastes partitus]
 ref|XP_008308957.1| PREDICTED: histone H3 [Cynoglossus semilaevis]
 ref|XP_008412290.1| PREDICTED: histone H3 [Poecilia reticulata]
 ref|XP_008419898.1| PREDICTED: histone H3 [Poecilia reticulata]
 ref|XP_008477668.1| PREDICTED: histone H3 [Diaphorina citri]
 ref|XP_008479071.1| PREDICTED: histone H3 [Diaphorina citri]
 ref|XP_008482959.1| PREDICTED: histone H3 [Diaphorina citri]
 ref|XP_008482965.1| PREDICTED: histone H3 [Diaphorina citri]
 ref|XP_008482968.1| PREDICTED: histone H3 [Diaphorina citri]
 ref|XP_008484708.1| PREDICTED: histone H3 [Diaphorina citri]
 ref|XP_008495139.1| PREDICTED: histone H3 [Calypte anna]
 ref|XP_008491721.1| PREDICTED: histone H3 [Calypte anna]
 ref|XP_008560152.1| PREDICTED: histone H3 [Microplitis demolitor]
 ref|XP_008560312.1| PREDICTED: histone H3 [Microplitis demolitor]
 ref|XP_008560345.1| PREDICTED: histone H3 [Microplitis demolitor]
 ref|XP_008545619.1| PREDICTED: histone H3 [Microplitis demolitor]
 ref|XP_008545947.1| PREDICTED: histone H3 [Microplitis demolitor]
 ref|XP_008548645.1| PREDICTED: histone H3 [Microplitis demolitor]
 ref|XP_008550905.1| PREDICTED: histone H3 [Microplitis demolitor]
 ref|XP_008552420.1| PREDICTED: histone H3 [Microplitis demolitor]
 ref|XP_008556698.1| PREDICTED: histone H3 [Microplitis demolitor]
 ref|XP_008557900.1| PREDICTED: histone H3 [Microplitis demolitor]
 ref|XP_008557955.1| PREDICTED: histone H3 [Microplitis demolitor]
 ref|XP_008583791.1| PREDICTED: histone H3 [Galeopterus variegatus]
 ref|XP_008634730.1| PREDICTED: histone H3 [Corvus brachyrhynchos]
 ref|XP_008634732.1| PREDICTED: histone H3 isoform X2 [Corvus brachyrhynchos]
 ref|XP_008693968.1| PREDICTED: histone H3 [Ursus maritimus]
 ref|XP_008772193.1| PREDICTED: histone H3 [Rattus norvegicus]
 ref|XP_008759568.1| PREDICTED: histone H3 [Rattus norvegicus]
 ref|XP_008769899.1| PREDICTED: histone H3 [Rattus norvegicus]
 ref|XP_008824858.1| PREDICTED: histone H3 [Nannospalax galili]
 ref|XP_008830081.1| PREDICTED: histone H3 [Nannospalax galili]
 ref|XP_008830090.1| PREDICTED: histone H3 [Nannospalax galili]
 ref|XP_008830109.1| PREDICTED: histone H3 [Nannospalax galili]
 ref|XP_008841937.1| PREDICTED: histone H3 [Nannospalax galili]
 ref|XP_008958392.1| PREDICTED: histone H3 [Pan paniscus]
 ref|XP_008982500.1| PREDICTED: histone H3 [Callithrix jacchus]
 ref|XP_009017733.1| hypothetical protein HELRODRAFT_79198 [Helobdella robusta]
 ref|XP_009018939.1| hypothetical protein HELRODRAFT_92562 [Helobdella robusta]
 ref|XP_009021573.1| hypothetical protein HELRODRAFT_92640 [Helobdella robusta]
 ref|XP_009022419.1| hypothetical protein HELRODRAFT_92700 [Helobdella robusta]
 ref|XP_009052125.1| hypothetical protein LOTGIDRAFT_147117 [Lottia gigantea]
 ref|XP_009054644.1| hypothetical protein LOTGIDRAFT_176709 [Lottia gigantea]
 ref|XP_009056376.1| hypothetical protein LOTGIDRAFT_145440 [Lottia gigantea]
 ref|XP_009059094.1| hypothetical protein LOTGIDRAFT_147816 [Lottia gigantea]
 ref|XP_009059299.1| hypothetical protein LOTGIDRAFT_147849 [Lottia gigantea]
 ref|XP_009065730.1| hypothetical protein LOTGIDRAFT_146472 [Lottia gigantea]
 ref|XP_009067270.1| hypothetical protein LOTGIDRAFT_148546 [Lottia gigantea]
 ref|XP_009084837.1| PREDICTED: histone H3 [Serinus canaria]
 ref|XP_009084840.1| PREDICTED: histone H3 [Serinus canaria]
 ref|XP_009084853.1| PREDICTED: histone H3 [Serinus canaria]
 ref|XP_009197942.1| PREDICTED: histone H3 [Papio anubis]
 ref|XP_009288329.1| PREDICTED: histone H3 [Aptenodytes forsteri]
 ref|XP_009288342.1| PREDICTED: histone H3 [Aptenodytes forsteri]
 ref|XP_009243259.1| PREDICTED: histone H3 [Pongo abelii]
 ref|XP_009296460.1| PREDICTED: histone H3 [Danio rerio]
 ref|XP_009296462.1| PREDICTED: histone H3 [Danio rerio]
 ref|XP_009428350.1| PREDICTED: histone H3 [Pan troglodytes]
 ref|XP_009428464.1| PREDICTED: histone H3 [Pan troglodytes]
 ref|XP_009675852.1| PREDICTED: histone H3 [Struthio camelus australis]
 ref|XP_009638415.1| PREDICTED: histone H3 [Egretta garzetta]
 ref|XP_009896818.1| PREDICTED: histone H3 [Picoides pubescens]
 ref|XP_009896826.1| PREDICTED: histone H3 [Picoides pubescens]
 ref|XP_009896827.1| PREDICTED: histone H3 [Picoides pubescens]
 ref|XP_009896828.1| PREDICTED: histone H3 [Picoides pubescens]
 ref|XP_010186631.1| PREDICTED: histone H3 [Mesitornis unicolor]
 ref|XP_010211924.1| PREDICTED: histone H3 [Tinamus guttatus]
 ref|XP_010211925.1| PREDICTED: histone H3 [Tinamus guttatus]
 ref|XP_010216917.1| PREDICTED: histone H3 [Tinamus guttatus]
 ref|XP_010223167.1| PREDICTED: histone H3 isoform X1 [Tinamus guttatus]
 ref|XP_010223168.1| PREDICTED: histone H3 isoform X2 [Tinamus guttatus]
 ref|XP_010371591.1| PREDICTED: histone H3 [Rhinopithecus roxellana]
 ref|XP_010374671.1| PREDICTED: histone H3 [Rhinopithecus roxellana]
 ref|XP_010353240.1| PREDICTED: histone H3 [Rhinopithecus roxellana]
 ref|XP_010409007.1| PREDICTED: histone H3 [Corvus cornix cornix]
 ref|XP_010409008.1| PREDICTED: histone H3 [Corvus cornix cornix]
 ref|XP_010409015.1| PREDICTED: histone H3 [Corvus cornix cornix]
 ref|XP_010409018.1| PREDICTED: histone H3 [Corvus cornix cornix]
 ref|XP_010567513.1| PREDICTED: histone H3 [Haliaeetus leucocephalus]
 ref|XP_010567521.1| PREDICTED: histone H3 [Haliaeetus leucocephalus]
 ref|XP_010567525.1| PREDICTED: histone H3 [Haliaeetus leucocephalus]
 ref|XP_010621019.1| PREDICTED: histone H3 [Fukomys damarensis]
 ref|XP_010621295.1| PREDICTED: histone H3 [Fukomys damarensis]
 ref|XP_010634567.1| PREDICTED: histone H3 isoform X1 [Fukomys damarensis]
 ref|XP_010725973.1| PREDICTED: histone H3 [Meleagris gallopavo]
 ref|XP_010746616.1| PREDICTED: histone H3 [Larimichthys crocea]
 ref|XP_010754598.1| PREDICTED: histone H3 [Larimichthys crocea]
 ref|XP_010754652.1| PREDICTED: histone H3 [Larimichthys crocea]
 ref|XP_010825132.1| PREDICTED: histone H3 [Bos taurus]
 ref|XP_010837041.1| PREDICTED: histone H3 [Bison bison bison]
 ref|XP_010837046.1| PREDICTED: histone H3 [Bison bison bison]
 ref|XP_010956830.1| PREDICTED: histone H3 [Camelus bactrianus]
 ref|XP_011057615.1| PREDICTED: histone H3 [Acromyrmex echinatior]
 ref|XP_011062466.1| PREDICTED: histone H3 [Acromyrmex echinatior]
 ref|XP_011151028.1| PREDICTED: histone H3 [Harpegnathos saltator]
 ref|XP_011166327.1| PREDICTED: histone H3 [Solenopsis invicta]
 ref|XP_011165753.1| PREDICTED: histone H3 [Solenopsis invicta]
 ref|XP_011216220.1| PREDICTED: histone H3 [Ailuropoda melanoleuca]
 ref|XP_011268848.1| PREDICTED: histone H3 [Camponotus floridanus]
 ref|XP_011264340.1| PREDICTED: histone H3 [Camponotus floridanus]
 ref|XP_011265838.1| PREDICTED: histone H3 [Camponotus floridanus]
 ref|XP_011311110.1| PREDICTED: histone H3 [Fopius arisanus]
 ref|XP_011312022.1| PREDICTED: histone H3 [Fopius arisanus]
 ref|XP_011313108.1| PREDICTED: histone H3 [Fopius arisanus]
 ref|XP_011350491.1| PREDICTED: histone H3 [Cerapachys biroi]
 ref|XP_011416643.1| PREDICTED: histone H3 [Crassostrea gigas]
 ref|XP_011416652.1| PREDICTED: histone H3 [Crassostrea gigas]
 ref|XP_011478933.1| PREDICTED: histone H3 [Oryzias latipes]
 ref|XP_011473870.1| PREDICTED: histone H3 [Oryzias latipes]
 ref|XP_011479935.1| PREDICTED: histone H3 [Oryzias latipes]
 ref|XP_011472070.1| PREDICTED: histone H3 [Oryzias latipes]
 ref|XP_011491737.1| PREDICTED: histone H3 [Oryzias latipes]
 ref|XP_011495696.1| PREDICTED: histone H3 [Ceratosolen solmsi marchali]
 ref|XP_011496729.1| PREDICTED: histone H3 [Ceratosolen solmsi marchali]
 ref|XP_011497548.1| PREDICTED: histone H3 [Ceratosolen solmsi marchali]
 ref|XP_011501815.1| PREDICTED: histone H3 [Ceratosolen solmsi marchali]
 ref|XP_011501822.1| PREDICTED: histone H3 [Ceratosolen solmsi marchali]
 sp|P02299.4|H3_DROME RecName: Full=Histone H3 [Drosophila melanogaster]
 sp|P84230.2|H32_CAIMO RecName: Full=Histone H3.2 [Cairina moschata]
 sp|P84234.2|H32_ONCMY RecName: Full=Histone H3.2 [Oncorhynchus mykiss]
 sp|P84235.2|H3_PLADU RecName: Full=Histone H3 [Platynereis dumerilii]
 sp|P84236.2|H3_DROHY RecName: Full=Histone H3 [Drosophila hydei]
 sp|P84237.2|H3_TIGCA RecName: Full=Histone H3 [Tigriopus californicus]
 sp|P84238.2|H3_CHITH RecName: Full=Histone H3; Short=H3 [Chironomus thummi thummi]
 sp|P84239.2|H3_URECA RecName: Full=Histone H3 [Urechis caupo]
 sp|P84228.2|H32_MOUSE RecName: Full=Histone H3.2 [Mus musculus]
 sp|P84229.2|H32_CHICK RecName: Full=Histone H3.2; AltName: Full=Histone H3 class I 
[Gallus gallus]
 sp|P84233.2|H32_XENLA RecName: Full=Histone H3.2 [Xenopus laevis]
 sp|Q71DI3.3|H32_HUMAN RecName: Full=Histone H3.2; AltName: Full=Histone H3/m; AltName: 
Full=Histone H3/o [Homo sapiens]
 sp|Q6LBE8.3|H32_MUSPA RecName: Full=Histone H3.2 [Mus pahari]
 sp|Q4QRF4.3|H32_DANRE RecName: Full=Histone H3.2 [Danio rerio]
 sp|Q28D37.3|H32_XENTR RecName: Full=Histone H3.2 [Xenopus (Silurana) tropicalis]
 sp|P84227.2|H32_BOVIN RecName: Full=Histone H3.2 [Bos taurus]
 sp|P84231.2|H32_ICTBU RecName: Full=Histone H3.2 [Ictiobus bubalus]
 sp|P84232.2|H32_PORAF RecName: Full=Histone H3.2 [Poroderma africanum]
 pir||S09655 histone H3 - fruit fly (Drosophila hydei)
 pir||A56618 histone H3 - spoonworm (Urechis caupo)
 pir||A56654 histone H3 - Tigriopus californicus
 pir||A56580 histone H3 - midge (Chironomus thummi thummi)
 pir||I49397 histone H3.2 protein - shrew mouse
 pdb|2HIO|C Chain C, Histone Octamer (Chicken), Chromosomal Protein
 pdb|1EQZ|C Chain C, X-Ray Structure Of The Nucleosome Core Particle At 2.5 
A Resolution
 pdb|1EQZ|G Chain G, X-Ray Structure Of The Nucleosome Core Particle At 2.5 
A Resolution
 pdb|1HQ3|C Chain C, Crystal Structure Of The Histone-Core-Octamer In KclPHOSPHATE
 pdb|1HQ3|G Chain G, Crystal Structure Of The Histone-Core-Octamer In KclPHOSPHATE
 pdb|1TZY|C Chain C, Crystal Structure Of The Core-Histone Octamer To 1.90 
Angstrom Resolution
 pdb|1TZY|G Chain G, Crystal Structure Of The Core-Histone Octamer To 1.90 
Angstrom Resolution
 pdb|2ARO|C Chain C, Crystal Structure Of The Native Histone Octamer To 2.1 
Angstrom Resolution, Crystalised In The Presence Of S-nitrosoglutathione
 pdb|2ARO|G Chain G, Crystal Structure Of The Native Histone Octamer To 2.1 
Angstrom Resolution, Crystalised In The Presence Of S-nitrosoglutathione
 pdb|2F8N|A Chain A, 2.9 Angstrom X-Ray Structure Of Hybrid Macroh2a Nucleosomes
 pdb|2F8N|E Chain E, 2.9 Angstrom X-Ray Structure Of Hybrid Macroh2a Nucleosomes
 pdb|4LD9|A Chain A, Crystal Structure Of The N-terminally Acetylated Bah 
Domain Of Sir3 Bound To The Nucleosome Core Particle
 pdb|4LD9|E Chain E, Crystal Structure Of The N-terminally Acetylated Bah 
Domain Of Sir3 Bound To The Nucleosome Core Particle
 pdb|4KGC|A Chain A, Nucleosome Core Particle Containing (eta6-p-cymene)-(1, 
2- Ethylenediamine)-ruthenium
 pdb|4KGC|E Chain E, Nucleosome Core Particle Containing (eta6-p-cymene)-(1, 
2- Ethylenediamine)-ruthenium
 pdb|4UUZ|A Chain A, Mcm2-histone Complex
 gb|AAK58062.1|AF378198_2 histone H3 [Rhynchosciara americana]
 emb|CAA39771.1| histone H3 [Chironomus thummi]
 emb|CAA36805.1| histone H3 [Drosophila hydei]
 emb|CAA34919.1| unnamed protein product [Drosophila hydei]
 emb|CAA37417.1| unnamed protein product [Platynereis dumerilii]
 emb|CAA36638.1| histone H3 [Tigriopus californicus]
 emb|CAA41696.1| H3 histone [Urechis caupo]
 emb|CAA25840.1| unnamed protein product [Mus musculus]
 emb|CAA32855.1| unnamed protein product [Cairina moschata]
 emb|CAA32856.1| unnamed protein product [Cairina moschata]
 emb|CAA26138.1| unnamed protein product [Gallus gallus]
 emb|CAA44180.1| histone H3-IV [Gallus gallus]
 emb|CAA44181.1| histone H3-V [Gallus gallus]
 emb|CAA25529.1| unnamed protein product [Oncorhynchus mykiss]
 emb|CAA26813.1| unnamed protein product [Xenopus laevis]
 emb|CAA26818.1| unnamed protein product [Xenopus laevis]
 emb|CAA26890.1| unnamed protein product [Xenopus laevis]
 gb|AAC41552.1| histone H3 [Tigriopus californicus]
 gb|AAA48796.1| histone H3 [Gallus gallus]
 gb|AAA49765.1| histone H3 [Xenopus laevis]
 emb|CAA51324.1| histone H3 [Chironomus thummi]
 gb|AAA37764.1| histone H3.2 [Mus musculus domesticus]
 gb|AAA37810.1| histone H3 [Mus musculus]
 gb|AAA37812.1| histone H3 [Mus musculus]
 gb|AAA49770.1| histone H3 [Xenopus laevis]
 emb|CAA56577.1| histone H3 protein [Mus musculus]
 emb|CAA56573.1| histone H3.2 protein [Mus pahari]
 gb|AAB04760.1| histone H3.2-F [Mus musculus]
 gb|AAB04764.1| histone H3.2-B [Mus musculus]
 gb|AAB04771.1| histone H3.2-615 [Mus musculus]
 gb|AAB04772.1| histone H3.2-616 [Mus musculus]
 gb|AAC60003.1| histone H3-VI [Gallus gallus]
 gb|AAC60004.1| histone H3-VII [Gallus gallus]
 gb|AAC60005.1| histone H3-VIII [Gallus gallus]
 gb|AAC15916.1| histone H3 [Chaetopterus variopedatus]
 dbj|BAA93621.1| histone H3 [Drosophila melanogaster]
 dbj|BAA93622.1| histone H3 [Drosophila simulans]
 dbj|BAA93623.1| histone H3 [Drosophila sechellia]
 dbj|BAA93624.1| histone H3 [Drosophila mauritiana]
 dbj|BAA93625.1| histone H3 [Drosophila teissieri]
 dbj|BAA93626.1| histone H3 [Drosophila yakuba]
 dbj|BAA93628.1| histone H3 [Drosophila orena]
 dbj|BAB26714.1| unnamed protein product [Mus musculus]
 dbj|BAB32097.1| unnamed protein product [Mus musculus]
 gb|AAH15270.1| Histone cluster 2, H3c2 [Mus musculus]
 gb|AAL54861.1| histone H3 [Aplysia californica]
 gb|AAN11127.1| histone H3 [Drosophila melanogaster]
 emb|CAD37818.1| histone H3 [Mytilus edulis]
 emb|CAD37822.1| histone H3 [Mytilus edulis]
 emb|CAD37824.1| histone H3 [Mytilus edulis]
 gb|AAN39283.1| histone H3 [Homo sapiens]
 gb|AAO06251.1| histone protein Hist2h2bb [Mus musculus]
 gb|AAO06257.1| histone protein Hist1h3f [Mus musculus]
 gb|AAO06258.1| histone protein Hist1h3e [Mus musculus]
 gb|AAO06259.1| histone protein Hist1h3d [Mus musculus]
 gb|AAO06260.1| histone protein Hist1h3c [Mus musculus]
 gb|AAO06261.1| histone protein Hist1h3b [Mus musculus]
 gb|AAO06265.1| histone protein Hist2h3b [Mus musculus]
 gb|AAP94646.1| histone H3 [Mytilus galloprovincialis]
 gb|AAP94666.1| histone H3 [Mytilus trossulus]
 gb|AAP94667.1| histone H3 [Mytilus galloprovincialis]
 gb|AAP94668.1| histone H3 [Mytilus edulis]
 dbj|BAD02415.1| histone 3 [Drosophila takahashii]
 dbj|BAD02416.1| histone 3 [Drosophila ficusphila]
 dbj|BAD02417.1| histone 3 [Drosophila immigrans]
 dbj|BAD02418.1| histone 3 [Drosophila lutescens]
 dbj|BAD02419.1| histone 3 [Drosophila americana]
 emb|CAF89505.1| unnamed protein product [Tetraodon nigroviridis]
 emb|CAF97259.1| unnamed protein product [Tetraodon nigroviridis]
 emb|CAF98791.1| unnamed protein product [Tetraodon nigroviridis]
 emb|CAF98798.1| unnamed protein product, partial [Tetraodon nigroviridis]
 emb|CAF98835.1| unnamed protein product, partial [Tetraodon nigroviridis]
 gb|AAT68254.1| histone H3/o [Homo sapiens]
 emb|CAI12559.1| histone cluster 2, H3d [Homo sapiens]
 emb|CAI12561.1| histone cluster 2, H3c [Homo sapiens]
 emb|CAI12566.1| histone cluster 2, H3a [Homo sapiens]
 gb|AAH97060.1| Zgc:113984 [Danio rerio]
 gb|AAZ66481.1| histone H3 [Drosophila melanogaster]
 gb|AAZ66485.1| histone H3 [Drosophila melanogaster]
 gb|AAZ66490.1| histone H3 [Drosophila melanogaster]
 gb|AAZ66494.1| histone H3 [Drosophila melanogaster]
 gb|AAZ66499.1| histone H3 [Drosophila melanogaster]
 gb|AAZ66504.1| histone H3 [Drosophila melanogaster]
 gb|AAZ66509.1| histone H3 [Drosophila melanogaster]
 gb|AAZ66514.1| histone H3 [Drosophila melanogaster]
 gb|AAZ66519.1| histone H3 [Drosophila melanogaster]
 gb|AAZ66524.1| histone H3 [Drosophila melanogaster]
 gb|AAZ66529.1| histone H3 [Drosophila melanogaster]
 gb|AAZ66534.1| histone H3 [Drosophila melanogaster]
 gb|AAZ66539.1| histone H3 [Drosophila melanogaster]
 gb|AAZ66544.1| histone H3 [Drosophila melanogaster]
 gb|AAZ66549.1| histone H3 [Drosophila melanogaster]
 gb|AAZ66554.1| histone H3 [Drosophila melanogaster]
 gb|AAZ66559.1| histone H3 [Drosophila melanogaster]
 gb|AAZ66564.1| histone H3 [Drosophila melanogaster]
 gb|AAZ66569.1| histone H3 [Drosophila melanogaster]
 gb|AAZ66574.1| histone H3 [Drosophila melanogaster]
 gb|AAZ66579.1| histone H3 [Drosophila melanogaster]
 gb|AAZ66583.1| histone H3 [Drosophila melanogaster]
 gb|AAI03550.1| Histone cluster 1, H3f [Mus musculus]
 gb|AAI01956.1| Histone cluster 1, H3f [Mus musculus]
 gb|AAI01955.1| Histone cluster 1, H3f [Mus musculus]
 gb|AAI01957.1| Histone cluster 1, H3f [Mus musculus]
 emb|CAJ82338.1| histone 2, H3c [Xenopus (Silurana) tropicalis]
 emb|CAJ82528.1| histone 2, H3c [Xenopus (Silurana) tropicalis]
 gb|ABD76393.1| histone H3 [Azumapecten farreri]
 gb|ABF51317.1| histone H3 [Bombyx mori]
 gb|EAT35786.1| AAEL012072-PA [Aedes aegypti]
 gb|EAT44809.1| AAEL003852-PA [Aedes aegypti]
 gb|EAT44812.1| AAEL003850-PA [Aedes aegypti]
 gb|EAT44816.1| AAEL003856-PA [Aedes aegypti]
 gb|EAT44818.1| AAEL003828-PA [Aedes aegypti]
 gb|EAT44823.1| AAEL003836-PA [Aedes aegypti]
 gb|EAT45038.1| AAEL003659-PA [Aedes aegypti]
 gb|EAT48477.1| AAEL000492-PA [Aedes aegypti]
 gb|EAT48481.1| AAEL000482-PA [Aedes aegypti]
 gb|EAT48485.1| AAEL000506-PA [Aedes aegypti]
 gb|AAH74969.2| Histone cluster 2, H3a [Homo sapiens]
 gb|AAI20803.1| Histone cluster 1, H3c [Mus musculus]
 gb|AAI20801.1| Histone cluster 1, H3c [Mus musculus]
 gb|AAI30636.1| Histone cluster 2, H3a [Homo sapiens]
 gb|AAI30638.1| Histone cluster 2, H3a [Homo sapiens]
 gb|AAI29334.1| Zgc:158629 protein [Danio rerio]
 gb|AAI32491.1| Histone cluster 2, H3c2 [Mus musculus]
 gb|AAI32489.1| Histone cluster 2, H3c2 [Mus musculus]
 gb|AAI33777.1| LOC100049126 protein [Xenopus laevis]
 dbj|BAF56193.1| histone 3 [Drosophila americana]
 gb|EDL32538.1| mCG122935 [Mus musculus]
 gb|EDL32540.1| mCG140859 [Mus musculus]
 gb|EDL32552.1| mCG7728 [Mus musculus]
 gb|EDL32556.1| mCG7727 [Mus musculus]
 gb|EDL32559.1| mCG7741 [Mus musculus]
 gb|EDL38879.1| mCG126480 [Mus musculus]
 gb|EDL38883.1| mCG16737 [Mus musculus]
 gb|EDL85636.1| rCG51970 [Rattus norvegicus]
 gb|EDL86583.1| rCG45187 [Rattus norvegicus]
 gb|EDL86588.1| rCG45215 [Rattus norvegicus]
 gb|AAI48479.1| Histone cluster 2, H3c, partial [synthetic construct]
 gb|EDO26111.1| predicted protein [Nematostella vectensis]
 gb|EDO26531.1| predicted protein [Nematostella vectensis]
 gb|EDO26659.1| predicted protein [Nematostella vectensis]
 gb|EDO26704.1| predicted protein [Nematostella vectensis]
 gb|EDO27012.1| predicted protein [Nematostella vectensis]
 gb|EDO27631.1| predicted protein [Nematostella vectensis]
 gb|EDO27768.1| predicted protein [Nematostella vectensis]
 gb|EDO30784.1| predicted protein [Nematostella vectensis]
 gb|EDO30785.1| predicted protein [Nematostella vectensis]
 gb|EDO36702.1| predicted protein [Nematostella vectensis]
 gb|EDO36704.1| predicted protein [Nematostella vectensis]
 gb|EDO40547.1| predicted protein [Nematostella vectensis]
 gb|EDO41230.1| predicted protein [Nematostella vectensis]
 gb|EDO46398.1| predicted protein [Nematostella vectensis]
 gb|EDO46464.1| predicted protein [Nematostella vectensis]
 gb|EDO47313.1| predicted protein [Nematostella vectensis]
 gb|EDO48282.1| predicted protein [Nematostella vectensis]
 gb|EDO48305.1| predicted protein [Nematostella vectensis]
 gb|EDO48404.1| predicted protein [Nematostella vectensis]
 gb|EDO48406.1| predicted protein [Nematostella vectensis]
 gb|AAI52074.1| Zgc:158629 protein [Danio rerio]
 gb|EAA13673.3| AGAP003910-PA [Anopheles gambiae str. PEST]
 gb|EAA10498.3| AGAP005024-PA [Anopheles gambiae str. PEST]
 gb|EAA03406.3| AGAP012572-PA [Anopheles gambiae str. PEST]
 gb|EAL42097.3| AGAP012573-PA [Anopheles gambiae str. PEST]
 gb|EAA03397.3| AGAP005025-PA [Anopheles gambiae str. PEST]
 gb|EAA03005.3| AGAP012559-PA [Anopheles gambiae str. PEST]
 gb|ABV25908.1| histone H3 [Ruditapes philippinarum]
 gb|ABV25913.1| histone H3 [Ruditapes decussatus]
 gb|ABV25918.1| histone H3 [Venerupis corrugata]
 gb|AAI53075.1| Histone cluster 2, H3c [synthetic construct]
 gb|ABW86653.1| histone H3 [Anthonomus grandis]
 gb|AAI56787.1| Histone cluster 1, H3e [synthetic construct]
 gb|AAI56108.1| Histone cluster 2, H3b, partial [synthetic construct]
 gb|AAI56966.1| Histone cluster 2, H3b [synthetic construct]
 gb|EDS26248.1| histone H3.1t [Culex quinquefasciatus]
 gb|EDS37347.1| histone H3.3 type 2 [Culex quinquefasciatus]
 gb|EDS37352.1| histone H3.2 [Culex quinquefasciatus]
 gb|EDS37357.1| histone H3.2 [Culex quinquefasciatus]
 gb|EDS37362.1| histone H3.1t [Culex quinquefasciatus]
 gb|EDS37370.1| histone H3.3 type 2 [Culex quinquefasciatus]
 gb|EDS37379.1| histone H3 type 2 [Culex quinquefasciatus]
 gb|EDS37386.1| histone H3 type 2 [Culex quinquefasciatus]
 gb|EDS37392.1| histone H3.1t [Culex quinquefasciatus]
 gb|EDS41247.1| histone H3.1t [Culex quinquefasciatus]
 gb|EDS41769.1| histone H3.2 [Culex quinquefasciatus]
 gb|AAI60302.1| Histone cluster 1, H3b [synthetic construct]
 gb|AAI60303.1| Histone cluster 1, H3d [synthetic construct]
 gb|EDV24675.1| conserved hypothetical protein [Trichoplax adhaerens]
 gb|EDV29956.1| GF21608 [Drosophila ananassae]
 gb|EDV32940.1| GF22293 [Drosophila ananassae]
 gb|EDV32945.1| GF22265 [Drosophila ananassae]
 gb|EDV32955.1| GF22200 [Drosophila ananassae]
 gb|EDV33672.1| GF15887 [Drosophila ananassae]
 gb|EDV44862.1| GF15922 [Drosophila ananassae]
 gb|EDV44896.1| GF21522 [Drosophila ananassae]
 gb|EDV44912.1| GF21669 [Drosophila ananassae]
 gb|EDV44935.1| GF22855 [Drosophila ananassae]
 gb|EDV44936.1| GF20380 [Drosophila ananassae]
 gb|EDV44939.1| GF20359 [Drosophila ananassae]
 gb|EDV44946.1| GF20165 [Drosophila ananassae]
 gb|EDV45005.1| GG12995 [Drosophila erecta]
 gb|EDV45006.1| GG13062 [Drosophila erecta]
 gb|EDV45059.1| GG18243 [Drosophila erecta]
 gb|EDV45064.1| GG13008 [Drosophila erecta]
 gb|EDV45065.1| GG19791 [Drosophila erecta]
 gb|EDV45077.1| GG16357 [Drosophila erecta]
 gb|EDV45082.1| GG19850 [Drosophila erecta]
 gb|EDV45088.1| GG19806 [Drosophila erecta]
 gb|EDV45095.1| GG12990 [Drosophila erecta]
 gb|EDV45121.1| GG13024 [Drosophila erecta]
 gb|EDV45126.1| GG13020 [Drosophila erecta]
 gb|EDV45136.1| GG13014 [Drosophila erecta]
 gb|EDV45188.1| GG19830 [Drosophila erecta]
 gb|EDV45294.1| GG12579 [Drosophila erecta]
 gb|EDV45299.1| GG12575 [Drosophila erecta]
 gb|EDV45309.1| GG11010 [Drosophila erecta]
 gb|EDV45314.1| GG11007 [Drosophila erecta]
 gb|EDV45319.1| GG11004 [Drosophila erecta]
 gb|EDV45324.1| GG11000 [Drosophila erecta]
 gb|EDV45329.1| GG12955 [Drosophila erecta]
 gb|EDV45336.1| GG16369 [Drosophila erecta]
 gb|EDV54386.1| GG21334 [Drosophila erecta]
 gb|EDV54388.1| GG21333 [Drosophila erecta]
 gb|EDV54393.1| GG21330 [Drosophila erecta]
 gb|EDV54398.1| GG21326 [Drosophila erecta]
 gb|EDV54403.1| GG21323 [Drosophila erecta]
 gb|EDV54408.1| GG21320 [Drosophila erecta]
 gb|EDV54413.1| GG21316 [Drosophila erecta]
 gb|EDV54418.1| GG21313 [Drosophila erecta]
 gb|EDV54423.1| GG21310 [Drosophila erecta]
 gb|EDV54428.1| GG21307 [Drosophila erecta]
 gb|EDV60036.1| GG19816 [Drosophila erecta]
 gb|EDV90267.1| GH24949 [Drosophila grimshawi]
 gb|EDV94008.1| GH23344 [Drosophila grimshawi]
 gb|EDV94014.1| GH23339 [Drosophila grimshawi]
 gb|EDV94023.1| GH23334 [Drosophila grimshawi]
 gb|EDV94026.1| GH23332 [Drosophila grimshawi]
 gb|EDV94107.1| GH25148 [Drosophila grimshawi]
 gb|EDV94112.1| GH25152 [Drosophila grimshawi]
 gb|EDV94117.1| GH25155 [Drosophila grimshawi]
 gb|EDV94122.1| GH25158 [Drosophila grimshawi]
 gb|EDV94126.1| GH25160 [Drosophila grimshawi]
 gb|EDV94130.1| GH25162 [Drosophila grimshawi]
 gb|EDV94135.1| GH25165 [Drosophila grimshawi]
 gb|EDV94140.1| GH25168 [Drosophila grimshawi]
 gb|EDV94145.1| GH25173 [Drosophila grimshawi]
 gb|EDV94150.1| GH25176 [Drosophila grimshawi]
 gb|EDV94153.1| GH25177 [Drosophila grimshawi]
 gb|EDV94157.1| GH25179 [Drosophila grimshawi]
 gb|EDV94162.1| GH25183 [Drosophila grimshawi]
 gb|EDV94166.1| GH25185 [Drosophila grimshawi]
 gb|EDV99503.1| GH23572 [Drosophila grimshawi]
 gb|EDV99506.1| GH23513 [Drosophila grimshawi]
 gb|EDW04452.1| GH23469 [Drosophila grimshawi]
 gb|EDW04513.1| GH23765 [Drosophila grimshawi]
 gb|EDW04517.1| GH23762 [Drosophila grimshawi]
 gb|EDW04674.1| GH13936 [Drosophila grimshawi]
 gb|EDW04714.1| GH25000 [Drosophila grimshawi]
 gb|EDW04770.1| GH23504 [Drosophila grimshawi]
 gb|EDW04806.1| GH23749 [Drosophila grimshawi]
 gb|EDW05040.1| GH23876 [Drosophila grimshawi]
 gb|EDW05150.1| GH10171 [Drosophila grimshawi]
 gb|EDW05154.1| GH10149 [Drosophila grimshawi]
 gb|EDW05308.1| GI21876 [Drosophila mojavensis]
 gb|EDW05415.1| GI11258 [Drosophila mojavensis]
 gb|EDW05445.1| GI12713 [Drosophila mojavensis]
 gb|EDW11643.1| GI17251 [Drosophila mojavensis]
 gb|EDW11647.1| GI17253 [Drosophila mojavensis]
 gb|EDW11651.1| GI17255 [Drosophila mojavensis]
 gb|EDW12432.1| GI24857 [Drosophila mojavensis]
 gb|EDW14234.1| GI23446 [Drosophila mojavensis]
 gb|EDW14240.1| GI23442 [Drosophila mojavensis]
 gb|EDW14244.1| GI23440 [Drosophila mojavensis]
 gb|EDW14248.1| GI23438 [Drosophila mojavensis]
 gb|EDW19823.1| GI16893 [Drosophila mojavensis]
 gb|EDW24105.1| GL23951 [Drosophila persimilis]
 gb|EDW24111.1| GL23955 [Drosophila persimilis]
 gb|EDW24116.1| GL23958 [Drosophila persimilis]
 gb|EDW24121.1| GL23961 [Drosophila persimilis]
 gb|EDW25250.1| GL19701 [Drosophila persimilis]
 gb|EDW26935.1| GL17801 [Drosophila persimilis]
 gb|EDW39515.1| GL22373 [Drosophila persimilis]
 gb|EDW43609.1| GM13626 [Drosophila sechellia]
 gb|EDW43638.1| GM17442 [Drosophila sechellia]
 gb|EDW43653.1| GM19655 [Drosophila sechellia]
 gb|EDW44132.1| GM16397 [Drosophila sechellia]
 gb|EDW44548.1| GM13139 [Drosophila sechellia]
 gb|EDW44571.1| GM23425 [Drosophila sechellia]
 gb|EDW44606.1| GM15133 [Drosophila sechellia]
 gb|EDW44932.1| GM11042 [Drosophila sechellia]
 gb|EDW44977.1| GM19648 [Drosophila sechellia]
 gb|EDW45313.1| GM16257 [Drosophila sechellia]
 gb|EDW49036.1| GM13193 [Drosophila sechellia]
 gb|EDW49041.1| GM13196 [Drosophila sechellia]
 gb|EDW49155.1| GM13582 [Drosophila sechellia]
 gb|EDW50884.1| GM19325 [Drosophila sechellia]
 gb|EDW51014.1| GM19753 [Drosophila sechellia]
 gb|EDW51094.1| GM18735 [Drosophila sechellia]
 gb|EDW51100.1| GM16232 [Drosophila sechellia]
 gb|EDW51456.1| GM11711 [Drosophila sechellia]
 gb|EDW51461.1| GM11708 [Drosophila sechellia]
 gb|EDW52632.1| GM13543 [Drosophila sechellia]
 gb|EDW52670.1| GM22103 [Drosophila sechellia]
 gb|EDW52674.1| GM21950 [Drosophila sechellia]
 gb|EDW52840.1| GM19738 [Drosophila sechellia]
 gb|EDW53645.1| GM11166 [Drosophila sechellia]
 gb|EDW53701.1| GM16108 [Drosophila sechellia]
 gb|EDW53787.1| GM19311 [Drosophila sechellia]
 gb|EDW53839.1| GM17398 [Drosophila sechellia]
 gb|EDW53862.1| GM12074 [Drosophila sechellia]
 gb|EDW53867.1| GM12385 [Drosophila sechellia]
 gb|EDW54673.1| GM13124 [Drosophila sechellia]
 gb|EDW55411.1| GM26727 [Drosophila sechellia]
 gb|EDW55418.1| GM13179 [Drosophila sechellia]
 gb|EDW55422.1| GM19314 [Drosophila sechellia]
 gb|EDW55439.1| GM19759 [Drosophila sechellia]
 gb|EDW55853.1| GM11184 [Drosophila sechellia]
 gb|EDW55858.1| GM11181 [Drosophila sechellia]
 gb|EDW55876.1| GM10805 [Drosophila sechellia]
 gb|EDW56411.1| GM18805 [Drosophila sechellia]
 gb|EDW56416.1| GM19709 [Drosophila sechellia]
 gb|EDW56419.1| GM19711 [Drosophila sechellia]
 gb|EDW56429.1| GM19719 [Drosophila sechellia]
 gb|EDW56434.1| GM19722 [Drosophila sechellia]
 gb|EDW56438.1| GM19726 [Drosophila sechellia]
 gb|EDW56443.1| GM19729 [Drosophila sechellia]
 gb|EDW56446.1| GM15453 [Drosophila sechellia]
 gb|EDW56484.1| GM11148 [Drosophila sechellia]
 gb|EDW56487.1| GM16280 [Drosophila sechellia]
 gb|EDW56511.1| GM24967 [Drosophila sechellia]
 gb|EDW56522.1| GM19343 [Drosophila sechellia]
 gb|EDW57347.1| GJ16113 [Drosophila virilis]
 gb|EDW57469.1| GJ15448 [Drosophila virilis]
 gb|EDW64420.1| GJ22585 [Drosophila virilis]
 gb|EDW64425.1| GJ22552 [Drosophila virilis]
 gb|EDW64428.1| GJ22537 [Drosophila virilis]
 gb|EDW66612.1| GJ23692 [Drosophila virilis]
 gb|EDW66616.1| GJ23694 [Drosophila virilis]
 gb|EDW66621.1| GJ23698 [Drosophila virilis]
 gb|EDW66626.1| GJ23701 [Drosophila virilis]
 gb|EDW66630.1| GJ23703 [Drosophila virilis]
 gb|EDW66637.1| GJ23707 [Drosophila virilis]
 gb|EDW66642.1| GJ23711 [Drosophila virilis]
 gb|EDW71477.1| GJ18585 [Drosophila virilis]
 gb|EDW71505.1| GJ18405 [Drosophila virilis]
 gb|EDW71523.1| GJ17075 [Drosophila virilis]
 gb|EDW71533.1| GJ18401 [Drosophila virilis]
 gb|EDW71545.1| GJ19811 [Drosophila virilis]
 gb|EDW71550.1| GJ15165 [Drosophila virilis]
 gb|EDW71553.1| GJ16344 [Drosophila virilis]
 gb|EDW71556.1| GJ16346 [Drosophila virilis]
 gb|EDW71590.1| GK19157 [Drosophila willistoni]
 gb|EDW80196.1| GK10380 [Drosophila willistoni]
 gb|EDW80201.1| GK18893 [Drosophila willistoni]
 gb|EDW86726.1| GK19237 [Drosophila willistoni]
 gb|EDW87055.1| GK21132 [Drosophila willistoni]
 gb|EDX15926.1| GD21986 [Drosophila simulans]
 gb|EDX16012.1| GD11866 [Drosophila simulans]
 gb|EDX16028.1| GD11987 [Drosophila simulans]
 gb|EDX16055.1| GD12595 [Drosophila simulans]
 gb|EDX16062.1| GD12699 [Drosophila simulans]
 gb|EDX16075.1| GD13036 [Drosophila simulans]
 gb|EDX16081.1| GD19005 [Drosophila simulans]
 gb|EDX16157.1| GD17998 [Drosophila simulans]
 gb|EDX16172.1| GD14456 [Drosophila simulans]
 gb|EDX16188.1| GD13666 [Drosophila simulans]
 gb|EDX16197.1| GD14852 [Drosophila simulans]
 gb|EDX16214.1| GD15113 [Drosophila simulans]
 gb|EDX16237.1| GD15434 [Drosophila simulans]
 gb|EDX16261.1| GD15753 [Drosophila simulans]
 dbj|BAG73252.1| Histone H3.1 [synthetic construct]
 gb|EEB18171.1| histone H3 [Pediculus humanus corporis]
 gb|EEB18180.1| histone H3 [Pediculus humanus corporis]
 gb|AAI39252.1| Hist2h3b protein [Mus musculus]
 gb|AAI39253.1| Hist2h3b protein [Mus musculus]
 gb|ACO11545.1| Histone H3 [Caligus rogercresseyi]
 gb|ACO15243.1| Histone H3 [Caligus clemensi]
 gb|EEN42367.1| hypothetical protein BRAFLDRAFT_62634 [Branchiostoma floridae]
 gb|EEN42376.1| hypothetical protein BRAFLDRAFT_62637 [Branchiostoma floridae]
 gb|EEN51660.1| hypothetical protein BRAFLDRAFT_64784 [Branchiostoma floridae]
 gb|EEN51678.1| hypothetical protein BRAFLDRAFT_64800 [Branchiostoma floridae]
 gb|EEN51690.1| hypothetical protein BRAFLDRAFT_64812 [Branchiostoma floridae]
 gb|EEN51721.1| hypothetical protein BRAFLDRAFT_56969 [Branchiostoma floridae]
 gb|EEN51722.1| hypothetical protein BRAFLDRAFT_56970 [Branchiostoma floridae]
 gb|EEN51731.1| hypothetical protein BRAFLDRAFT_56975 [Branchiostoma floridae]
 gb|EEN51747.1| hypothetical protein BRAFLDRAFT_64865 [Branchiostoma floridae]
 dbj|BAH72344.1| ACYPI007201 [Acyrthosiphon pisum]
 gb|EFA13237.1| hypothetical protein TcasGA2_TC006933 [Tribolium castaneum]
 gb|EFA13385.1| hypothetical protein TcasGA2_TC016050 [Tribolium castaneum]
 gb|EFA13540.1| hypothetical protein TcasGA2_TC005139 [Tribolium castaneum]
 gb|EFA13671.1| hypothetical protein TcasGA2_TC001497 [Tribolium castaneum]
 gb|EFB29319.1| hypothetical protein PANDA_021728 [Ailuropoda melanoleuca]
 emb|CAP53903.1| histone H3 [Xenoturbella bocki]
 tpg|DAA31651.1| TPA: histone H3.2 [Bos taurus]
 tpg|DAA31726.1| TPA: histone cluster 2, H3c2-like [Bos taurus]
 tpg|DAA31730.1| TPA: histone cluster 2, H3c2-like [Bos taurus]
 gb|EFN61843.1| Histone H3 [Camponotus floridanus]
 gb|EFN62817.1| Histone H3 [Camponotus floridanus]
 gb|EFN72896.1| Histone H3 [Camponotus floridanus]
 gb|EFN76783.1| Histone H3 [Harpegnathos saltator]
 gb|EFN76878.1| Histone H3 [Harpegnathos saltator]
 emb|CBY36196.1| unnamed protein product [Oikopleura dioica]
 emb|CBY37787.1| unnamed protein product [Oikopleura dioica]
 emb|CBY12294.1| unnamed protein product [Oikopleura dioica]
 gb|EFX62753.1| hypothetical protein DAPPUDRAFT_67712 [Daphnia pulex]
 gb|EFX71392.1| hypothetical protein DAPPUDRAFT_255862 [Daphnia pulex]
 gb|EFX86865.1| hypothetical protein DAPPUDRAFT_235594 [Daphnia pulex]
 gb|EFX86883.1| hypothetical protein DAPPUDRAFT_235620 [Daphnia pulex]
 gb|EFX86890.1| hypothetical protein DAPPUDRAFT_44125 [Daphnia pulex]
 gb|EFX86911.1| hypothetical protein DAPPUDRAFT_44149 [Daphnia pulex]
 gb|EFX86921.1| hypothetical protein DAPPUDRAFT_44114 [Daphnia pulex]
 gb|EFX86944.1| hypothetical protein DAPPUDRAFT_43874 [Daphnia pulex]
 gb|EFX86961.1| hypothetical protein DAPPUDRAFT_43597 [Daphnia pulex]
 gb|EFX86977.1| hypothetical protein DAPPUDRAFT_235802 [Daphnia pulex]
 gb|EFX87022.1| hypothetical protein DAPPUDRAFT_43441 [Daphnia pulex]
 gb|EFX87061.1| hypothetical protein DAPPUDRAFT_44115 [Daphnia pulex]
 gb|EFX87072.1| hypothetical protein DAPPUDRAFT_43440 [Daphnia pulex]
 gb|EFX87254.1| hypothetical protein DAPPUDRAFT_43467 [Daphnia pulex]
 gb|EFX87270.1| hypothetical protein DAPPUDRAFT_43863 [Daphnia pulex]
 gb|EFX87305.1| hypothetical protein DAPPUDRAFT_43402 [Daphnia pulex]
 gb|EFX87341.1| hypothetical protein DAPPUDRAFT_43405 [Daphnia pulex]
 gb|EFX87367.1| hypothetical protein DAPPUDRAFT_44153 [Daphnia pulex]
 gb|EFX87388.1| hypothetical protein DAPPUDRAFT_43482 [Daphnia pulex]
 gb|EFX87398.1| hypothetical protein DAPPUDRAFT_43862 [Daphnia pulex]
 gb|EFX87419.1| hypothetical protein DAPPUDRAFT_43602 [Daphnia pulex]
 gb|EFX87430.1| hypothetical protein DAPPUDRAFT_44116 [Daphnia pulex]
 gb|EFX87440.1| hypothetical protein DAPPUDRAFT_235586 [Daphnia pulex]
 gb|EFX88870.1| hypothetical protein DAPPUDRAFT_304645 [Daphnia pulex]
 gb|EGI63565.1| Histone H3 [Acromyrmex echinatior]
 gb|AEH58055.1| histone H3 [Mimachlamys varia]
 gb|EGV94272.1| Histone H3 [Cricetulus griseus]
 gb|EGV94275.1| Histone H3 [Cricetulus griseus]
 gb|EGV94289.1| Histone H3 [Cricetulus griseus]
 gb|EGV94292.1| Histone H3 [Cricetulus griseus]
 gb|EGV94772.1| Histone H3 [Cricetulus griseus]
 gb|EGV96117.1| Histone H3 [Cricetulus griseus]
 gb|EHB09823.1| Histone H3 [Heterocephalus glaber]
 gb|EHB11504.1| Histone H3 [Heterocephalus glaber]
 gb|EHH15154.1| hypothetical protein EGK_01209 [Macaca mulatta]
 gb|EHH25687.1| hypothetical protein EGK_21183 [Macaca mulatta]
 gb|EHH50254.1| hypothetical protein EGM_01058 [Macaca fascicularis]
 gb|EHH62657.1| hypothetical protein EGM_21076 [Macaca fascicularis]
 gb|EHJ75639.1| hypothetical protein KGM_19632 [Danaus plexippus]
 gb|EKC28014.1| Histone H3 [Crassostrea gigas]
 gb|EKC28020.1| Histone H3 [Crassostrea gigas]
 gb|EKC28025.1| Histone H3 [Crassostrea gigas]
 gb|EKC28030.1| Histone H3 [Crassostrea gigas]
 gb|EKC28035.1| Histone H3 [Crassostrea gigas]
 gb|ELK06004.1| Histone H3 [Pteropus alecto]
 gb|ELT87490.1| hypothetical protein CAPTEDRAFT_113088 [Capitella teleta]
 gb|ELT88273.1| hypothetical protein CAPTEDRAFT_183410 [Capitella teleta]
 gb|ELT91938.1| hypothetical protein CAPTEDRAFT_143680 [Capitella teleta]
 gb|ELT92790.1| hypothetical protein CAPTEDRAFT_140172 [Capitella teleta]
 gb|ELT94370.1| hypothetical protein CAPTEDRAFT_103051 [Capitella teleta]
 gb|ELT95343.1| hypothetical protein CAPTEDRAFT_139827 [Capitella teleta]
 gb|ELT97390.1| hypothetical protein CAPTEDRAFT_98969 [Capitella teleta]
 gb|ELT97809.1| hypothetical protein CAPTEDRAFT_145086 [Capitella teleta]
 gb|ELT97815.1| hypothetical protein CAPTEDRAFT_145096 [Capitella teleta]
 gb|ELU01210.1| hypothetical protein CAPTEDRAFT_177743 [Capitella teleta]
 gb|ELU01981.1| hypothetical protein CAPTEDRAFT_114963 [Capitella teleta]
 gb|ELU02042.1| hypothetical protein CAPTEDRAFT_128643 [Capitella teleta]
 gb|ELU02630.1| hypothetical protein CAPTEDRAFT_146003 [Capitella teleta]
 gb|ELU03396.1| hypothetical protein CAPTEDRAFT_96020 [Capitella teleta]
 gb|ELU04790.1| hypothetical protein CAPTEDRAFT_97620 [Capitella teleta]
 gb|ELU12646.1| hypothetical protein CAPTEDRAFT_185601 [Capitella teleta]
 gb|ELU12731.1| hypothetical protein CAPTEDRAFT_91648 [Capitella teleta]
 gb|ELU15444.1| hypothetical protein CAPTEDRAFT_4232 [Capitella teleta]
 gb|ELU15997.1| hypothetical protein CAPTEDRAFT_106383 [Capitella teleta]
 gb|EMC86815.1| Histone H3 [Columba livia]
 gb|EMC89183.1| Histone H3 [Columba livia]
 gb|EMC89190.1| Histone H3 [Columba livia]
 gb|EMC89195.1| Histone H3 [Columba livia]
 gb|EMP31830.1| Histone H3 [Chelonia mydas]
 gb|EMP31838.1| Histone H3 [Chelonia mydas]
 gb|EMP31846.1| Histone H3 [Chelonia mydas]
 gb|EMP31852.1| Histone H3 [Chelonia mydas]
 gb|EMS65048.1| Histone H3 [Triticum urartu]
 gb|EOB06755.1| Histone H3, partial [Anas platyrhynchos]
 gb|EPY72766.1| histone cluster 2, H3c2-like protein [Camelus ferus]
 gb|ERE77558.1| histone H3.2-like protein [Cricetulus griseus]
 gb|ERE77567.1| histone H3.2-like protein [Cricetulus griseus]
 gb|ERE78119.1| histone H3.2-like protein [Cricetulus griseus]
 gb|ERE88447.1| histone H3.2-like protein [Cricetulus griseus]
 gb|ESN99479.1| hypothetical protein HELRODRAFT_92700 [Helobdella robusta]
 gb|ESO00330.1| hypothetical protein HELRODRAFT_92640 [Helobdella robusta]
 gb|ESO02962.1| hypothetical protein HELRODRAFT_92562 [Helobdella robusta]
 gb|ESO04464.1| hypothetical protein HELRODRAFT_79198 [Helobdella robusta]
 gb|ESO82042.1| hypothetical protein LOTGIDRAFT_148546 [Lottia gigantea]
 gb|ESO83577.1| hypothetical protein LOTGIDRAFT_146472 [Lottia gigantea]
 gb|ESO90012.1| hypothetical protein LOTGIDRAFT_147849 [Lottia gigantea]
 gb|ESO90218.1| hypothetical protein LOTGIDRAFT_147816 [Lottia gigantea]
 gb|ESO92938.1| hypothetical protein LOTGIDRAFT_145440 [Lottia gigantea]
 gb|ESO94670.1| hypothetical protein LOTGIDRAFT_176709 [Lottia gigantea]
 gb|ESO97192.1| hypothetical protein LOTGIDRAFT_147117 [Lottia gigantea]
 gb|ETE61490.1| hypothetical protein L345_12748, partial [Ophiophagus hannah]
 gb|ETN62627.1| histone H3 [Anopheles darlingi]
 gb|ETN66359.1| histone H3 [Anopheles darlingi]
 gb|EYB97094.1| hypothetical protein Y032_0143g2383 [Ancylostoma ceylanicum]
 gb|EYB97107.1| hypothetical protein Y032_0143g2395 [Ancylostoma ceylanicum]
 gb|EYC33917.1| hypothetical protein Y032_0001g163 [Ancylostoma ceylanicum]
 gb|EYC41370.1| hypothetical protein Y032_0571g115 [Ancylostoma ceylanicum]
 gb|EYC41378.1| hypothetical protein Y032_0571g123 [Ancylostoma ceylanicum]
 gb|EYC41386.1| hypothetical protein Y032_0571g131 [Ancylostoma ceylanicum]
 gb|AHN53414.1| histone H3C [Nuttalliella namaqua]
 gb|EZA45107.1| histone H3-like protein-1 [Microplitis demolitor]
 gb|EZA45746.1| histone H3-like protein-3 [Microplitis demolitor]
 gb|EZA46993.1| Histone H3 [Cerapachys biroi]
 gb|EZA48677.1| Histone H3 [Cerapachys biroi]
 gb|KDR07175.1| Histone H3 [Zootermopsis nevadensis]
 gb|AIC53007.1| HIST2H3C, partial [synthetic construct]
 gb|AII16468.1| histone H3c, partial [Paracyclopina nana]
 gb|KFM02243.1| Histone H3 [Aptenodytes forsteri]
 gb|KFM02261.1| Histone H3 [Aptenodytes forsteri]
 gb|KFO28174.1| Histone H3 [Fukomys damarensis]
 gb|KFO33710.1| Histone H3 [Fukomys damarensis]
 gb|KFO61364.1| Histone H3 [Corvus brachyrhynchos]
 gb|KFO61377.1| Histone H3 [Corvus brachyrhynchos]
 gb|KFO96022.1| Histone H3 [Calypte anna]
 gb|KFP00617.1| Histone H3 [Calypte anna]
 gb|KFP17070.1| Histone H3 [Egretta garzetta]
 gb|KFQ38516.1| Histone H3 [Mesitornis unicolor]
 gb|KFQ38517.1| Histone H3 [Mesitornis unicolor]
 gb|KFQ39994.1| Histone H3 [Mesitornis unicolor]
 gb|KFR08209.1| Histone H3 [Nipponia nippon]
 gb|KFU93231.1| Histone H3 [Chaetura pelagica]
 gb|KFU93232.1| Histone H3 [Chaetura pelagica]
 gb|KFV65813.1| Histone H3 [Picoides pubescens]
 gb|KFV65818.1| Histone H3 [Picoides pubescens]
 gb|KFV65826.1| Histone H3 [Picoides pubescens]
 gb|KFV65827.1| Histone H3 [Picoides pubescens]
 gb|KFV65834.1| Histone H3 [Picoides pubescens]
 gb|KFV65844.1| Histone H3 [Picoides pubescens]
 gb|KFV65845.1| Histone H3 [Picoides pubescens]
 gb|KFV65846.1| Histone H3 [Picoides pubescens]
 gb|KGL80000.1| Histone H3 [Tinamus guttatus]
 gb|KGL84315.1| Histone H3 [Tinamus guttatus]
 gb|KGL87479.1| Histone H3 [Charadrius vociferus]
 gb|KGL87482.1| Histone H3 [Charadrius vociferus]
 gb|KHJ75865.1| core histone H2A/H2B/H3/H4 [Oesophagostomum dentatum]
 gb|KHJ79715.1| core histone H2A/H2B/H3/H4 [Oesophagostomum dentatum]
 gb|KHJ91401.1| core histone H2A/H2B/H3/H4 [Oesophagostomum dentatum]
 gb|KIH45863.1| core histone H2A/H2B/H3/H4 [Ancylostoma duodenale]
 gb|KIH55445.1| core histone H2A/H2B/H3/H4 [Ancylostoma duodenale]
 gb|KIH66228.1| core histone H2A/H2B/H3/H4 [Ancylostoma duodenale]
Length=136

 Score =   157 bits (398),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   111 bits (278),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHRYRPGTVALREIR+YQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>ref|XP_001691008.1| histone H3 [Chlamydomonas reinhardtii]
 gb|EDP05454.1| histone H3, partial [Chlamydomonas reinhardtii]
Length=134

 Score =   157 bits (398),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 77/79 (97%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AVLALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  56   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSQAVLALQEAAEAYLVGLFEDTNLCAIHAK  115

Query  242  RVTIMPKDIQLARRIRGER  186
            RVTIMPKDIQLARRIRGER
Sbjct  116  RVTIMPKDIQLARRIRGER  134


 Score =   105 bits (263),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 60/71 (85%), Gaps = 1/71 (1%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARK+ P TGGVKKPHRYRPGTVALREIRKYQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKT-PATGGVKKPHRYRPGTVALREIRKYQKSTE  59

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  60   LLIRKLPFQRL  70



>ref|XP_307081.3| Anopheles gambiae str. PEST AGAP012709-PA [Anopheles gambiae 
str. PEST]
 pdb|2IO5|B Chain B, Crystal Structure Of The Cia- Histone H3-H4 Complex
 pdb|2NQB|A Chain A, Drosophila Nucleosome Structure
 pdb|2NQB|E Chain E, Drosophila Nucleosome Structure
 pdb|2PYO|A Chain A, Drosophila Nucleosome Core
 pdb|2PYO|E Chain E, Drosophila Nucleosome Core
 pdb|3C9K|C Chain C, Model Of Histone Octamer Tubular Crystals
 pdb|3C9K|G Chain G, Model Of Histone Octamer Tubular Crystals
 gb|EAA02896.3| AGAP012709-PA [Anopheles gambiae str. PEST]
 gb|AFY26269.1| histone H3, partial [Plectorhinchus mediterraneus]
 gb|AFY26270.1| histone H3, partial [Plectorhinchus mediterraneus]
 gb|AFY26272.1| histone H3, partial [Plectorhinchus mediterraneus]
 gb|AFY26273.1| histone H3, partial [Plectorhinchus mediterraneus]
 gb|AFY26275.1| histone H3, partial [Plectorhinchus mediterraneus]
 gb|AFY26277.1| histone H3, partial [Plectorhinchus mediterraneus]
 gb|AFY26278.1| histone H3, partial [Plectorhinchus mediterraneus]
 gb|AFY26279.1| histone H3, partial [Plectorhinchus mediterraneus]
 prf||0806228A histone H3 [Gallus gallus]
 prf||0710252A histone H3
Length=135

 Score =   157 bits (398),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  56   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  115

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  116  RVTIMPKDIQLARRIRGERA  135


 Score =   108 bits (271),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 60/70 (86%), Gaps = 0/70 (0%)
 Frame = -2

Query  586  ARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALSS  407
            ARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHRYRPGTVALREIR+YQ++   
Sbjct  1    ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTEL  60

Query  406  LSASFPSRGL  377
            L    P + L
Sbjct  61   LIRKLPFQRL  70



>ref|XP_008172413.1| PREDICTED: histone H3-like [Chrysemys picta bellii]
Length=148

 Score =   158 bits (399),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  69   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  128

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  129  RVTIMPKDIQLARRIRGERA  148


 Score =   102 bits (254),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 61/83 (73%), Gaps = 12/83 (14%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARK------------SAPTTGGVKKPHRYRPGTVA  446
            MARTKQTARKSTGGKAPRKQLATKAARK            SAP TGGVKKPHRYRPGTVA
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKGAPSXXXXXXRKSAPATGGVKKPHRYRPGTVA  60

Query  445  LREIRKYQRALSSLSASFPSRGL  377
            LREIR+YQ++   L    P + L
Sbjct  61   LREIRRYQKSTELLIRKLPFQRL  83



>gb|EKC28040.1| Histone H3 [Crassostrea gigas]
Length=157

 Score =   158 bits (400),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  78   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  137

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  138  RVTIMPKDIQLARRIRGERA  157


 Score = 99.0 bits (245),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 61/92 (66%), Gaps = 21/92 (23%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLAT---------------------KAARKSAPTTGGVKKP  473
            MARTKQTARKSTGGKAPRKQLAT                     KAARKSAP TGGVKKP
Sbjct  1    MARTKQTARKSTGGKAPRKQLATNSLDGTPKTELTPKTDPSRLTKAARKSAPATGGVKKP  60

Query  472  HRYRPGTVALREIRKYQRALSSLSASFPSRGL  377
            HRYRPGTVALREIR+YQ++   L    P + L
Sbjct  61   HRYRPGTVALREIRRYQKSTELLIRKLPFQRL  92



>ref|XP_002045012.1| GM24194 [Drosophila sechellia]
 gb|EDW51030.1| GM24194 [Drosophila sechellia]
Length=136

 Score =   157 bits (398),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   107 bits (266),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHRYRPGT  LREIR+YQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTETLREIRRYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>ref|XP_002633139.1| Hypothetical protein CBG05838 [Caenorhabditis briggsae]
 ref|XP_002633174.1| Hypothetical protein CBG05886 [Caenorhabditis briggsae]
 ref|XP_002633318.1| Hypothetical protein CBG06055 [Caenorhabditis briggsae]
 ref|XP_002633321.1| Hypothetical protein CBG06058 [Caenorhabditis briggsae]
 ref|XP_002639224.1| Hypothetical protein CBG03775 [Caenorhabditis briggsae]
 emb|CAP26312.1| Protein CBG06058 [Caenorhabditis briggsae]
 emb|CAP26315.1| Protein CBG06055 [Caenorhabditis briggsae]
 emb|CAP26459.1| Protein CBG05886 [Caenorhabditis briggsae]
 emb|CAP26494.1| Protein CBG05838 [Caenorhabditis briggsae]
 emb|CAP24611.1| Protein CBG03775 [Caenorhabditis briggsae]
Length=136

 Score =   157 bits (398),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQE+AEAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQESAEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   109 bits (273),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAP  GGVKKPHRYRPGTVALREIR+YQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPAAGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>ref|XP_002502604.1| histone H3 [Micromonas sp. RCC299]
 ref|XP_002509008.1| histone H3 [Micromonas sp. RCC299]
 ref|XP_003059221.1| predicted protein [Micromonas pusilla CCMP1545]
 ref|XP_003061708.1| predicted protein [Micromonas pusilla CCMP1545]
 ref|XP_003061754.1| histone H3 [Micromonas pusilla CCMP1545]
 gb|EEH54338.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH54384.1| histone H3 [Micromonas pusilla CCMP1545]
 gb|EEH56353.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|ACO63862.1| histone H3 [Micromonas sp. RCC299]
 gb|ACO70266.1| histone H3 [Micromonas sp. RCC299]
Length=136

 Score =   157 bits (398),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS A+LALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAILALQEASEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   112 bits (281),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/71 (82%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHRYRPGTVALREIRKYQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRKYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>ref|XP_008830105.1| PREDICTED: histone H3-like [Nannospalax galili]
Length=136

 Score =   157 bits (398),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   108 bits (271),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MAR KQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHRYRPGTVALREIR+YQ++  
Sbjct  1    MARRKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>ref|XP_002077397.1| GD13199 [Drosophila simulans]
 gb|EDX16082.1| GD13199, partial [Drosophila simulans]
Length=133

 Score =   157 bits (398),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  54   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  113

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  114  RVTIMPKDIQLARRIRGERA  133


 Score =   104 bits (259),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = -2

Query  580  TKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALSSLS  401
            TKQTARKSTGGKAPRKQLATKAARKSAP TGGVK PHRYRPGTVALREIR+YQ++   L 
Sbjct  1    TKQTARKSTGGKAPRKQLATKAARKSAPATGGVKNPHRYRPGTVALREIRRYQKSTELLI  60

Query  400  ASFPSRGL  377
               P + L
Sbjct  61   RKLPFQRL  68



>dbj|BAD02413.1| histone 3 [Drosophila pseudoobscura]
Length=136

 Score =   157 bits (398),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   109 bits (273),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARK AP TGGVKKPHRYRPGTVALREIR+YQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKGAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>emb|CBI16419.3| unnamed protein product [Vitis vinifera]
Length=156

 Score =   127 bits (319),  Expect(2) = 8e-45, Method: Compositional matrix adjust.
 Identities = 62/64 (97%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = -1

Query  374  REIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIR  195
            REIAQDFKTDLRFQS AV ALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIR
Sbjct  93   REIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIR  152

Query  194  GERA  183
            GERA
Sbjct  153  GERA  156


 Score = 80.9 bits (198),  Expect(2) = 8e-45, Method: Compositional matrix adjust.
 Identities = 40/42 (95%), Positives = 41/42 (98%), Gaps = 0/42 (0%)
 Frame = -2

Query  592  DMARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHR  467
            +MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHR
Sbjct  52   EMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHR  93



>ref|XP_002045405.1| GM13629 [Drosophila sechellia]
 gb|EDW43605.1| GM13629 [Drosophila sechellia]
Length=136

 Score =   157 bits (398),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   109 bits (273),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MA TKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHRYRPGTVALREIR+YQ++  
Sbjct  1    MAHTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>ref|XP_004900740.1| PREDICTED: uncharacterized protein LOC101700900 [Heterocephalus 
glaber]
 gb|EHB13144.1| Histone H3.2 [Heterocephalus glaber]
Length=130

 Score =   157 bits (397),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  51   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  110

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  111  RVTIMPKDIQLARRIRGERA  130


 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 55/71 (77%), Gaps = 6/71 (8%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHR+      LREIR+YQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRH------LREIRRYQKSTE  54

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  55   LLIRKLPFQRL  65



>gb|KHJ92628.1| core histone H2A/H2B/H3/H4 [Oesophagostomum dentatum]
Length=136

 Score =   157 bits (398),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   108 bits (271),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MAR KQTARK+TGGKAPRKQLATKAARKSAP TGGVKKPHRYRPGTVALREIR+YQ++  
Sbjct  1    MARNKQTARKATGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>ref|XP_001983086.1| GG16350 [Drosophila erecta]
 gb|EDV45052.1| GG16350 [Drosophila erecta]
Length=136

 Score =   157 bits (398),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   104 bits (260),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            M  TKQTARKSTGGKA RKQLATKAARKSAP TGGVKKPHRYRPGTVALREIR+YQ++  
Sbjct  1    MVCTKQTARKSTGGKATRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>gb|AFY26274.1| histone H3, partial [Plectorhinchus mediterraneus]
Length=135

 Score =   157 bits (398),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  56   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  115

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  116  RVTIMPKDIQLARRIRGERA  135


 Score =   104 bits (259),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -2

Query  586  ARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALSS  407
            ARTKQTAR+STGGKAPRKQLATKAARKSA  TGGVKKPHRYRPGTVALREIR+YQ++   
Sbjct  1    ARTKQTARESTGGKAPRKQLATKAARKSALATGGVKKPHRYRPGTVALREIRRYQKSTEL  60

Query  406  LSASFPSRGL  377
            L    P + L
Sbjct  61   LIRKLPFQRL  70



>pdb|3AV1|A Chain A, The Human Nucleosome Structure Containing The Histone 
Variant H3.2
 pdb|3AV1|E Chain E, The Human Nucleosome Structure Containing The Histone 
Variant H3.2
Length=139

 Score =   157 bits (398),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  60   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  119

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  120  RVTIMPKDIQLARRIRGERA  139


 Score =   111 bits (277),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHRYRPGTVALREIR+YQ++  
Sbjct  4    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  63

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  64   LLIRKLPFQRL  74



>ref|XP_002028918.1| GL16975 [Drosophila persimilis]
 gb|EDW29383.1| GL16975 [Drosophila persimilis]
Length=130

 Score =   157 bits (397),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  51   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  110

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  111  RVTIMPKDIQLARRIRGERA  130


 Score =   100 bits (248),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = -2

Query  571  TARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALSSLSASF  392
            TARKSTGGKAPRKQLATKAARKSAP TGGVKKPHRYRPGTVALREIR+YQ++   L    
Sbjct  1    TARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKL  60

Query  391  PSRGL  377
            P + L
Sbjct  61   PFQRL  65



>ref|XP_004831868.1| histone H3, putative [Babesia equi]
 gb|EKX72416.1| histone H3, putative [Babesia equi strain WA]
Length=136

 Score =   157 bits (398),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQD+KTDLRFQS AVLALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDYKTDLRFQSQAVLALQEAAEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGER+
Sbjct  117  RVTIMPKDIQLARRIRGERS  136


 Score =   108 bits (270),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARK+AP T G+KKPHRYRPGTVALREIRK+Q++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKTAPVTAGIKKPHRYRPGTVALREIRKFQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>gb|AAI29431.1| Zgc:113984 protein [Danio rerio]
Length=136

 Score =   157 bits (398),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   109 bits (273),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHR+RPGTVALREIR+YQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRHRPGTVALREIRRYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>gb|EMS49486.1| Histone H3.2 [Triticum urartu]
Length=97

 Score =   156 bits (394),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 78/80 (98%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV ALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  18   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAK  77

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  78   RVTIMPKDIQLARRIRGERA  97



>gb|EGI60526.1| Histone H3 [Acromyrmex echinatior]
Length=138

 Score =   157 bits (398),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  59   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  118

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  119  RVTIMPKDIQLARRIRGERA  138


 Score =   111 bits (278),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHRYRPGTVALREIR+YQ++  
Sbjct  3    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  62

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  63   LLIRKLPFQRL  73



>gb|EJK60530.1| hypothetical protein THAOC_19093 [Thalassiosira oceanica]
Length=167

 Score =   158 bits (400),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 96/135 (71%), Gaps = 0/135 (0%)
 Frame = -1

Query  587  GSN*ANCP*VYRWKGSEEAACYEGCPEISPYHWWSEEAPSLSSWNCCSP*NPQVSESTEL  408
            G N A+ P V+R KG  +    +   + +P     ++               +  +ST+L
Sbjct  33   GPNKADRPQVHRRKGPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTDL  92

Query  407  LIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIM  228
            LIRKLPFQRLVREIAQDFK+DLRFQ  AVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIM
Sbjct  93   LIRKLPFQRLVREIAQDFKSDLRFQGSAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIM  152

Query  227  PKDIQLARRIRGERA  183
            PKDIQLARRIRGER+
Sbjct  153  PKDIQLARRIRGERS  167



>ref|XP_002002986.1| GI10040 [Drosophila mojavensis]
 gb|EDW12428.1| GI10040 [Drosophila mojavensis]
Length=131

 Score =   157 bits (397),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  52   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  111

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  112  RVTIMPKDIQLARRIRGERA  131


 Score = 95.9 bits (237),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 56/71 (79%), Gaps = 5/71 (7%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAA      TGGVKKPHRYRPGTVALREIR+YQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAA-----PTGGVKKPHRYRPGTVALREIRRYQKSTE  55

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  56   LLIRKLPFQRL  66



>emb|CAP53898.1| histone H3 [Xenoturbella bocki]
Length=135

 Score =   157 bits (398),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  56   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  115

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  116  RVTIMPKDIQLARRIRGERA  135


 Score = 95.9 bits (237),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 56/71 (79%), Gaps = 1/71 (1%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            M RTKQTARKSTGGKAPRKQL  +  RKSAP TGGVKKPHRYRPGTVALREIR+YQ++  
Sbjct  1    MTRTKQTARKSTGGKAPRKQL-RQGRRKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  59

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  60   LLIRKLPFQRL  70



>gb|ELU17516.1| hypothetical protein CAPTEDRAFT_212232 [Capitella teleta]
Length=137

 Score =   157 bits (398),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  58   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  117

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  118  RVTIMPKDIQLARRIRGERA  137


 Score = 95.5 bits (236),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -2

Query  562  KSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALSSLSASFPSR  383
            KSTGGKAPRKQLATKAARKSAP TGGVKKPHRYRPGTVALREIR+YQ++   L    P +
Sbjct  11   KSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQ  70

Query  382  GL  377
             L
Sbjct  71   RL  72



>ref|XP_008634735.1| PREDICTED: histone H3-like [Corvus brachyrhynchos]
 gb|KFO61379.1| Histone H3 [Corvus brachyrhynchos]
Length=136

 Score =   157 bits (398),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   107 bits (267),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLAT+AARKSAP  GGVKKPHRYRPGTVALREIR+YQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATQAARKSAPAPGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>ref|XP_002422632.1| histone H3, putative [Pediculus humanus corporis]
 ref|XP_002422650.1| histone H3, putative [Pediculus humanus corporis]
 gb|EEB09894.1| histone H3, putative [Pediculus humanus corporis]
 gb|EEB09912.1| histone H3, putative [Pediculus humanus corporis]
Length=153

 Score =   158 bits (399),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  74   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  133

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  134  RVTIMPKDIQLARRIRGERA  153


 Score =   111 bits (278),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHRYRPGTVALREIR+YQ++  
Sbjct  18   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  77

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  78   LLIRKLPFQRL  88



>gb|KGL82468.1| Histone H3, partial [Tinamus guttatus]
Length=131

 Score =   157 bits (397),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  52   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  111

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  112  RVTIMPKDIQLARRIRGERA  131


 Score =   101 bits (251),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = -2

Query  574  QTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALSSLSAS  395
            +TARKSTGGKAPRKQLATKAARKSAP TGGVKKPHRYRPGTVALREIR+YQ++   L   
Sbjct  1    ETARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRK  60

Query  394  FPSRGL  377
             P + L
Sbjct  61   LPFQRL  66



>gb|KFW77903.1| Histone H3, partial [Manacus vitellinus]
 gb|KFW77910.1| Histone H3, partial [Manacus vitellinus]
 gb|KFW87250.1| Histone H3, partial [Manacus vitellinus]
 gb|KFW87254.1| Histone H3, partial [Manacus vitellinus]
 gb|KFW87255.1| Histone H3, partial [Manacus vitellinus]
Length=134

 Score =   157 bits (397),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  55   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  114

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  115  RVTIMPKDIQLARRIRGERA  134


 Score =   102 bits (254),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = -2

Query  583  RTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALSSL  404
            RTKQT RKS GGKAPRKQLATKAARKSAP TGGVKKPHRYRPGTVALREIR+YQ++   L
Sbjct  1    RTKQTWRKSPGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELL  60

Query  403  SASFPSRGL  377
                P + L
Sbjct  61   IRKLPFQRL  69



>ref|XP_005108567.1| PREDICTED: histone H3-like [Aplysia californica]
Length=136

 Score =   157 bits (397),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   104 bits (259),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTAR STGGKAPRK+LATKAA KSAP TGGVKKPHRYRPGTVALREIR+YQ++  
Sbjct  1    MARTKQTARMSTGGKAPRKRLATKAACKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>ref|XP_003768750.1| PREDICTED: histone H3.2-like [Sarcophilus harrisii]
Length=118

 Score =   157 bits (396),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  39   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  98

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  99   RVTIMPKDIQLARRIRGERA  118


 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 43/71 (61%), Gaps = 18/71 (25%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTG                   TGGVKKPHRYRPGTVALREIR+YQ++  
Sbjct  1    MARTKQTARKSTGA------------------TGGVKKPHRYRPGTVALREIRRYQKSTE  42

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  43   LLIRKLPFQRL  53



>gb|EMS51112.1| Histone H3.2 [Triticum urartu]
Length=110

 Score =   156 bits (395),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/80 (96%), Positives = 78/80 (98%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV ALQEAAEAYLVGLFEDTNLCAIHAK
Sbjct  31   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAYLVGLFEDTNLCAIHAK  90

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  91   RVTIMPKDIQLARRIRGERA  110


 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 36/71 (51%), Gaps = 26/71 (37%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQ                          VALREIRKYQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQ--------------------------VALREIRKYQKSTE  34

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  35   LLIRKLPFQRL  45



>ref|XP_001862683.1| histone H3.1t [Culex quinquefasciatus]
 gb|EDS37375.1| histone H3.1t [Culex quinquefasciatus]
Length=151

 Score =   158 bits (399),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  72   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  131

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  132  RVTIMPKDIQLARRIRGERA  151


 Score =   111 bits (278),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHRYRPGTVALREIR+YQ++  
Sbjct  16   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  75

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  76   LLIRKLPFQRL  86



>emb|CBM82435.1| histone H3-I protein [Rhabdopleura compacta]
 emb|CBM82436.1| histone H3-II protein [Rhabdopleura compacta]
 emb|CBM82437.1| histone H3-III protein [Rhabdopleura compacta]
 emb|CBM82487.1| histone H3-VI protein [Balanoglossus clavigerus]
 emb|CBM82488.1| histone H3-VII protein [Balanoglossus clavigerus]
 emb|CBM82489.1| histone H3-VIII protein [Balanoglossus clavigerus]
 emb|CBM82490.1| histone H3-IX protein [Balanoglossus clavigerus]
Length=129

 Score =   157 bits (397),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  50   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  109

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  110  RVTIMPKDIQLARRIRGERA  129


 Score = 98.6 bits (244),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = -2

Query  568  ARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALSSLSASFP  389
            ARKSTGGKAPRKQLATKAARKSAP TGGVKKPHRYRPGTVALREIR+YQ++   L    P
Sbjct  1    ARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLP  60

Query  388  SRGL  377
             + L
Sbjct  61   FQRL  64



>ref|XP_008313557.1| PREDICTED: histone H3-like [Cynoglossus semilaevis]
Length=136

 Score =   157 bits (397),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 78/80 (98%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
             STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  57   NSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   108 bits (271),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 59/71 (83%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHRYRPGTVALREIR Y+ +  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRLYENSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>ref|XP_005150559.1| PREDICTED: histone H3.2-like [Melopsittacus undulatus]
Length=161

 Score =   158 bits (399),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   111 bits (277),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHRYRPGTVALREIR+YQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



>ref|XP_006125958.1| PREDICTED: histone H3.2-like isoform X1 [Pelodiscus sinensis]
Length=144

 Score =   157 bits (398),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  65   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  124

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  125  RVTIMPKDIQLARRIRGERA  144


 Score =   103 bits (257),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 61/79 (77%), Gaps = 8/79 (10%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKP--------HRYRPGTVALREI  434
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKP        HRYRPGTVALREI
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTPHRYRPGTVALREI  60

Query  433  RKYQRALSSLSASFPSRGL  377
            R+YQ++   L    P + L
Sbjct  61   RRYQKSTELLIRKLPFQRL  79



>ref|XP_004576699.1| PREDICTED: histone H3.2-like [Maylandia zebra]
Length=140

 Score =   157 bits (398),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/80 (95%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = -1

Query  422  ESTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAK  243
            +STELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAK
Sbjct  57   KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAK  116

Query  242  RVTIMPKDIQLARRIRGERA  183
            RVTIMPKDIQLARRIRGERA
Sbjct  117  RVTIMPKDIQLARRIRGERA  136


 Score =   111 bits (278),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -2

Query  589  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQRALS  410
            MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHRYRPGTVALREIR+YQ++  
Sbjct  1    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE  60

Query  409  SLSASFPSRGL  377
             L    P + L
Sbjct  61   LLIRKLPFQRL  71



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1064095936780