BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF008B19

Length=663
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004252814.1|  PREDICTED: tubulin alpha-2 chain-like              302   3e-100   Solanum lycopersicum
emb|CAJ38386.1|  alpha tubulin                                          303   6e-100   Plantago major [cart-track plant]
gb|EYU34085.1|  hypothetical protein MIMGU_mgv1a0196712mg               301   6e-100   Erythranthe guttata [common monkey flower]
gb|AHM93474.1|  alpha-tubulin                                           305   8e-100   Camellia chekiangoleosa
ref|XP_006433708.1|  hypothetical protein CICLE_v100015522mg            300   1e-99    
gb|AFR42020.1|  alpha-tubulin                                           300   1e-99    Populus trichocarpa [western balsam poplar]
gb|AFR42026.1|  alpha-tubulin                                           299   1e-99    Populus trichocarpa [western balsam poplar]
gb|AFR42035.1|  alpha-tubulin                                           299   2e-99    Populus alba [abele]
gb|AFR42049.1|  alpha-tubulin                                           299   2e-99    Populus fremontii
gb|AFR42054.1|  alpha-tubulin                                           299   2e-99    Populus fremontii
gb|AFR42036.1|  alpha-tubulin                                           299   2e-99    Populus alba [abele]
gb|AFR42042.1|  alpha-tubulin                                           299   2e-99    Populus fremontii
gb|KJB58759.1|  hypothetical protein B456_009G224800                    304   2e-99    Gossypium raimondii
gb|AFR42047.1|  alpha-tubulin                                           299   2e-99    Populus fremontii
emb|CAB76917.1|  alpha-tubulin 4                                        301   9e-99    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB32211.1|  hypothetical protein B456_005G229600                    303   1e-98    Gossypium raimondii
gb|AAW57309.1|  alpha-tubulin                                           300   1e-98    Ceratopteris richardii
gb|AAW57305.1|  alpha-tubulin                                           301   1e-98    Ceratopteris richardii
gb|AAW57310.1|  alpha-tubulin                                           299   1e-98    Ceratopteris richardii
gb|AHZ58481.1|  alpha-tubulin                                           297   1e-98    Syntrichia caninervis
gb|KDO81349.1|  hypothetical protein CISIN_1g013037mg                   302   2e-98    Citrus sinensis [apfelsine]
gb|ADD84794.1|  tubulin-like protein                                    296   2e-98    Cenchrus ciliaris [African foxtail grass]
dbj|BAH19954.1|  AT1G50010                                              298   2e-98    Arabidopsis thaliana [mouse-ear cress]
gb|EPS62716.1|  alpha-tubulin                                           303   3e-98    Genlisea aurea
dbj|BAF01952.1|  putative tubulin alpha-2/alpha-4 chain                 296   4e-98    Arabidopsis thaliana [mouse-ear cress]
gb|AHJ80819.1|  Tua1                                                    297   5e-98    Eragrostis tef [tef]
gb|KJB58756.1|  hypothetical protein B456_009G224800                    303   6e-98    Gossypium raimondii
gb|KIY91712.1|  Tubulin alpha chain                                     297   7e-98    Monoraphidium neglectum
gb|KGN48654.1|  hypothetical protein Csa_6G497050                       303   7e-98    Cucumis sativus [cucumbers]
ref|XP_004238046.1|  PREDICTED: tubulin alpha chain                     304   8e-98    
ref|XP_009614122.1|  PREDICTED: tubulin alpha-3 chain                   304   8e-98    Nicotiana tomentosiformis
ref|XP_004244533.1|  PREDICTED: tubulin alpha-3 chain-like              304   8e-98    Solanum lycopersicum
emb|CAD13176.1|  alpha-tubulin                                          304   8e-98    Nicotiana tabacum [American tobacco]
gb|ACH68563.1|  alpha-tubulin                                           304   8e-98    Solanum tuberosum [potatoes]
ref|XP_009790136.1|  PREDICTED: tubulin alpha chain                     304   8e-98    Nicotiana sylvestris
gb|ABB02631.1|  unknown                                                 304   8e-98    Solanum tuberosum [potatoes]
ref|XP_006356798.1|  PREDICTED: tubulin alpha chain-like                304   9e-98    Solanum tuberosum [potatoes]
ref|XP_009620798.1|  PREDICTED: tubulin alpha chain                     304   9e-98    Nicotiana tomentosiformis
ref|XP_006362511.1|  PREDICTED: tubulin alpha-1 chain-like              304   9e-98    
ref|XP_009605705.1|  PREDICTED: tubulin alpha-2 chain-like              304   9e-98    Nicotiana tomentosiformis
gb|ABP65320.1|  alpha tubulin                                           303   1e-97    Capsicum annuum
ref|NP_001275271.1|  alpha-tubulin-like protein                         303   1e-97    Solanum tuberosum [potatoes]
gb|ABC59068.2|  alpha tubulin 1                                         303   1e-97    Camellia sinensis [black tea]
ref|WP_039310890.1|  hypothetical protein                               303   1e-97    
emb|CAA52158.1|  alpha tubulin                                          296   2e-97    Zea mays [maize]
ref|XP_002677064.1|  alpha-tubulin                                      294   2e-97    Naegleria gruberi strain NEG-M
gb|ADW83724.1|  alpha-tubulin                                           301   3e-97    Musa acuminata AAA Group [Cavendish banana]
gb|EYU34660.1|  hypothetical protein MIMGU_mgv1a006269mg                302   3e-97    Erythranthe guttata [common monkey flower]
dbj|BAB19779.1|  alpha tubulin                                          302   3e-97    Nicotiana tabacum [American tobacco]
gb|KDO49533.1|  hypothetical protein CISIN_1g013062mg                   301   3e-97    Citrus sinensis [apfelsine]
gb|KJB58757.1|  hypothetical protein B456_009G224800                    301   4e-97    Gossypium raimondii
gb|EYU37544.1|  hypothetical protein MIMGU_mgv1a007145mg                301   4e-97    Erythranthe guttata [common monkey flower]
gb|AAW57306.1|  alpha-tubulin                                           295   4e-97    Ceratopteris richardii
emb|CDY46272.1|  BnaC05g50610D                                          296   4e-97    Brassica napus [oilseed rape]
gb|AAD11425.1|  alpha tubulin                                           299   4e-97    Mesembryanthemum crystallinum
ref|XP_003608582.1|  Tubulin alpha-5 chain                              302   4e-97    Medicago truncatula
emb|CDP02221.1|  unnamed protein product                                302   5e-97    Coffea canephora [robusta coffee]
ref|NP_001291325.1|  tubulin alpha chain-like                           302   5e-97    Sesamum indicum [beniseed]
ref|XP_011098608.1|  PREDICTED: tubulin alpha chain                     302   5e-97    Sesamum indicum [beniseed]
ref|XP_010242419.1|  PREDICTED: tubulin alpha-1 chain                   302   5e-97    Nelumbo nucifera [Indian lotus]
gb|KDO81348.1|  hypothetical protein CISIN_1g013037mg                   301   5e-97    Citrus sinensis [apfelsine]
gb|ACN40181.1|  unknown                                                 301   5e-97    Picea sitchensis
ref|XP_002283198.1|  PREDICTED: tubulin alpha chain                     301   5e-97    Vitis vinifera
emb|CAN62392.1|  hypothetical protein VITISV_016172                     301   5e-97    Vitis vinifera
ref|XP_008384431.1|  PREDICTED: tubulin alpha-3 chain-like              296   5e-97    
ref|XP_008804464.1|  PREDICTED: tubulin alpha chain-like                301   5e-97    Phoenix dactylifera
gb|KDP44552.1|  hypothetical protein JCGZ_16385                         301   5e-97    Jatropha curcas
gb|ACJ60905.1|  alpha tubulin                                           301   5e-97    Betula pendula [white birch]
ref|XP_006422747.1|  hypothetical protein CICLE_v10028426mg             301   5e-97    Citrus clementina [clementine]
gb|ABX57816.1|  alpha tubulin                                           301   6e-97    Picea wilsonii
ref|NP_001289660.1|  tubulin alpha chain-like                           301   6e-97    Eucalyptus grandis [rose gum]
gb|AAV92352.1|  alpha tubulin 1                                         301   6e-97    Pseudotsuga menziesii var. menziesii
sp|P33629.1|TBA_PRUDU  RecName: Full=Tubulin alpha chain                301   6e-97    Prunus dulcis [sweet almond]
ref|XP_007199840.1|  hypothetical protein PRUPE_ppa005633mg             301   6e-97    Prunus persica
ref|XP_010245599.1|  PREDICTED: tubulin alpha chain-like                301   6e-97    Nelumbo nucifera [Indian lotus]
ref|XP_008372961.1|  PREDICTED: tubulin alpha chain isoform X1          301   6e-97    Malus domestica [apple tree]
ref|XP_007032501.1|  Tubulin alpha-2 chain                              301   6e-97    
gb|ABO47740.1|  alpha-tubulin                                           301   6e-97    Gossypium hirsutum [American cotton]
ref|XP_011457777.1|  PREDICTED: tubulin alpha chain                     301   6e-97    Fragaria vesca subsp. vesca
ref|XP_009335354.1|  PREDICTED: tubulin alpha chain                     301   6e-97    Pyrus x bretschneideri [bai li]
ref|XP_010943272.1|  PREDICTED: tubulin alpha chain-like                301   6e-97    Elaeis guineensis
ref|XP_008787760.1|  PREDICTED: tubulin alpha chain-like                301   6e-97    Phoenix dactylifera
ref|XP_002510010.1|  tubulin alpha chain, putative                      301   6e-97    Ricinus communis
ref|XP_007018369.1|  Tubulin alpha-2 chain                              301   6e-97    Theobroma cacao [chocolate]
gb|ABO47739.1|  alpha-tubulin                                           301   6e-97    Gossypium hirsutum [American cotton]
ref|XP_010266793.1|  PREDICTED: tubulin alpha chain                     301   6e-97    Nelumbo nucifera [Indian lotus]
ref|XP_008787237.1|  PREDICTED: tubulin alpha chain                     301   6e-97    Phoenix dactylifera
ref|XP_002522104.1|  tubulin alpha chain, putative                      301   6e-97    Ricinus communis
ref|XP_004143417.1|  PREDICTED: tubulin alpha chain-like                301   6e-97    Cucumis sativus [cucumbers]
ref|XP_004288297.1|  PREDICTED: tubulin alpha-3 chain                   301   6e-97    Fragaria vesca subsp. vesca
ref|XP_009626810.1|  PREDICTED: tubulin alpha chain-like                301   6e-97    Nicotiana tomentosiformis
ref|XP_009335355.1|  PREDICTED: tubulin alpha chain-like                301   6e-97    Pyrus x bretschneideri [bai li]
ref|XP_010093625.1|  Tubulin alpha chain                                301   6e-97    Morus notabilis
ref|XP_001764722.1|  predicted protein                                  301   6e-97    
ref|XP_008440459.1|  PREDICTED: tubulin alpha chain-like isoform X1     301   7e-97    Cucumis melo [Oriental melon]
ref|XP_010065856.1|  PREDICTED: tubulin alpha chain                     301   7e-97    Eucalyptus grandis [rose gum]
ref|XP_002981542.1|  hypothetical protein SELMODRAFT_178975             301   7e-97    Selaginella moellendorffii
ref|XP_003635553.2|  PREDICTED: tubulin alpha chain-like                301   7e-97    Vitis vinifera
sp|P46259.1|TBA1_PEA  RecName: Full=Tubulin alpha-1 chain               301   7e-97    Pisum sativum [garden pea]
gb|AIX10966.1|  tubulin                                                 301   7e-97    Ornithogalum longebracteatum [sea-onion]
ref|XP_010939312.1|  PREDICTED: tubulin alpha chain-like                301   7e-97    Elaeis guineensis
gb|KDO81347.1|  hypothetical protein CISIN_1g013037mg                   301   7e-97    Citrus sinensis [apfelsine]
ref|XP_006472372.1|  PREDICTED: tubulin alpha chain isoform X1          301   7e-97    Citrus sinensis [apfelsine]
gb|KHG18997.1|  Tubulin alpha chain                                     301   7e-97    Gossypium arboreum [tree cotton]
gb|KDP32140.1|  hypothetical protein JCGZ_12601                         301   7e-97    Jatropha curcas
ref|XP_004232226.1|  PREDICTED: tubulin alpha chain-like                301   7e-97    Solanum lycopersicum
sp|Q6VAF9.1|TBA4_GOSHI  RecName: Full=Tubulin alpha-4 chain; AltN...    301   7e-97    Gossypium hirsutum [American cotton]
ref|XP_002275973.1|  PREDICTED: tubulin alpha chain                     301   7e-97    Vitis vinifera
ref|XP_007205183.1|  hypothetical protein PRUPE_ppa005613mg             301   7e-97    Prunus persica
ref|XP_006426173.1|  hypothetical protein CICLE_v10025588mg             301   7e-97    Citrus clementina [clementine]
ref|XP_010256937.1|  PREDICTED: tubulin alpha chain-like                301   7e-97    Nelumbo nucifera [Indian lotus]
ref|XP_002517492.1|  tubulin alpha chain, putative                      301   7e-97    Ricinus communis
ref|XP_010104543.1|  Tubulin alpha chain                                301   7e-97    
ref|XP_002301128.1|  hypothetical protein POPTR_0002s11250g             301   7e-97    Populus trichocarpa [western balsam poplar]
ref|XP_010099392.1|  Tubulin alpha chain                                302   7e-97    
ref|XP_010526692.1|  PREDICTED: tubulin alpha chain-like                301   7e-97    Tarenaya hassleriana [spider flower]
ref|XP_010531321.1|  PREDICTED: tubulin alpha chain isoform X1          301   7e-97    Tarenaya hassleriana [spider flower]
gb|AID52921.1|  tubulin alpha chain                                     301   7e-97    Carthamus tinctorius
ref|XP_010936237.1|  PREDICTED: tubulin alpha chain-like                301   7e-97    Elaeis guineensis
ref|XP_008455054.1|  PREDICTED: tubulin alpha-4 chain isoform X1        301   7e-97    Cucumis melo [Oriental melon]
ref|XP_004136930.1|  PREDICTED: tubulin alpha-4 chain-like              301   7e-97    Cucumis sativus [cucumbers]
emb|CAD20821.1|  alpha tubulin                                          295   8e-97    Zea mays [maize]
ref|XP_007137281.1|  hypothetical protein PHAVU_009G114100g             301   8e-97    Phaseolus vulgaris [French bean]
gb|ABO47736.1|  alpha-tubulin                                           301   8e-97    Gossypium hirsutum [American cotton]
ref|XP_006466394.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    301   8e-97    Citrus sinensis [apfelsine]
ref|XP_004501073.1|  PREDICTED: tubulin alpha chain-like                301   8e-97    Cicer arietinum [garbanzo]
gb|AGG37283.1|  alpha-tubulin 1                                         301   8e-97    Salix arbutifolia
ref|XP_003522731.1|  PREDICTED: tubulin alpha-4 chain isoform X1        301   8e-97    Glycine max [soybeans]
gb|KDP41548.1|  hypothetical protein JCGZ_15955                         301   8e-97    Jatropha curcas
ref|XP_007042689.1|  Tubulin alpha-2 chain                              301   8e-97    Theobroma cacao [chocolate]
ref|XP_003603670.1|  Tubulin alpha-7 chain                              301   8e-97    Medicago truncatula
ref|XP_010555432.1|  PREDICTED: tubulin alpha chain-like                301   9e-97    Tarenaya hassleriana [spider flower]
gb|AGG37289.1|  alpha-tubulin 7                                         301   1e-96    Salix arbutifolia
gb|KHN08201.1|  Tubulin alpha chain                                     301   1e-96    Glycine soja [wild soybean]
ref|XP_011008936.1|  PREDICTED: tubulin alpha chain                     301   1e-96    Populus euphratica
gb|AEQ75493.1|  alpha-tubulin                                           300   1e-96    Rosa multiflora [Japanese rose]
gb|KHG20487.1|  Tubulin alpha chain                                     301   1e-96    Gossypium arboreum [tree cotton]
gb|ACK76232.1|  alpha-tubulin                                           301   1e-96    Dimocarpus longan [longan]
sp|P33623.1|TBA1_ANEPH  RecName: Full=Tubulin alpha-1 chain             301   1e-96    Anemia phyllitidis
ref|XP_002324047.2|  hypothetical protein POPTR_0017s11740g             301   1e-96    
gb|AIX10773.1|  alpha tubulin                                           301   1e-96    Panax notoginseng [san-qi]
ref|XP_008621874.1|  tubulin alpha                                      295   1e-96    Saprolegnia diclina VS20
gb|ABR26150.1|  tubulin alpha-3 chain                                   291   1e-96    Oryza sativa Indica Group [Indian rice]
ref|XP_004304311.1|  PREDICTED: tubulin alpha-2 chain-like              301   1e-96    Fragaria vesca subsp. vesca
ref|XP_011088040.1|  PREDICTED: tubulin alpha chain                     300   1e-96    Sesamum indicum [beniseed]
ref|XP_007215369.1|  hypothetical protein PRUPE_ppa005626mg             300   2e-96    Prunus persica
gb|AAX96763.1|  Tubulin/FtsZ family, GTPase domain, putative            297   2e-96    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006404742.1|  hypothetical protein EUTSA_v10000161mg             300   2e-96    Eutrema salsugineum [saltwater cress]
ref|XP_010060142.1|  PREDICTED: tubulin alpha chain-like                300   2e-96    Eucalyptus grandis [rose gum]
ref|XP_004299843.1|  PREDICTED: tubulin alpha chain-like                300   2e-96    Fragaria vesca subsp. vesca
gb|ABR25510.1|  tubulin alpha-1 chain                                   294   2e-96    Oryza sativa Indica Group [Indian rice]
emb|CAD20820.1|  alpha tubulin                                          291   2e-96    Zea mays [maize]
gb|AGG37285.1|  alpha-tubulin 3                                         300   2e-96    Salix arbutifolia
ref|XP_002298794.2|  TUBULIN ALPHA CHAIN family protein                 300   2e-96    Populus trichocarpa [western balsam poplar]
gb|ABK92520.1|  unknown                                                 300   2e-96    Populus trichocarpa [western balsam poplar]
ref|XP_008379344.1|  PREDICTED: tubulin alpha-2 chain                   300   2e-96    Malus domestica [apple tree]
ref|XP_006581474.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    300   2e-96    
ref|XP_003558668.1|  PREDICTED: tubulin alpha-2 chain-like              300   2e-96    Brachypodium distachyon [annual false brome]
dbj|BAJ06364.1|  alpha-tubulin                                          300   2e-96    Alopecurus aequalis
emb|CAL35827.1|  alpha-2 tubulin                                        293   2e-96    Plantago major [cart-track plant]
ref|XP_011030289.1|  PREDICTED: tubulin alpha-4 chain                   300   2e-96    Populus euphratica
ref|XP_009402887.1|  PREDICTED: tubulin alpha chain                     300   2e-96    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007223365.1|  hypothetical protein PRUPE_ppa005617mg             300   2e-96    Prunus persica
ref|XP_002959708.1|  alpha tubulin                                      293   2e-96    Volvox carteri f. nagariensis
ref|XP_006307493.1|  hypothetical protein CARUB_v10009117mg             300   2e-96    Capsella rubella
gb|AFW67749.1|  alpha tubulin4                                          296   2e-96    
gb|ABR25378.1|  tubulin alpha 3 chain                                   291   2e-96    Oryza sativa Indica Group [Indian rice]
gb|ABQ59633.1|  alpha-tubulin 3                                         300   2e-96    Populus tremuloides
ref|XP_009409992.1|  PREDICTED: tubulin alpha chain-like                300   2e-96    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009388502.1|  PREDICTED: tubulin alpha-2 chain isoform X1        300   2e-96    Musa acuminata subsp. malaccensis [pisang utan]
gb|ABD92937.1|  alpha tubulin-4A                                        300   2e-96    Triticum aestivum [Canadian hard winter wheat]
gb|KDO25258.1|  hypothetical protein SPRG_09506                         291   2e-96    Saprolegnia parasitica CBS 223.65
ref|XP_010096739.1|  Tubulin alpha chain                                300   3e-96    
gb|ABD92936.1|  alpha tubulin-4D                                        300   3e-96    Triticum aestivum [Canadian hard winter wheat]
gb|AAB36609.1|  alpha-tubulin                                           298   3e-96    Eucalyptus globulus subsp. bicostata
sp|Q6VAG0.1|TBA2_GOSHI  RecName: Full=Tubulin alpha-2 chain; AltN...    300   3e-96    Gossypium hirsutum [American cotton]
ref|XP_003556001.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    300   3e-96    Glycine max [soybeans]
sp|Q6VAG1.1|TBA1_GOSHI  RecName: Full=Tubulin alpha-1 chain; AltN...    300   3e-96    Gossypium hirsutum [American cotton]
gb|KHN42598.1|  Tubulin alpha-2 chain                                   300   3e-96    Glycine soja [wild soybean]
ref|XP_003536570.1|  PREDICTED: tubulin alpha chain-like isoform X1     300   3e-96    Glycine max [soybeans]
ref|XP_007156677.1|  hypothetical protein PHAVU_002G007900g             300   3e-96    Phaseolus vulgaris [French bean]
gb|KEH43997.1|  tubulin beta-1 chain                                    300   3e-96    Medicago truncatula
ref|XP_004496862.1|  PREDICTED: tubulin alpha chain-like                300   3e-96    Cicer arietinum [garbanzo]
ref|XP_003517369.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    300   3e-96    Glycine max [soybeans]
ref|XP_011014531.1|  PREDICTED: tubulin alpha-4 chain-like              300   3e-96    Populus euphratica
ref|XP_002779346.1|  alpha-tubulin, putative                            290   3e-96    Perkinsus marinus ATCC 50983
ref|XP_003539228.1|  PREDICTED: tubulin alpha-2 chain-like              300   3e-96    Glycine max [soybeans]
ref|XP_007515802.1|  alpha-tubulin                                      298   3e-96    Bathycoccus prasinos
ref|XP_002962630.1|  hypothetical protein SELMODRAFT_230143             300   4e-96    
ref|XP_007143142.1|  hypothetical protein PHAVU_007G047300g             300   4e-96    Phaseolus vulgaris [French bean]
gb|KIZ01406.1|  Tubulin alpha-1 chain                                   300   4e-96    Monoraphidium neglectum
emb|CDY29334.1|  BnaA05g16010D                                          299   4e-96    Brassica napus [oilseed rape]
ref|XP_001777110.1|  predicted protein                                  296   4e-96    
ref|XP_002964078.1|  hypothetical protein SELMODRAFT_405729             299   4e-96    Selaginella moellendorffii
gb|AFW67748.1|  alpha tubulin4                                          296   4e-96    
ref|XP_010420792.1|  PREDICTED: tubulin alpha-3 chain-like              290   5e-96    Camelina sativa [gold-of-pleasure]
gb|KJB29387.1|  hypothetical protein B456_005G097800                    299   5e-96    Gossypium raimondii
gb|AAO73546.1|  alpha-tubulin                                           299   5e-96    Ceratopteris richardii
ref|XP_004150268.1|  PREDICTED: tubulin alpha chain-like                299   5e-96    Cucumis sativus [cucumbers]
gb|KFK32793.1|  hypothetical protein AALP_AA6G289100                    299   5e-96    Arabis alpina [alpine rockcress]
emb|CDY66630.1|  BnaCnng51680D                                          298   6e-96    Brassica napus [oilseed rape]
dbj|BAH20267.1|  AT5G19780                                              293   6e-96    Arabidopsis thaliana [mouse-ear cress]
gb|AAO46127.1|  alpha-tubulin                                           292   6e-96    Streblomastix strix
ref|XP_010507910.1|  PREDICTED: tubulin alpha-2 chain-like              299   6e-96    Camelina sativa [gold-of-pleasure]
dbj|BAE99023.1|  tubulin alpha-2/alpha-4 chain                          299   7e-96    Arabidopsis thaliana [mouse-ear cress]
ref|NP_171974.1|  tubulin alpha-4 chain                                 299   7e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009147859.1|  PREDICTED: tubulin alpha-6 chain                   299   7e-96    Brassica rapa
gb|AHJ80823.1|  Tua1                                                    299   7e-96    Eragrostis tef [tef]
dbj|BAC24800.1|  alpha tubulin                                          299   7e-96    Physcomitrella patens
gb|ACU20294.1|  unknown                                                 295   7e-96    Glycine max [soybeans]
gb|AAL16174.1|AF428406_1  AT4g14960/dl3520c                             299   8e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010500555.1|  PREDICTED: tubulin alpha-6 chain isoform X1        299   8e-96    Camelina sativa [gold-of-pleasure]
ref|NP_193232.1|  tubulin alpha-6 chain                                 299   8e-96    Arabidopsis thaliana [mouse-ear cress]
emb|CAB66336.1|  alpha-tubulin                                          298   9e-96    Betula pendula [white birch]
ref|XP_010664458.1|  PREDICTED: tubulin alpha-4 chain                   298   1e-95    Vitis vinifera
ref|XP_011398411.1|  Tubulin alpha chain                                296   1e-95    Auxenochlorella protothecoides
gb|AEW46684.1|  beta-tubulin                                            298   1e-95    Ulva linza
ref|XP_009407690.1|  PREDICTED: tubulin alpha chain-like                298   1e-95    Musa acuminata subsp. malaccensis [pisang utan]
gb|AAO46130.1|  alpha-tubulin                                           291   1e-95    Streblomastix strix
ref|XP_009124556.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    298   1e-95    Brassica rapa
gb|KJB33191.1|  hypothetical protein B456_006G002500                    289   1e-95    Gossypium raimondii
ref|XP_008665337.1|  PREDICTED: tubulin alpha-1 chain-like              298   1e-95    
ref|XP_008665339.1|  PREDICTED: tubulin alpha-2 chain                   298   1e-95    Zea mays [maize]
gb|ABL61201.1|  alpha-tubulin                                           293   1e-95    Oxymonadida environmental sample
dbj|BAP59012.1|  alpha tubulin                                          298   1e-95    Taxus cuspidata [ichii]
gb|AHJ80815.1|  Tua1                                                    298   1e-95    Eragrostis tef [tef]
gb|ABQ59634.1|  alpha-tubulin 5                                         298   1e-95    Populus tremuloides
gb|AHJ80817.1|  Tua1                                                    298   1e-95    Eragrostis tef [tef]
ref|XP_007047652.1|  Tubulin alpha-2 chain                              300   1e-95    
dbj|BAJ06362.1|  alpha-tubulin                                          298   1e-95    Alopecurus aequalis
ref|XP_003560377.1|  PREDICTED: tubulin alpha-1 chain                   298   1e-95    Brachypodium distachyon [annual false brome]
ref|XP_004981922.1|  PREDICTED: tubulin alpha-1 chain-like              298   1e-95    Setaria italica
tpg|DAA51109.1|  TPA: alpha tubulin                                     298   1e-95    
ref|NP_001167663.1|  tubulin alpha-3 chain                              298   1e-95    Zea mays [maize]
emb|CAA06619.1|  alpha-tubulin 1                                        298   1e-95    Eleusine indica [crabgrass]
sp|O22347.1|TBA1_ELEIN  RecName: Full=Tubulin alpha-1 chain; AltN...    298   1e-95    Eleusine indica [crabgrass]
gb|AFC88832.1|  putative tubulin alpha-3 chain                          298   1e-95    Miscanthus sinensis
dbj|BAD94893.1|  tubulin alpha-5 chain-like protein                     289   1e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002313194.1|  hypothetical protein POPTR_0009s08850g             298   1e-95    Populus trichocarpa [western balsam poplar]
gb|ABO47742.1|  alpha-tubulin                                           298   1e-95    Gossypium hirsutum [American cotton]
sp|Q9ZRR5.1|TBA3_HORVU  RecName: Full=Tubulin alpha-3 chain             298   1e-95    Hordeum vulgare [barley]
gb|AGG37287.1|  alpha-tubulin 5                                         298   2e-95    Salix arbutifolia
gb|ABL61216.1|  alpha-tubulin                                           293   2e-95    Oxymonadida environmental sample
ref|XP_002466535.1|  hypothetical protein SORBIDRAFT_01g009570          298   2e-95    
ref|XP_010680774.1|  PREDICTED: tubulin alpha-2 chain                   298   2e-95    Beta vulgaris subsp. vulgaris [field beet]
gb|ABV55999.1|  alpha-tubulin 7                                         298   2e-95    Populus tremuloides
emb|CDO97305.1|  unnamed protein product                                298   2e-95    Coffea canephora [robusta coffee]
ref|XP_006650518.1|  PREDICTED: tubulin alpha-1 chain-like              298   2e-95    Oryza brachyantha
dbj|BAG99724.1|  unnamed protein product                                296   2e-95    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006662856.1|  PREDICTED: tubulin alpha-3 chain-like              298   2e-95    Oryza brachyantha
gb|ABF98641.1|  Tubulin alpha-1 chain, putative, expressed              296   2e-95    Oryza sativa Japonica Group [Japonica rice]
ref|XP_005651460.1|  tubulin alpha chain                                298   2e-95    Coccomyxa subellipsoidea C-169
ref|XP_011002356.1|  PREDICTED: tubulin alpha chain-like                298   2e-95    Populus euphratica
ref|XP_005851144.1|  alpha-tubulin                                      297   2e-95    Chlorella variabilis
ref|XP_005643073.1|  tubulin alpha chain                                297   3e-95    Coccomyxa subellipsoidea C-169
gb|EKF29047.1|  epsilon tubulin, putative                               290   3e-95    Trypanosoma cruzi marinkellei
gb|EKF28172.1|  epsilon tubulin, putative                               290   3e-95    Trypanosoma cruzi marinkellei
emb|CBH08958.1|  alpha tubulin, (fragment)                              292   3e-95    Trypanosoma brucei gambiense DAL972
gb|KIZ03400.1|  Tubulin alpha chain                                     297   3e-95    Monoraphidium neglectum
ref|XP_006650524.1|  PREDICTED: tubulin alpha-1 chain-like              297   3e-95    Oryza brachyantha
gb|ADJ00012.1|  tubulin alpha chain                                     290   3e-95    Chromera velia
gb|KJB83378.1|  hypothetical protein B456_013G244600                    296   3e-95    Gossypium raimondii
gb|ABL61212.1|  alpha-tubulin                                           293   3e-95    Oxymonadida environmental sample
gb|ABL61215.1|  alpha-tubulin                                           293   3e-95    Oxymonadida environmental sample
gb|KDD76276.1|  tubulin/FtsZ GTPase                                     297   4e-95    Helicosporidium sp. ATCC 50920
gb|ABD92930.1|  alpha tubulin-2A                                        297   4e-95    Triticum aestivum [Canadian hard winter wheat]
emb|CCD11782.1|  unnamed protein product                                290   4e-95    Trypanosoma congolense IL3000
ref|XP_001770881.1|  predicted protein                                  297   4e-95    
gb|AAB08791.1|  alpha tubulin                                           297   4e-95    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABL61224.1|  alpha-tubulin                                           292   4e-95    Oxymonadida environmental sample
tpg|DAA41189.1|  TPA: alpha tubulin5                                    293   4e-95    
sp|Q96460.1|TBA2_HORVU  RecName: Full=Tubulin alpha-2 chain             297   4e-95    Hordeum vulgare [barley]
tpg|DAA63280.1|  TPA: alpha tubulin6                                    293   4e-95    
ref|XP_006601463.1|  PREDICTED: tubulin alpha-3 chain-like              296   4e-95    
sp|Q9ZRB7.1|TBA_WHEAT  RecName: Full=Tubulin alpha chain                297   5e-95    Triticum aestivum [Canadian hard winter wheat]
gb|AHJ80821.1|  Tua3                                                    295   5e-95    Eragrostis tef [tef]
emb|CBH08953.1|  alpha tubulin, (fragment)                              288   5e-95    Trypanosoma brucei gambiense DAL972
gb|ACU19580.1|  unknown                                                 296   5e-95    Glycine max [soybeans]
ref|XP_002508010.1|  alpha tubulin 2                                    296   5e-95    Micromonas commoda
ref|XP_008341563.1|  PREDICTED: tubulin alpha-2 chain-like              296   5e-95    
gb|ETM52928.1|  tubulin alpha chain                                     295   5e-95    
gb|ABO47737.1|  alpha-tubulin                                           296   5e-95    
ref|XP_010461854.1|  PREDICTED: tubulin alpha-6 chain-like              296   6e-95    
gb|AAO46128.1|  alpha-tubulin                                           290   6e-95    
ref|XP_003058621.1|  alpha tubulin                                      296   6e-95    
gb|AAZ23863.1|  alpha-tubulin                                           296   7e-95    
ref|XP_010557535.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    296   8e-95    
gb|ABL61219.1|  alpha-tubulin                                           291   8e-95    
ref|XP_008804327.1|  PREDICTED: tubulin alpha-1 chain-like              296   8e-95    
gb|ABL61202.1|  alpha-tubulin                                           291   9e-95    
gb|KCW87067.1|  hypothetical protein EUGRSUZ_B03604                     294   9e-95    
sp|Q25563.1|TBA13_NAEGR  RecName: Full=Tubulin alpha-13 chain           296   9e-95    
ref|XP_008464962.1|  PREDICTED: tubulin alpha-3 chain-like              296   9e-95    
ref|XP_004141134.1|  PREDICTED: tubulin alpha-3 chain-like              296   9e-95    
gb|AAQ81585.1|  putative tubulin alpha-2/alpha-4 chain                  296   1e-94    
ref|XP_002675196.1|  alpha-tubulin                                      296   1e-94    
gb|AAT09063.1|  alpha tubulin 1                                         296   1e-94    
gb|AEG74028.1|  alpha-tubulin                                           296   1e-94    
ref|XP_009400845.1|  PREDICTED: tubulin alpha-3 chain                   296   1e-94    
ref|XP_009406530.1|  PREDICTED: tubulin alpha-3 chain-like              296   1e-94    
gb|ACN40824.1|  unknown                                                 296   1e-94    
ref|XP_008349406.1|  PREDICTED: tubulin alpha-3 chain                   296   1e-94    
emb|CEG01594.1|  Tubulin/FtsZ, 2-layer sandwich domain                  296   1e-94    
gb|ABL61217.1|  alpha-tubulin                                           291   1e-94    
gb|KJB34154.1|  hypothetical protein B456_006G050600                    288   1e-94    
gb|KHN01709.1|  Tubulin alpha chain                                     296   1e-94    
gb|AHJ80820.1|  Tua3                                                    294   1e-94    
gb|ABK92552.1|  unknown                                                 296   1e-94    
ref|XP_009375870.1|  PREDICTED: tubulin alpha-3 chain                   296   1e-94    
gb|ABL61204.1|  alpha-tubulin                                           290   1e-94    
emb|CDW82295.1|  alpha tubulin                                          296   1e-94    
ref|XP_003524707.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    296   1e-94    
emb|CDP12358.1|  unnamed protein product                                296   1e-94    
ref|XP_006431130.1|  hypothetical protein CICLE_v10011709mg             295   1e-94    
ref|XP_010673470.1|  PREDICTED: tubulin alpha-3 chain                   295   1e-94    
ref|XP_011089722.1|  PREDICTED: tubulin alpha-3 chain                   295   1e-94    
emb|CDP17586.1|  unnamed protein product                                295   1e-94    
gb|ABU93321.1|  tubulin alpha subunit                                   296   1e-94    
emb|CAA62916.1|  alpha-tubulin                                          295   1e-94    
sp|P28287.1|TBA_OXYGR  RecName: Full=Tubulin alpha chain                295   1e-94    
gb|AAK37831.1|AF182309_1  alpha-tubulin                                 295   1e-94    
gb|ABL61203.1|  alpha-tubulin                                           290   1e-94    
ref|XP_002782100.1|  Tubulin alpha chain, putative                      291   1e-94    
gb|EJY81124.1|  Alpha tubulin,putative                                  295   1e-94    
ref|XP_002285721.1|  PREDICTED: tubulin alpha-3 chain                   295   1e-94    
gb|ETW27380.1|  tubulin alpha chain                                     291   1e-94    
gb|AAG28536.1|AF199019_1  alpha tubulin                                 287   1e-94    
gb|AEF79970.1|  alpha-tubulin protein                                   295   2e-94    
ref|XP_007155784.1|  hypothetical protein PHAVU_003G231500g             295   2e-94    
ref|NP_001051132.1|  Os03g0726100                                       295   2e-94    
gb|ACL53551.1|  unknown                                                 286   2e-94    
ref|XP_008351479.1|  PREDICTED: tubulin alpha-3 chain                   295   2e-94    
ref|XP_006445597.1|  hypothetical protein CICLE_v10015224mg             295   2e-94    
ref|XP_008223650.1|  PREDICTED: tubulin alpha-3 chain-like              295   2e-94    
ref|XP_001777081.1|  predicted protein                                  295   2e-94    
ref|XP_006858944.1|  hypothetical protein AMTR_s00068p00090790          295   2e-94    
ref|XP_002980240.1|  hypothetical protein SELMODRAFT_419896             294   2e-94    
ref|XP_003080933.1|  TBA_CHLVU Tubulin alpha chain (ISS)                296   2e-94    
gb|ETM53002.1|  tubulin alpha chain                                     286   2e-94    
gb|ABL61227.1|  alpha-tubulin                                           291   2e-94    
ref|XP_004295008.1|  PREDICTED: tubulin alpha-3 chain isoform X1        295   2e-94    
ref|XP_007205189.1|  hypothetical protein PRUPE_ppa005642mg             295   2e-94    
sp|P33625.1|TBA_EUGGR  RecName: Full=Tubulin alpha chain                295   2e-94    
gb|ABL61213.1|  alpha-tubulin                                           291   2e-94    
ref|XP_010276368.1|  PREDICTED: tubulin alpha-3 chain-like              295   2e-94    
ref|XP_009622332.1|  PREDICTED: tubulin alpha-3 chain                   295   2e-94    
ref|XP_009408459.1|  PREDICTED: tubulin alpha-3 chain-like              295   2e-94    
emb|CDJ60085.1|  tubulin alpha chain, putative                          294   2e-94    
gb|AIA82433.1|  alpha-tubulin-like protein 01                           295   2e-94    
gb|AIA82435.1|  alpha-tubulin-like protein 03                           295   2e-94    
gb|EYU23006.1|  hypothetical protein MIMGU_mgv1a006283mg                295   2e-94    
ref|XP_001782790.1|  predicted protein                                  295   2e-94    
gb|AHJ80816.1|  Tua1                                                    295   2e-94    
gb|AFK33477.1|  unknown                                                 292   2e-94    
gb|ABL61226.1|  alpha-tubulin                                           290   2e-94    
gb|EPR58771.1|  alpha tubulin TUBA1                                     294   2e-94    
sp|P33624.1|TBA2_ANEPH  RecName: Full=Tubulin alpha-2 chain             292   2e-94    
ref|XP_001419217.1|  predicted protein                                  295   2e-94    
gb|EWC76931.1|  tubulin alpha chain                                     290   3e-94    
gb|ABL61214.1|  alpha-tubulin                                           290   3e-94    
gb|ABU93324.1|  tubulin alpha subunit                                   295   3e-94    
ref|XP_010257632.1|  PREDICTED: tubulin alpha-3 chain                   295   3e-94    
ref|XP_009353129.1|  PREDICTED: tubulin alpha-3 chain-like              295   3e-94    
gb|KHG14074.1|  Tubulin alpha-2 chain                                   293   3e-94    
gb|ABB16994.1|  unknown                                                 295   3e-94    
ref|XP_004958110.1|  PREDICTED: tubulin alpha-3 chain-like              295   3e-94    
ref|XP_008813089.1|  PREDICTED: tubulin alpha-3 chain                   295   3e-94    
ref|XP_002976230.1|  hypothetical protein SELMODRAFT_105136             295   3e-94    
ref|NP_001105324.1|  tubulin alpha-5 chain                              295   3e-94    
gb|EPY33355.1|  tubulin alpha                                           290   3e-94    
gb|EPY40479.1|  tubulin alpha                                           288   3e-94    
gb|KHG06160.1|  Tubulin alpha-3/alpha-5 chain -like protein             295   3e-94    
emb|CAD26886.1|  alpha-tubulin                                          295   3e-94    
ref|XP_009413318.1|  PREDICTED: tubulin alpha-3 chain-like              295   3e-94    
ref|XP_002989731.1|  hypothetical protein SELMODRAFT_130285             295   3e-94    
ref|XP_010695478.1|  PREDICTED: tubulin alpha-2 chain-like              295   3e-94    
gb|AGY80453.1|  tubulin                                                 295   3e-94    
sp|Q43473.1|TBA1_HORVU  RecName: Full=Tubulin alpha-1 chain             295   3e-94    
gb|KJB83375.1|  hypothetical protein B456_013G244600                    295   3e-94    
gb|AGG37284.1|  alpha-tubulin 2                                         295   3e-94    
gb|AAO46126.1|  alpha-tubulin                                           288   3e-94    
gb|AAU10519.1|  alpha tubulin                                           288   3e-94    
gb|EPY39349.1|  tubulin alpha                                           290   4e-94    
gb|ABD92942.1|  alpha tubulin-1D                                        295   4e-94    
emb|CAD26891.1|  alpha-tubulin                                          295   4e-94    
dbj|BAJ06363.1|  alpha-tubulin                                          294   4e-94    
ref|XP_003562846.1|  PREDICTED: tubulin alpha-1 chain                   294   4e-94    
ref|XP_002951007.1|  alpha tubulin                                      295   4e-94    
ref|XP_002532068.1|  tubulin alpha chain, putative                      294   4e-94    
gb|AGD80034.1|  alpha-tubulin 1                                         294   4e-94    
ref|XP_010934670.1|  PREDICTED: tubulin alpha-3 chain-like              294   4e-94    
ref|XP_007512064.1|  alpha-tubulin                                      294   4e-94    
gb|ABU93323.1|  tubulin alpha subunit                                   294   4e-94    
ref|XP_011025144.1|  PREDICTED: tubulin alpha-3 chain                   294   4e-94    
emb|CAD24765.1|  alpha-tubulin                                          294   4e-94    
gb|ABO47735.1|  alpha-tubulin                                           294   4e-94    
ref|XP_002303998.1|  alpha-tubulin 2 family protein                     294   4e-94    
sp|O22349.1|TBA3_ELEIN  RecName: Full=Tubulin alpha-3 chain; AltN...    294   4e-94    
gb|KHN06388.1|  Tubulin alpha-3 chain                                   293   4e-94    
gb|AAO63773.2|  alpha-tubulin 2                                         294   4e-94    
gb|ABL61218.1|  alpha-tubulin                                           290   4e-94    
ref|XP_006657877.1|  PREDICTED: tubulin alpha-3 chain-like              294   4e-94    
ref|XP_010923361.1|  PREDICTED: tubulin alpha-3 chain                   294   4e-94    
gb|ABO47741.1|  alpha-tubulin                                           294   5e-94    
gb|EYU31677.1|  hypothetical protein MIMGU_mgv1a006281mg                294   5e-94    
ref|NP_001105588.1|  tubulin alpha-6 chain                              294   5e-94    
gb|ABL61086.1|  alpha-tubulin                                           290   5e-94    
ref|NP_001060075.1|  Os07g0574800                                       294   5e-94    
ref|XP_010044940.1|  PREDICTED: tubulin alpha-3 chain                   294   5e-94    
gb|AIA82436.1|  alpha-tubulin-like protein 04                           295   5e-94    
emb|CAE52514.1|  alpha tubulin                                          294   5e-94    
ref|XP_002962209.1|  hypothetical protein SELMODRAFT_230058             294   5e-94    
ref|XP_009389058.1|  PREDICTED: tubulin alpha-3 chain-like              294   6e-94    
gb|KCW87065.1|  hypothetical protein EUGRSUZ_B03604                     294   6e-94    
ref|XP_009537046.1|  hypothetical protein PHYSODRAFT_340566             290   6e-94    
gb|ETM53018.1|  tubulin alpha chain                                     287   6e-94    
ref|XP_006286664.1|  hypothetical protein CARUB_v10002583mg             294   6e-94    
ref|XP_002963093.1|  hypothetical protein SELMODRAFT_404672             294   6e-94    
ref|XP_004981594.1|  PREDICTED: tubulin alpha-3 chain-like              294   6e-94    
ref|XP_002525416.1|  tubulin alpha chain, putative                      294   6e-94    
gb|AAT09064.1|  alpha tubulin 2                                         294   7e-94    
ref|XP_010112637.1|  Tubulin alpha-3 chain                              294   7e-94    
ref|XP_002364807.1|  tubulin alpha chain                                294   7e-94    
emb|CDP00974.1|  unnamed protein product                                294   7e-94    
emb|CDJ53173.1|  tubulin alpha chain, putative                          294   7e-94    
gb|ADP08782.1|  alpha tubulin                                           294   7e-94    
emb|CAD24768.1|  alpha-tubulin                                          293   8e-94    
gb|ETM30643.1|  tubulin alpha chain                                     293   8e-94    
gb|KHG06861.1|  Tubulin alpha-6 chain                                   294   8e-94    
ref|XP_008386829.1|  PREDICTED: tubulin alpha-3 chain-like              293   8e-94    
ref|XP_002904167.1|  cleavage induced tubulin alpha chain               289   8e-94    
emb|CDI81818.1|  tubulin alpha chain, putative                          293   8e-94    
gb|AAX63396.1|  alpha-tubulin                                           293   9e-94    
sp|P09243.1|TBA2_STYLE  RecName: Full=Tubulin alpha-2 chain             293   9e-94    
ref|XP_001691876.1|  alpha tubulin 1                                    293   9e-94    
gb|KDP39691.1|  hypothetical protein JCGZ_02711                         293   9e-94    
gb|AAB86649.1|  alpha-tubulin                                           293   9e-94    
gb|ABP65323.1|  alpha tubulin                                           293   9e-94    
ref|XP_011048194.1|  PREDICTED: tubulin alpha-6 chain-like              293   1e-93    
ref|XP_002972670.1|  hypothetical protein SELMODRAFT_231979             293   1e-93    
ref|XP_008872990.1|  tubulin alpha chain                                293   1e-93    
ref|XP_011075054.1|  PREDICTED: tubulin alpha-3 chain-like              293   1e-93    
emb|CDJ42547.1|  tubulin alpha chain, putative                          293   1e-93    
gb|AGG37286.1|  alpha-tubulin 4                                         293   1e-93    
gb|ABG78593.1|  alpha-tubulin                                           293   1e-93    
ref|XP_002904195.1|  alpha-tubulin, putative                            293   1e-93    
gb|ETM52951.1|  tubulin alpha chain                                     293   1e-93    
gb|ETO82054.1|  tubulin alpha chain                                     293   1e-93    
gb|AAB86648.1|  alpha-tubulin                                           293   1e-93    
ref|XP_002989721.1|  hypothetical protein SELMODRAFT_235864             293   1e-93    
ref|XP_007014666.1|  Tubulin alpha-5                                    293   1e-93    
emb|CCI41153.1|  unnamed protein product                                293   1e-93    
ref|XP_009842456.1|  tubulin alpha chain                                293   1e-93    
ref|XP_008900864.1|  tubulin alpha chain                                293   1e-93    
ref|XP_009126391.1|  PREDICTED: tubulin alpha-3 chain-like              293   1e-93    
ref|NP_001067613.1|  Os11g0247300                                       293   1e-93    
sp|Q9FT36.1|TBA_DAUCA  RecName: Full=Tubulin alpha chain                293   1e-93    
ref|XP_010531152.1|  PREDICTED: tubulin alpha-3 chain                   293   1e-93    
ref|XP_007030078.1|  Tubulin alpha-5                                    294   1e-93    
ref|XP_010454260.1|  PREDICTED: tubulin alpha-3 chain-like              293   1e-93    
ref|NP_001237301.1|  tubulin A                                          293   1e-93    
ref|XP_002297631.1|  alpha-tubulin 2 family protein                     293   1e-93    
ref|NP_197478.1|  tubulin alpha-3                                       293   1e-93    
emb|CAA62917.1|  alfa-tubulin                                           293   1e-93    
ref|XP_002904194.1|  alpha-tubulin                                      293   1e-93    
ref|XP_010535933.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    293   1e-93    
ref|XP_009366459.1|  PREDICTED: tubulin alpha-3 chain                   293   1e-93    
emb|CDY42294.1|  BnaC02g09000D                                          293   1e-93    
ref|XP_009126389.1|  PREDICTED: tubulin alpha-3 chain-like              293   1e-93    
gb|KDP42087.1|  hypothetical protein JCGZ_01875                         293   2e-93    
emb|CDY44941.1|  BnaA02g04460D                                          293   2e-93    
emb|CDX88875.1|  BnaA03g07740D                                          293   2e-93    
ref|XP_009120857.1|  PREDICTED: tubulin alpha-3 chain                   293   2e-93    
gb|KHG26159.1|  Tubulin alpha-6 chain                                   293   2e-93    
gb|ETP23198.1|  tubulin alpha chain                                     290   2e-93    
ref|NP_001242878.1|  uncharacterized protein LOC100806907               293   2e-93    
ref|XP_002963092.1|  hypothetical protein SELMODRAFT_78469              293   2e-93    
gb|ABR67425.1|  alpha-tubulin 4                                         293   2e-93    
ref|XP_006579487.1|  PREDICTED: tubulin A isoform X1                    293   2e-93    
ref|XP_007159433.1|  hypothetical protein PHAVU_002G237400g             293   2e-93    
gb|ABL61209.1|  alpha-tubulin                                           292   2e-93    
gb|KHN47983.1|  Tubulin alpha-3 chain                                   292   2e-93    
ref|XP_004149645.1|  PREDICTED: tubulin alpha-3 chain-like              293   2e-93    
gb|ETW61813.1|  tubulin alpha chain                                     290   2e-93    
gb|ABL61208.1|  alpha-tubulin                                           292   2e-93    
ref|XP_008877307.1|  tubulin alpha chain                                290   2e-93    
gb|ABL61205.1|  alpha-tubulin                                           292   2e-93    
gb|ABL61206.1|  alpha-tubulin                                           292   2e-93    
ref|XP_008449885.1|  PREDICTED: tubulin alpha-3 chain isoform X1        292   2e-93    
gb|ABL61210.1|  alpha-tubulin                                           292   2e-93    
emb|CAD24766.1|  alpha-tubulin                                          292   2e-93    
gb|ABO47738.1|  alpha-tubulin                                           292   2e-93    
gb|ABL61228.1|  alpha-tubulin                                           288   2e-93    
emb|CAD26887.1|  alpha-tubulin                                          292   3e-93    
gb|KJB44614.1|  hypothetical protein B456_007G261000                    292   3e-93    
ref|XP_002973792.1|  hypothetical protein SELMODRAFT_100162             292   3e-93    
ref|XP_001427643.1|  hypothetical protein                               285   3e-93    
gb|KJB48791.1|  hypothetical protein B456_008G087400                    290   3e-93    
gb|ABC97356.1|  alpha tubulin                                           291   3e-93    
emb|CAD26890.1|  alpha-tubulin                                          292   3e-93    



>ref|XP_004252814.1| PREDICTED: tubulin alpha-2 chain-like [Solanum lycopersicum]
Length=227

 Score =   302 bits (774),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 141/143 (99%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  66   EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  125

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQ+AVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  126  GFKCGINYQPPTVVPGGDLAKVQKAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  185

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  186  GEGMEEGEFSEAREDLAALEKDY  208



>emb|CAJ38386.1| alpha tubulin [Plantago major]
Length=270

 Score =   303 bits (776),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITN+AFEPSSMMVKCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  110  EITNTAFEPSSMMVKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  169

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  170  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  229

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  230  GEGMEEGEFSEAREDLAALEKDY  252



>gb|EYU34085.1| hypothetical protein MIMGU_mgv1a0196712mg, partial [Erythranthe 
guttata]
Length=217

 Score =   301 bits (771),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITN+AFEPSSMMVKCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  57   EITNTAFEPSSMMVKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  116

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  117  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  176

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  177  GEGMEEGEFSEAREDLAALEKDY  199



>gb|AHM93474.1| alpha-tubulin, partial [Camellia chekiangoleosa]
Length=327

 Score =   305 bits (780),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 141/143 (99%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMMVKCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  167  EITNSAFEPSSMMVKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  226

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  227  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  286

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  287  GEGMEEGEFSEAREDLAALEKDY  309



>ref|XP_006433708.1| hypothetical protein CICLE_v100015522mg, partial [Citrus clementina]
 gb|ESR46948.1| hypothetical protein CICLE_v100015522mg, partial [Citrus clementina]
Length=218

 Score =   300 bits (769),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  57   EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  116

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  117  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  176

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  177  GEGMEEGEFSEAREDLAALEKDY  199



>gb|AFR42020.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42021.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42022.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42023.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42024.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42025.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42027.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42028.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42029.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42030.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42031.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42032.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42033.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42034.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42037.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42038.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42039.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42041.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42045.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42046.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42048.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42056.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42057.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42058.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42059.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42060.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42061.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42062.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42063.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42064.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42065.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42066.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42067.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42068.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42069.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42070.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42071.1| alpha-tubulin, partial [Populus nigra]
Length=197

 Score =   300 bits (767),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  51   EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  110

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  111  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  170

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  171  GEGMEEGEFSEAREDLAALEKDY  193



>gb|AFR42026.1| alpha-tubulin, partial [Populus trichocarpa]
Length=196

 Score =   299 bits (766),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  51   EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  110

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  111  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  170

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  171  GEGMEEGEFSEAREDLAALEKDY  193



>gb|AFR42035.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42040.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42044.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42052.1| alpha-tubulin, partial [Populus fremontii]
Length=196

 Score =   299 bits (766),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  50   EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  109

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  110  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  169

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  170  GEGMEEGEFSEAREDLAALEKDY  192



>gb|AFR42049.1| alpha-tubulin, partial [Populus fremontii]
Length=197

 Score =   299 bits (766),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  51   EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  110

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  111  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  170

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  171  GEGMEEGEFSEAREDLAALEKDY  193



>gb|AFR42054.1| alpha-tubulin, partial [Populus fremontii]
Length=196

 Score =   299 bits (765),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  50   EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  109

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  110  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  169

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  170  GEGMEEGEFSEAREDLAALEKDY  192



>gb|AFR42036.1| alpha-tubulin, partial [Populus alba]
Length=195

 Score =   299 bits (765),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  49   EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  108

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  109  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  168

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  169  GEGMEEGEFSEAREDLAALEKDY  191



>gb|AFR42042.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42043.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42050.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42051.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42053.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42055.1| alpha-tubulin, partial [Populus fremontii]
Length=194

 Score =   299 bits (765),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  48   EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  107

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  108  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  167

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  168  GEGMEEGEFSEAREDLAALEKDY  190



>gb|KJB58759.1| hypothetical protein B456_009G224800 [Gossypium raimondii]
Length=340

 Score =   304 bits (778),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  180  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  239

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  240  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  299

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  300  GEGMEEGEFSEAREDLAALEKDY  322



>gb|AFR42047.1| alpha-tubulin, partial [Populus fremontii]
Length=194

 Score =   299 bits (765),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  48   EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  107

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  108  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  167

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  168  GEGMEEGEFSEAREDLAALEKDY  190



>emb|CAB76917.1| alpha-tubulin 4 [Hordeum vulgare subsp. vulgare]
Length=289

 Score =   301 bits (770),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  128  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  187

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYV
Sbjct  188  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYV  247

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  248  GEGMEEGEFSEAREDLAALEKDY  270



>gb|KJB32211.1| hypothetical protein B456_005G229600 [Gossypium raimondii]
Length=361

 Score =   303 bits (776),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  201  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  260

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  261  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  320

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  321  GEGMEEGEFSEAREDLAALEKDY  343



>gb|AAW57309.1| alpha-tubulin, partial [Ceratopteris richardii]
Length=266

 Score =   300 bits (767),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  105  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  164

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRID+KFDLMY KRAFVHWYV
Sbjct  165  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDYKFDLMYAKRAFVHWYV  224

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  225  GEGMEEGEFSEAREDLAALEKDY  247



>gb|AAW57305.1| alpha-tubulin, partial [Ceratopteris richardii]
Length=306

 Score =   301 bits (770),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  146  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  205

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRA+CMISNSTSVAEVFSRID KFDLMYCKRAFVHWYV
Sbjct  206  GFKCGINYQPPTVVPGGDLAKVQRAICMISNSTSVAEVFSRIDFKFDLMYCKRAFVHWYV  265

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  266  GEGMEEGEFSEAREDLAALEKDY  288



>gb|AAW57310.1| alpha-tubulin, partial [Ceratopteris richardii]
 gb|AAW57311.1| alpha-tubulin, partial [Ceratopteris richardii]
 gb|AAW57313.1| alpha-tubulin, partial [Ceratopteris richardii]
Length=267

 Score =   299 bits (766),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  106  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  165

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRID+KFDLMY KRAFVHWYV
Sbjct  166  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDYKFDLMYAKRAFVHWYV  225

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  226  GEGMEEGEFSEAREDLAALEKDY  248



>gb|AHZ58481.1| alpha-tubulin, partial [Syntrichia caninervis]
Length=200

 Score =   297 bits (760),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  41   EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  100

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  101  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYV  160

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  161  GEGMEEGEFSEAREDLAALEKDY  183



>gb|KDO81349.1| hypothetical protein CISIN_1g013037mg [Citrus sinensis]
Length=355

 Score =   302 bits (773),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  194  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  253

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  254  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  313

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  314  GEGMEEGEFSEAREDLAALEKDY  336



>gb|ADD84794.1| tubulin-like protein [Cenchrus ciliaris]
Length=184

 Score =   296 bits (757),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  23   EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  82

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYV
Sbjct  83   GFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYV  142

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  143  GEGMEEGEFSEAREDLAALEKDY  165



>dbj|BAH19954.1| AT1G50010 [Arabidopsis thaliana]
Length=248

 Score =   298 bits (763),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPT
Sbjct  88   EITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPT  147

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  148  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  207

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  208  GEGMEEGEFSEAREDLAALEKDY  230



>gb|EPS62716.1| alpha-tubulin, partial [Genlisea aurea]
Length=404

 Score =   303 bits (777),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITN+AFEPSSMMVKCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  244  EITNTAFEPSSMMVKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  303

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  304  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  363

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  364  GEGMEEGEFSEAREDLAALEKDY  386



>dbj|BAF01952.1| putative tubulin alpha-2/alpha-4 chain [Arabidopsis thaliana]
Length=202

 Score =   296 bits (758),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPT
Sbjct  42   EITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPT  101

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  102  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  161

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  162  GEGMEEGEFSEAREDLAALEKDY  184



>gb|AHJ80819.1| Tua1, partial [Eragrostis tef]
Length=243

 Score =   297 bits (761),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  82   EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  141

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYV
Sbjct  142  GFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYV  201

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  202  GEGMEEGEFSEAREDLAALEKDY  224



>gb|KJB58756.1| hypothetical protein B456_009G224800 [Gossypium raimondii]
Length=415

 Score =   303 bits (776),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  255  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  314

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  315  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  374

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  375  GEGMEEGEFSEAREDLAALEKDY  397



>gb|KIY91712.1| Tubulin alpha chain [Monoraphidium neglectum]
Length=249

 Score =   297 bits (760),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNA+VATIKTKRTIQFVDWCPT
Sbjct  88   EITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNASVATIKTKRTIQFVDWCPT  147

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNST+VAEVFSR+DHKFDLMY KRAFVHWYV
Sbjct  148  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAVAEVFSRLDHKFDLMYAKRAFVHWYV  207

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  208  GEGMEEGEFSEAREDLAALEKDY  230



>gb|KGN48654.1| hypothetical protein Csa_6G497050 [Cucumis sativus]
Length=415

 Score =   303 bits (775),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  255  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  314

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  315  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  374

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  375  GEGMEEGEFSEAREDLAALEKDY  397



>ref|XP_004238046.1| PREDICTED: tubulin alpha chain [Solanum lycopersicum]
Length=450

 Score =   304 bits (778),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 142/143 (99%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009614122.1| PREDICTED: tubulin alpha-3 chain [Nicotiana tomentosiformis]
 ref|XP_009787472.1| PREDICTED: tubulin alpha-3 chain [Nicotiana sylvestris]
 emb|CAD13177.1| alpha-tubulin [Nicotiana tabacum]
Length=451

 Score =   304 bits (778),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 142/143 (99%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004244533.1| PREDICTED: tubulin alpha-3 chain-like [Solanum lycopersicum]
Length=451

 Score =   304 bits (778),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 142/143 (99%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>emb|CAD13176.1| alpha-tubulin [Nicotiana tabacum]
Length=450

 Score =   304 bits (778),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 142/143 (99%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|ACH68563.1| alpha-tubulin [Solanum tuberosum]
Length=449

 Score =   304 bits (778),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 142/143 (99%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  289  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  348

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  349  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  408

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  409  GEGMEEGEFSEAREDLAALEKDY  431



>ref|XP_009790136.1| PREDICTED: tubulin alpha chain [Nicotiana sylvestris]
Length=450

 Score =   304 bits (778),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 142/143 (99%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|ABB02631.1| unknown [Solanum tuberosum]
Length=450

 Score =   304 bits (778),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 142/143 (99%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006356798.1| PREDICTED: tubulin alpha chain-like [Solanum tuberosum]
Length=450

 Score =   304 bits (778),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 142/143 (99%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009620798.1| PREDICTED: tubulin alpha chain [Nicotiana tomentosiformis]
Length=450

 Score =   304 bits (778),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 142/143 (99%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006362511.1| PREDICTED: tubulin alpha-1 chain-like [Solanum tuberosum]
Length=450

 Score =   304 bits (778),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 142/143 (99%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009605705.1| PREDICTED: tubulin alpha-2 chain-like [Nicotiana tomentosiformis]
 ref|XP_009761158.1| PREDICTED: tubulin alpha-2 chain-like [Nicotiana sylvestris]
 emb|CAD13178.1| alpha-tubulin [Nicotiana tabacum]
Length=451

 Score =   304 bits (778),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 142/143 (99%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|ABP65320.1| alpha tubulin [Capsicum annuum]
Length=450

 Score =   303 bits (777),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 142/143 (99%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|NP_001275271.1| alpha-tubulin-like protein [Solanum tuberosum]
 gb|ABB72803.1| alpha-tubulin-like protein [Solanum tuberosum]
Length=452

 Score =   303 bits (777),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 142/143 (99%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  291  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  350

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  351  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  410

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  411  GEGMEEGEFSEAREDLAALEKDY  433



>gb|ABC59068.2| alpha tubulin 1 [Camellia sinensis]
Length=450

 Score =   303 bits (777),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 141/143 (99%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMMVKCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMVKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|WP_039310890.1| hypothetical protein, partial [Paenibacillus sp. IHB B 3415]
 gb|KHL91192.1| hypothetical protein QW71_36085, partial [Paenibacillus sp. IHB 
B 3415]
Length=453

 Score =   303 bits (777),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 141/143 (99%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMMVKCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  294  EITNSAFEPSSMMVKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  353

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  354  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  413

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  414  GEGMEEGEFSEAREDLAALEKDY  436



>emb|CAA52158.1| alpha tubulin [Zea mays]
Length=256

 Score =   296 bits (758),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  95   EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  154

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYV
Sbjct  155  GFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYV  214

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDL ALEKDY
Sbjct  215  GEGMEEGEFSEAREDLRALEKDY  237



>ref|XP_002677064.1| alpha-tubulin [Naegleria gruberi]
 gb|EFC44320.1| alpha-tubulin [Naegleria gruberi]
Length=195

 Score =   294 bits (752),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDW PT
Sbjct  32   EITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWSPT  91

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNST++AEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  92   GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRIDHKFDLMYAKRAFVHWYV  151

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  152  GEGMEEGEFSEAREDLAALEKDY  174



>gb|ADW83724.1| alpha-tubulin [Musa acuminata AAA Group]
Length=423

 Score =   301 bits (772),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  262  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  321

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  322  GFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  381

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  382  GEGMEEGEFSEAREDLAALEKDY  404



>gb|EYU34660.1| hypothetical protein MIMGU_mgv1a006269mg [Erythranthe guttata]
Length=450

 Score =   302 bits (774),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITN+AFEPSSMMVKCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNTAFEPSSMMVKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>dbj|BAB19779.1| alpha tubulin [Nicotiana tabacum]
Length=450

 Score =   302 bits (774),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 141/143 (99%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRA VHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRALVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|KDO49533.1| hypothetical protein CISIN_1g013062mg [Citrus sinensis]
Length=431

 Score =   301 bits (772),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  271  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  330

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  331  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  390

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  391  GEGMEEGEFSEAREDLAALEKDY  413



>gb|KJB58757.1| hypothetical protein B456_009G224800 [Gossypium raimondii]
Length=403

 Score =   301 bits (770),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  243  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  302

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  303  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  362

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  363  GEGMEEGEFSEAREDLAALEKDY  385



>gb|EYU37544.1| hypothetical protein MIMGU_mgv1a007145mg [Erythranthe guttata]
Length=417

 Score =   301 bits (771),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  256  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  315

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  316  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  375

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  376  GEGMEEGEFSEAREDLAALEKDY  398



>gb|AAW57306.1| alpha-tubulin, partial [Ceratopteris richardii]
 gb|AAW57308.1| alpha-tubulin, partial [Ceratopteris richardii]
Length=257

 Score =   295 bits (756),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEP+SMM KCDPRHGKYMACC+M+RGDVVPKDVNA+VATIKTKRTIQFVDWCPT
Sbjct  96   EITNSAFEPASMMAKCDPRHGKYMACCMMYRGDVVPKDVNASVATIKTKRTIQFVDWCPT  155

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS+AEVFSR+DHKFDLMY KRAFVHWYV
Sbjct  156  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSIAEVFSRLDHKFDLMYAKRAFVHWYV  215

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKD+
Sbjct  216  GEGMEEGEFSEAREDLAALEKDF  238



>emb|CDY46272.1| BnaC05g50610D [Brassica napus]
Length=289

 Score =   296 bits (759),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EIT+SAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPT
Sbjct  129  EITSSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPT  188

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAF HWYV
Sbjct  189  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFFHWYV  248

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  249  GEGMEEGEFSEAREDLAALEKDY  271



>gb|AAD11425.1| alpha tubulin [Mesembryanthemum crystallinum]
Length=366

 Score =   299 bits (766),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EIT SAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  205  EITTSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  264

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  265  GFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  324

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  325  GEGMEEGEFSEAREDLAALEKDY  347



>ref|XP_003608582.1| Tubulin alpha-5 chain [Medicago truncatula]
 gb|AES90779.1| tubulin beta-1 chain [Medicago truncatula]
Length=451

 Score =   302 bits (773),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>emb|CDP02221.1| unnamed protein product [Coffea canephora]
Length=449

 Score =   302 bits (773),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITN+AFEPSSMMVKCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNTAFEPSSMMVKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|NP_001291325.1| tubulin alpha chain-like [Sesamum indicum]
 gb|AFJ42573.1| alpha-tubulin [Sesamum indicum]
Length=450

 Score =   302 bits (773),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITN+AFEPSSMMVKCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNTAFEPSSMMVKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_011098608.1| PREDICTED: tubulin alpha chain [Sesamum indicum]
Length=450

 Score =   302 bits (773),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITN+AFEPSSMMVKCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNTAFEPSSMMVKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010242419.1| PREDICTED: tubulin alpha-1 chain [Nelumbo nucifera]
Length=451

 Score =   302 bits (773),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|KDO81348.1| hypothetical protein CISIN_1g013037mg [Citrus sinensis]
Length=447

 Score =   301 bits (772),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  286  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  345

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  346  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  405

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  406  GEGMEEGEFSEAREDLAALEKDY  428



>gb|ACN40181.1| unknown [Picea sitchensis]
 gb|ACN40840.1| unknown [Picea sitchensis]
Length=450

 Score =   301 bits (772),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002283198.1| PREDICTED: tubulin alpha chain [Vitis vinifera]
 ref|XP_006827169.1| hypothetical protein AMTR_s00010p00254750 [Amborella trichopoda]
 ref|XP_010939541.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
 gb|ERM94406.1| hypothetical protein AMTR_s00010p00254750 [Amborella trichopoda]
Length=450

 Score =   301 bits (772),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>emb|CAN62392.1| hypothetical protein VITISV_016172 [Vitis vinifera]
Length=435

 Score =   301 bits (771),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  275  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  334

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  335  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  394

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  395  GEGMEEGEFSEAREDLAALEKDY  417



>ref|XP_008384431.1| PREDICTED: tubulin alpha-3 chain-like [Malus domestica]
Length=282

 Score =   296 bits (757),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITN+ FEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRT+QFVDWCPT
Sbjct  123  EITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPT  182

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  183  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYSKRAFVHWYV  242

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  243  GEGMEEGEFSEAREDLAALEKDY  265



>ref|XP_008804464.1| PREDICTED: tubulin alpha chain-like [Phoenix dactylifera]
Length=450

 Score =   301 bits (772),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|KDP44552.1| hypothetical protein JCGZ_16385 [Jatropha curcas]
Length=450

 Score =   301 bits (772),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|ACJ60905.1| alpha tubulin [Betula pendula]
Length=450

 Score =   301 bits (772),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006422747.1| hypothetical protein CICLE_v10028426mg [Citrus clementina]
 ref|XP_006486878.1| PREDICTED: tubulin alpha chain-like isoform X1 [Citrus sinensis]
 gb|ESR35987.1| hypothetical protein CICLE_v10028426mg [Citrus clementina]
 gb|KDO49534.1| hypothetical protein CISIN_1g013062mg [Citrus sinensis]
Length=450

 Score =   301 bits (772),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|ABX57816.1| alpha tubulin [Picea wilsonii]
Length=451

 Score =   301 bits (772),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|NP_001289660.1| tubulin alpha chain-like [Eucalyptus grandis]
 gb|ABS50670.1| alpha-tubulin [Eucalyptus grandis]
Length=451

 Score =   301 bits (772),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|AAV92352.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92353.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92354.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92355.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92356.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92357.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92358.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92359.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92360.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92361.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92362.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92363.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92364.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92365.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92366.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92367.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92368.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92369.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92370.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92371.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92372.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92373.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92374.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92375.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92376.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92377.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92378.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92379.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|ACN40661.1| unknown [Picea sitchensis]
 gb|ACN40854.1| unknown [Picea sitchensis]
 gb|ACN40972.1| unknown [Picea sitchensis]
 gb|ACN41102.1| unknown [Picea sitchensis]
 gb|AIZ74331.1| alpha-tubulin [Pinus massoniana]
Length=451

 Score =   301 bits (772),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>sp|P33629.1|TBA_PRUDU RecName: Full=Tubulin alpha chain [Prunus dulcis]
 emb|CAA47635.1| alpha-tubulin [Prunus dulcis]
Length=450

 Score =   301 bits (772),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007199840.1| hypothetical protein PRUPE_ppa005633mg [Prunus persica]
 ref|XP_008236252.1| PREDICTED: tubulin alpha chain isoform X1 [Prunus mume]
 gb|EMJ01039.1| hypothetical protein PRUPE_ppa005633mg [Prunus persica]
Length=450

 Score =   301 bits (772),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010245599.1| PREDICTED: tubulin alpha chain-like [Nelumbo nucifera]
Length=451

 Score =   301 bits (772),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008372961.1| PREDICTED: tubulin alpha chain isoform X1 [Malus domestica]
Length=450

 Score =   301 bits (772),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007032501.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOY03427.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=450

 Score =   301 bits (772),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|ABO47740.1| alpha-tubulin [Gossypium hirsutum]
 gb|ACM89777.1| alpha-tubulin 10 [Gossypium hirsutum]
 gb|KHG24734.1| Tubulin alpha chain [Gossypium arboreum]
 gb|KJB58758.1| hypothetical protein B456_009G224800 [Gossypium raimondii]
Length=450

 Score =   301 bits (772),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_011457777.1| PREDICTED: tubulin alpha chain [Fragaria vesca subsp. vesca]
Length=450

 Score =   301 bits (772),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009335354.1| PREDICTED: tubulin alpha chain [Pyrus x bretschneideri]
Length=450

 Score =   301 bits (772),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010943272.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
Length=451

 Score =   301 bits (772),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008787760.1| PREDICTED: tubulin alpha chain-like [Phoenix dactylifera]
Length=451

 Score =   301 bits (772),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002510010.1| tubulin alpha chain, putative [Ricinus communis]
 ref|XP_006852746.1| hypothetical protein AMTR_s00033p00112490 [Amborella trichopoda]
 gb|EEF52197.1| tubulin alpha chain, putative [Ricinus communis]
 gb|ERN14213.1| hypothetical protein AMTR_s00033p00112490 [Amborella trichopoda]
Length=451

 Score =   301 bits (772),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007018369.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOY15594.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=451

 Score =   301 bits (772),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|ABO47739.1| alpha-tubulin [Gossypium hirsutum]
 gb|KHG18532.1| Tubulin alpha-2 chain [Gossypium arboreum]
Length=450

 Score =   301 bits (772),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010266793.1| PREDICTED: tubulin alpha chain [Nelumbo nucifera]
Length=451

 Score =   301 bits (772),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008787237.1| PREDICTED: tubulin alpha chain [Phoenix dactylifera]
 ref|XP_010941981.1| PREDICTED: tubulin alpha chain [Elaeis guineensis]
Length=451

 Score =   301 bits (772),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002522104.1| tubulin alpha chain, putative [Ricinus communis]
 gb|EEF40304.1| tubulin alpha chain, putative [Ricinus communis]
Length=450

 Score =   301 bits (772),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004143417.1| PREDICTED: tubulin alpha chain-like [Cucumis sativus]
 ref|XP_004160931.1| PREDICTED: tubulin alpha chain-like [Cucumis sativus]
Length=450

 Score =   301 bits (772),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004288297.1| PREDICTED: tubulin alpha-3 chain [Fragaria vesca subsp. vesca]
Length=451

 Score =   301 bits (772),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009626810.1| PREDICTED: tubulin alpha chain-like [Nicotiana tomentosiformis]
 ref|XP_009785294.1| PREDICTED: tubulin alpha chain-like [Nicotiana sylvestris]
Length=450

 Score =   301 bits (772),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITN+AFEPSSMMVKCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNTAFEPSSMMVKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009335355.1| PREDICTED: tubulin alpha chain-like [Pyrus x bretschneideri]
Length=450

 Score =   301 bits (772),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010093625.1| Tubulin alpha chain [Morus notabilis]
 gb|EXB54386.1| Tubulin alpha chain [Morus notabilis]
Length=451

 Score =   301 bits (772),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_001764722.1| predicted protein [Physcomitrella patens]
 gb|EDQ70421.1| predicted protein [Physcomitrella patens]
Length=451

 Score =   301 bits (772),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008440459.1| PREDICTED: tubulin alpha chain-like isoform X1 [Cucumis melo]
Length=450

 Score =   301 bits (772),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010065856.1| PREDICTED: tubulin alpha chain [Eucalyptus grandis]
 gb|KCW63554.1| hypothetical protein EUGRSUZ_G01186 [Eucalyptus grandis]
Length=450

 Score =   301 bits (772),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002981542.1| hypothetical protein SELMODRAFT_178975 [Selaginella moellendorffii]
 gb|EFJ17357.1| hypothetical protein SELMODRAFT_178975 [Selaginella moellendorffii]
Length=449

 Score =   301 bits (772),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_003635553.2| PREDICTED: tubulin alpha chain-like [Vitis vinifera]
Length=451

 Score =   301 bits (772),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>sp|P46259.1|TBA1_PEA RecName: Full=Tubulin alpha-1 chain [Pisum sativum]
 gb|AAA79910.1| alpha-tubulin [Pisum sativum]
Length=452

 Score =   301 bits (772),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|AIX10966.1| tubulin [Ornithogalum saundersiae]
Length=451

 Score =   301 bits (772),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010939312.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
Length=451

 Score =   301 bits (772),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|KDO81347.1| hypothetical protein CISIN_1g013037mg [Citrus sinensis]
Length=451

 Score =   301 bits (772),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006472372.1| PREDICTED: tubulin alpha chain isoform X1 [Citrus sinensis]
Length=451

 Score =   301 bits (772),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|KHG18997.1| Tubulin alpha chain [Gossypium arboreum]
 gb|KJB32210.1| hypothetical protein B456_005G229600 [Gossypium raimondii]
Length=450

 Score =   301 bits (772),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|KDP32140.1| hypothetical protein JCGZ_12601 [Jatropha curcas]
Length=450

 Score =   301 bits (772),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004232226.1| PREDICTED: tubulin alpha chain-like [Solanum lycopersicum]
 ref|XP_006338460.1| PREDICTED: tubulin alpha-3 chain-like isoform X1 [Solanum tuberosum]
Length=450

 Score =   301 bits (772),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITN+AFEPSSMMVKCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNTAFEPSSMMVKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>sp|Q6VAF9.1|TBA4_GOSHI RecName: Full=Tubulin alpha-4 chain; AltName: Full=Alpha-4-tubulin 
[Gossypium hirsutum]
 gb|AAQ92663.1| alpha-tubulin 4 [Gossypium hirsutum]
Length=450

 Score =   301 bits (772),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYTKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002275973.1| PREDICTED: tubulin alpha chain [Vitis vinifera]
Length=450

 Score =   301 bits (772),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007205183.1| hypothetical protein PRUPE_ppa005613mg [Prunus persica]
 ref|XP_008236958.1| PREDICTED: tubulin alpha chain-like isoform X1 [Prunus mume]
 gb|EMJ06382.1| hypothetical protein PRUPE_ppa005613mg [Prunus persica]
Length=451

 Score =   301 bits (772),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006426173.1| hypothetical protein CICLE_v10025588mg [Citrus clementina]
 gb|ESR39413.1| hypothetical protein CICLE_v10025588mg [Citrus clementina]
Length=451

 Score =   301 bits (772),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010256937.1| PREDICTED: tubulin alpha chain-like [Nelumbo nucifera]
Length=450

 Score =   301 bits (772),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002517492.1| tubulin alpha chain, putative [Ricinus communis]
 gb|EEF45034.1| tubulin alpha chain, putative [Ricinus communis]
Length=450

 Score =   301 bits (772),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010104543.1| Tubulin alpha chain [Morus notabilis]
 gb|EXC01144.1| Tubulin alpha chain [Morus notabilis]
Length=448

 Score =   301 bits (771),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  287  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  346

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  347  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  406

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  407  GEGMEEGEFSEAREDLAALEKDY  429



>ref|XP_002301128.1| hypothetical protein POPTR_0002s11250g [Populus trichocarpa]
 ref|XP_011017025.1| PREDICTED: tubulin alpha chain-like isoform X1 [Populus euphratica]
 ref|XP_011017026.1| PREDICTED: tubulin alpha chain-like isoform X1 [Populus euphratica]
 ref|XP_011017027.1| PREDICTED: tubulin alpha chain-like isoform X2 [Populus euphratica]
 gb|AAO63781.1| alpha-tubulin 1 [Populus tremuloides]
 gb|ABK96001.1| unknown [Populus trichocarpa]
 gb|EEE80401.1| hypothetical protein POPTR_0002s11250g [Populus trichocarpa]
Length=451

 Score =   301 bits (772),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010099392.1| Tubulin alpha chain [Morus notabilis]
 ref|XP_010105098.1| Tubulin alpha chain [Morus notabilis]
 gb|EXB78237.1| Tubulin alpha chain [Morus notabilis]
 gb|EXC03883.1| Tubulin alpha chain [Morus notabilis]
Length=467

 Score =   302 bits (773),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  306  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  365

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  366  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  425

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  426  GEGMEEGEFSEAREDLAALEKDY  448



>ref|XP_010526692.1| PREDICTED: tubulin alpha chain-like [Tarenaya hassleriana]
Length=450

 Score =   301 bits (771),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010531321.1| PREDICTED: tubulin alpha chain isoform X1 [Tarenaya hassleriana]
Length=450

 Score =   301 bits (771),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|AID52921.1| tubulin alpha chain [Carthamus tinctorius]
Length=450

 Score =   301 bits (771),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010936237.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
Length=451

 Score =   301 bits (772),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008455054.1| PREDICTED: tubulin alpha-4 chain isoform X1 [Cucumis melo]
Length=451

 Score =   301 bits (772),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004136930.1| PREDICTED: tubulin alpha-4 chain-like [Cucumis sativus]
 ref|XP_004155416.1| PREDICTED: tubulin alpha-4 chain-like [Cucumis sativus]
 gb|KGN43837.1| Tubulin alpha chain [Cucumis sativus]
Length=450

 Score =   301 bits (771),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>emb|CAD20821.1| alpha tubulin [Zea mays]
Length=274

 Score =   295 bits (756),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITN+ FEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRT+QFVDWCPT
Sbjct  114  EITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPT  173

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPP+VVPGGDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  174  GFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYV  233

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  234  GEGMEEGEFSEAREDLAALEKDY  256



>ref|XP_007137281.1| hypothetical protein PHAVU_009G114100g [Phaseolus vulgaris]
 gb|ESW09275.1| hypothetical protein PHAVU_009G114100g [Phaseolus vulgaris]
Length=451

 Score =   301 bits (771),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|ABO47736.1| alpha-tubulin [Gossypium hirsutum]
 gb|ACM89778.1| alpha-tubulin 6 [Gossypium hirsutum]
Length=450

 Score =   301 bits (771),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006466394.1| PREDICTED: tubulin alpha-3 chain-like isoform X1 [Citrus sinensis]
Length=451

 Score =   301 bits (771),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004501073.1| PREDICTED: tubulin alpha chain-like [Cicer arietinum]
Length=451

 Score =   301 bits (771),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|AGG37283.1| alpha-tubulin 1 [Salix arbutifolia]
Length=451

 Score =   301 bits (771),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_003522731.1| PREDICTED: tubulin alpha-4 chain isoform X1 [Glycine max]
Length=452

 Score =   301 bits (771),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|KDP41548.1| hypothetical protein JCGZ_15955 [Jatropha curcas]
Length=451

 Score =   301 bits (771),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007042689.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOX98520.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=450

 Score =   301 bits (771),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_003603670.1| Tubulin alpha-7 chain [Medicago truncatula]
 gb|AES73921.1| tubulin beta-1 chain [Medicago truncatula]
Length=451

 Score =   301 bits (771),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010555432.1| PREDICTED: tubulin alpha chain-like [Tarenaya hassleriana]
Length=450

 Score =   301 bits (771),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|AGG37289.1| alpha-tubulin 7 [Salix arbutifolia]
Length=450

 Score =   301 bits (771),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            E+TNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EVTNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|KHN08201.1| Tubulin alpha chain [Glycine soja]
Length=457

 Score =   301 bits (771),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  295  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  354

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  355  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  414

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  415  GEGMEEGEFSEAREDLAALEKDY  437



>ref|XP_011008936.1| PREDICTED: tubulin alpha chain [Populus euphratica]
Length=451

 Score =   301 bits (770),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            E+TNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EVTNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|AEQ75493.1| alpha-tubulin [Rosa multiflora]
Length=440

 Score =   300 bits (769),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  279  EITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  338

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  339  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  398

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  399  GEGMEEGEFSEAREDLAALEKDY  421



>gb|KHG20487.1| Tubulin alpha chain [Gossypium arboreum]
Length=451

 Score =   301 bits (770),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITN+AFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNTAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|ACK76232.1| alpha-tubulin [Dimocarpus longan]
Length=450

 Score =   301 bits (770),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>sp|P33623.1|TBA1_ANEPH RecName: Full=Tubulin alpha-1 chain [Anemia phyllitidis]
 emb|CAA48927.1| alpha tubulin [Anemia phyllitidis]
Length=451

 Score =   301 bits (770),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002324047.2| hypothetical protein POPTR_0017s11740g [Populus trichocarpa]
 gb|EEF04180.2| hypothetical protein POPTR_0017s11740g [Populus trichocarpa]
Length=454

 Score =   301 bits (770),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            E+TNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  293  EVTNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  352

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  353  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  412

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  413  GEGMEEGEFSEAREDLAALEKDY  435



>gb|AIX10773.1| alpha tubulin [Panax notoginseng]
Length=451

 Score =   301 bits (770),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 140/143 (98%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYSKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008621874.1| tubulin alpha, partial [Saprolegnia diclina VS20]
 gb|EQC24696.1| tubulin alpha, partial [Saprolegnia diclina VS20]
Length=273

 Score =   295 bits (754),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 133/143 (93%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEP+SMM KCDPRHGKYMA CLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  110  EITNSAFEPASMMAKCDPRHGKYMAACLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  169

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLA+VQRAVCMISN++++AEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  170  GFKCGINYQPPTVVPGGDLARVQRAVCMISNTSAIAEVFSRIDHKFDLMYAKRAFVHWYV  229

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  230  GEGMEEGEFSEAREDLAALEKDY  252



>gb|ABR26150.1| tubulin alpha-3 chain [Oryza sativa Indica Group]
Length=186

 Score =   291 bits (746),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  25   EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  84

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRID KFDLMY KRAFVHWYV
Sbjct  85   GFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDIKFDLMYSKRAFVHWYV  144

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  145  GEGMEEGEFSEAREDLAALEKDY  167



>ref|XP_004304311.1| PREDICTED: tubulin alpha-2 chain-like [Fragaria vesca subsp. 
vesca]
Length=450

 Score =   301 bits (770),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_011088040.1| PREDICTED: tubulin alpha chain [Sesamum indicum]
Length=450

 Score =   300 bits (769),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLA+VQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLARVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007215369.1| hypothetical protein PRUPE_ppa005626mg [Prunus persica]
 ref|XP_008230754.1| PREDICTED: tubulin alpha chain-like [Prunus mume]
 gb|EMJ16568.1| hypothetical protein PRUPE_ppa005626mg [Prunus persica]
Length=450

 Score =   300 bits (769),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|AAX96763.1| Tubulin/FtsZ family, GTPase domain, putative [Oryza sativa Japonica 
Group]
 gb|ABA92354.1| Tubulin alpha-3 chain, putative, expressed [Oryza sativa Japonica 
Group]
Length=346

 Score =   297 bits (760),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  185  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  244

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRID KFDLMY KRAFVHWYV
Sbjct  245  GFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDIKFDLMYSKRAFVHWYV  304

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  305  GEGMEEGEFSEAREDLAALEKDY  327



>ref|XP_006404742.1| hypothetical protein EUTSA_v10000161mg [Eutrema salsugineum]
 gb|ESQ46195.1| hypothetical protein EUTSA_v10000161mg [Eutrema salsugineum]
Length=451

 Score =   300 bits (769),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITN+AFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNTAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010060142.1| PREDICTED: tubulin alpha chain-like [Eucalyptus grandis]
 gb|KCW66706.1| hypothetical protein EUGRSUZ_F00470 [Eucalyptus grandis]
Length=451

 Score =   300 bits (769),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004299843.1| PREDICTED: tubulin alpha chain-like [Fragaria vesca subsp. vesca]
 gb|AAK81858.1|AF394915_1 alpha tubulin subunit [Rosa hybrid cultivar]
Length=451

 Score =   300 bits (769),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|ABR25510.1| tubulin alpha-1 chain [Oryza sativa Indica Group]
Length=255

 Score =   294 bits (752),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITN+ FEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRT+QFVDWCPT
Sbjct  95   EITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPT  154

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPP+VVPGGDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  155  GFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYV  214

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  215  GEGMEEGEFSEAREDLAALEKDY  237



>emb|CAD20820.1| alpha tubulin [Zea mays]
Length=200

 Score =   291 bits (746),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITN+ FEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRT+QFVDWCPT
Sbjct  40   EITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPT  99

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPP+VVPGGDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  100  GFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYV  159

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  160  GEGMEEGEFSEAREDLAALEKDY  182



>gb|AGG37285.1| alpha-tubulin 3 [Salix arbutifolia]
Length=451

 Score =   300 bits (769),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYSKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002298794.2| TUBULIN ALPHA CHAIN family protein [Populus trichocarpa]
 gb|EEE83599.2| TUBULIN ALPHA CHAIN family protein [Populus trichocarpa]
Length=451

 Score =   300 bits (769),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYSKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|ABK92520.1| unknown [Populus trichocarpa]
Length=451

 Score =   300 bits (769),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYSKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008379344.1| PREDICTED: tubulin alpha-2 chain [Malus domestica]
Length=450

 Score =   300 bits (769),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006581474.1| PREDICTED: tubulin alpha-4 chain-like isoform X1 [Glycine max]
Length=452

 Score =   300 bits (769),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLA+VQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLARVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_003558668.1| PREDICTED: tubulin alpha-2 chain-like [Brachypodium distachyon]
 emb|CAM58977.1| alpha-tubulin 4 [Hordeum vulgare subsp. vulgare]
Length=451

 Score =   300 bits (769),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>dbj|BAJ06364.1| alpha-tubulin [Alopecurus aequalis]
Length=451

 Score =   300 bits (769),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>emb|CAL35827.1| alpha-2 tubulin [Plantago major]
Length=249

 Score =   293 bits (751),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 134/143 (94%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITN+ FEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRT+QFVDWCPT
Sbjct  89   EITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTVQFVDWCPT  148

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  149  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYV  208

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  209  GEGMEEGEFSEAREDLAALEKDY  231



>ref|XP_011030289.1| PREDICTED: tubulin alpha-4 chain [Populus euphratica]
Length=451

 Score =   300 bits (769),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYSKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009402887.1| PREDICTED: tubulin alpha chain [Musa acuminata subsp. malaccensis]
Length=451

 Score =   300 bits (769),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007223365.1| hypothetical protein PRUPE_ppa005617mg [Prunus persica]
 ref|XP_008219156.1| PREDICTED: tubulin alpha chain-like isoform X1 [Prunus mume]
 ref|XP_008347836.1| PREDICTED: tubulin alpha chain isoform X1 [Malus domestica]
 ref|XP_008352750.1| PREDICTED: tubulin alpha chain isoform X1 [Malus domestica]
 ref|XP_009357230.1| PREDICTED: tubulin alpha chain-like isoform X1 [Pyrus x bretschneideri]
 ref|XP_009335481.1| PREDICTED: tubulin alpha chain-like [Pyrus x bretschneideri]
 gb|EMJ24564.1| hypothetical protein PRUPE_ppa005617mg [Prunus persica]
Length=451

 Score =   300 bits (769),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002959708.1| alpha tubulin [Volvox carteri f. nagariensis]
 gb|EFJ39226.1| alpha tubulin [Volvox carteri f. nagariensis]
Length=255

 Score =   293 bits (751),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 133/143 (93%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITN+AFEP+SMMVKCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  94   EITNAAFEPASMMVKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  153

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNST++ E+FSR+DHKFDLMY KRAFVHWYV
Sbjct  154  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIGEIFSRLDHKFDLMYAKRAFVHWYV  213

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKD+
Sbjct  214  GEGMEEGEFSEAREDLAALEKDF  236



>ref|XP_006307493.1| hypothetical protein CARUB_v10009117mg [Capsella rubella]
 ref|XP_010418156.1| PREDICTED: tubulin alpha-2 chain [Camelina sativa]
 ref|XP_010430201.1| PREDICTED: tubulin alpha-2 chain isoform X1 [Camelina sativa]
 ref|XP_010430202.1| PREDICTED: tubulin alpha-2 chain isoform X2 [Camelina sativa]
 ref|XP_010473400.1| PREDICTED: tubulin alpha-2 chain [Camelina sativa]
 gb|EOA40391.1| hypothetical protein CARUB_v10009117mg [Capsella rubella]
Length=450

 Score =   300 bits (768),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|AFW67749.1| alpha tubulin4 [Zea mays]
Length=321

 Score =   296 bits (757),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  160  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  219

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYV
Sbjct  220  GFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYV  279

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  280  GEGMEEGEFSEAREDLAALEKDY  302



>gb|ABR25378.1| tubulin alpha 3 chain [Oryza sativa Indica Group]
Length=207

 Score =   291 bits (746),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  46   EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  105

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRID KFDLMY KRAFVHWYV
Sbjct  106  GFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDIKFDLMYSKRAFVHWYV  165

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  166  GEGMEEGEFSEAREDLAALEKDY  188



>gb|ABQ59633.1| alpha-tubulin 3 [Populus tremuloides]
Length=451

 Score =   300 bits (768),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYSKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009409992.1| PREDICTED: tubulin alpha chain-like [Musa acuminata subsp. malaccensis]
Length=451

 Score =   300 bits (768),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVA+VFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVADVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009388502.1| PREDICTED: tubulin alpha-2 chain isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=451

 Score =   300 bits (768),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|ABD92937.1| alpha tubulin-4A [Triticum aestivum]
 gb|ABD92938.1| alpha tubulin-4B [Triticum aestivum]
 gb|EMS53764.1| Tubulin alpha chain [Triticum urartu]
Length=451

 Score =   300 bits (768),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|KDO25258.1| hypothetical protein SPRG_09506 [Saprolegnia parasitica CBS 223.65]
Length=186

 Score =   291 bits (744),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 132/143 (92%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEP+SMM KCDPRHGKYMA CLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  23   EITNSAFEPASMMAKCDPRHGKYMAACLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  82

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLA+VQRAVCMISN++++AEVFSRIDHKFDLMY KRAF HWYV
Sbjct  83   GFKCGINYQPPTVVPGGDLARVQRAVCMISNTSAIAEVFSRIDHKFDLMYAKRAFAHWYV  142

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  143  GEGMEEGEFSEAREDLAALEKDY  165



>ref|XP_010096739.1| Tubulin alpha chain [Morus notabilis]
 gb|EXB65591.1| Tubulin alpha chain [Morus notabilis]
Length=449

 Score =   300 bits (768),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPT
Sbjct  287  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPT  346

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  347  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  406

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  407  GEGMEEGEFSEAREDLAALEKDY  429



>gb|ABD92936.1| alpha tubulin-4D [Triticum aestivum]
Length=451

 Score =   300 bits (768),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|AAB36609.1| alpha-tubulin, partial [Eucalyptus globulus subsp. bicostata]
Length=380

 Score =   298 bits (762),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            E TNSAFEPSS+M KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  220  ETTNSAFEPSSLMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  279

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNST +AEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  280  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTRLAEVFSRIDHKFDLMYAKRAFVHWYV  339

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  340  GEGMEEGEFSEAREDLAALEKDY  362



>sp|Q6VAG0.1|TBA2_GOSHI RecName: Full=Tubulin alpha-2 chain; AltName: Full=Alpha-2-tubulin 
[Gossypium hirsutum]
 gb|AAQ92662.1| alpha-tubulin 2 [Gossypium hirsutum]
 gb|ACM89776.1| alpha-tubulin 2 [Gossypium hirsutum]
 gb|KJB77616.1| hypothetical protein B456_012G147000 [Gossypium raimondii]
 gb|KJB77617.1| hypothetical protein B456_012G147000 [Gossypium raimondii]
Length=450

 Score =   300 bits (768),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVA+IKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVASIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAF+HWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFIHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_003556001.1| PREDICTED: tubulin alpha-4 chain-like isoform X1 [Glycine max]
 gb|KHN01573.1| Tubulin alpha-4 chain [Glycine soja]
Length=449

 Score =   300 bits (768),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVF RIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFGRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>sp|Q6VAG1.1|TBA1_GOSHI RecName: Full=Tubulin alpha-1 chain; AltName: Full=Alpha-1-tubulin 
[Gossypium hirsutum]
 gb|AAQ92661.1| alpha-tubulin 1 [Gossypium hirsutum]
Length=451

 Score =   300 bits (768),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQF DWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFADWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|KHN42598.1| Tubulin alpha-2 chain [Glycine soja]
Length=451

 Score =   300 bits (768),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVA IKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVAIIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_003536570.1| PREDICTED: tubulin alpha chain-like isoform X1 [Glycine max]
 gb|KHN23177.1| Tubulin alpha chain [Glycine soja]
Length=449

 Score =   300 bits (767),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVF RIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFGRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007156677.1| hypothetical protein PHAVU_002G007900g [Phaseolus vulgaris]
 gb|ESW28671.1| hypothetical protein PHAVU_002G007900g [Phaseolus vulgaris]
Length=451

 Score =   300 bits (768),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFV+WCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVEWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|KEH43997.1| tubulin beta-1 chain [Medicago truncatula]
Length=450

 Score =   300 bits (767),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVF RIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFGRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004496862.1| PREDICTED: tubulin alpha chain-like [Cicer arietinum]
Length=450

 Score =   300 bits (767),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVF RIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFGRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_003517369.1| PREDICTED: tubulin alpha-2 chain-like isoform X1 [Glycine max]
Length=451

 Score =   300 bits (767),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVA IKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVAIIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_011014531.1| PREDICTED: tubulin alpha-4 chain-like [Populus euphratica]
Length=451

 Score =   300 bits (767),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYSKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002779346.1| alpha-tubulin, putative [Perkinsus marinus ATCC 50983]
 gb|EER11141.1| alpha-tubulin, putative [Perkinsus marinus ATCC 50983]
Length=186

 Score =   290 bits (743),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNS FEP+SMMVKCDPRHGKYMACC+M+RGDVVPKDVNAAVATIKTKRTIQFVDW PT
Sbjct  23   EITNSVFEPASMMVKCDPRHGKYMACCMMYRGDVVPKDVNAAVATIKTKRTIQFVDWSPT  82

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKV RAVCMISNST+VAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  83   GFKCGINYQPPTVVPGGDLAKVMRAVCMISNSTAVAEVFSRIDHKFDLMYAKRAFVHWYV  142

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  143  GEGMEEGEFSEAREDLAALEKDY  165



>ref|XP_003539228.1| PREDICTED: tubulin alpha-2 chain-like [Glycine max]
 gb|KHN13032.1| Tubulin alpha-2 chain [Glycine soja]
Length=451

 Score =   300 bits (767),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVA IKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVAIIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007515802.1| alpha-tubulin [Bathycoccus prasinos]
 emb|CCO14681.1| alpha-tubulin [Bathycoccus prasinos]
Length=415

 Score =   298 bits (764),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVA+IKTKRTIQFVDWCPT
Sbjct  255  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVASIKTKRTIQFVDWCPT  314

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNST++AEVFSR+DHKFDLMY KRAFVHWYV
Sbjct  315  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRLDHKFDLMYAKRAFVHWYV  374

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  375  GEGMEEGEFSEAREDLAALEKDY  397



>ref|XP_002962630.1| hypothetical protein SELMODRAFT_230143 [Selaginella moellendorffii]
 ref|XP_002980460.1| hypothetical protein SELMODRAFT_233518 [Selaginella moellendorffii]
 gb|EFJ18720.1| hypothetical protein SELMODRAFT_233518 [Selaginella moellendorffii]
 gb|EFJ36093.1| hypothetical protein SELMODRAFT_230143 [Selaginella moellendorffii]
Length=452

 Score =   300 bits (767),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITN+AFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  292  EITNTAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  351

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  352  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  411

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  412  GEGMEEGEFSEAREDLAALEKDY  434



>ref|XP_007143142.1| hypothetical protein PHAVU_007G047300g [Phaseolus vulgaris]
 gb|ESW15136.1| hypothetical protein PHAVU_007G047300g [Phaseolus vulgaris]
Length=449

 Score =   300 bits (767),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVF RIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFGRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|KIZ01406.1| Tubulin alpha-1 chain [Monoraphidium neglectum]
Length=451

 Score =   300 bits (767),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 142/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMMVKCDPRHGKYMACCLM+RGDVVPKDVNA+VATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMVKCDPRHGKYMACCLMYRGDVVPKDVNASVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNST++AEVFSR+DHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRLDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>emb|CDY29334.1| BnaA05g16010D [Brassica napus]
Length=431

 Score =   299 bits (765),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPT
Sbjct  271  EITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPT  330

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  331  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  390

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  391  GEGMEEGEFSEAREDLAALEKDY  413



>ref|XP_001777110.1| predicted protein [Physcomitrella patens]
 gb|EDQ58103.1| predicted protein [Physcomitrella patens]
Length=344

 Score =   296 bits (758),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITN+ FEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRT+QFVDWCPT
Sbjct  185  EITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTVQFVDWCPT  244

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  245  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYV  304

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  305  GEGMEEGEFSEAREDLAALEKDY  327



>ref|XP_002964078.1| hypothetical protein SELMODRAFT_405729 [Selaginella moellendorffii]
 ref|XP_002975442.1| hypothetical protein SELMODRAFT_232506 [Selaginella moellendorffii]
 gb|EFJ23643.1| hypothetical protein SELMODRAFT_232506 [Selaginella moellendorffii]
 gb|EFJ34411.1| hypothetical protein SELMODRAFT_405729 [Selaginella moellendorffii]
Length=451

 Score =   299 bits (766),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITN+AFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNTAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|AFW67748.1| alpha tubulin4 [Zea mays]
Length=364

 Score =   296 bits (759),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  203  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  262

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYV
Sbjct  263  GFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYV  322

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  323  GEGMEEGEFSEAREDLAALEKDY  345



>ref|XP_010420792.1| PREDICTED: tubulin alpha-3 chain-like [Camelina sativa]
Length=183

 Score =   290 bits (742),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 133/143 (93%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITN+ FEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRT+QFVDWCPT
Sbjct  23   EITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTVQFVDWCPT  82

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  83   GFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYV  142

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  143  GEGMEEGEFSEAREDLAALEKDY  165



>gb|KJB29387.1| hypothetical protein B456_005G097800 [Gossypium raimondii]
Length=451

 Score =   299 bits (766),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITN+AFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNTAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLA+VQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAEVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|AAO73546.1| alpha-tubulin [Ceratopteris richardii]
 gb|AAW57307.1| alpha-tubulin [Ceratopteris richardii]
Length=450

 Score =   299 bits (766),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRA+CMISNSTSVAEVFSRID KFDLMYCKRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAICMISNSTSVAEVFSRIDFKFDLMYCKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004150268.1| PREDICTED: tubulin alpha chain-like [Cucumis sativus]
 ref|XP_004156870.1| PREDICTED: tubulin alpha chain-like [Cucumis sativus]
 ref|XP_008454421.1| PREDICTED: tubulin alpha chain [Cucumis melo]
 gb|ADN33817.1| tubulin alpha chain [Cucumis melo subsp. melo]
 gb|KGN52737.1| Tubulin alpha chain [Cucumis sativus]
Length=450

 Score =   299 bits (766),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMMVKCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMVKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLA+VQRAVC ISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLARVQRAVCKISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|KFK32793.1| hypothetical protein AALP_AA6G289100 [Arabis alpina]
Length=450

 Score =   299 bits (766),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITN+AFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPT
Sbjct  290  EITNTAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>emb|CDY66630.1| BnaCnng51680D [Brassica napus]
Length=435

 Score =   298 bits (764),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>dbj|BAH20267.1| AT5G19780 [Arabidopsis thaliana]
Length=284

 Score =   293 bits (751),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 133/143 (93%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITN+ FEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRT+QFVDWCPT
Sbjct  124  EITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTVQFVDWCPT  183

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  184  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYV  243

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  244  GEGMEEGEFSEAREDLAALEKDY  266



>gb|AAO46127.1| alpha-tubulin [Streblomastix strix]
 gb|AAO46129.1| alpha-tubulin [Streblomastix strix]
Length=249

 Score =   292 bits (747),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 133/143 (93%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNS+FEP++MM KCDPRHGKYMACC+M+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  89   EITNSSFEPANMMAKCDPRHGKYMACCMMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  148

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFK GINYQPPTVVPGGDLAKVQRAVCMISNST++AEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  149  GFKVGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRIDHKFDLMYAKRAFVHWYV  208

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  209  GEGMEEGEFSEAREDLAALEKDY  231



>ref|XP_010507910.1| PREDICTED: tubulin alpha-2 chain-like [Camelina sativa]
 ref|XP_010466126.1| PREDICTED: tubulin alpha-2 chain-like isoform X1 [Camelina sativa]
 ref|XP_010487911.1| PREDICTED: tubulin alpha-2 chain-like [Camelina sativa]
Length=451

 Score =   299 bits (765),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITN+AFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPT
Sbjct  290  EITNTAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>dbj|BAE99023.1| tubulin alpha-2/alpha-4 chain [Arabidopsis thaliana]
Length=450

 Score =   299 bits (765),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|NP_171974.1| tubulin alpha-4 chain [Arabidopsis thaliana]
 ref|NP_175423.1| tubulin alpha-2 chain [Arabidopsis thaliana]
 ref|XP_002863595.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002891551.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 ref|XP_006279139.1| hypothetical protein CARUB_v10008014mg [Capsella rubella]
 ref|XP_006393188.1| hypothetical protein EUTSA_v10011471mg [Eutrema salsugineum]
 ref|XP_006406473.1| hypothetical protein EUTSA_v10020718mg [Eutrema salsugineum]
 ref|XP_009107244.1| PREDICTED: tubulin alpha-2 chain isoform X1 [Brassica rapa]
 sp|B9DGT7.2|TBA2_ARATH RecName: Full=Tubulin alpha-2 chain [Arabidopsis thaliana]
 sp|Q0WV25.2|TBA4_ARATH RecName: Full=Tubulin alpha-4 chain [Arabidopsis thaliana]
 gb|AAF40454.1|AC004809_12 Identical to the alpha-4 tubulin (TUA4) gene from A. thaliana 
gb|M84697. ESTs gb|T46564. gb|T04381, gb|T76028, gb|T21602, 
gb|H37154 gb|H37663 and gb|T21719 come from this gene [Arabidopsis 
thaliana]
 gb|AAF76449.1|AC015445_16 Identical to Tubulin Alpha-6 Chain from Arabidopsis thaliana 
gi|267070 and contains a Tubulin PF|00091 domain. ESTs gb|N37387, 
gb|N37805, gb|R90497, gb|T44684, gb|H36144, gb|N38686, 
gb|AI994844, gb|R90689, gb|T04725, gb|H36928, gb|N96479, gb|H36922, 
gb|R90670, gb|Z17980, gb|T4428, gb|H36248, gb|N65408, 
gb|T46222 come from this gene [Arabidopsis thaliana]
 gb|AAK95316.1|AF410330_1 At1g50010/F2J10_12 [Arabidopsis thaliana]
 gb|AAA32889.1| apha-2 tubulin [Arabidopsis thaliana]
 gb|AAA32890.1| alpha-4 tubulin [Arabidopsis thaliana]
 gb|AAL25612.1| At1g04820/F13M7_26 [Arabidopsis thaliana]
 gb|AAL38293.1| Tubulin Alpha-6 Chain [Arabidopsis thaliana]
 gb|AAM98269.1| At1g04820/F13M7_26 [Arabidopsis thaliana]
 gb|AAN31076.1| At1g50010/F2J10_12 [Arabidopsis thaliana]
 gb|ABQ01730.1| TUA2 [Eutrema halophilum]
 gb|ABQ01731.1| TUA2-2 [Eutrema halophilum]
 gb|EFH39854.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67810.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 gb|AEE27747.1| tubulin alpha-4 chain [Arabidopsis thaliana]
 gb|AEE32507.1| tubulin alpha-2 chain [Arabidopsis thaliana]
 gb|EOA12037.1| hypothetical protein CARUB_v10008014mg [Capsella rubella]
 gb|ESQ30474.1| hypothetical protein EUTSA_v10011471mg [Eutrema salsugineum]
 gb|ESQ47926.1| hypothetical protein EUTSA_v10020718mg [Eutrema salsugineum]
 gb|KFK35954.1| hypothetical protein AALP_AA4G059800 [Arabis alpina]
 gb|KFK39296.1| alpha tubulin 1 [Arabis alpina]
 emb|CDY45043.1| BnaA08g02320D [Brassica napus]
 emb|CDY03583.1| BnaC03g68420D [Brassica napus]
Length=450

 Score =   299 bits (765),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009147859.1| PREDICTED: tubulin alpha-6 chain [Brassica rapa]
Length=450

 Score =   299 bits (765),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|AHJ80823.1| Tua1 [Eragrostis tef]
Length=451

 Score =   299 bits (765),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>dbj|BAC24800.1| alpha tubulin [Physcomitrella patens]
Length=451

 Score =   299 bits (765),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKF LMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFGLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|ACU20294.1| unknown [Glycine max]
Length=339

 Score =   295 bits (755),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 138/143 (97%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAV  IKTKRTIQFVDWCPT
Sbjct  179  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGIIKTKRTIQFVDWCPT  238

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYV
Sbjct  239  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYV  298

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEG+FSEAREDLAALEKDY
Sbjct  299  GEGMEEGKFSEAREDLAALEKDY  321



>gb|AAL16174.1|AF428406_1 AT4g14960/dl3520c [Arabidopsis thaliana]
Length=450

 Score =   299 bits (765),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010500555.1| PREDICTED: tubulin alpha-6 chain isoform X1 [Camelina sativa]
 ref|XP_010479400.1| PREDICTED: tubulin alpha-6 chain [Camelina sativa]
Length=450

 Score =   299 bits (765),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|NP_193232.1| tubulin alpha-6 chain [Arabidopsis thaliana]
 sp|P29511.1|TBA6_ARATH RecName: Full=Tubulin alpha-6 chain [Arabidopsis thaliana]
 gb|AAA32892.1| TUA6 [Arabidopsis thaliana]
 emb|CAB10275.1| tubulin alpha-6 chain (TUA6) [Arabidopsis thaliana]
 emb|CAB78538.1| tubulin alpha-6 chain (TUA6) [Arabidopsis thaliana]
 gb|AAL24246.1| AT4g14960/dl3520c [Arabidopsis thaliana]
 gb|AAL38788.1| putative tubulin alpha-6 chain TUA6 [Arabidopsis thaliana]
 gb|AAL79586.1| AT4g14960/dl3520c [Arabidopsis thaliana]
 gb|AAM51249.1| putative tubulin alpha-6 chain TUA6 [Arabidopsis thaliana]
 gb|ABD75335.1| tubulin alpha-1 chain [Brassica rapa subsp. oleifera]
 gb|AEE83530.1| tubulin alpha-6 chain [Arabidopsis thaliana]
 emb|CDY50974.1| BnaA06g37700D [Brassica napus]
 emb|CDY28123.1| BnaC06g03040D [Brassica napus]
Length=450

 Score =   299 bits (765),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>emb|CAB66336.1| alpha-tubulin [Betula pendula]
 gb|AJA29683.1| tubulin alpha chain [Betula luminifera]
Length=451

 Score =   298 bits (764),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRID+KFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDNKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010664458.1| PREDICTED: tubulin alpha-4 chain [Vitis vinifera]
 emb|CAN77412.1| hypothetical protein VITISV_000470 [Vitis vinifera]
Length=451

 Score =   298 bits (764),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRID+KFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDNKFDLMYSKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_011398411.1| Tubulin alpha chain [Auxenochlorella protothecoides]
 gb|KFM25515.1| Tubulin alpha chain [Auxenochlorella protothecoides]
Length=394

 Score =   296 bits (759),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVAT+KTKRTIQFVDWCPT
Sbjct  234  EITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATVKTKRTIQFVDWCPT  293

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNST++AEVFSR+DHKFDLMY KRAFVHWYV
Sbjct  294  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRLDHKFDLMYAKRAFVHWYV  353

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  354  GEGMEEGEFSEAREDLAALEKDY  376



>gb|AEW46684.1| beta-tubulin [Ulva linza]
Length=452

 Score =   298 bits (764),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 136/143 (95%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNST++AEVFSR+DHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRLDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009407690.1| PREDICTED: tubulin alpha chain-like [Musa acuminata subsp. malaccensis]
Length=452

 Score =   298 bits (764),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFE SSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFETSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|AAO46130.1| alpha-tubulin [Streblomastix strix]
Length=249

 Score =   291 bits (746),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 133/143 (93%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNS+FEP++MM KCDPRHGKYMACC+M+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  89   EITNSSFEPANMMAKCDPRHGKYMACCMMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  148

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFK GINYQPPTVVPGGDLAKVQRAVCMISNST++AEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  149  GFKVGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRIDHKFDLMYAKRAFVHWYV  208

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  209  GEGMEEGEFSEAREDLAALEKDY  231



>ref|XP_009124556.1| PREDICTED: tubulin alpha-2 chain-like isoform X1 [Brassica rapa]
Length=450

 Score =   298 bits (764),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAV TIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|KJB33191.1| hypothetical protein B456_006G002500 [Gossypium raimondii]
Length=183

 Score =   289 bits (739),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 135/143 (94%), Positives = 138/143 (97%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EIT+SAFEP+SMM KCDPRHGKYM CCLM+RGDVV KDVNAAVATIKTKRTIQFVDWCPT
Sbjct  23   EITSSAFEPASMMAKCDPRHGKYMDCCLMYRGDVVRKDVNAAVATIKTKRTIQFVDWCPT  82

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  83   GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  142

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
             EGMEEGEFSEAREDLAALEKDY
Sbjct  143  SEGMEEGEFSEAREDLAALEKDY  165



>ref|XP_008665337.1| PREDICTED: tubulin alpha-1 chain-like [Zea mays]
 sp|P14640.1|TBA1_MAIZE RecName: Full=Tubulin alpha-1 chain; AltName: Full=Alpha-1-tubulin 
[Zea mays]
 emb|CAA33734.1| alpha1-tubulin [Zea mays]
 tpg|DAA51112.1| TPA: tubulin alpha-1 chain [Zea mays]
 tpg|DAA51113.1| TPA: tubulin alpha-1 chain [Zea mays]
 tpg|DAA51114.1| TPA: tubulin alpha-1 chain [Zea mays]
 tpg|DAA51117.1| TPA: tubulin alpha-1 chain [Zea mays]
Length=451

 Score =   298 bits (764),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008665339.1| PREDICTED: tubulin alpha-2 chain [Zea mays]
 sp|P14641.1|TBA2_MAIZE RecName: Full=Tubulin alpha-2 chain; AltName: Full=Alpha-2-tubulin 
[Zea mays]
 emb|CAA33733.1| alpha2-tubulin [Zea mays]
 tpg|DAA51111.1| TPA: tubulin alpha-2 chain [Zea mays]
Length=451

 Score =   298 bits (764),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|ABL61201.1| alpha-tubulin [Oxymonadida environmental sample]
Length=299

 Score =   293 bits (750),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 133/143 (93%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNS+FEP++MM KCDPRHGKYMACC+M+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  138  EITNSSFEPANMMAKCDPRHGKYMACCMMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  197

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNST++AEVFSRID KFDLMY KRAFVHWYV
Sbjct  198  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRIDRKFDLMYAKRAFVHWYV  257

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  258  GEGMEEGEFSEAREDLAALEKDY  280



>dbj|BAP59012.1| alpha tubulin [Taxus cuspidata]
Length=451

 Score =   298 bits (764),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRID KFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDRKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|AHJ80815.1| Tua1 [Eragrostis tef]
Length=451

 Score =   298 bits (764),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|ABQ59634.1| alpha-tubulin 5 [Populus tremuloides]
Length=451

 Score =   298 bits (763),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRID KFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDSKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|AHJ80817.1| Tua1 [Eragrostis tef]
Length=451

 Score =   298 bits (763),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007047652.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOX91809.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=501

 Score =   300 bits (767),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNS FEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  340  EITNSTFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  399

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  400  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  459

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  460  GEGMEEGEFSEAREDLAALEKDY  482



>dbj|BAJ06362.1| alpha-tubulin [Alopecurus aequalis]
Length=451

 Score =   298 bits (763),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_003560377.1| PREDICTED: tubulin alpha-1 chain [Brachypodium distachyon]
Length=451

 Score =   298 bits (763),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004981922.1| PREDICTED: tubulin alpha-1 chain-like [Setaria italica]
 emb|CAE52515.1| alpha tubulin [Setaria viridis]
Length=451

 Score =   298 bits (763),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>tpg|DAA51109.1| TPA: alpha tubulin [Zea mays]
Length=452

 Score =   298 bits (763),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  291  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  350

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYV
Sbjct  351  GFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYV  410

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  411  GEGMEEGEFSEAREDLAALEKDY  433



>ref|NP_001167663.1| tubulin alpha-3 chain [Zea mays]
 gb|ACG26907.1| tubulin alpha-3 chain [Zea mays]
 gb|AFW67746.1| alpha tubulin4 isoform 1 [Zea mays]
 gb|AFW67747.1| alpha tubulin4 isoform 2 [Zea mays]
Length=451

 Score =   298 bits (763),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>emb|CAA06619.1| alpha-tubulin 1 [Eleusine indica]
Length=451

 Score =   298 bits (763),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>sp|O22347.1|TBA1_ELEIN RecName: Full=Tubulin alpha-1 chain; AltName: Full=Alpha-1-tubulin 
[Eleusine indica]
 gb|AAC05717.1| alpha tubulin 1 [Eleusine indica]
 emb|CAA06618.1| alpha-tubulin 1 [Eleusine indica]
 gb|AFC88823.1| putative tubulin alpha-1 chain [Miscanthus sinensis]
 gb|AFC88833.1| tubulin alpha-1 chain [Miscanthus sinensis]
Length=451

 Score =   298 bits (763),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|AFC88832.1| putative tubulin alpha-3 chain [Miscanthus sinensis]
Length=451

 Score =   298 bits (763),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>dbj|BAD94893.1| tubulin alpha-5 chain-like protein [Arabidopsis thaliana]
Length=183

 Score =   289 bits (739),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 132/143 (92%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITN+ FEP+SMM KCDP+HGKYMACCLM+RGDVVPKDVNAAV TIKTKRT+QFVDWCPT
Sbjct  23   EITNAVFEPASMMAKCDPKHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTVQFVDWCPT  82

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+VAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  83   GFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYV  142

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  143  GEGMEEGEFSEAREDLAALEKDY  165



>ref|XP_002313194.1| hypothetical protein POPTR_0009s08850g [Populus trichocarpa]
 gb|EEE87149.1| hypothetical protein POPTR_0009s08850g [Populus trichocarpa]
Length=451

 Score =   298 bits (763),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRID KFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDSKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|ABO47742.1| alpha-tubulin [Gossypium hirsutum]
 gb|KHG08879.1| Tubulin alpha-1 chain [Gossypium arboreum]
 gb|KJB11380.1| hypothetical protein B456_001G255600 [Gossypium raimondii]
Length=450

 Score =   298 bits (763),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 141/143 (99%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EIT+SAFEP+SMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITSSAFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>sp|Q9ZRR5.1|TBA3_HORVU RecName: Full=Tubulin alpha-3 chain [Hordeum vulgare]
 emb|CAA10663.1| alpha-tubulin 3 [Hordeum vulgare subsp. vulgare]
 gb|ABD92933.1| alpha tubulin-3B [Triticum aestivum]
 gb|ABD92934.1| alpha tubulin-3A [Triticum aestivum]
 gb|ABD92935.1| alpha tubulin-3D [Triticum aestivum]
 dbj|BAJ87680.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMS48260.1| Tubulin alpha-3 chain [Triticum urartu]
 gb|EMT18537.1| Tubulin alpha-3 chain [Aegilops tauschii]
Length=451

 Score =   298 bits (763),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|AGG37287.1| alpha-tubulin 5 [Salix arbutifolia]
Length=451

 Score =   298 bits (763),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 139/143 (97%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRID KFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDTKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|ABL61216.1| alpha-tubulin [Oxymonadida environmental sample]
Length=314

 Score =   293 bits (751),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 133/143 (93%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNS+FEP++MM KCDPRHGKYMACC+M+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  153  EITNSSFEPANMMAKCDPRHGKYMACCMMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  212

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNST++AEVFSRID KFDLMY KRAFVHWYV
Sbjct  213  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTAIAEVFSRIDRKFDLMYAKRAFVHWYV  272

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  273  GEGMEEGEFSEAREDLAALEKDY  295



>ref|XP_002466535.1| hypothetical protein SORBIDRAFT_01g009570 [Sorghum bicolor]
 gb|EER93533.1| hypothetical protein SORBIDRAFT_01g009570 [Sorghum bicolor]
 gb|ACX70682.1| tubulin alpha-2-like protein [Sorghum bicolor]
Length=452

 Score =   298 bits (763),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  291  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  350

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYV
Sbjct  351  GFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYV  410

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  411  GEGMEEGEFSEAREDLAALEKDY  433



>ref|XP_010680774.1| PREDICTED: tubulin alpha-2 chain [Beta vulgaris subsp. vulgaris]
Length=451

 Score =   298 bits (763),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EIT SAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITTSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>gb|ABV55999.1| alpha-tubulin 7 [Populus tremuloides]
Length=451

 Score =   298 bits (763),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            E+TNSAFEPSSMM KCDPR GKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EVTNSAFEPSSMMAKCDPRRGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>emb|CDO97305.1| unnamed protein product [Coffea canephora]
Length=450

 Score =   298 bits (762),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPPTVVPGGDL+ VQRAVCMISNSTSVAEVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPTVVPGGDLSGVQRAVCMISNSTSVAEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006650518.1| PREDICTED: tubulin alpha-1 chain-like [Oryza brachyantha]
Length=451

 Score =   298 bits (762),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPP++VPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPSIVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



>dbj|BAG99724.1| unnamed protein product [Oryza sativa Japonica Group]
Length=417

 Score =   296 bits (759),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  255  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  314

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPP+VVP GDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYV
Sbjct  315  GFKCGINYQPPSVVPSGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYSKRAFVHWYV  374

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  375  GEGMEEGEFSEAREDLAALEKDY  397



>ref|XP_006662856.1| PREDICTED: tubulin alpha-3 chain-like [Oryza brachyantha]
Length=451

 Score =   298 bits (762),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 138/143 (97%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -3

Query  661  EITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  482
            EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDVVPKDVNAAVATIKTKRTIQFVDWCPT
Sbjct  290  EITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVATIKTKRTIQFVDWCPT  349

Query  481  GFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTSVAEVFSRIDHKFDLMYCKRAFVHWYV  302
            GFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTSV EVFSRIDHKFDLMY KRAFVHWYV
Sbjct  350  GFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTSVVEVFSRIDHKFDLMYAKRAFVHWYV  409

Query  301  GEGMEEGEFSEAREDLAALEKDY  233
            GEGMEEGEFSEAREDLAALEKDY
Sbjct  410  GEGMEEGEFSEAREDLAALEKDY  432



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1037156799140