BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF007P17

Length=401
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009596640.1|  PREDICTED: proteasome subunit beta type-5-like     140   5e-38   Nicotiana tomentosiformis
ref|XP_004239661.1|  PREDICTED: proteasome subunit beta type-5          140   1e-37   Solanum lycopersicum
ref|XP_006345787.1|  PREDICTED: proteasome subunit beta type-5-like     140   1e-37   Solanum tuberosum [potatoes]
ref|XP_011071212.1|  PREDICTED: proteasome subunit beta type-5-like     140   1e-37   Sesamum indicum [beniseed]
ref|XP_009783836.1|  PREDICTED: proteasome subunit beta type-5-like     139   1e-37   Nicotiana sylvestris
ref|XP_009780639.1|  PREDICTED: proteasome subunit beta type-5-like     137   2e-36   Nicotiana sylvestris
ref|XP_009619742.1|  PREDICTED: proteasome subunit beta type-5-like     137   2e-36   Nicotiana tomentosiformis
gb|EYU42103.1|  hypothetical protein MIMGU_mgv1a011714mg                136   2e-36   Erythranthe guttata [common monkey flower]
ref|XP_006363770.1|  PREDICTED: proteasome subunit beta type-5-li...    134   1e-35   Solanum tuberosum [potatoes]
gb|EPS61043.1|  hypothetical protein M569_13757                         132   6e-35   Genlisea aurea
ref|XP_004144192.1|  PREDICTED: proteasome subunit beta type-5-like     130   6e-34   Cucumis sativus [cucumbers]
ref|XP_008445492.1|  PREDICTED: proteasome subunit beta type-5          130   8e-34   Cucumis melo [Oriental melon]
ref|XP_009376552.1|  PREDICTED: proteasome subunit beta type-5-like     129   8e-34   Pyrus x bretschneideri [bai li]
ref|XP_008222076.1|  PREDICTED: proteasome subunit beta type-5          129   1e-33   Prunus mume [ume]
gb|AAL26914.1|AF323592_1  putative 20S proteasome beta subunit 5        127   2e-33   Prunus persica
ref|XP_002264828.1|  PREDICTED: proteasome subunit beta type-5          129   2e-33   Vitis vinifera
ref|XP_008446052.1|  PREDICTED: proteasome subunit beta type-5-li...    125   2e-33   
ref|XP_008446054.1|  PREDICTED: proteasome subunit beta type-5-li...    125   2e-33   
ref|XP_007222598.1|  hypothetical protein PRUPE_ppa009896mg             127   5e-33   Prunus persica
ref|XP_009416647.1|  PREDICTED: proteasome subunit beta type-5-like     127   6e-33   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG05622.1|  Proteasome subunit beta type-5                          127   6e-33   Gossypium arboreum [tree cotton]
ref|XP_004135309.1|  PREDICTED: proteasome subunit beta type-5-like     127   7e-33   Cucumis sativus [cucumbers]
ref|XP_007045043.1|  N-terminal nucleophile aminohydrolases (Ntn ...    127   7e-33   
ref|XP_011457464.1|  PREDICTED: proteasome subunit beta type-5-like     127   7e-33   Fragaria vesca subsp. vesca
ref|XP_010251768.1|  PREDICTED: proteasome subunit beta type-5-like     127   7e-33   Nelumbo nucifera [Indian lotus]
gb|KJB15718.1|  hypothetical protein B456_002G192400                    127   8e-33   Gossypium raimondii
gb|KJB78067.1|  hypothetical protein B456_012G175200                    127   9e-33   Gossypium raimondii
ref|XP_007137929.1|  hypothetical protein PHAVU_009G167300g             127   9e-33   Phaseolus vulgaris [French bean]
ref|XP_008381840.1|  PREDICTED: proteasome subunit beta type-5-like     127   1e-32   
gb|KGN51684.1|  hypothetical protein Csa_5G590010                       127   1e-32   Cucumis sativus [cucumbers]
ref|XP_009372313.1|  PREDICTED: proteasome subunit beta type-5          126   1e-32   Pyrus x bretschneideri [bai li]
gb|KHG25400.1|  Proteasome subunit beta type-5                          126   1e-32   Gossypium arboreum [tree cotton]
ref|XP_008340194.1|  PREDICTED: proteasome subunit beta type-5          126   2e-32   
gb|KDP26783.1|  hypothetical protein JCGZ_17941                         126   2e-32   Jatropha curcas
ref|XP_010250770.1|  PREDICTED: proteasome subunit beta type-5          126   2e-32   Nelumbo nucifera [Indian lotus]
ref|XP_008806245.1|  PREDICTED: proteasome subunit beta type-5-like     125   3e-32   Phoenix dactylifera
gb|EMS57921.1|  Proteasome subunit beta type-5                          124   4e-32   Triticum urartu
ref|XP_003564317.1|  PREDICTED: proteasome subunit beta type-5-A-...    125   4e-32   Brachypodium distachyon [annual false brome]
ref|XP_010905449.1|  PREDICTED: proteasome subunit beta type-5-like     125   6e-32   Elaeis guineensis
ref|XP_006291670.1|  hypothetical protein CARUB_v10017828mg             124   6e-32   Capsella rubella
gb|EMT01588.1|  Proteasome subunit beta type-5-A                        130   8e-32   
gb|KHN31904.1|  Proteasome subunit beta type-5                          124   9e-32   Glycine soja [wild soybean]
ref|XP_003523139.1|  PREDICTED: proteasome subunit beta type-5-li...    124   9e-32   Glycine max [soybeans]
ref|XP_003526966.1|  PREDICTED: proteasome subunit beta type-5-like     124   9e-32   Glycine max [soybeans]
dbj|BAJ97061.1|  predicted protein                                      124   1e-31   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACU23791.1|  unknown                                                 124   1e-31   Glycine max [soybeans]
gb|AAU82107.1|  20S proteasome beta 5 subunit                           124   1e-31   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006395566.1|  hypothetical protein EUTSA_v10004762mg             124   1e-31   Eutrema salsugineum [saltwater cress]
gb|ACP43316.1|  20S proteasome beta subunit 5                           122   1e-31   Citrus maxima [buntan]
ref|XP_006842100.1|  hypothetical protein AMTR_s00078p00083100          123   3e-31   
gb|ACP43315.1|  20S proteasome beta subunit 5                           123   3e-31   Citrus maxima [buntan]
ref|XP_006484070.1|  PREDICTED: proteasome subunit beta type-5-B-...    123   3e-31   Citrus sinensis [apfelsine]
ref|XP_006438069.1|  hypothetical protein CICLE_v10032238mg             123   3e-31   Citrus clementina [clementine]
ref|XP_010105786.1|  Proteasome subunit beta type-5                     123   3e-31   Morus notabilis
emb|CDP13326.1|  unnamed protein product                                124   5e-31   Coffea canephora [robusta coffee]
ref|XP_010025332.1|  PREDICTED: proteasome subunit beta type-5-B        122   5e-31   Eucalyptus grandis [rose gum]
emb|CDY34594.1|  BnaC03g56940D                                          122   8e-31   Brassica napus [oilseed rape]
ref|XP_010538272.1|  PREDICTED: proteasome subunit beta type-5-B-...    121   9e-31   Tarenaya hassleriana [spider flower]
emb|CDX98014.1|  BnaA06g07650D                                          121   1e-30   
emb|CDY19402.1|  BnaC05g09110D                                          121   1e-30   Brassica napus [oilseed rape]
emb|CDY21081.1|  BnaA08g24440D                                          120   2e-30   Brassica napus [oilseed rape]
ref|XP_009110603.1|  PREDICTED: proteasome subunit beta type-5-B        120   2e-30   Brassica rapa
ref|XP_009148547.1|  PREDICTED: proteasome subunit beta type-5-B-...    120   3e-30   Brassica rapa
ref|XP_010682823.1|  PREDICTED: proteasome subunit beta type-5          120   3e-30   Beta vulgaris subsp. vulgaris [field beet]
gb|AFK46055.1|  unknown                                                 120   3e-30   Lotus japonicus
ref|XP_008810773.1|  PREDICTED: proteasome subunit beta type-5-like     120   3e-30   Phoenix dactylifera
ref|XP_002876966.1|  hypothetical protein ARALYDRAFT_484397             120   3e-30   
gb|ABQ50544.1|  hypothetical protein                                    119   3e-30   Brassica rapa
ref|XP_006417162.1|  hypothetical protein EUTSA_v10008454mg             120   4e-30   Eutrema salsugineum [saltwater cress]
gb|ABK25785.1|  unknown                                                 119   7e-30   Picea sitchensis
dbj|BAG92607.1|  unnamed protein product                                118   7e-30   Oryza sativa Japonica Group [Japonica rice]
emb|CDY16054.1|  BnaC08g40690D                                          119   8e-30   Brassica napus [oilseed rape]
ref|XP_010502548.1|  PREDICTED: proteasome subunit beta type-5-B-...    119   8e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010425347.1|  PREDICTED: proteasome subunit beta type-5-B        119   8e-30   Camelina sativa [gold-of-pleasure]
ref|XP_009118034.1|  PREDICTED: proteasome subunit beta type-5-B-...    119   9e-30   Brassica rapa
ref|XP_010514289.1|  PREDICTED: proteasome subunit beta type-5-B-...    119   9e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010912107.1|  PREDICTED: proteasome subunit beta type-5-like     119   1e-29   Elaeis guineensis
ref|XP_002437853.1|  hypothetical protein SORBIDRAFT_10g003770          119   1e-29   Sorghum bicolor [broomcorn]
ref|XP_010540655.1|  PREDICTED: proteasome subunit beta type-5-B        119   1e-29   Tarenaya hassleriana [spider flower]
gb|EEE65108.1|  hypothetical protein OsJ_20167                          118   2e-29   Oryza sativa Japonica Group [Japonica rice]
dbj|BAA96838.1|  beta 5 subunit of 20S proteasome                       118   2e-29   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001056842.1|  Os06g0153800                                       118   2e-29   
ref|NP_189265.1|  proteasome subunit beta type-5-B                      117   3e-29   Arabidopsis thaliana [mouse-ear cress]
gb|EEC80034.1|  hypothetical protein OsI_21721                          117   4e-29   Oryza sativa Indica Group [Indian rice]
ref|XP_004964820.1|  PREDICTED: proteasome subunit beta type-5-A-...    117   4e-29   Setaria italica
sp|O24361.1|PSB5_SPIOL  RecName: Full=Proteasome subunit beta typ...    117   4e-29   Spinacia oleracea
gb|ABK25888.1|  unknown                                                 117   4e-29   Picea sitchensis
ref|XP_006655798.1|  PREDICTED: proteasome subunit beta type-5-A-...    117   6e-29   Oryza brachyantha
ref|NP_001132821.1|  uncharacterized protein LOC100194311               116   1e-28   Zea mays [maize]
ref|XP_003602092.1|  Proteasome subunit beta type                       115   2e-28   Medicago truncatula
emb|CDY26610.1|  BnaA09g46670D                                          115   2e-28   Brassica napus [oilseed rape]
gb|AFK34329.1|  unknown                                                 115   2e-28   Medicago truncatula
ref|XP_006305519.1|  hypothetical protein CARUB_v10009991mg             115   2e-28   Capsella rubella
ref|NP_172765.1|  20S proteasome beta subunit E1                        115   2e-28   Arabidopsis thaliana [mouse-ear cress]
gb|AAK92808.1|  putative proteasome epsilon chain precursor             115   2e-28   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001265983.1|  proteasome subunit beta type-5-like                114   2e-28   Cicer arietinum [garbanzo]
ref|NP_001184978.1|  20S proteasome beta subunit E1                     115   3e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002889982.1|  hypothetical protein ARALYDRAFT_471459             115   4e-28   
gb|AFW85803.1|  hypothetical protein ZEAMMB73_646691                    114   9e-28   
gb|ABE68720.1|  20S proteasome beta subunit                             112   1e-27   Arachis hypogaea [goober]
ref|XP_010476293.1|  PREDICTED: proteasome subunit beta type-5-A-...    113   2e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010494920.1|  PREDICTED: proteasome subunit beta type-5-A        113   2e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010458748.1|  PREDICTED: proteasome subunit beta type-5-A-...    113   2e-27   Camelina sativa [gold-of-pleasure]
gb|ACU51028.1|  20S proteasome beta5 subunit                            112   3e-27   Conocephalum conicum
gb|AFK38197.1|  unknown                                                 110   1e-26   Medicago truncatula
ref|XP_001759925.1|  predicted protein                                  109   5e-26   
ref|XP_002972642.1|  hypothetical protein SELMODRAFT_270977             108   8e-26   Selaginella moellendorffii
ref|XP_011029673.1|  PREDICTED: proteasome subunit beta type-5-B-...    108   9e-26   Populus euphratica
ref|XP_002312631.2|  20S proteasome beta subunit family protein         108   1e-25   
ref|XP_008791726.1|  PREDICTED: proteasome subunit beta type-5-like     107   2e-25   Phoenix dactylifera
ref|XP_002994143.1|  hypothetical protein SELMODRAFT_272351             107   3e-25   Selaginella moellendorffii
ref|XP_002315619.1|  20S proteasome beta subunit family protein         107   4e-25   Populus trichocarpa [western balsam poplar]
ref|XP_011041516.1|  PREDICTED: proteasome subunit beta type-5-B-...    106   5e-25   Populus euphratica
gb|ACJ85344.1|  unknown                                                 104   3e-24   Medicago truncatula
ref|XP_010912828.1|  PREDICTED: proteasome subunit beta type-5-like     104   3e-24   Elaeis guineensis
emb|CAC43326.1|  putative beta5 proteasome subunit                      102   4e-24   Nicotiana tabacum [American tobacco]
ref|XP_002889984.1|  predicted protein                                96.3    2e-22   
ref|XP_003061052.1|  predicted protein                                97.4    1e-21   Micromonas pusilla CCMP1545
ref|XP_007514496.1|  predicted protein                                97.1    2e-21   Bathycoccus prasinos
ref|XP_010912159.1|  PREDICTED: proteasome subunit beta type-11-like  96.3    2e-21   
ref|XP_003083185.1|  20S proteasome, regulatory subunit beta type...  96.3    4e-21   Ostreococcus tauri
ref|XP_001421201.1|  predicted protein                                94.7    1e-20   Ostreococcus lucimarinus CCE9901
ref|XP_005643539.1|  20S proteasome beta subunit E, type beta 5       93.2    4e-20   Coccomyxa subellipsoidea C-169
ref|XP_002506817.1|  predicted protein                                92.4    1e-19   Micromonas commoda
ref|XP_001751936.1|  predicted protein                                88.6    1e-18   
ref|XP_002950006.1|  hypothetical protein VOLCADRAFT_74437            87.8    4e-18   Volvox carteri f. nagariensis
gb|ADQ00176.1|  20S proteasome beta subunit E type beta 5             85.9    5e-18   Chlamydomonas sp. ICE-L
ref|XP_005851025.1|  hypothetical protein CHLNCDRAFT_56983            85.1    3e-17   Chlorella variabilis
ref|XP_001698605.1|  20S proteasome beta subunit E, type beta 5       84.7    5e-17   Chlamydomonas reinhardtii
ref|XP_011396916.1|  Proteasome subunit beta type-5-B                 79.3    4e-15   Auxenochlorella protothecoides
gb|EKC31214.1|  Proteasome subunit beta type-8                        81.6    5e-15   Crassostrea gigas
ref|XP_001568804.1|  putative proteasome beta 5 subunit               78.6    8e-15   Leishmania braziliensis MHOM/BR/75/M2904
ref|XP_010703107.1|  proteasome beta 5 subunit, putative              78.2    9e-15   Leishmania panamensis
gb|KIY94545.1|  20S proteasome subunit beta 5                         74.7    9e-15   Monoraphidium neglectum
gb|AAF37285.1|AF226674_1  20S proteasome beta 5 subunit               77.4    1e-14   Trypanosoma brucei
gb|AGG11598.1|  hypothetical protein                                  77.4    2e-14   Leptomonas pyrrhocoris
gb|AGG11403.1|  hypothetical protein                                  77.4    2e-14   Paratrypanosoma confusum
ref|XP_822850.1|  proteasome subunit beta 5                           77.0    2e-14   Trypanosoma brucei brucei TREU927
ref|XP_004333043.1|  proteasome endopeptidase subunit, putative       77.0    2e-14   Acanthamoeba castellanii str. Neff
gb|EPY20654.1|  20S proteasome subunit beta 5                         77.0    3e-14   Strigomonas culicis
ref|XP_001686739.1|  putative proteasome beta 5 subunit               76.3    5e-14   Leishmania major strain Friedlin
ref|XP_003874511.1|  putative proteasome beta 5 subunit               76.3    5e-14   Leishmania mexicana MHOM/GT/2001/U1103
ref|XP_001469755.1|  putative proteasome beta 5 subunit               76.3    5e-14   Leishmania infantum JPCM5
ref|XP_011441202.1|  PREDICTED: proteasome subunit beta type-5-like   75.9    5e-14   Crassostrea gigas
ref|XP_005825075.1|  20S proteasome subunit beta type 5               75.9    6e-14   Guillardia theta CCMP2712
emb|CCC93748.1|  proteasome beta 5 subunit                            75.9    6e-14   Trypanosoma congolense IL3000
ref|XP_006682354.1|  hypothetical protein BATDEDRAFT_14510            75.5    6e-14   Batrachochytrium dendrobatidis JAM81
ref|XP_009311762.1|  proteasome beta 5 subunit                        75.9    7e-14   Trypanosoma grayi
dbj|BAA10934.1|  LMP7                                                 75.5    7e-14   Ginglymostoma cirratum
ref|XP_009021669.1|  hypothetical protein HELRODRAFT_83371            75.1    8e-14   Helobdella robusta
ref|XP_005707411.1|  20S proteasome subunit beta 5                    75.1    1e-13   Galdieria sulphuraria
ref|XP_002063746.1|  GK15836                                          75.1    1e-13   Drosophila willistoni
ref|XP_002050049.1|  GJ21921                                          74.7    1e-13   Drosophila virilis
ref|XP_394680.3|  PREDICTED: proteasome subunit beta type-5-like      74.7    2e-13   Apis mellifera [bee]
gb|AAL59862.1|AF363583_1  proteasome beta-subunit LMP7                74.3    2e-13   Heterodontus francisci
gb|AAC97957.2|  proteasome beta 5 subunit                             74.3    2e-13   Trypanosoma cruzi
ref|XP_003394930.1|  PREDICTED: proteasome subunit beta type-5-like   74.3    2e-13   Bombus terrestris [large earth bumblebee]
ref|XP_003488646.1|  PREDICTED: proteasome subunit beta type-5-like   74.3    2e-13   Bombus impatiens
ref|XP_003694700.1|  PREDICTED: proteasome subunit beta type-5-like   73.9    2e-13   Apis florea [dwarf honeybee]
emb|CCC51553.1|  putative proteasome beta 5 subunit, fragment         74.3    2e-13   Trypanosoma vivax Y486
ref|XP_005110562.1|  PREDICTED: proteasome subunit beta type-5-like   73.6    4e-13   Aplysia californica
gb|KDD75121.1|  proteasome subunit protein                            73.2    4e-13   Helicosporidium sp. ATCC 50920
dbj|GAM19629.1|  hypothetical protein SAMD00019534_028040             73.2    4e-13   Acytostelium subglobosum LB1
ref|XP_810086.1|  proteasome beta 5 subunit                           73.6    5e-13   Trypanosoma cruzi strain CL Brener
gb|EKG04000.1|  proteasome beta 5 subunit, putative                   73.6    5e-13   Trypanosoma cruzi
gb|ESS68038.1|  proteasome beta 5 subunit                             73.6    5e-13   Trypanosoma cruzi Dm28c
ref|XP_810804.1|  proteasome beta 5 subunit                           73.6    5e-13   Trypanosoma cruzi strain CL Brener
ref|XP_004994692.1|  LMP X protein                                    73.2    5e-13   Salpingoeca rosetta
ref|XP_005994469.1|  PREDICTED: proteasome subunit beta type-5-like   72.8    5e-13   Latimeria chalumnae
gb|ESL07999.1|  proteasome beta 5 subunit                             73.6    6e-13   Trypanosoma rangeli SC58
ref|XP_001361733.1|  GA11556                                          72.8    7e-13   Drosophila pseudoobscura pseudoobscura
gb|EKF32460.1|  proteasome beta 5 subunit, putative                   73.2    7e-13   Trypanosoma cruzi marinkellei
ref|XP_004534832.1|  PREDICTED: proteasome subunit beta type-5-like   72.8    7e-13   Ceratitis capitata [medfly]
ref|XP_002678668.1|  predicted protein                                73.2    7e-13   Naegleria gruberi strain NEG-M
gb|AAI55951.1|  LOC100127332 protein                                  72.4    8e-13   Xenopus laevis [clawed frog]
dbj|BAM21000.1|  proteasome subunit beta type-8                       72.4    8e-13   Polypterus senegalus
ref|XP_001986559.1|  GH20460                                          72.4    9e-13   Drosophila grimshawi
gb|EFX81688.1|  hypothetical protein DAPPUDRAFT_303318                72.4    9e-13   Daphnia pulex
gb|EPY26658.1|  20S proteasome subunit beta 5                         72.0    1e-12   Angomonas deanei
ref|XP_007439509.1|  PREDICTED: proteasome subunit beta type-5        72.4    1e-12   Python bivittatus
ref|XP_009061521.1|  hypothetical protein LOTGIDRAFT_166223           72.0    1e-12   Lottia gigantea
gb|EPY31554.1|  20S proteasome subunit beta 5                         72.0    1e-12   Angomonas deanei
gb|EHJ72628.1|  proteasome subunit beta 5                             72.0    1e-12   
gb|AAY98499.1|  LMP X                                                 72.0    1e-12   Swiftia exserta
gb|ADL27419.1|  proteasome subunit beta type                          72.0    1e-12   Pheronema raphanus
gb|AJK90586.1|  20S proteasome beta5 subunit                          71.6    2e-12   Laodelphax striatella
ref|XP_002730946.1|  PREDICTED: proteasome subunit beta type-5-like   71.6    2e-12   Saccoglossus kowalevskii
ref|XP_011182734.1|  PREDICTED: proteasome subunit beta type-5-like   71.6    2e-12   Zeugodacus cucurbitae [melon fruit fly]
gb|ENN71488.1|  hypothetical protein YQE_11784                        71.6    2e-12   Dendroctonus ponderosae
gb|EPY36607.1|  20S proteasome subunit beta 5                         72.0    2e-12   Angomonas deanei
emb|CAA66313.1|  LMP7-like protein                                    71.2    2e-12   Botryllus schlosseri
gb|AAR09671.1|  similar to Drosophila melanogaster Prosbeta5          70.5    2e-12   Drosophila yakuba
ref|XP_011214452.1|  PREDICTED: proteasome subunit beta type-5-like   71.2    2e-12   Bactrocera dorsalis [papaya fruit fly]
dbj|BAA10933.1|  LMP7 of nurse shark                                  71.2    2e-12   Ginglymostoma cirratum
dbj|BAO50685.1|  proteasome subunit beta type 8,F-type                70.9    2e-12   Gymnothorax kidako
ref|XP_002941560.1|  PREDICTED: proteasome subunit beta type-5        71.2    2e-12   Xenopus tropicalis [western clawed frog]
ref|XP_008543771.1|  PREDICTED: proteasome subunit beta type-5        71.2    2e-12   
emb|CAA66312.1|  LMP7-like protein                                    71.2    2e-12   Geodia cydonium
ref|XP_005188727.1|  PREDICTED: proteasome subunit beta type-5        71.2    2e-12   Musca domestica
emb|CCF75037.1|  unnamed protein product                              70.9    3e-12   
emb|CEG76257.1|  Putative Proteasome subunit beta type                70.9    3e-12   Rhizopus microsporus
dbj|BAO50689.1|  proteasome subunit beta type 8,A-type                70.5    3e-12   Conger japonicus [beach conger]
ref|XP_002080955.1|  GD10758                                          71.2    3e-12   Drosophila simulans
ref|XP_002033298.1|  GM21240                                          70.9    3e-12   Drosophila sechellia
ref|XP_004347536.2|  hypothetical protein CAOG_04785                  71.2    3e-12   Capsaspora owczarzaki ATCC 30864
gb|EFA82937.1|  proteasome subunit beta type 5                        70.9    4e-12   Heterostelium album PN500
ref|XP_001867951.1|  proteasome subunit beta type 8                   70.5    4e-12   Culex quinquefasciatus
gb|EFX80663.1|  hypothetical protein DAPPUDRAFT_303852                70.5    4e-12   Daphnia pulex
ref|XP_002062691.1|  GK19557                                          71.6    4e-12   
gb|AEE61820.1|  unknown                                               70.5    4e-12   Dendroctonus ponderosae
ref|XP_011184652.1|  PREDICTED: proteasome subunit beta type-5-like   70.5    5e-12   Zeugodacus cucurbitae [melon fruit fly]
ref|XP_006619720.1|  PREDICTED: proteasome subunit beta type-5-like   70.5    5e-12   Apis dorsata [rock honeybee]
gb|EFA07659.1|  hypothetical protein TcasGA2_TC030625                 70.5    5e-12   
gb|ELT88834.1|  hypothetical protein CAPTEDRAFT_150903                70.5    5e-12   Capitella teleta
dbj|BAO50692.1|  proteasome subunit beta type 8,A-type                69.7    5e-12   Anguilla japonica
ref|XP_001745267.1|  hypothetical protein                             70.1    5e-12   Monosiga brevicollis MX1
ref|XP_006832137.1|  PREDICTED: proteasome subunit beta type-5-like   69.3    5e-12   Chrysochloris asiatica
ref|XP_011351485.1|  PREDICTED: proteasome subunit beta type-5        70.5    5e-12   Ooceraea biroi
ref|XP_970194.1|  PREDICTED: proteasome subunit beta type-5           70.5    6e-12   Tribolium castaneum [rust-red flour beetle]
gb|ETO17068.1|  hypothetical protein RFI_20264                        72.8    6e-12   Reticulomyxa filosa
ref|XP_008292170.1|  PREDICTED: proteasome subunit beta type-5        70.1    6e-12   Stegastes partitus
dbj|BAM18296.1|  proteasome beta5 subunit                             70.1    6e-12   Papilio xuthus [Chinese swallowtail]
gb|AHC95478.1|  proteasome subunit beta type-5-like protein           68.6    6e-12   Biomphalaria glabrata [bloodfluke planorb]
gb|KFH65162.1|  20S proteasome subunit beta 5                         70.1    6e-12   Mortierella verticillata NRRL 6337
ref|XP_001663403.1|  AAEL013236-PA                                    70.1    7e-12   
ref|XP_001961263.1|  GF13778                                          70.1    7e-12   Drosophila ananassae
dbj|BAO50693.1|  proteasome subunit beta type 8,F-type                69.3    8e-12   Anguilla japonica
dbj|BAO49776.1|  proteasome subunit beta type 8,A-type-A              68.9    8e-12   Anguilla japonica
ref|XP_002435468.1|  20S proteasome, regulatory subunit beta, put...  69.7    8e-12   Ixodes scapularis [blacklegged tick]
gb|AAL59861.1|AF363582_1  proteasome beta-subunit LMP7-like protein   69.7    9e-12   Heterodontus francisci
dbj|BAO50686.1|  proteasome subunit beta type 8,A-type                68.9    9e-12   Nettastoma parviceps [smallhead duckbill eel]
ref|NP_652014.1|  proteasome beta5 subunit, isoform A                 69.7    9e-12   Drosophila melanogaster
ref|XP_004934300.1|  PREDICTED: proteasome subunit beta type-5-like   67.4    9e-12   
gb|EIE77859.1|  proteasome component PRE2                             69.7    9e-12   Rhizopus delemar RA 99-880
gb|AAF26416.1|AF217726_1  20S proteasome beta5 subunit                69.7    1e-11   Drosophila melanogaster
gb|EIE87710.1|  proteasome component PRE2                             68.6    1e-11   Rhizopus delemar RA 99-880
ref|XP_011407456.1|  PREDICTED: proteasome subunit beta type-5-like   68.6    1e-11   
dbj|BAO50684.1|  proteasome subunit beta type 8,A-type                68.6    1e-11   Gymnothorax kidako
ref|XP_006835507.1|  PREDICTED: proteasome subunit beta type-5        68.9    1e-11   Chrysochloris asiatica
ref|XP_008332973.1|  PREDICTED: proteasome subunit beta type-5        68.9    2e-11   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_006001021.1|  PREDICTED: proteasome subunit beta type-8-like   68.9    2e-11   Latimeria chalumnae
ref|XP_004474611.1|  PREDICTED: proteasome subunit beta type-5        68.6    2e-11   Dasypus novemcinctus
ref|XP_007949375.1|  PREDICTED: proteasome subunit beta type-5 is...  67.8    2e-11   Orycteropus afer afer
gb|AEL23024.1|  proteasome subunit beta type 8                        66.6    2e-11   Cherax quadricarinatus [Australian red claw crayfish]
ref|XP_011254239.1|  PREDICTED: proteasome subunit beta type-5        68.9    2e-11   Camponotus floridanus
dbj|BAO50691.1|  proteasome subunit beta type 8,A-type                68.2    2e-11   Conger myriaster [conger eel]
dbj|BAO50694.1|  proteasome subunit beta type 8,F-type                68.2    2e-11   Pantodon buchholzi
dbj|BAO50690.1|  proteasome subunit beta type 8,A-type                68.2    2e-11   Conger myriaster [conger eel]
ref|XP_003388964.1|  PREDICTED: proteasome subunit beta type-5-like   68.6    2e-11   Amphimedon queenslandica
ref|XP_011502385.1|  PREDICTED: proteasome subunit beta type-5        68.2    2e-11   Ceratosolen solmsi marchali
ref|XP_001976166.1|  GG20151                                          68.6    2e-11   Drosophila erecta
pdb|3UNB|K  Chain K, Mouse Constitutive 20s Proteasome In Complex...  67.8    2e-11   Mus musculus [mouse]
ref|XP_003700810.1|  PREDICTED: proteasome subunit beta type-5-like   68.6    2e-11   Megachile rotundata
ref|NP_001017791.1|  proteasome subunit beta type 8                   68.6    2e-11   Danio rerio [leopard danio]
ref|XP_559226.2|  AGAP010718-PA                                       68.6    2e-11   Anopheles gambiae str. PEST
ref|XP_002179855.1|  predicted protein                                68.6    2e-11   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_792356.3|  PREDICTED: proteasome subunit beta type-5-like      67.8    3e-11   
ref|XP_001730616.1|  hypothetical protein MGL_2412                    68.6    3e-11   Malassezia globosa CBS 7966
gb|ACJ09226.1|  proteasome subunit beta 5                             68.6    3e-11   Helicoverpa armigera [American bollworm]
dbj|BAA08204.1|  proteasome subunit RCX                               67.8    3e-11   Rattus rattus [house rat]
dbj|BAM20999.1|  proteasome subunit beta type-8                       67.8    3e-11   Polypterus senegalus
gb|EFN77251.1|  Proteasome subunit beta type-5                        68.6    3e-11   Harpegnathos saltator
gb|KFB51802.1|  AGAP010718-PA-like protein                            68.6    3e-11   Anopheles sinensis
ref|XP_010866034.1|  PREDICTED: proteasome subunit beta type-8-like   67.4    3e-11   
ref|XP_002090364.1|  Prosbeta5                                        68.6    3e-11   Drosophila yakuba
ref|XP_011150435.1|  PREDICTED: proteasome subunit beta type-5        68.6    3e-11   Harpegnathos saltator
ref|XP_003755883.1|  PREDICTED: proteasome subunit beta type-5        68.2    3e-11   Sarcophilus harrisii
gb|ETN63828.1|  proteasome subunit beta type 5,8                      68.6    3e-11   Anopheles darlingi [American malaria mosquito]
ref|XP_001626004.1|  predicted protein                                68.2    3e-11   Nematostella vectensis
ref|XP_004922586.1|  PREDICTED: proteasome subunit beta type-5-like   68.2    3e-11   Bombyx mori [silk moth]
emb|CDQ70116.1|  unnamed protein product                              66.2    3e-11   Oncorhynchus mykiss
ref|XP_002006554.1|  GI21121                                          68.6    3e-11   Drosophila mojavensis
gb|KFM59336.1|  Proteasome subunit beta type-5                        68.2    4e-11   Stegodyphus mimosarum
gb|ACI66984.1|  Proteasome subunit beta type-8 precursor              68.2    4e-11   Salmo salar
ref|XP_011206211.1|  PREDICTED: proteasome subunit beta type-5-like   67.8    4e-11   Bactrocera dorsalis [papaya fruit fly]
ref|XP_002005785.1|  GI18886                                          68.2    4e-11   Drosophila mojavensis
gb|ABQ22703.1|  proteasome subunit beta type 5 precursor-like pro...  67.0    4e-11   Callithrix jacchus [common marmoset]
gb|EPY87607.1|  proteasome subunit beta type-5-like isoform 1         67.4    4e-11   Camelus ferus
gb|ABQ22856.1|  proteasome subunit beta type 5 precursor-like pro...  67.0    4e-11   Callithrix jacchus [common marmoset]
ref|XP_011163166.1|  PREDICTED: proteasome subunit beta type-5        68.2    4e-11   
ref|XP_004389982.1|  PREDICTED: proteasome subunit beta type-5        67.8    4e-11   
ref|XP_005377152.1|  PREDICTED: proteasome subunit beta type-5        66.6    4e-11   
ref|XP_003421032.1|  PREDICTED: proteasome subunit beta type-5        67.8    4e-11   
gb|ACN10160.1|  Proteasome subunit beta type-8 precursor              68.2    5e-11   
ref|XP_004698955.1|  PREDICTED: proteasome subunit beta type-5        67.4    5e-11   
ref|XP_002049057.1|  GJ20967                                          68.2    5e-11   
ref|XP_011060822.1|  PREDICTED: proteasome subunit beta type-5        67.8    5e-11   
gb|AAL74417.1|  proteosome PSMB5/8 protein                            67.0    5e-11   
ref|XP_004010385.1|  PREDICTED: proteasome subunit beta type-5        67.4    5e-11   
gb|KII65275.1|  Proteasome subunit beta type-8                        67.4    5e-11   
gb|AGU16243.1|  LMP7                                                  67.8    5e-11   
ref|XP_007949373.1|  PREDICTED: proteasome subunit beta type-5 is...  67.4    5e-11   
ref|XP_006066544.1|  PREDICTED: proteasome subunit beta type-5        67.4    5e-11   
ref|XP_005978061.1|  PREDICTED: proteasome subunit beta type-5 is...  67.4    5e-11   
ref|XP_001379940.1|  PREDICTED: proteasome subunit beta type-5        67.4    5e-11   
ref|XP_002426270.1|  proteasome subunit beta type 5 precursor, pu...  67.4    5e-11   
ref|NP_001032701.1|  proteasome subunit beta type-5                   67.4    5e-11   
gb|ELR56586.1|  Proteasome subunit beta type-5                        67.4    5e-11   
ref|XP_004694702.1|  PREDICTED: proteasome subunit beta type-5 is...  67.0    5e-11   
ref|XP_007100518.1|  PREDICTED: proteasome subunit beta type-5 is...  66.6    6e-11   
gb|ESA00717.1|  hypothetical protein GLOINDRAFT_338395                67.8    6e-11   
dbj|BAO50697.1|  proteasome subunit beta type 8,F-type                66.6    6e-11   
ref|XP_007882652.1|  PREDICTED: proteasome subunit beta type-8-like   67.4    6e-11   
emb|CAX70715.1|  proteasome (prosome, macropain) subunit, beta ty...  65.1    6e-11   
ref|XP_006883201.1|  PREDICTED: proteasome subunit beta type-5        67.0    7e-11   
ref|XP_006988553.1|  PREDICTED: proteasome subunit beta type-5        67.0    7e-11   
ref|XP_006751981.1|  PREDICTED: proteasome subunit beta type-5-like   65.5    7e-11   
pdb|1IRU|L  Chain L, Crystal Structure Of The Mammalian 20s Prote...  66.6    7e-11   
ref|NP_001124197.1|  proteasome subunit beta type-5 isoform 2         66.2    7e-11   
ref|XP_004054986.1|  PREDICTED: proteasome subunit beta type-5 is...  66.2    7e-11   
ref|XP_008267580.1|  PREDICTED: proteasome subunit beta type-5 is...  66.2    7e-11   
pdb|4R3O|L  Chain L, Human Constitutive 20s Proteasome                66.6    7e-11   
gb|AAV98549.1|  proteasome subunit beta type 5                        65.1    7e-11   
ref|NP_001099197.2|  proteasome subunit beta type-5                   67.0    7e-11   
ref|XP_008121563.1|  PREDICTED: proteasome subunit beta type-5        67.0    7e-11   
gb|AAM18885.1|AF391293_2  unknown                                     67.0    7e-11   
dbj|BAO50687.1|  proteasome subunit beta type 8,F-type                66.6    8e-11   
dbj|BAM20998.1|  proteasome subunit beta type-8                       66.6    8e-11   
sp|P28075.3|PSB5_RAT  RecName: Full=Proteasome subunit beta type-...  67.0    8e-11   
gb|EDL36338.1|  mCG8712, isoform CRA_a                                66.2    8e-11   
ref|NP_001158688.1|  Proteasome subunit beta type 8                   67.0    8e-11   
gb|AAP36588.1|  Homo sapiens proteasome (prosome, macropain) subu...  66.2    8e-11   
dbj|BAA06097.1|  proteasome subunit X                                 66.2    8e-11   
gb|ACO07495.1|  Proteasome subunit beta type 8 precursor              67.0    8e-11   
dbj|BAC40307.1|  unnamed protein product                              66.2    8e-11   
ref|NP_035316.1|  proteasome subunit beta type-5                      67.0    8e-11   
ref|XP_003287743.1|  proteasome subunit beta type 5                   67.0    9e-11   
gb|AAH12246.1|  Proteasome (prosome, macropain) subunit, beta type 5  66.6    9e-11   
dbj|BAB26942.1|  unnamed protein product                              66.6    9e-11   
emb|CDX83281.1|  BnaA03g22250D                                        65.5    9e-11   
gb|KFH71396.1|  20S proteasome subunit beta 5                         67.0    9e-11   
ref|XP_002753673.3|  PREDICTED: proteasome subunit beta type-5        66.6    1e-10   
ref|XP_004421295.1|  PREDICTED: proteasome subunit beta type-5        66.6    1e-10   
ref|XP_001459945.1|  hypothetical protein                             66.2    1e-10   
ref|XP_006438071.1|  hypothetical protein CICLE_v10032238mg           66.6    1e-10   
ref|XP_006217298.1|  PREDICTED: proteasome subunit beta type-5        66.6    1e-10   
ref|XP_006175925.1|  PREDICTED: proteasome subunit beta type-5        66.6    1e-10   
gb|AAB33092.1|  proteasome subunit MB1                                65.9    1e-10   
ref|XP_003924370.1|  PREDICTED: proteasome subunit beta type-5        66.6    1e-10   
emb|CDH56820.1|  20s proteasome subunit                               66.6    1e-10   
ref|XP_006036581.1|  PREDICTED: proteasome subunit beta type-5        66.2    1e-10   
ref|XP_001995254.1|  GH23050                                          67.0    1e-10   
gb|AGM32352.1|  proteasome subunit beta type-5-like protein           66.6    1e-10   
ref|XP_003474544.1|  PREDICTED: proteasome subunit beta type-5        66.2    1e-10   
ref|XP_004694701.1|  PREDICTED: proteasome subunit beta type-5 is...  66.2    1e-10   
ref|XP_004519324.1|  PREDICTED: proteasome subunit beta type-5-like   66.2    1e-10   
ref|XP_007258118.1|  PREDICTED: proteasome subunit beta type-5-li...  66.2    1e-10   
emb|CDJ63505.1|  proteasome subunit beta type 5, putative             64.7    1e-10   
emb|CCW60032.1|  unnamed protein product                              67.0    1e-10   
ref|XP_005933706.1|  PREDICTED: proteasome subunit beta type-5-like   66.2    1e-10   
ref|XP_005882305.1|  PREDICTED: proteasome subunit beta type-5        66.2    1e-10   
ref|XP_006100131.1|  PREDICTED: proteasome subunit beta type-5        66.2    2e-10   
ref|XP_005875924.1|  PREDICTED: proteasome subunit beta type-5-like   66.2    2e-10   
ref|XP_005740284.1|  PREDICTED: proteasome subunit beta type-5-like   66.2    2e-10   
ref|XP_006438070.1|  hypothetical protein CICLE_v10032238mg           66.6    2e-10   
emb|CAF97719.1|  unnamed protein product                              66.2    2e-10   
ref|XP_008156742.1|  PREDICTED: proteasome subunit beta type-5 is...  65.9    2e-10   
ref|XP_003457456.2|  PREDICTED: proteasome subunit beta type-5-like   66.2    2e-10   
ref|XP_007449602.1|  PREDICTED: proteasome subunit beta type-5 is...  65.9    2e-10   
ref|XP_007100517.1|  PREDICTED: proteasome subunit beta type-5 is...  65.9    2e-10   
ref|XP_003987515.1|  PREDICTED: proteasome subunit beta type-5        65.9    2e-10   
ref|XP_002926051.1|  PREDICTED: proteasome subunit beta type-5        65.9    2e-10   
ref|XP_004402154.1|  PREDICTED: proteasome subunit beta type-5        65.9    2e-10   
ref|XP_007180616.1|  PREDICTED: proteasome subunit beta type-5        65.9    2e-10   
ref|XP_005338834.1|  PREDICTED: proteasome subunit beta type-5        65.5    2e-10   
ref|XP_006484069.1|  PREDICTED: proteasome subunit beta type-5-B-...  66.6    2e-10   
ref|XP_004565403.1|  PREDICTED: proteasome subunit beta type-5-like   66.2    2e-10   
ref|XP_006776843.1|  PREDICTED: proteasome subunit beta type-5        65.9    2e-10   
ref|XP_004283228.1|  PREDICTED: proteasome subunit beta type-5 is...  65.9    2e-10   
ref|XP_004879937.1|  PREDICTED: proteasome subunit beta type-5        65.9    2e-10   
ref|XP_010636092.1|  PREDICTED: proteasome subunit beta type-5        65.9    2e-10   
emb|CDJ38252.1|  proteasome subunit beta type 5, putative             65.5    2e-10   
ref|XP_628966.1|  proteasome subunit beta type 5                      65.9    2e-10   
ref|XP_006144566.1|  PREDICTED: proteasome subunit beta type-5        65.9    2e-10   
gb|AAW24786.1|  SJCHGC05978 protein                                   65.9    2e-10   
emb|CEP17612.1|  hypothetical protein                                 65.9    2e-10   
ref|XP_008564788.1|  PREDICTED: proteasome subunit beta type-5        65.9    2e-10   
ref|XP_006913661.1|  PREDICTED: proteasome subunit beta type-5        65.9    2e-10   
ref|XP_008527207.1|  PREDICTED: proteasome subunit beta type-5        65.9    2e-10   
ref|XP_001494538.2|  PREDICTED: proteasome subunit beta type-5 is...  65.9    2e-10   
ref|XP_008708757.1|  PREDICTED: proteasome subunit beta type-5        65.5    2e-10   
ref|XP_003639276.1|  PREDICTED: proteasome subunit beta type-5        65.5    2e-10   
ref|XP_004313402.1|  PREDICTED: proteasome subunit beta type-5 is...  65.1    2e-10   
emb|CDJ01199.1|  proteasome (prosome, macropain)                      65.9    2e-10   
emb|CAD97956.1|  hypothetical protein                                 65.5    2e-10   
dbj|BAE93066.1|  low molecular mass polypeptide                       65.1    2e-10   
gb|KDN39743.1|  putative PRE2-20S core proteasome subunit             66.2    2e-10   
ref|XP_002718121.1|  PREDICTED: proteasome subunit beta type-5 is...  65.5    2e-10   
ref|NP_002788.1|  proteasome subunit beta type-5 isoform 1            65.5    2e-10   
ref|XP_004054980.1|  PREDICTED: proteasome subunit beta type-5 is...  65.5    2e-10   
ref|XP_003260670.1|  PREDICTED: proteasome subunit beta type-5 is...  65.5    2e-10   
ref|XP_001614425.1|  20S proteasome beta subunit                      65.9    2e-10   
ref|XP_010376681.1|  PREDICTED: proteasome subunit beta type-5        65.5    3e-10   
ref|XP_006802789.1|  PREDICTED: proteasome subunit beta type-5-like   65.9    3e-10   
ref|XP_008065987.1|  PREDICTED: proteasome subunit beta type-5        65.5    3e-10   
ref|XP_004054982.1|  PREDICTED: proteasome subunit beta type-5 is...  65.5    3e-10   
ref|NP_001270574.1|  uncharacterized protein LOC101865806             65.5    3e-10   
ref|NP_001247774.1|  proteasome subunit beta type-5                   65.5    3e-10   
ref|XP_007989004.1|  PREDICTED: proteasome subunit beta type-5 is...  65.5    3e-10   
ref|XP_004646709.1|  PREDICTED: proteasome subunit beta type-5        65.5    3e-10   
ref|XP_006261242.1|  PREDICTED: proteasome subunit beta type-5        65.5    3e-10   
ref|XP_004054985.1|  PREDICTED: proteasome subunit beta type-5 is...  65.5    3e-10   
gb|EPQ17641.1|  Proteasome subunit beta type-5                        66.6    3e-10   
ref|XP_001445995.1|  hypothetical protein                             64.7    3e-10   
ref|XP_001924480.2|  PREDICTED: proteasome subunit beta type-5        65.5    3e-10   
ref|XP_003977752.1|  PREDICTED: proteasome subunit beta type-5-like   65.1    3e-10   
ref|XP_003506173.1|  PREDICTED: proteasome subunit beta type-5        65.1    4e-10   
dbj|BAH05039.1|  proteasome subunit, beta type 8                      64.7    4e-10   
ref|XP_005370537.1|  PREDICTED: proteasome subunit beta type-5        65.1    4e-10   
ref|XP_002111558.1|  hypothetical protein TRIADDRAFT_55706            65.1    4e-10   
dbj|BAO50688.1|  proteasome subunit beta type 8,F-type                64.3    4e-10   
gb|KDO81951.1|  hypothetical protein CISIN_1g022125mg                 65.5    4e-10   
ref|XP_004267811.1|  PREDICTED: proteasome subunit beta type-8        65.1    5e-10   
ref|XP_002040051.1|  GM15565                                          65.5    5e-10   
ref|XP_004584741.1|  PREDICTED: proteasome subunit beta type-5        64.7    5e-10   
ref|XP_010744420.1|  PREDICTED: proteasome subunit beta type-5        65.1    5e-10   
ref|NP_611776.1|  proteasome beta5 subunit-related 1                  65.5    5e-10   
gb|AAL68121.1|  AT21741p                                              65.5    5e-10   
gb|ETE64662.1|  Proteasome subunit beta type-5                        65.1    5e-10   
dbj|BAA10935.1|  nurse shark LMPX                                     64.7    5e-10   
ref|XP_004755396.1|  PREDICTED: proteasome subunit beta type-5 is...  63.9    5e-10   
ref|XP_004030248.1|  proteasome subunit beta type, putative           65.1    5e-10   
ref|XP_005951627.1|  PREDICTED: proteasome subunit beta type-8-like   64.7    5e-10   
ref|XP_005947330.1|  PREDICTED: proteasome subunit beta type-8-like   64.7    5e-10   
dbj|BAO00930.1|  proteasome subunit beta type 8,A-type                64.7    5e-10   
ref|XP_006794522.1|  PREDICTED: proteasome subunit beta type-8-like   64.7    5e-10   
dbj|BAJ51756.1|  proteasome subunit, beta type 8                      64.7    6e-10   
ref|XP_011309100.1|  PREDICTED: proteasome subunit beta type-5        64.7    6e-10   
gb|ACO15462.1|  Proteasome subunit beta type-5 precursor              64.7    6e-10   
ref|XP_002258752.1|  20S proteasome beta subunit                      64.7    6e-10   
ref|XP_008421020.1|  PREDICTED: proteasome subunit beta type-8-like   64.7    6e-10   
ref|XP_008815980.1|  20S proteasome subunit beta 5                    64.7    6e-10   
gb|ETW36451.1|  hypothetical protein PFTANZ_02851                     64.3    6e-10   
ref|XP_004358358.1|  proteasome subunit beta type 5                   65.1    6e-10   
dbj|BAA10932.1|  LMPX of lamprey                                      64.7    6e-10   
ref|XP_001347396.1|  20S proteasome beta subunit, putative            64.7    6e-10   
gb|ETB58178.1|  hypothetical protein YYC_04244                        64.3    6e-10   
ref|XP_004661842.1|  PREDICTED: proteasome subunit beta type-5        64.3    6e-10   
emb|CDQ70111.1|  unnamed protein product                              62.8    7e-10   
ref|XP_004313401.1|  PREDICTED: proteasome subunit beta type-5 is...  64.3    7e-10   
emb|CAX70714.1|  proteasome (prosome, macropain) subunit, beta ty...  64.3    7e-10   
ref|XP_001960331.1|  GF13303                                          65.1    7e-10   
ref|XP_005978060.1|  PREDICTED: proteasome subunit beta type-5 is...  64.3    7e-10   
dbj|BAO50695.1|  proteasome subunit beta type 8,A-type                63.5    7e-10   
emb|CCW66993.1|  unnamed protein product                              65.1    7e-10   
ref|XP_005951629.1|  PREDICTED: proteasome subunit beta type-8-li...  63.2    7e-10   
gb|ADO27969.1|  proteasome subunit beta type-5                        64.3    7e-10   
ref|XP_007536740.1|  PREDICTED: proteasome subunit beta type-5        64.3    7e-10   
emb|CAA40494.1|  proteasome C1 subunit                                63.5    7e-10   
ref|XP_001428075.1|  hypothetical protein                             64.3    7e-10   
ref|XP_004221998.1|  20S proteasome beta subunit                      64.3    7e-10   
ref|XP_727486.1|  proteosome PSMB5/8 protein                          64.7    8e-10   
dbj|BAA19767.1|  LMP7                                                 63.5    8e-10   
gb|EWM22648.1|  proteasome subunit beta type 5                        64.3    8e-10   
gb|ERE89366.1|  proteasome subunit beta type-5-like protein           64.7    8e-10   
dbj|BAH05038.1|  proteasome subunit, beta type 8                      63.9    8e-10   
gb|EDL34145.1|  mCG7455                                               62.8    8e-10   
ref|XP_002092584.1|  GE11586                                          64.7    9e-10   
ref|XP_005142720.1|  PREDICTED: proteasome subunit beta type-5-like   63.9    9e-10   
ref|XP_002514943.1|  proteasome subunit beta type 5,8, putative       63.5    1e-09   
ref|XP_005951628.1|  PREDICTED: proteasome subunit beta type-8-li...  63.2    1e-09   
gb|EPZ32630.1|  Proteasome, beta-type subunit domain-containing p...  63.2    1e-09   
gb|ACO11122.1|  Proteasome subunit beta type-5 precursor              63.9    1e-09   
ref|NP_001264655.1|  proteasome subunit beta type-5                   63.5    1e-09   
sp|P34065.2|PSB5_CHICK  RecName: Full=Proteasome subunit beta typ...  63.5    1e-09   
ref|XP_001015486.2|  proteasome, putative                             64.3    1e-09   
dbj|BAO49777.1|  proteasome subunit beta type 8,A-type-V              62.8    1e-09   
ref|XP_008838115.1|  PREDICTED: proteasome subunit beta type-5        63.5    1e-09   
dbj|BAD93264.1|  PSMB8-A                                              63.9    1e-09   
gb|KGB40340.1|  Proteasome subunit beta type-5                        63.2    1e-09   
dbj|BAJ51776.1|  proteasome subunit, beta type 8                      63.2    1e-09   
ref|XP_734786.1|  20S proteasome beta subunit                         62.8    1e-09   
ref|XP_010781265.1|  PREDICTED: proteasome subunit beta type-5        63.5    1e-09   
emb|CDS18151.1|  proteasome prosome macropain                         63.5    1e-09   
gb|AAH66288.1|  Proteasome (prosome, macropain) subunit, beta typ...  63.5    1e-09   
ref|NP_571467.3|  proteasome subunit beta type-8                      63.5    1e-09   
gb|EUB57790.1|  Proteasome subunit beta type-5                        63.9    1e-09   
ref|XP_003801967.1|  PREDICTED: proteasome subunit beta type-5        63.5    1e-09   
gb|ACO09253.1|  Proteasome subunit beta type 5 precursor              62.8    1e-09   
dbj|BAO00926.1|  proteasome subunit beta type 8,A-type                62.8    1e-09   
ref|XP_010866810.1|  PREDICTED: proteasome subunit beta type-8-like   63.5    1e-09   
ref|XP_008623340.1|  20S proteasome subunit beta 5                    63.5    1e-09   
ref|XP_007957196.1|  PREDICTED: proteasome subunit beta type-8        63.5    2e-09   
ref|XP_007107938.1|  PREDICTED: proteasome subunit beta type-8        63.5    2e-09   
ref|XP_001976373.1|  GG20051                                          64.7    2e-09   
ref|XP_004755394.1|  PREDICTED: proteasome subunit beta type-5 is...  63.2    2e-09   
gb|KDR22252.1|  Proteasome subunit beta type-5                        63.5    2e-09   
dbj|BAO00924.1|  proteasome subunit beta type 8,A-type                62.8    2e-09   
emb|CDR14546.1|  proteasome subunit beta type-5, putative             63.5    2e-09   
ref|XP_010866033.1|  PREDICTED: proteasome subunit beta type-8-like   63.5    2e-09   
gb|ABQ01989.1|  proteasome subunit beta type 8                        63.2    2e-09   
gb|KFG64840.1|  putative proteasome subunit beta type                 62.4    2e-09   
dbj|BAD89554.1|  proteasome subunit                                   63.2    2e-09   
ref|NP_001117007.1|  proteasome subunit beta type 7b                  63.2    2e-09   
ref|XP_005808237.1|  PREDICTED: proteasome subunit beta type-8-like   63.2    2e-09   
ref|XP_008470711.1|  PREDICTED: proteasome subunit beta type-5        63.5    2e-09   
gb|AAG43439.1|AF184937_1  low molecular mass protein 7                63.2    2e-09   
ref|XP_006809571.1|  PREDICTED: proteasome subunit beta type-8-like   63.2    2e-09   
ref|NP_001119673.1|  20S proteasome beta5 subunit                     63.2    2e-09   
emb|CAN13318.1|  proteasome (prosome, macropain) subunit, beta ty...  62.4    2e-09   



>ref|XP_009596640.1| PREDICTED: proteasome subunit beta type-5-like [Nicotiana tomentosiformis]
Length=273

 Score =   140 bits (354),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 66/78 (85%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            DNGYR+DLSVEEAAELARR+IYHATFRDG  GGVASVYH GPNGWK LSGDDVGELHY  
Sbjct  196  DNGYRYDLSVEEAAELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYNY  255

Query  197  YPVEAAAVEHEMTEVPIA  144
            YPVE AAVE EM EVP+A
Sbjct  256  YPVEVAAVEQEMAEVPVA  273



>ref|XP_004239661.1| PREDICTED: proteasome subunit beta type-5 [Solanum lycopersicum]
 ref|XP_010321315.1| PREDICTED: proteasome subunit beta type-5 [Solanum lycopersicum]
Length=273

 Score =   140 bits (352),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/78 (85%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            DNGYR+DLSVEEAAELARR+IYHATFRDG  GGVASVYH GPNGWK LSGDDVGELHY  
Sbjct  196  DNGYRYDLSVEEAAELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  255

Query  197  YPVEAAAVEHEMTEVPIA  144
            YPVE AAVE EM EVP+A
Sbjct  256  YPVEVAAVEQEMAEVPVA  273



>ref|XP_006345787.1| PREDICTED: proteasome subunit beta type-5-like [Solanum tuberosum]
Length=273

 Score =   140 bits (352),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/78 (85%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            DNGYR+DLSVEEAAELARR+IYHATFRDG  GGVASVYH GPNGWK LSGDDVGELHY  
Sbjct  196  DNGYRYDLSVEEAAELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  255

Query  197  YPVEAAAVEHEMTEVPIA  144
            YPVE AAVE EM EVP+A
Sbjct  256  YPVEVAAVEQEMAEVPVA  273



>ref|XP_011071212.1| PREDICTED: proteasome subunit beta type-5-like [Sesamum indicum]
Length=287

 Score =   140 bits (352),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/78 (86%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            DNGYRFDLSVEEAAELARR+IYHATFRDG  GGVASVYH GPNGWK LSGDDVGELHY  
Sbjct  196  DNGYRFDLSVEEAAELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYKY  255

Query  197  YPVEAAAVEHEMTEVPIA  144
            YPVE  AVE EMTEV IA
Sbjct  256  YPVEPTAVEQEMTEVSIA  273



>ref|XP_009783836.1| PREDICTED: proteasome subunit beta type-5-like [Nicotiana sylvestris]
 ref|XP_009783895.1| PREDICTED: proteasome subunit beta type-5-like [Nicotiana sylvestris]
Length=273

 Score =   139 bits (351),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 69/78 (88%), Gaps = 0/78 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            DNGYR+DLSV+EAAELARR+IYHATFRDG  GGVASVYH GPNGWK LSGDDVGELHY  
Sbjct  196  DNGYRYDLSVKEAAELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYNY  255

Query  197  YPVEAAAVEHEMTEVPIA  144
            YPVE AAVE EM EVP+A
Sbjct  256  YPVEVAAVEQEMAEVPVA  273



>ref|XP_009780639.1| PREDICTED: proteasome subunit beta type-5-like [Nicotiana sylvestris]
Length=273

 Score =   137 bits (344),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/78 (82%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GYRFDLSVEEAAELARR+IYHATFRDG  GGVASVYH GPNGWK LSGDDVGELHY  
Sbjct  196  DSGYRFDLSVEEAAELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYNY  255

Query  197  YPVEAAAVEHEMTEVPIA  144
            YPVE  +VE EM EVP+A
Sbjct  256  YPVELESVEQEMAEVPVA  273



>ref|XP_009619742.1| PREDICTED: proteasome subunit beta type-5-like [Nicotiana tomentosiformis]
Length=273

 Score =   137 bits (344),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/78 (82%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GYRFDLSVEEAAELARR+IYHATFRDG  GGVASVYH GPNGWK LSGDDVGELHY  
Sbjct  196  DSGYRFDLSVEEAAELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYNY  255

Query  197  YPVEAAAVEHEMTEVPIA  144
            YPVE  +VE EM EVP+A
Sbjct  256  YPVELESVEQEMAEVPVA  273



>gb|EYU42103.1| hypothetical protein MIMGU_mgv1a011714mg [Erythranthe guttata]
Length=273

 Score =   136 bits (343),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GYRFDLSVEEAAELARR+IYHATFRDG  GGVASVYH GPNGW+ LSGDDVGELHY  
Sbjct  196  DSGYRFDLSVEEAAELARRAIYHATFRDGASGGVASVYHVGPNGWEKLSGDDVGELHYKY  255

Query  197  YPVEAAAVEHEMTEVPIA  144
            YPVE A VE EMTEV IA
Sbjct  256  YPVETAVVEQEMTEVAIA  273



>ref|XP_006363770.1| PREDICTED: proteasome subunit beta type-5-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006363771.1| PREDICTED: proteasome subunit beta type-5-like isoform X2 [Solanum 
tuberosum]
Length=273

 Score =   134 bits (337),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/78 (82%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            DNGYR DLSVEEAAELARR+IYHATFRDG  GGVASVYH GPNGWK LSGDDVGELHY  
Sbjct  196  DNGYRNDLSVEEAAELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  255

Query  197  YPVEAAAVEHEMTEVPIA  144
            YP+E AAVE EM EV +A
Sbjct  256  YPIEVAAVEQEMAEVSVA  273



>gb|EPS61043.1| hypothetical protein M569_13757, partial [Genlisea aurea]
Length=274

 Score =   132 bits (333),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+G+RFDLSVEEAAELARR+IYHATFRDG  GGVASVYH GPNGWK LSGDDVGELHY  
Sbjct  197  DSGHRFDLSVEEAAELARRAIYHATFRDGASGGVASVYHIGPNGWKKLSGDDVGELHYLY  256

Query  197  YPVEAAAVEHEMTEVPIA  144
            YPVE A VE EM+EV I+
Sbjct  257  YPVEPATVEREMSEVAIS  274



>ref|XP_004144192.1| PREDICTED: proteasome subunit beta type-5-like [Cucumis sativus]
 ref|XP_004171974.1| PREDICTED: proteasome subunit beta type-5-like [Cucumis sativus]
 gb|KGN47623.1| hypothetical protein Csa_6G365720 [Cucumis sativus]
Length=272

 Score =   130 bits (326),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            DNGYR+DLSVEEAAELARR+IYHATFRDG  GGVASVY+ GPNGWK LSGDDVGELHY  
Sbjct  195  DNGYRYDLSVEEAAELARRAIYHATFRDGASGGVASVYYVGPNGWKKLSGDDVGELHYNY  254

Query  197  YPVEAAAVEHEMTEVPIA  144
            YPV    V+ EMTEV  A
Sbjct  255  YPVTPTTVDQEMTEVTAA  272



>ref|XP_008445492.1| PREDICTED: proteasome subunit beta type-5 [Cucumis melo]
Length=272

 Score =   130 bits (326),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            DNGYR+DLSVEEAAELARR+IYHATFRDG  GGVASVY+ GPNGWK LSGDDVGELHY  
Sbjct  195  DNGYRYDLSVEEAAELARRAIYHATFRDGASGGVASVYYVGPNGWKKLSGDDVGELHYNY  254

Query  197  YPVEAAAVEHEMTEVPIA  144
            YPV    V+ EMTEV  A
Sbjct  255  YPVTPTTVDQEMTEVTAA  272



>ref|XP_009376552.1| PREDICTED: proteasome subunit beta type-5-like [Pyrus x bretschneideri]
Length=270

 Score =   129 bits (325),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 61/75 (81%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            DNGYR+D+SVEEAAELARR+IYHATFRDG  GGVASVYH GPNGWK LSGDDVGELHY  
Sbjct  196  DNGYRYDMSVEEAAELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  255

Query  197  YPVEAAAVEHEMTEV  153
            YPV A +VE EM EV
Sbjct  256  YPVVAGSVEQEMVEV  270



>ref|XP_008222076.1| PREDICTED: proteasome subunit beta type-5 [Prunus mume]
Length=272

 Score =   129 bits (325),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/75 (81%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            DNGYR+D+SVEEAAELARR+IYHATFRDG  GGVASVYH GPNGWK LSGDDVGELHY  
Sbjct  195  DNGYRYDMSVEEAAELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  254

Query  197  YPVEAAAVEHEMTEV  153
            YPV   AVE EM EV
Sbjct  255  YPVVQGAVEQEMVEV  269



>gb|AAL26914.1|AF323592_1 putative 20S proteasome beta subunit 5, partial [Prunus persica]
Length=201

 Score =   127 bits (319),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GYR+D+SVEEAAELARR+IYHATFRDG  GGVASVYH GPNGWK LSGDDVGELHY  
Sbjct  124  DDGYRYDMSVEEAAELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  183

Query  197  YPVEAAAVEHEMTEVPIA  144
            YPV   AVE EM EV  A
Sbjct  184  YPVVEGAVEQEMVEVAAA  201



>ref|XP_002264828.1| PREDICTED: proteasome subunit beta type-5 [Vitis vinifera]
 ref|XP_010655500.1| PREDICTED: proteasome subunit beta type-5 [Vitis vinifera]
 emb|CBI27591.3| unnamed protein product [Vitis vinifera]
Length=272

 Score =   129 bits (323),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            DNGYR+D+SVEEAAELARRSIYHATFRDG  GGVASVY+ GPNGWK LSGDDVGELHY  
Sbjct  195  DNGYRYDMSVEEAAELARRSIYHATFRDGASGGVASVYYVGPNGWKKLSGDDVGELHYKY  254

Query  197  YPVEAAAVEHEMTEV  153
            YPV  + VE EM EV
Sbjct  255  YPVMPSTVEQEMVEV  269



>ref|XP_008446052.1| PREDICTED: proteasome subunit beta type-5-like isoform X1 [Cucumis 
melo]
Length=145

 Score =   125 bits (313),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 71/92 (77%), Gaps = 1/92 (1%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            DNGY++DLSVEEAAELARR+IYHATFRDG  GGVASVYH GPNGWK LSGDDVGELHY  
Sbjct  43   DNGYQYDLSVEEAAELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYKY  102

Query  197  YPVEAAAVEHEMTEVPIA*TDPFLE-NKSVCS  105
            YPV    VE EM EV     + ++  + SVC+
Sbjct  103  YPVVLDTVEQEMVEVSGVVFNKWISVSGSVCA  134



>ref|XP_008446054.1| PREDICTED: proteasome subunit beta type-5-like isoform X2 [Cucumis 
melo]
Length=143

 Score =   125 bits (313),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/91 (69%), Positives = 70/91 (77%), Gaps = 1/91 (1%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            DNGY++DLSVEEAAELARR+IYHATFRDG  GGVASVYH GPNGWK LSGDDVGELHY  
Sbjct  43   DNGYQYDLSVEEAAELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYKY  102

Query  197  YPVEAAAVEHEMTEVPIA*TDPFLENKSVCS  105
            YPV    VE EM EV     + ++   SVC+
Sbjct  103  YPVVLDTVEQEMVEVSGVVFNKWISG-SVCA  132



>ref|XP_007222598.1| hypothetical protein PRUPE_ppa009896mg [Prunus persica]
 gb|EMJ23797.1| hypothetical protein PRUPE_ppa009896mg [Prunus persica]
Length=272

 Score =   127 bits (320),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GYR+D+SVEEAAELARR+IYHATFRDG  GGVASVYH GPNGWK LSGDDVGELHY  
Sbjct  195  DDGYRYDMSVEEAAELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  254

Query  197  YPVEAAAVEHEMTEVPIA  144
            YPV   AVE EM EV  A
Sbjct  255  YPVVEGAVEQEMVEVAAA  272



>ref|XP_009416647.1| PREDICTED: proteasome subunit beta type-5-like [Musa acuminata 
subsp. malaccensis]
Length=273

 Score =   127 bits (319),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GYRFD+ VEEAAELARR+IYHATFRDG  GGVASVYH GP+GWK LSGDDVGELHY  
Sbjct  196  DSGYRFDMPVEEAAELARRAIYHATFRDGASGGVASVYHVGPDGWKKLSGDDVGELHYKY  255

Query  197  YPVEAAAVEHEMTEVPIA  144
            YPV    VE EMT+ P A
Sbjct  256  YPVAPTPVEQEMTDAPAA  273



>gb|KHG05622.1| Proteasome subunit beta type-5 [Gossypium arboreum]
Length=272

 Score =   127 bits (319),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            DNGYR+D+SVEEAAELARR+IYHATFRDG  GGVASVY+ GPNGWK LSGDDVGELHY  
Sbjct  195  DNGYRYDMSVEEAAELARRAIYHATFRDGASGGVASVYYVGPNGWKKLSGDDVGELHYKY  254

Query  197  YPVEAAAVEHEMTEV  153
            YPV  + VE EM EV
Sbjct  255  YPVMPSTVEQEMVEV  269



>ref|XP_004135309.1| PREDICTED: proteasome subunit beta type-5-like [Cucumis sativus]
 ref|XP_004159677.1| PREDICTED: proteasome subunit beta type-5-like [Cucumis sativus]
Length=272

 Score =   127 bits (319),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            DNGY++DLSVEEAAELARR+IYHATFRDG  GGVASVYH GPNGWK LSGDDVGELHY  
Sbjct  196  DNGYQYDLSVEEAAELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYKY  255

Query  197  YPVEAAAVEHEMTEVPI  147
            YPV    VE EM EV +
Sbjct  256  YPVVHDTVEQEMIEVTV  272



>ref|XP_007045043.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein isoform 1 [Theobroma cacao]
 ref|XP_007045044.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY00875.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY00876.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily 
protein isoform 1 [Theobroma cacao]
Length=272

 Score =   127 bits (319),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GYR+D+SVEEAAELARR+IYHATFRDG  GGVASVYH GPNGWK LSGDDVGELHY  
Sbjct  195  DSGYRYDMSVEEAAELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYKY  254

Query  197  YPVEAAAVEHEMTEV  153
            YPV  + VE EM EV
Sbjct  255  YPVMPSTVEQEMVEV  269



>ref|XP_011457464.1| PREDICTED: proteasome subunit beta type-5-like [Fragaria vesca 
subsp. vesca]
Length=277

 Score =   127 bits (319),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 60/78 (77%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            DNGYR+D+SVEEA+ELARR+IYHATFRDG  GGVASVYH GPNGWK LSGDDVGELHY  
Sbjct  200  DNGYRYDMSVEEASELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYEY  259

Query  197  YPVEAAAVEHEMTEVPIA  144
            YPV    VE EM EV  A
Sbjct  260  YPVTPETVEQEMVEVGAA  277



>ref|XP_010251768.1| PREDICTED: proteasome subunit beta type-5-like [Nelumbo nucifera]
Length=272

 Score =   127 bits (319),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            DNGYR+D+SVEEAAELARR+IYHATFRDG  GGVASVY+ GPNGWK LSGDDVGELH+  
Sbjct  195  DNGYRYDMSVEEAAELARRAIYHATFRDGASGGVASVYYVGPNGWKKLSGDDVGELHFKY  254

Query  197  YPVEAAAVEHEMTEV  153
            YPV    VE EM+EV
Sbjct  255  YPVTPGTVEQEMSEV  269



>gb|KJB15718.1| hypothetical protein B456_002G192400 [Gossypium raimondii]
 gb|KJB15719.1| hypothetical protein B456_002G192400 [Gossypium raimondii]
 gb|KJB15720.1| hypothetical protein B456_002G192400 [Gossypium raimondii]
Length=272

 Score =   127 bits (319),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            DNGYR+D+SVEEAAELARR+IYHATFRDG  GGVASVY+ GPNGWK LSGDDVGELHY  
Sbjct  195  DNGYRYDMSVEEAAELARRAIYHATFRDGASGGVASVYYVGPNGWKKLSGDDVGELHYKY  254

Query  197  YPVEAAAVEHEMTEV  153
            YPV  + VE EM EV
Sbjct  255  YPVMPSTVEQEMVEV  269



>gb|KJB78067.1| hypothetical protein B456_012G175200 [Gossypium raimondii]
Length=272

 Score =   127 bits (318),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            DNGYR+D+SVEEAAELARR+IYHATFRDG  GGVASVY+ GPNGWK LSGDDVGELHY  
Sbjct  195  DNGYRYDMSVEEAAELARRAIYHATFRDGASGGVASVYYVGPNGWKKLSGDDVGELHYRY  254

Query  197  YPVEAAAVEHEMTEV  153
            YPV  + VE EM EV
Sbjct  255  YPVMPSTVEQEMVEV  269



>ref|XP_007137929.1| hypothetical protein PHAVU_009G167300g [Phaseolus vulgaris]
 gb|ESW09923.1| hypothetical protein PHAVU_009G167300g [Phaseolus vulgaris]
Length=272

 Score =   127 bits (318),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 60/78 (77%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GYR+DLSVEEAAELARR+IYHATFRDG  GGVASVY+ GPNGWK LSGDDVGELHY  
Sbjct  195  DSGYRYDLSVEEAAELARRAIYHATFRDGASGGVASVYYVGPNGWKKLSGDDVGELHYHY  254

Query  197  YPVEAAAVEHEMTEVPIA  144
            YPV  + VE EM E P A
Sbjct  255  YPVTPSTVEQEMVEAPGA  272



>ref|XP_008381840.1| PREDICTED: proteasome subunit beta type-5-like [Malus domestica]
Length=270

 Score =   127 bits (318),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            DNGYR+D+SVEEAAELARR+IYHATFRDG  GGVASVY  GPNGWK LSGDDVGELHY  
Sbjct  196  DNGYRYDMSVEEAAELARRAIYHATFRDGASGGVASVYXVGPNGWKKLSGDDVGELHYHY  255

Query  197  YPVEAAAVEHEMTEV  153
            YPV A +VE EM EV
Sbjct  256  YPVVAGSVEQEMVEV  270



>gb|KGN51684.1| hypothetical protein Csa_5G590010 [Cucumis sativus]
Length=288

 Score =   127 bits (318),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/77 (78%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            DNGY++DLSVEEAAELARR+IYHATFRDG  GGVASVYH GPNGWK LSGDDVGELHY  
Sbjct  212  DNGYQYDLSVEEAAELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYKY  271

Query  197  YPVEAAAVEHEMTEVPI  147
            YPV    VE EM EV +
Sbjct  272  YPVVHDTVEQEMIEVTV  288



>ref|XP_009372313.1| PREDICTED: proteasome subunit beta type-5 [Pyrus x bretschneideri]
Length=272

 Score =   126 bits (317),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            DNGYR+D+SVEEAAELARR+IYHATFRDG  GGVASVYH G NGWK LSGDDVGELHY  
Sbjct  195  DNGYRYDMSVEEAAELARRAIYHATFRDGASGGVASVYHVGANGWKKLSGDDVGELHYSY  254

Query  197  YPVEAAAVEHEMTEV  153
            YPV   AVE EM EV
Sbjct  255  YPVVPGAVEQEMVEV  269



>gb|KHG25400.1| Proteasome subunit beta type-5 [Gossypium arboreum]
Length=272

 Score =   126 bits (317),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            DNGYR+D+SVEEAAELARR+IYHATFRDG  GGVASVY+ GPNGWK LSGDDVGELHY  
Sbjct  195  DNGYRYDMSVEEAAELARRAIYHATFRDGASGGVASVYYVGPNGWKKLSGDDVGELHYRY  254

Query  197  YPVEAAAVEHEMTEV  153
            YPV  + +E EM EV
Sbjct  255  YPVMPSTIEQEMAEV  269



>ref|XP_008340194.1| PREDICTED: proteasome subunit beta type-5 [Malus domestica]
Length=272

 Score =   126 bits (317),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GYR+D+SVEEAAELARR+IYHATFRDG  GGVASVYH G NGWK LSGDDVGELHY  
Sbjct  195  DDGYRYDMSVEEAAELARRAIYHATFRDGASGGVASVYHVGANGWKKLSGDDVGELHYSY  254

Query  197  YPVEAAAVEHEMTEV  153
            YPV A AVE EM EV
Sbjct  255  YPVVAGAVEQEMVEV  269



>gb|KDP26783.1| hypothetical protein JCGZ_17941 [Jatropha curcas]
Length=270

 Score =   126 bits (316),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GYR+DLS+EEAAELARR+IYHATFRDG  GGVASVY+ GPNGWK LSGDDVGELHY  
Sbjct  195  DSGYRYDLSIEEAAELARRAIYHATFRDGASGGVASVYYVGPNGWKKLSGDDVGELHYKY  254

Query  197  YPVEAAAVEHEMTEV  153
            YPV  + VE EM EV
Sbjct  255  YPVMPSTVEQEMVEV  269



>ref|XP_010250770.1| PREDICTED: proteasome subunit beta type-5 [Nelumbo nucifera]
Length=272

 Score =   126 bits (316),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            DNGYR+D+S+EEAAELARR+IYHATFRDG  GGVASVY+ GPNGWK LSGDDVGELH+  
Sbjct  195  DNGYRYDMSIEEAAELARRAIYHATFRDGASGGVASVYYVGPNGWKKLSGDDVGELHFKY  254

Query  197  YPVEAAAVEHEMTEV  153
            YPV    VE EM EV
Sbjct  255  YPVSPGTVEQEMVEV  269



>ref|XP_008806245.1| PREDICTED: proteasome subunit beta type-5-like [Phoenix dactylifera]
Length=272

 Score =   125 bits (315),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            DNGYR+D+S+EEAAELARR+IYHATFRDG  GGVASVY+ G +GWK LSGDDVGELHY  
Sbjct  195  DNGYRYDMSIEEAAELARRAIYHATFRDGASGGVASVYYVGRDGWKKLSGDDVGELHYTY  254

Query  197  YPVEAAAVEHEMTEVP  150
            YPV  + VEHEM EVP
Sbjct  255  YPVAPSPVEHEMAEVP  270



>gb|EMS57921.1| Proteasome subunit beta type-5 [Triticum urartu]
Length=226

 Score =   124 bits (311),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D GY+F++SVEEAAELARR+IYHATFRDG  GG  SVY+ GP+GWK LSGDDVGELHY  
Sbjct  147  DEGYKFNMSVEEAAELARRAIYHATFRDGASGGCVSVYYVGPDGWKKLSGDDVGELHYHY  206

Query  197  YPVEAAAVEHEMTEVPIA*T  138
            YPV+AA VE EM E P A T
Sbjct  207  YPVQAAPVEQEMAEAPSAST  226



>ref|XP_003564317.1| PREDICTED: proteasome subunit beta type-5-A-like [Brachypodium 
distachyon]
Length=277

 Score =   125 bits (314),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D GY+F++SVEEA ELARR+IYHATFRDG  GG  SVYH GPNGWK LSGDDVGELHY  
Sbjct  198  DEGYKFNMSVEEAGELARRAIYHATFRDGASGGCVSVYHVGPNGWKKLSGDDVGELHYHY  257

Query  197  YPVEAAAVEHEMTEVPIA*T  138
            YPV+AA VE EM + P A T
Sbjct  258  YPVQAAPVEQEMADAPSAST  277



>ref|XP_010905449.1| PREDICTED: proteasome subunit beta type-5-like [Elaeis guineensis]
Length=272

 Score =   125 bits (313),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 65/78 (83%), Gaps = 0/78 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            DNGYR+D+S+EEAAELARR+IYHATFRDG  GGV SVY+ G +GWK LSGDDVGELHY  
Sbjct  195  DNGYRYDMSIEEAAELARRAIYHATFRDGASGGVVSVYYVGRDGWKKLSGDDVGELHYTY  254

Query  197  YPVEAAAVEHEMTEVPIA  144
            YPV  + VEHEM EVP A
Sbjct  255  YPVAPSPVEHEMAEVPPA  272



>ref|XP_006291670.1| hypothetical protein CARUB_v10017828mg [Capsella rubella]
 gb|EOA24568.1| hypothetical protein CARUB_v10017828mg [Capsella rubella]
Length=272

 Score =   124 bits (312),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GYRFD+SVEEA+ELARRSIYHATFRDG  GGVASVYH GP GWK LSGDDVGELHY  
Sbjct  197  DSGYRFDMSVEEASELARRSIYHATFRDGASGGVASVYHVGPQGWKKLSGDDVGELHYHY  256

Query  197  YPVEAAAVEHEMTE  156
            YPV     EHEM E
Sbjct  257  YPVAPTTAEHEMAE  270



>gb|EMT01588.1| Proteasome subunit beta type-5-A [Aegilops tauschii]
Length=1520

 Score =   130 bits (328),  Expect = 8e-32, Method: Composition-based stats.
 Identities = 58/80 (73%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = -1

Query  377   DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
             D GY+F++SVEEAAELARR+IYHATFRDG  GG  SVY+ GP+GWK LSGDDVGELHY  
Sbjct  1441  DEGYKFNMSVEEAAELARRAIYHATFRDGASGGCVSVYYVGPDGWKKLSGDDVGELHYHY  1500

Query  197   YPVEAAAVEHEMTEVPIA*T  138
             YPV+AA VE EM E P A T
Sbjct  1501  YPVQAAPVEQEMAEAPSAST  1520



>gb|KHN31904.1| Proteasome subunit beta type-5 [Glycine soja]
Length=272

 Score =   124 bits (312),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GYR+DLSVEEAAELARR+IYHATFRDG  GGVASVY+ GPNGWK LSGDDVGELHY  
Sbjct  195  DSGYRYDLSVEEAAELARRAIYHATFRDGASGGVASVYYVGPNGWKKLSGDDVGELHYHY  254

Query  197  YPVEAAAVEHEMTE  156
            YPV  + VE EM E
Sbjct  255  YPVTPSTVEQEMVE  268



>ref|XP_003523139.1| PREDICTED: proteasome subunit beta type-5-like isoform X1 [Glycine 
max]
 ref|XP_006578699.1| PREDICTED: proteasome subunit beta type-5-like isoform X2 [Glycine 
max]
 ref|XP_006578700.1| PREDICTED: proteasome subunit beta type-5-like isoform X3 [Glycine 
max]
Length=272

 Score =   124 bits (312),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GYR+DLSVEEAAELARR+IYHATFRDG  GGVASVY+ GPNGWK LSGDDVGELHY  
Sbjct  195  DSGYRYDLSVEEAAELARRAIYHATFRDGASGGVASVYYVGPNGWKKLSGDDVGELHYHY  254

Query  197  YPVEAAAVEHEMTE  156
            YPV  + VE EM E
Sbjct  255  YPVTPSTVEQEMVE  268



>ref|XP_003526966.1| PREDICTED: proteasome subunit beta type-5-like [Glycine max]
 gb|KHN23280.1| Proteasome subunit beta type-5 [Glycine soja]
Length=272

 Score =   124 bits (311),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GYR+DLSVEEAAELARR+IYHATFRDG  GGVASVY+ GPNGWK LSGDDVGELHY  
Sbjct  195  DSGYRYDLSVEEAAELARRAIYHATFRDGASGGVASVYYVGPNGWKKLSGDDVGELHYHY  254

Query  197  YPVEAAAVEHEMTE  156
            YPV  + VE EM E
Sbjct  255  YPVTPSTVEQEMVE  268



>dbj|BAJ97061.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=279

 Score =   124 bits (312),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D GY+F++SVEEAAELARR+IYHATFRDG  GG  SVY+ GP+GWK LSGDDVGELHY  
Sbjct  200  DEGYKFNMSVEEAAELARRAIYHATFRDGASGGCVSVYYVGPDGWKKLSGDDVGELHYHY  259

Query  197  YPVEAAAVEHEMTEVPIA*T  138
            YPV+AA VE EM E P A T
Sbjct  260  YPVQAAPVEQEMAEAPSAST  279



>gb|ACU23791.1| unknown [Glycine max]
Length=272

 Score =   124 bits (311),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GYR+DLSVEEAAELARR+IYHATFRDG  GGVASVY+ GPNGWK LSGDDVGELHY  
Sbjct  195  DSGYRYDLSVEEAAELARRAIYHATFRDGASGGVASVYYVGPNGWKKLSGDDVGELHYHY  254

Query  197  YPVEAAAVEHEMTE  156
            YPV  + VE EM E
Sbjct  255  YPVTPSTVEQEMVE  268



>gb|AAU82107.1| 20S proteasome beta 5 subunit [Triticum aestivum]
Length=279

 Score =   124 bits (312),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D GY+F++SVEEAAELARR+IYHATFRDG  GG  SVY+ GP+GWK LSGDDVGELHY  
Sbjct  200  DEGYKFNMSVEEAAELARRAIYHATFRDGASGGCVSVYYVGPDGWKKLSGDDVGELHYHY  259

Query  197  YPVEAAAVEHEMTEVPIA*T  138
            YPV+AA VE EM E P A T
Sbjct  260  YPVQAAPVEQEMAEAPSAST  279



>ref|XP_006395566.1| hypothetical protein EUTSA_v10004762mg [Eutrema salsugineum]
 gb|ESQ32852.1| hypothetical protein EUTSA_v10004762mg [Eutrema salsugineum]
Length=273

 Score =   124 bits (311),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GY+FD+SVEEA+ELARRSIYHATFRDG  GGVASVYH GPNGWK LSGDDVGELHY  
Sbjct  197  DSGYKFDMSVEEASELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  256

Query  197  YPVEAAAVEHEMTE  156
            YPV  A  E EM E
Sbjct  257  YPVVPATAEQEMEE  270



>gb|ACP43316.1| 20S proteasome beta subunit 5 [Citrus maxima]
Length=194

 Score =   122 bits (305),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GY+FD+S+EEAAELARR+IYHATFRD   GGVASVY+ GPNGWK LSGDDVGELHY  
Sbjct  117  DSGYKFDMSIEEAAELARRAIYHATFRDAASGGVASVYYVGPNGWKKLSGDDVGELHYHY  176

Query  197  YPVEAAAVEHEMTEV  153
            YPV  + VE EM EV
Sbjct  177  YPVTPSTVEQEMAEV  191



>ref|XP_006842100.1| hypothetical protein AMTR_s00078p00083100 [Amborella trichopoda]
 gb|ERN03775.1| hypothetical protein AMTR_s00078p00083100 [Amborella trichopoda]
Length=276

 Score =   123 bits (308),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GYR+D+S EEAAELARRSIYHATFRDG  GGVASVY+ GPNGWK LSGDDVGELHY  
Sbjct  200  DSGYRYDMSCEEAAELARRSIYHATFRDGASGGVASVYYVGPNGWKKLSGDDVGELHYKY  259

Query  197  YPVEAAAVEHEMTE  156
            YPV    VE EM E
Sbjct  260  YPVPKGNVEQEMVE  273



>gb|ACP43315.1| 20S proteasome beta subunit 5 [Citrus maxima]
 gb|KDO81952.1| hypothetical protein CISIN_1g022125mg [Citrus sinensis]
Length=272

 Score =   123 bits (308),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GY+FD+S+EEAAELARR+IYHATFRD   GGVASVY+ GPNGWK LSGDDVGELHY  
Sbjct  195  DSGYKFDMSIEEAAELARRAIYHATFRDAASGGVASVYYVGPNGWKKLSGDDVGELHYHY  254

Query  197  YPVEAAAVEHEMTEV  153
            YPV  + VE EM EV
Sbjct  255  YPVTPSTVEQEMAEV  269



>ref|XP_006484070.1| PREDICTED: proteasome subunit beta type-5-B-like isoform X2 [Citrus 
sinensis]
Length=272

 Score =   123 bits (308),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GY+FD+S+EEAAELARR+IYHATFRD   GGVASVY+ GPNGWK LSGDDVGELHY  
Sbjct  195  DSGYKFDMSIEEAAELARRAIYHATFRDAASGGVASVYYVGPNGWKKLSGDDVGELHYHY  254

Query  197  YPVEAAAVEHEMTEV  153
            YPV  + VE EM EV
Sbjct  255  YPVTPSTVEQEMAEV  269



>ref|XP_006438069.1| hypothetical protein CICLE_v10032238mg [Citrus clementina]
 gb|ESR51309.1| hypothetical protein CICLE_v10032238mg [Citrus clementina]
Length=272

 Score =   123 bits (308),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GY+FD+S+EEAAELARR+IYHATFRD   GGVASVY+ GPNGWK LSGDDVGELHY  
Sbjct  195  DSGYKFDMSIEEAAELARRAIYHATFRDAASGGVASVYYVGPNGWKKLSGDDVGELHYHY  254

Query  197  YPVEAAAVEHEMTEV  153
            YPV  + VE EM EV
Sbjct  255  YPVTPSTVEQEMAEV  269



>ref|XP_010105786.1| Proteasome subunit beta type-5 [Morus notabilis]
 gb|EXC06139.1| Proteasome subunit beta type-5 [Morus notabilis]
Length=272

 Score =   123 bits (308),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GYR+D+SV EAAELARR+IYHATFRDG  GGVASVY+ GP+GWK LSGDDVGELHY  
Sbjct  195  DDGYRYDMSVHEAAELARRAIYHATFRDGASGGVASVYYVGPDGWKKLSGDDVGELHYKY  254

Query  197  YPVEAAAVEHEMTEV  153
            YPV A  VE EM EV
Sbjct  255  YPVTAGTVEQEMAEV  269



>emb|CDP13326.1| unnamed protein product [Coffea canephora]
Length=339

 Score =   124 bits (310),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 63/74 (85%), Gaps = 1/74 (1%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GYRFD+SVEEAAELARR+IYHATFRDG  GGV SVYH GP+GWK LSGDDVGELHY  
Sbjct  263  DSGYRFDMSVEEAAELARRAIYHATFRDGASGGVVSVYHVGPDGWKKLSGDDVGELHYAY  322

Query  197  YPVEAAAVEHEMTE  156
            YPVE   VEHEM E
Sbjct  323  YPVE-PTVEHEMAE  335



>ref|XP_010025332.1| PREDICTED: proteasome subunit beta type-5-B [Eucalyptus grandis]
 ref|XP_010025333.1| PREDICTED: proteasome subunit beta type-5-B [Eucalyptus grandis]
 gb|KCW61970.1| hypothetical protein EUGRSUZ_H04655 [Eucalyptus grandis]
Length=273

 Score =   122 bits (306),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GYR+D+SVEEAAELARR+IYHATFRDG  GGVASVYH GP GWK LSGDDVGELHY  
Sbjct  195  DSGYRYDMSVEEAAELARRAIYHATFRDGASGGVASVYHVGPTGWKKLSGDDVGELHYHY  254

Query  197  YPVEAAAVEHEMTEV  153
            +PV  + VE EM EV
Sbjct  255  HPVTPSTVEQEMAEV  269



>emb|CDY34594.1| BnaC03g56940D [Brassica napus]
Length=274

 Score =   122 bits (305),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GY+FD+SVEEA+ELARRSIYHATFRDG  GGVASVYH GPNGWK LSGDDVGELHY  
Sbjct  197  DSGYKFDMSVEEASELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  256

Query  197  YPVEAAAVEHEMTE  156
            YPV  A  E  M E
Sbjct  257  YPVPPATAEQVMEE  270



>ref|XP_010538272.1| PREDICTED: proteasome subunit beta type-5-B-like [Tarenaya hassleriana]
Length=271

 Score =   121 bits (304),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GY++D++VEEAAELARRSIYHATFRDG  GGVASVYH GPNGWK LSGDDVGELHY  
Sbjct  197  DSGYKYDMTVEEAAELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYKY  256

Query  197  YPVEAAAVEHEMTE  156
            YPV  ++ E  M+E
Sbjct  257  YPVTPSSAEQVMSE  270



>emb|CDX98014.1| BnaA06g07650D [Brassica napus]
Length=274

 Score =   121 bits (304),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GY+FD+SVEEA+ELARRSIYHATFRDG  GGVASVYH GPNGWK LSGDDVGELHY  
Sbjct  197  DSGYKFDMSVEEASELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  256

Query  197  YPVEAAAVEHEMTE  156
            YPV  A  E  M E
Sbjct  257  YPVPPAIAEQVMEE  270



>emb|CDY19402.1| BnaC05g09110D [Brassica napus]
Length=274

 Score =   121 bits (303),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GY+FD+SVEEA+ELARRSIYHATFRDG  GGVASVYH GPNGWK LSGDDVGELHY  
Sbjct  197  DSGYKFDMSVEEASELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  256

Query  197  YPVEAAAVEHEMTE  156
            YPV  A  E  M E
Sbjct  257  YPVPPAIAEQVMEE  270



>emb|CDY21081.1| BnaA08g24440D [Brassica napus]
Length=274

 Score =   120 bits (302),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GY+FD+SVEEA+ELARRSIYHATFRDG  GGVASVYH GPNGWK LSGDDVGELHY  
Sbjct  197  DSGYKFDMSVEEASELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  256

Query  197  YPVEAAAVEHEMTE  156
            YPV  +  E  M E
Sbjct  257  YPVPPSTAEQVMEE  270



>ref|XP_009110603.1| PREDICTED: proteasome subunit beta type-5-B [Brassica rapa]
Length=274

 Score =   120 bits (302),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GY+FD+SVEEA+ELARRSIYHATFRDG  GGVASVYH GPNGWK LSGDDVGELHY  
Sbjct  197  DSGYKFDMSVEEASELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  256

Query  197  YPVEAAAVEHEMTE  156
            YPV  +  E  M E
Sbjct  257  YPVPPSTAEQVMEE  270



>ref|XP_009148547.1| PREDICTED: proteasome subunit beta type-5-B-like [Brassica rapa]
Length=274

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GY+FD++VEEA+ELARRSIYHATFRDG  GGVASVYH GPNGWK LSGDDVGELHY  
Sbjct  197  DSGYKFDMTVEEASELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  256

Query  197  YPVEAAAVEHEMTE  156
            YPV  A  E  M E
Sbjct  257  YPVPPAIAEQVMEE  270



>ref|XP_010682823.1| PREDICTED: proteasome subunit beta type-5 [Beta vulgaris subsp. 
vulgaris]
Length=272

 Score =   120 bits (301),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            DNGY++D++VEEA+ELARR+IYHAT+RDG  GGV SVYH GP+GWK L+GDDVGELHY  
Sbjct  195  DNGYQYDMTVEEASELARRAIYHATYRDGASGGVVSVYHVGPDGWKKLTGDDVGELHYQY  254

Query  197  YPVEAAAVEHEMTEVPIA  144
            YPV  A VE EM EV  A
Sbjct  255  YPVVPATVEQEMAEVGAA  272



>gb|AFK46055.1| unknown [Lotus japonicus]
Length=270

 Score =   120 bits (301),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GY++D+SVEEAAELARR+IYHATFRDG  GGVASVYH GPNGWK LSGDDVGELHY  
Sbjct  195  DSGYKYDMSVEEAAELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  254

Query  197  YPVEAAAVEHEMTE  156
             PV  + VE EM E
Sbjct  255  NPVVPSTVEQEMVE  268



>ref|XP_008810773.1| PREDICTED: proteasome subunit beta type-5-like [Phoenix dactylifera]
Length=272

 Score =   120 bits (301),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            DNGYR+D+SVEEAAELARR+IYHATFRD   GGVASVY+ GP+GWK LSGDDVGELH+  
Sbjct  195  DNGYRYDMSVEEAAELARRAIYHATFRDAASGGVASVYYVGPSGWKKLSGDDVGELHFRY  254

Query  197  YPVEAAAVEHEMTEV  153
            YPV  +  E EM EV
Sbjct  255  YPVAPSPTEQEMAEV  269



>ref|XP_002876966.1| hypothetical protein ARALYDRAFT_484397 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53225.1| hypothetical protein ARALYDRAFT_484397 [Arabidopsis lyrata subsp. 
lyrata]
Length=274

 Score =   120 bits (301),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GY+FD+SVEEA+ELARRSIYHATFRDG  GGVASVYH GP GWK LSGDDVGELHY  
Sbjct  198  DSGYKFDMSVEEASELARRSIYHATFRDGASGGVASVYHVGPQGWKKLSGDDVGELHYHY  257

Query  197  YPVEAAAVEHEMTE  156
            YPV     EH M E
Sbjct  258  YPVTPVTAEHVMEE  271



>gb|ABQ50544.1| hypothetical protein [Brassica rapa]
Length=218

 Score =   119 bits (297),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GY+FD+SVEEA+ELARRSIYHATFRDG  GGVASVYH GPNGW  LSGDDVGELHY  
Sbjct  141  DSGYKFDMSVEEASELARRSIYHATFRDGASGGVASVYHVGPNGWTKLSGDDVGELHYHY  200

Query  197  YPVEAAAVEHEMTE  156
            YPV  A  E  M E
Sbjct  201  YPVPPAIAEQVMEE  214



>ref|XP_006417162.1| hypothetical protein EUTSA_v10008454mg [Eutrema salsugineum]
 gb|ESQ35515.1| hypothetical protein EUTSA_v10008454mg [Eutrema salsugineum]
Length=274

 Score =   120 bits (301),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GY++D+SVEEA+ELARRSIYHATFRDG  GGVASVYH GPNGWK LSGDDVGELHY  
Sbjct  197  DSGYKYDMSVEEASELARRSIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVGELHYHY  256

Query  197  YPVEAAAVEHEMTE  156
            YPV  A  E  M E
Sbjct  257  YPVAPATAEQVMEE  270



>gb|ABK25785.1| unknown [Picea sitchensis]
Length=271

 Score =   119 bits (299),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GYR+D+ VEEAAELARRSIYHATFRDG  GGVASVY+ GP GWK LSGDDVGELH+  
Sbjct  195  DSGYRWDMPVEEAAELARRSIYHATFRDGASGGVASVYYVGPQGWKKLSGDDVGELHFKY  254

Query  197  YPVEAAAVEHEMTEV  153
            YPV    VE EM EV
Sbjct  255  YPVTENVVEQEMVEV  269



>dbj|BAG92607.1| unnamed protein product [Oryza sativa Japonica Group]
Length=224

 Score =   118 bits (296),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D GYR+ + VEEAAELARR+IY ATFRDG  GG  SVYH GPNGW  LSGDDVGELHY  
Sbjct  147  DEGYRYVMPVEEAAELARRAIYQATFRDGASGGCVSVYHVGPNGWTKLSGDDVGELHYKY  206

Query  197  YPVEAAAVEHEMTEVPIA  144
            YPVEA  VE EM + P A
Sbjct  207  YPVEATPVEQEMADAPAA  224



>emb|CDY16054.1| BnaC08g40690D [Brassica napus]
Length=274

 Score =   119 bits (298),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GY+FD+SVEEA+ELARRSIYHATFRDG  GGVASVYH GPNGW  LSGDDVGELHY  
Sbjct  197  DSGYKFDMSVEEASELARRSIYHATFRDGASGGVASVYHVGPNGWTKLSGDDVGELHYHY  256

Query  197  YPVEAAAVEHEMTE  156
            YPV  A  E  M E
Sbjct  257  YPVPPAIAEQVMEE  270



>ref|XP_010502548.1| PREDICTED: proteasome subunit beta type-5-B-like [Camelina sativa]
Length=272

 Score =   119 bits (298),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GY+FD+S+EEA+ELARRSIYHATFRDG  GGVASVYH GP GW  LSGDDVGELHY  
Sbjct  197  DSGYKFDMSIEEASELARRSIYHATFRDGASGGVASVYHVGPQGWTKLSGDDVGELHYHY  256

Query  197  YPVEAAAVEHEMTE  156
            YPV  A  EH M E
Sbjct  257  YPVAPATAEHVMEE  270



>ref|XP_010425347.1| PREDICTED: proteasome subunit beta type-5-B [Camelina sativa]
Length=272

 Score =   119 bits (298),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GY+FD+S+EEA+ELARRSIYHATFRDG  GGVASVYH GP GW  LSGDDVGELHY  
Sbjct  197  DSGYKFDMSIEEASELARRSIYHATFRDGASGGVASVYHVGPQGWTKLSGDDVGELHYHY  256

Query  197  YPVEAAAVEHEMTE  156
            YPV  A  EH M E
Sbjct  257  YPVAPATAEHVMEE  270



>ref|XP_009118034.1| PREDICTED: proteasome subunit beta type-5-B-like [Brassica rapa]
Length=274

 Score =   119 bits (298),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GY+FD+SVEEA+ELARRSIYHATFRDG  GGVASVYH GPNGW  LSGDDVGELHY  
Sbjct  197  DSGYKFDMSVEEASELARRSIYHATFRDGASGGVASVYHVGPNGWTKLSGDDVGELHYHY  256

Query  197  YPVEAAAVEHEMTE  156
            YPV  A  E  M E
Sbjct  257  YPVPPAIAEQVMEE  270



>ref|XP_010514289.1| PREDICTED: proteasome subunit beta type-5-B-like [Camelina sativa]
Length=272

 Score =   119 bits (298),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GY+FD+S+EEA+ELARRSIYHATFRDG  GGVASVYH GP GW  LSGDDVGELHY  
Sbjct  197  DSGYKFDMSIEEASELARRSIYHATFRDGASGGVASVYHVGPQGWTKLSGDDVGELHYHY  256

Query  197  YPVEAAAVEHEMTE  156
            YPV  A  EH M E
Sbjct  257  YPVAPATAEHVMEE  270



>ref|XP_010912107.1| PREDICTED: proteasome subunit beta type-5-like [Elaeis guineensis]
Length=272

 Score =   119 bits (297),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            DNGYR+D+S+EEAAELARR+IYHATFRD   GGVASVY+ GP+GWK LSGDDVGELH+  
Sbjct  195  DNGYRYDMSIEEAAELARRAIYHATFRDAASGGVASVYYVGPSGWKKLSGDDVGELHFRY  254

Query  197  YPVEAAAVEHEMTEV  153
            YPV     E EM EV
Sbjct  255  YPVAPNPTEQEMAEV  269



>ref|XP_002437853.1| hypothetical protein SORBIDRAFT_10g003770 [Sorghum bicolor]
 gb|EER89220.1| hypothetical protein SORBIDRAFT_10g003770 [Sorghum bicolor]
Length=280

 Score =   119 bits (297),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GYRF++SVEEAAELARR+IY ATFRD   GG  SVYH GP+GW  LSGDDVGELHY  
Sbjct  201  DDGYRFNMSVEEAAELARRAIYGATFRDAASGGCVSVYHVGPDGWTKLSGDDVGELHYHY  260

Query  197  YPVEAAAVEHEMTEVPIA  144
            YPV+   VE EMT+ P A
Sbjct  261  YPVQKTPVEQEMTDAPTA  278



>ref|XP_010540655.1| PREDICTED: proteasome subunit beta type-5-B [Tarenaya hassleriana]
Length=271

 Score =   119 bits (297),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GY++D++VEEAAELARRSIYHATFRDG  GGVASVY+ GPNGWK LSGDDVGELHY  
Sbjct  197  DSGYKYDMTVEEAAELARRSIYHATFRDGASGGVASVYYVGPNGWKKLSGDDVGELHYKY  256

Query  197  YPVEAAAVEHEMTE  156
            YPV  +  E  M E
Sbjct  257  YPVAPSTAEQVMAE  270



>gb|EEE65108.1| hypothetical protein OsJ_20167 [Oryza sativa Japonica Group]
Length=277

 Score =   118 bits (296),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D GYR+ + VEEAAELARR+IY ATFRDG  GG  SVYH GPNGW  LSGDDVGELHY  
Sbjct  200  DEGYRYVMPVEEAAELARRAIYQATFRDGASGGCVSVYHVGPNGWTKLSGDDVGELHYKY  259

Query  197  YPVEAAAVEHEMTEVPIA  144
            YPVEA  VE EM + P A
Sbjct  260  YPVEATPVEQEMADAPAA  277



>dbj|BAA96838.1| beta 5 subunit of 20S proteasome [Oryza sativa Japonica Group]
Length=277

 Score =   118 bits (295),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D GYR+ + VEEAAELARR+IY ATFRDG  GG  SVYH GPNGW  LSGDDVGELHY  
Sbjct  200  DEGYRYVMPVEEAAELARRAIYQATFRDGASGGCVSVYHVGPNGWTKLSGDDVGELHYKY  259

Query  197  YPVEAAAVEHEMTEVPIA  144
            YPVEA  VE EM + P A
Sbjct  260  YPVEATPVEQEMADAPAA  277



>ref|NP_001056842.1| Os06g0153800 [Oryza sativa Japonica Group]
 dbj|BAD69286.1| beta 5 subunit of 20S proteasome [Oryza sativa Japonica Group]
 dbj|BAF18756.1| Os06g0153800 [Oryza sativa Japonica Group]
 dbj|BAG96622.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96749.1| unnamed protein product [Oryza sativa Japonica Group]
Length=277

 Score =   118 bits (295),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D GYR+ + VEEAAELARR+IY ATFRDG  GG  SVYH GPNGW  LSGDDVGELHY  
Sbjct  200  DEGYRYVMPVEEAAELARRAIYQATFRDGASGGCVSVYHVGPNGWTKLSGDDVGELHYKY  259

Query  197  YPVEAAAVEHEMTEVPIA  144
            YPVEA  VE EM + P A
Sbjct  260  YPVEATPVEQEMADAPAA  277



>ref|NP_189265.1| proteasome subunit beta type-5-B [Arabidopsis thaliana]
 sp|Q9LIP2.1|PSB5B_ARATH RecName: Full=Proteasome subunit beta type-5-B; AltName: Full=20S 
proteasome beta subunit E-2; AltName: Full=Proteasome epsilon-2 
chain; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL27514.1|AF439846_1 AT3g26340/F20C19_6 [Arabidopsis thaliana]
 dbj|BAB02194.1| proteasome epsilon chain precursor [Arabidopsis thaliana]
 gb|AAM62897.1| 26S proteasome beta subunit, putative [Arabidopsis thaliana]
 gb|AAM78079.1| AT3g26340/F20C19_6 [Arabidopsis thaliana]
 gb|AEE77147.1| proteasome subunit beta type-5-B [Arabidopsis thaliana]
Length=273

 Score =   117 bits (294),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GY+FD+SVEEA+ELARRSIYHATFRDG  GGVASVYH GP GW  LSGDDVGELHY  
Sbjct  197  DSGYKFDMSVEEASELARRSIYHATFRDGASGGVASVYHVGPQGWTKLSGDDVGELHYHY  256

Query  197  YPVEAAAVEHEMTE  156
            YPV     EH M E
Sbjct  257  YPVAPITAEHVMEE  270



>gb|EEC80034.1| hypothetical protein OsI_21721 [Oryza sativa Indica Group]
Length=277

 Score =   117 bits (294),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D GYR+ + VEEAAELARR+IY ATFRDG  GG  SVYH GPNGW  LSGDDVGELHY  
Sbjct  200  DEGYRYVMPVEEAAELARRAIYQATFRDGASGGCVSVYHVGPNGWTKLSGDDVGELHYKY  259

Query  197  YPVEAAAVEHEMTEVPIA  144
            YPVEA  VE EM + P A
Sbjct  260  YPVEAIPVEQEMADAPAA  277



>ref|XP_004964820.1| PREDICTED: proteasome subunit beta type-5-A-like [Setaria italica]
Length=280

 Score =   117 bits (294),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D GYRF++SVEEA ELARR+IY ATFRD   GG  SVYH GP+GWK LSGDDVGELHY  
Sbjct  201  DEGYRFNMSVEEAGELARRAIYGATFRDAASGGCVSVYHVGPDGWKKLSGDDVGELHYHY  260

Query  197  YPVEAAAVEHEMTEVPIA  144
            YPV+   VE EMT+ P A
Sbjct  261  YPVQKTPVEQEMTDAPSA  278



>sp|O24361.1|PSB5_SPIOL RecName: Full=Proteasome subunit beta type-5; AltName: Full=20S 
proteasome subunit E; AltName: Full=Proteasome epsilon chain; 
Flags: Precursor [Spinacia oleracea]
 dbj|BAA21650.1| 26S proteasome beta subunit [Spinacia oleracea]
Length=272

 Score =   117 bits (293),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            DNGY++D++VEEA+ELARR+IYHAT+RDG  GGV SVYH GP+GWK ++GDDVG+LH+  
Sbjct  195  DNGYKYDMTVEEASELARRAIYHATYRDGASGGVVSVYHVGPDGWKKVTGDDVGDLHFQY  254

Query  197  YPVEAAAVEHEMTEV  153
            YPV  A VE EM EV
Sbjct  255  YPVVPATVEQEMVEV  269



>gb|ABK25888.1| unknown [Picea sitchensis]
Length=271

 Score =   117 bits (293),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 60/75 (80%), Gaps = 0/75 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GYR+D+ VEEAAELARRSIYHATFRDG  GGVASVY+ GP GWK LSGDDV ELH+  
Sbjct  195  DSGYRWDMPVEEAAELARRSIYHATFRDGASGGVASVYYVGPQGWKKLSGDDVAELHFNY  254

Query  197  YPVEAAAVEHEMTEV  153
            YPV    VE EM EV
Sbjct  255  YPVTENVVEQEMVEV  269



>ref|XP_006655798.1| PREDICTED: proteasome subunit beta type-5-A-like [Oryza brachyantha]
Length=276

 Score =   117 bits (292),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D GYR+ +SVEEA ELARR+IYHATFRDG  GG  SVYH G +GWK LSGDDVGELHY  
Sbjct  199  DEGYRYVMSVEEAGELARRAIYHATFRDGASGGCVSVYHVGADGWKKLSGDDVGELHYKY  258

Query  197  YPVEAAAVEHEMTEVPIA  144
            YPV+A  VE EM + P A
Sbjct  259  YPVQATPVEQEMADAPAA  276



>ref|NP_001132821.1| uncharacterized protein LOC100194311 [Zea mays]
 gb|ACF81829.1| unknown [Zea mays]
 gb|ACF86108.1| unknown [Zea mays]
 gb|ACG33811.1| proteasome subunit beta type 5 precursor [Zea mays]
 gb|AFW85804.1| proteasome subunit beta type [Zea mays]
Length=280

 Score =   116 bits (290),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GYRF +SVEEAAELARR+IY ATFRD   GG  SVYH GP+GW  LSGDDVGELHY  
Sbjct  201  DDGYRFSMSVEEAAELARRAIYGATFRDAASGGCVSVYHVGPDGWTKLSGDDVGELHYHY  260

Query  197  YPVEAAAVEHEMTEVPIA  144
            YPV+   VE EM + P A
Sbjct  261  YPVQKTPVEQEMADAPTA  278



>ref|XP_003602092.1| Proteasome subunit beta type [Medicago truncatula]
 gb|AES72343.1| proteasome-alpha-type-5 protein [Medicago truncatula]
Length=271

 Score =   115 bits (289),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GY++D+SVEEA+ELARR+IYHATFRDG  GGVASVY+ GP GWK LSGDDVGELHY  
Sbjct  194  DSGYKYDMSVEEASELARRAIYHATFRDGASGGVASVYYVGPTGWKKLSGDDVGELHYHY  253

Query  197  YPVEAAAVEHEMTE  156
             PV  + VE EM E
Sbjct  254  NPVTPSTVEQEMVE  267



>emb|CDY26610.1| BnaA09g46670D [Brassica napus]
Length=274

 Score =   115 bits (289),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GY+FD+SVEEA+ELARRSIYHATFRDG  GGVASVYH G NGW  LSGDDVGELHY  
Sbjct  197  DSGYKFDMSVEEASELARRSIYHATFRDGASGGVASVYHVGSNGWTKLSGDDVGELHYHY  256

Query  197  YPVEAAAVEHEMTE  156
            YPV  A  E  M E
Sbjct  257  YPVPPAIAEQVMEE  270



>gb|AFK34329.1| unknown [Medicago truncatula]
Length=271

 Score =   115 bits (289),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GY++D+SVEEA+ELARR+IYHATFRDG  GGVASVY+ GP GWK LSGDDVGELHY  
Sbjct  194  DSGYKYDMSVEEASELARRAIYHATFRDGASGGVASVYYVGPTGWKKLSGDDVGELHYHY  253

Query  197  YPVEAAAVEHEMTE  156
             PV  + VE EM E
Sbjct  254  NPVTPSTVEQEMVE  267



>ref|XP_006305519.1| hypothetical protein CARUB_v10009991mg [Capsella rubella]
 gb|EOA38417.1| hypothetical protein CARUB_v10009991mg [Capsella rubella]
Length=274

 Score =   115 bits (288),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GY++D+SVEEA+ELARRSIYHATFRDG  GGVASVYH GP+GW  LSGDDVGELHY  
Sbjct  197  DSGYKYDMSVEEASELARRSIYHATFRDGASGGVASVYHVGPDGWTKLSGDDVGELHYHY  256

Query  197  YPVEAAAVEHEMTE  156
            YPV  A  E  M E
Sbjct  257  YPVAPAIAEQVMEE  270



>ref|NP_172765.1| 20S proteasome beta subunit E1 [Arabidopsis thaliana]
 sp|O23717.1|PSB5A_ARATH RecName: Full=Proteasome subunit beta type-5-A; AltName: Full=20S 
proteasome beta subunit E-1; AltName: Full=Proteasome component 
E; AltName: Full=Proteasome epsilon-1 chain; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAD31059.1|AC007357_8 Identical to gb|Y13695 multicatalytic endopeptidase complex, 
proteasome precursor, beta subunit (prce) from Arabidopsis thaliana. 
ESTs gb|Y09360, gb|F13852, gb|T20555, gb|T44620, gb|AI099779 
and gb|AA586183 come from this gene [Arabidopsis thaliana]
 gb|AAK15550.1|AF348579_1 putative proteasome epsilon chain precursor [Arabidopsis thaliana]
 emb|CAA74029.1| multicatalytic endopeptidase complex, proteasome precursor, beta 
subunit [Arabidopsis thaliana]
 gb|AAC32072.1| 20S proteasome beta subunit PBE1 [Arabidopsis thaliana]
 gb|AAN12998.1| proteasome epsilon chain precursor [Arabidopsis thaliana]
 gb|AEE28965.1| 20S proteasome beta subunit E1 [Arabidopsis thaliana]
Length=274

 Score =   115 bits (288),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GY++D+SVEEA+ELARRSIYHATFRDG  GGVASVYH GP GW  LSGDDVGELHY  
Sbjct  197  DSGYKYDMSVEEASELARRSIYHATFRDGASGGVASVYHVGPEGWTKLSGDDVGELHYHY  256

Query  197  YPVEAAAVEHEMTE  156
            YPV  A  E  M E
Sbjct  257  YPVAPATAEQVMEE  270



>gb|AAK92808.1| putative proteasome epsilon chain precursor [Arabidopsis thaliana]
Length=274

 Score =   115 bits (288),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GY++D+SVEEA+ELARRSIYHATFRDG  GGVASVYH GP GW  LSGDDVGELHY  
Sbjct  197  DSGYKYDMSVEEASELARRSIYHATFRDGASGGVASVYHVGPEGWTKLSGDDVGELHYHY  256

Query  197  YPVEAAAVEHEMTE  156
            YPV  A  E  M E
Sbjct  257  YPVAPATAEQVMEE  270



>ref|NP_001265983.1| proteasome subunit beta type-5-like [Cicer arietinum]
 emb|CAA09603.1| 20S proteasome beta subunit [Cicer arietinum]
Length=238

 Score =   114 bits (286),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GY++D+S+EEA+ELARR+IYHATFRDG  GGVASVY+ GP GWK LSGDDVGELHY  
Sbjct  161  DSGYKYDMSIEEASELARRAIYHATFRDGASGGVASVYYVGPTGWKKLSGDDVGELHYHY  220

Query  197  YPVEAAAVEHEMTE  156
             PV  + VE EM E
Sbjct  221  NPVTPSTVEQEMVE  234



>ref|NP_001184978.1| 20S proteasome beta subunit E1 [Arabidopsis thaliana]
 gb|AEE28966.1| 20S proteasome beta subunit E1 [Arabidopsis thaliana]
Length=298

 Score =   115 bits (289),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GY++D+SVEEA+ELARRSIYHATFRDG  GGVASVYH GP GW  LSGDDVGELHY  
Sbjct  221  DSGYKYDMSVEEASELARRSIYHATFRDGASGGVASVYHVGPEGWTKLSGDDVGELHYHY  280

Query  197  YPVEAAAVEHEMTE  156
            YPV  A  E  M E
Sbjct  281  YPVAPATAEQVMEE  294



>ref|XP_002889982.1| hypothetical protein ARALYDRAFT_471459 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66241.1| hypothetical protein ARALYDRAFT_471459 [Arabidopsis lyrata subsp. 
lyrata]
Length=274

 Score =   115 bits (287),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GY++D+SVEEA+ELARRSIYHATFRDG  GGVASVYH GP GW  LSGDDVGELHY  
Sbjct  197  DSGYKYDMSVEEASELARRSIYHATFRDGASGGVASVYHVGPEGWTKLSGDDVGELHYHY  256

Query  197  YPVEAAAVEHEMTE  156
            YPV  A  E  M E
Sbjct  257  YPVAPAIAEQVMEE  270



>gb|AFW85803.1| hypothetical protein ZEAMMB73_646691 [Zea mays]
Length=263

 Score =   114 bits (284),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 57/77 (74%), Gaps = 0/77 (0%)
 Frame = -1

Query  374  NGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXXY  195
            N YRF +SVEEAAELARR+IY ATFRD   GG  SVYH GP+GW  LSGDDVGELHY  Y
Sbjct  185  NSYRFSMSVEEAAELARRAIYGATFRDAASGGCVSVYHVGPDGWTKLSGDDVGELHYHYY  244

Query  194  PVEAAAVEHEMTEVPIA  144
            PV+   VE EM + P A
Sbjct  245  PVQKTPVEQEMADAPTA  261



>gb|ABE68720.1| 20S proteasome beta subunit [Arachis hypogaea]
Length=223

 Score =   112 bits (280),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GYR+DLSV+EA EL RR+IYHATFRDG  GGV SVYH GP GWK  +GDDVG+LHY  
Sbjct  146  DSGYRYDLSVDEAVELGRRAIYHATFRDGASGGVVSVYHVGPEGWKKWTGDDVGDLHYQY  205

Query  197  YPVEAAAVEHEMTE  156
            YPV  + VE EM E
Sbjct  206  YPVVPSTVEQEMAE  219



>ref|XP_010476293.1| PREDICTED: proteasome subunit beta type-5-A-like [Camelina sativa]
Length=274

 Score =   113 bits (282),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GY++++SVEEA+ELARRSIYHATFRDG  GGVASVYH GP GW  LSGDDVGELHY  
Sbjct  197  DSGYKYEMSVEEASELARRSIYHATFRDGASGGVASVYHVGPEGWTKLSGDDVGELHYHY  256

Query  197  YPVEAAAVEHEMTE  156
            YPV  A  E  M E
Sbjct  257  YPVPPAIAEQVMEE  270



>ref|XP_010494920.1| PREDICTED: proteasome subunit beta type-5-A [Camelina sativa]
Length=274

 Score =   113 bits (282),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GY++++SVEEA+ELARRSIYHATFRDG  GGVASVYH GP GW  LSGDDVGELHY  
Sbjct  197  DSGYKYEMSVEEASELARRSIYHATFRDGASGGVASVYHVGPEGWTKLSGDDVGELHYHY  256

Query  197  YPVEAAAVEHEMTE  156
            YPV  A  E  M E
Sbjct  257  YPVPPAIAEQVMEE  270



>ref|XP_010458748.1| PREDICTED: proteasome subunit beta type-5-A-like [Camelina sativa]
Length=274

 Score =   113 bits (282),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GY++++SVEEA+ELARRSIYHATFRDG  GGVASVYH GP GW  LSGDDVGELHY  
Sbjct  197  DSGYKYEMSVEEASELARRSIYHATFRDGASGGVASVYHVGPEGWTKLSGDDVGELHYHY  256

Query  197  YPVEAAAVEHEMTE  156
            YPV  A  E  M E
Sbjct  257  YPVPPAIAEQVMEE  270



>gb|ACU51028.1| 20S proteasome beta5 subunit [Conocephalum conicum]
Length=280

 Score =   112 bits (280),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D G+R+D++VEEA ELARRSIYHATFRDG  GGVASVY+ GP+GWK +SGDDVGELHY  
Sbjct  200  DTGFRWDMTVEEAVELARRSIYHATFRDGASGGVASVYYVGPDGWKKMSGDDVGELHYKY  259

Query  197  YPVEAAAVEHEM  162
            YPV  A  E E+
Sbjct  260  YPVSDAPAEQEV  271



>gb|AFK38197.1| unknown [Medicago truncatula]
Length=271

 Score =   110 bits (276),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GY++D+SVEEA+ELARR+IYHATFRDG  GGVASVY+ GP G K LSGDDVGELHY  
Sbjct  194  DSGYKYDMSVEEASELARRAIYHATFRDGASGGVASVYYVGPTGRKKLSGDDVGELHYHY  253

Query  197  YPVEAAAVEHEMTE  156
             PV  + VE EM E
Sbjct  254  NPVTPSTVEQEMVE  267



>ref|XP_001759925.1| predicted protein [Physcomitrella patens]
 gb|EDQ75429.1| predicted protein [Physcomitrella patens]
Length=269

 Score =   109 bits (272),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D G+ +D+S++EA ELARRSIYHATFRDG  GGV SVY+ GP GWK +SGDDVGELHY  
Sbjct  193  DTGFNWDMSIDEAVELARRSIYHATFRDGASGGVVSVYYVGPGGWKKMSGDDVGELHYSY  252

Query  197  YPVEAAAVEHEMTE  156
            YPV+    E EM E
Sbjct  253  YPVQEVPAEAEMGE  266



>ref|XP_002972642.1| hypothetical protein SELMODRAFT_270977 [Selaginella moellendorffii]
 gb|EFJ25863.1| hypothetical protein SELMODRAFT_270977 [Selaginella moellendorffii]
Length=277

 Score =   108 bits (271),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GY+F++SVEEA EL RR+IYHATFRDG  GGVASVYH GP GWK +SGDDV ELHY  
Sbjct  197  DSGYKFEMSVEEAVELGRRAIYHATFRDGASGGVASVYHIGPQGWKKISGDDVSELHYQY  256

Query  197  YPVEAAAVEHEMTE  156
            YP E+ A   ++ E
Sbjct  257  YPPESQASAPDVVE  270



>ref|XP_011029673.1| PREDICTED: proteasome subunit beta type-5-B-like [Populus euphratica]
Length=272

 Score =   108 bits (270),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GYRFD+S+EEAAEL RR+IYHATFRDG  GGVASVY+ GP+GWK LSGDDV ELHY  
Sbjct  196  DSGYRFDMSIEEAAELGRRAIYHATFRDGASGGVASVYYVGPDGWKKLSGDDVSELHYNY  255

Query  197  YPV  189
            YPV
Sbjct  256  YPV  258



>ref|XP_002312631.2| 20S proteasome beta subunit family protein [Populus trichocarpa]
 gb|EEE89998.2| 20S proteasome beta subunit family protein [Populus trichocarpa]
Length=272

 Score =   108 bits (270),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GYRFD+S+EEAAEL RR+IYHATFRDG  GGVASVY+ GP+GWK LSGDDV ELHY  
Sbjct  196  DSGYRFDMSIEEAAELGRRAIYHATFRDGASGGVASVYYVGPDGWKKLSGDDVSELHYNY  255

Query  197  YPV  189
            YPV
Sbjct  256  YPV  258



>ref|XP_008791726.1| PREDICTED: proteasome subunit beta type-5-like [Phoenix dactylifera]
Length=272

 Score =   107 bits (268),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            DNGYR+D+   EAAELARR+IYHATFRDG  GGVA VYH GP+GWK +SGDDV ELH   
Sbjct  195  DNGYRYDMPTGEAAELARRAIYHATFRDGASGGVAVVYHVGPDGWKKISGDDVRELHDKY  254

Query  197  YPVEAAAVEHEMTEVP  150
            YP      E EM +VP
Sbjct  255  YPAVQVPPEQEMMQVP  270



>ref|XP_002994143.1| hypothetical protein SELMODRAFT_272351 [Selaginella moellendorffii]
 gb|EFJ04804.1| hypothetical protein SELMODRAFT_272351 [Selaginella moellendorffii]
Length=275

 Score =   107 bits (267),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GY++++SVEEA EL RR+IYHATFRDG  GGVASVYH GP GWK +SGDDV ELHY  
Sbjct  195  DSGYKYEMSVEEAVELGRRAIYHATFRDGASGGVASVYHIGPQGWKKISGDDVSELHYQY  254

Query  197  YPVEAAAVEHEMTE  156
            YP E+ A   ++ E
Sbjct  255  YPPESQASAPDVVE  268



>ref|XP_002315619.1| 20S proteasome beta subunit family protein [Populus trichocarpa]
 gb|EEF01790.1| 20S proteasome beta subunit family protein [Populus trichocarpa]
Length=274

 Score =   107 bits (266),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GYRFD+S+EEAAEL RR+IYHATFRDG  GGVASVY+ G NGW  LSGDDV ELHY  
Sbjct  198  DSGYRFDMSIEEAAELGRRAIYHATFRDGASGGVASVYYVGANGWTKLSGDDVSELHYKY  257

Query  197  YPVEAA  180
            YPV +A
Sbjct  258  YPVVSA  263



>ref|XP_011041516.1| PREDICTED: proteasome subunit beta type-5-B-like [Populus euphratica]
 ref|XP_011041517.1| PREDICTED: proteasome subunit beta type-5-B-like [Populus euphratica]
 ref|XP_011041518.1| PREDICTED: proteasome subunit beta type-5-B-like [Populus euphratica]
 ref|XP_011041519.1| PREDICTED: proteasome subunit beta type-5-B-like [Populus euphratica]
Length=274

 Score =   106 bits (265),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 55/66 (83%), Gaps = 0/66 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GYRFD+S+EEAAEL RR+IYHATFRDG  GGVASVY+ G NGW  LSGDDV ELHY  
Sbjct  198  DSGYRFDMSIEEAAELGRRAIYHATFRDGASGGVASVYYVGANGWTKLSGDDVSELHYKY  257

Query  197  YPVEAA  180
            YPV +A
Sbjct  258  YPVVSA  263



>gb|ACJ85344.1| unknown [Medicago truncatula]
Length=262

 Score =   104 bits (259),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GY++D+SVEEA+ELARR+IYHATFRDG  GGVASVY+ GP G K LSGDDVGELHY  
Sbjct  194  DSGYKYDMSVEEASELARRAIYHATFRDGASGGVASVYYVGPTGRKKLSGDDVGELHYHY  253

Query  197  YPVEAAAVE  171
             PV  + VE
Sbjct  254  NPVTPSTVE  262



>ref|XP_010912828.1| PREDICTED: proteasome subunit beta type-5-like [Elaeis guineensis]
Length=272

 Score =   104 bits (259),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 55/75 (73%), Gaps = 0/75 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            DNGYR+D+ + EAAELARR+IYHATFRDG  GGVA V H GP+GWK LSGDDV ELH   
Sbjct  195  DNGYRYDMPLGEAAELARRAIYHATFRDGASGGVAIVCHVGPDGWKKLSGDDVKELHDKY  254

Query  197  YPVEAAAVEHEMTEV  153
            YP      E EM ++
Sbjct  255  YPAVQVPAEQEMMQI  269



>emb|CAC43326.1| putative beta5 proteasome subunit [Nicotiana tabacum]
Length=174

 Score =   102 bits (253),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 48/54 (89%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVG  216
            D+GYRFDLSVEEAAELARR+IYHATFRDG  GGVASVYH GPNGWK LSGDDVG
Sbjct  121  DSGYRFDLSVEEAAELARRAIYHATFRDGASGGVASVYHVGPNGWKKLSGDDVG  174



>ref|XP_002889984.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66243.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=113

 Score = 96.3 bits (238),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = -1

Query  353  SVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXXYPVEAAAV  174
            +VEE +ELARRSIYHATFRDG  GGVASVYH GP GW  LSGDDV ELHY  YPV  A  
Sbjct  44   AVEETSELARRSIYHATFRDGASGGVASVYHVGPEGWTKLSGDDVEELHYHYYPVAPAIA  103

Query  173  EHEMTE  156
            E  M E
Sbjct  104  EQVMEE  109



>ref|XP_003061052.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH54702.1| predicted protein [Micromonas pusilla CCMP1545]
Length=286

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D GYR+DLSVE+A EL RR+IYHATFRD   GG  SVYH GP+GW  +SG DVGELHY  
Sbjct  199  DQGYRWDLSVEDACELGRRAIYHATFRDAFSGGTVSVYHVGPDGWTKMSGTDVGELHYEY  258

Query  197  YPVE  186
            YP +
Sbjct  259  YPAD  262



>ref|XP_007514496.1| predicted protein [Bathycoccus prasinos]
 emb|CCO14736.1| predicted protein [Bathycoccus prasinos]
Length=311

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D G+R DLS++EAAEL RR+IYHATFRD   GG  SVYH GP+GW  +SG DVGELHY  
Sbjct  205  DQGFRHDLSIKEAAELGRRAIYHATFRDAFSGGTVSVYHVGPDGWTKMSGTDVGELHYEY  264

Query  197  YPVEAA  180
            YP +A 
Sbjct  265  YPADAV  270



>ref|XP_010912159.1| PREDICTED: proteasome subunit beta type-11-like [Elaeis guineensis]
Length=258

 Score = 96.3 bits (238),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 54/74 (73%), Gaps = 0/74 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            DNGY  D+S+EEAAELA R+IYHATF D   GGVA V + GP GWK LSGD+VGELH+  
Sbjct  58   DNGYWCDMSIEEAAELACRAIYHATFHDAASGGVARVCYVGPCGWKKLSGDNVGELHFRY  117

Query  197  YPVEAAAVEHEMTE  156
             PV  + +E EM E
Sbjct  118  CPVVPSPIEQEMAE  131



>ref|XP_003083185.1| 20S proteasome, regulatory subunit beta type PSMB3/PUP3 (ISS) 
[Ostreococcus tauri]
 emb|CAL57460.1| Proteasome B-type subunit [Ostreococcus tauri]
Length=294

 Score = 96.3 bits (238),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D GYR+DLSV+EA EL RR+IYHATFRD   GG  SVYH G NGW  ++GDDVGELH+  
Sbjct  203  DQGYRWDLSVKEACELGRRAIYHATFRDAFSGGTVSVYHVGKNGWTKVTGDDVGELHFHY  262

Query  197  YPVE  186
            YP E
Sbjct  263  YPSE  266



>ref|XP_001421201.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO99494.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=297

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D GY++DL+VEEA EL RR+IYHATFRD   GG  SVYH G NGW  ++GDDVGELH+  
Sbjct  204  DQGYKWDLTVEEACELGRRAIYHATFRDAFSGGTVSVYHVGANGWTKVTGDDVGELHFSY  263

Query  197  YP  192
            YP
Sbjct  264  YP  265



>ref|XP_005643539.1| 20S proteasome beta subunit E, type beta 5 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE18995.1| 20S proteasome beta subunit E, type beta 5 [Coccomyxa subellipsoidea 
C-169]
Length=276

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            DNGY++D+ VE+A EL RRSIYHATFRD   GG  SVYH   +GWK + GDDVGELHY  
Sbjct  199  DNGYKWDMDVEDAIELGRRSIYHATFRDAVSGGTVSVYHVTADGWKKVRGDDVGELHYEY  258

Query  197  YPVEAAAVEHE  165
            YP   A   H 
Sbjct  259  YPTPEAHPCHR  269



>ref|XP_002506817.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO68075.1| predicted protein [Micromonas sp. RCC299]
Length=291

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D GYR+DLSVEEA EL RR+IYHATFRD   GG  SVYH   NGW  +SG DVGELH+  
Sbjct  202  DQGYRWDLSVEEACELGRRAIYHATFRDAFSGGTISVYHVNENGWTKVSGTDVGELHFEY  261

Query  197  YPVE  186
            YP +
Sbjct  262  YPAD  265



>ref|XP_001751936.1| predicted protein [Physcomitrella patens]
 gb|EDQ83371.1| predicted protein, partial [Physcomitrella patens]
Length=236

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 54/80 (68%), Gaps = 3/80 (4%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHX---GPNGWKXLSGDDVGELH  207
            D  ++ D+S++EA ELARRSIYHAT RDG  GGV  +      GP+GWK +SGDD GELH
Sbjct  157  DTVFKQDMSIDEAVELARRSIYHATLRDGASGGVTLLKCSLLCGPSGWKKMSGDDGGELH  216

Query  206  YXXYPVEAAAVEHEMTEVPI  147
            +  YPV+    E EM+E  +
Sbjct  217  HSYYPVQETPAEAEMSEASV  236



>ref|XP_002950006.1| hypothetical protein VOLCADRAFT_74437 [Volvox carteri f. nagariensis]
 gb|EFJ49109.1| hypothetical protein VOLCADRAFT_74437 [Volvox carteri f. nagariensis]
Length=272

 Score = 87.8 bits (216),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 50/77 (65%), Gaps = 3/77 (4%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GYR+DLSVEEA EL RRSIYHA FRD   GG  SVYH   +GW  + GDDV ELHY  
Sbjct  198  DSGYRWDLSVEEAIELGRRSIYHAGFRDCASGGTVSVYHVTQDGWTKVRGDDVTELHYQY  257

Query  197  YPVEAAAVEHEMTEVPI  147
            YP  A   +H  T   +
Sbjct  258  YPDPA---QHPATATSV  271



>gb|ADQ00176.1| 20S proteasome beta subunit E type beta 5 [Chlamydomonas sp. 
ICE-L]
Length=170

 Score = 85.9 bits (211),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GY++D+ V+EA EL RR+IYHATFRD   GG  SVYH   +GWK + GDDV ELHY  
Sbjct  96   DSGYKWDMPVDEAIELGRRAIYHATFRDCASGGTVSVYHVTKDGWKKVHGDDVSELHYKY  155

Query  197  YP  192
            YP
Sbjct  156  YP  157



>ref|XP_005851025.1| hypothetical protein CHLNCDRAFT_56983 [Chlorella variabilis]
 gb|EFN58923.1| hypothetical protein CHLNCDRAFT_56983 [Chlorella variabilis]
Length=275

 Score = 85.1 bits (209),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D GYR+DLSVEEA EL +RSIYHATFRD   GG  S YH    GW  + G+DVG+LH+  
Sbjct  199  DEGYRWDLSVEEAVELGQRSIYHATFRDAASGGTVSAYHVTQEGWTKVRGEDVGQLHFNY  258

Query  197  YP  192
            YP
Sbjct  259  YP  260



>ref|XP_001698605.1| 20S proteasome beta subunit E, type beta 5 [Chlamydomonas reinhardtii]
 gb|EDP08098.1| 20S proteasome beta subunit E, type beta 5 [Chlamydomonas reinhardtii]
Length=273

 Score = 84.7 bits (208),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D GYR+D+ VEEA EL RRSIYHA FRD   GG  SVYH   +GW  + GDD+ ELHY  
Sbjct  199  DAGYRWDMPVEEAVELGRRSIYHAGFRDCASGGTVSVYHVTQDGWTKVRGDDISELHYQY  258

Query  197  YP  192
            YP
Sbjct  259  YP  260



>ref|XP_011396916.1| Proteasome subunit beta type-5-B [Auxenochlorella protothecoides]
 gb|KFM24035.1| Proteasome subunit beta type-5-B [Auxenochlorella protothecoides]
Length=277

 Score = 79.3 bits (194),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D GY +D+SVE+A EL +R+IYHAT RD   GG ASVYH    GW  + G+ VGELHY  
Sbjct  201  DAGYSWDMSVEDAVELGQRAIYHATARDAASGGTASVYHVTEAGWTKVRGESVGELHYKY  260

Query  197  YP  192
            YP
Sbjct  261  YP  262



>gb|EKC31214.1| Proteasome subunit beta type-8 [Crassostrea gigas]
Length=777

 Score = 81.6 bits (200),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 35/58 (60%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHY  204
            D+GYR+DLSVEEA +L RRSIYHAT RD   GGV ++YH   +GW+ +S  DV +LHY
Sbjct  711  DSGYRYDLSVEEAIDLGRRSIYHATHRDAYSGGVVNLYHMKESGWEFISQTDVFDLHY  768



>ref|XP_001568804.1| putative proteasome beta 5 subunit [Leishmania braziliensis MHOM/BR/75/M2904]
 emb|CAM43936.1| putative proteasome beta 5 subunit [Leishmania braziliensis MHOM/BR/75/M2904]
Length=302

 Score = 78.6 bits (192),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D GYR DLSVE+A +LARRSI+HAT+RDG  GG+ +VYH   NGW  +S DD  +L+   
Sbjct  239  DTGYRKDLSVEDACDLARRSIFHATYRDGASGGIVTVYHIHANGWTKISRDDQTKLYDRY  298

Query  197  YPVE  186
            +P +
Sbjct  299  FPFK  302



>ref|XP_010703107.1| proteasome beta 5 subunit, putative [Leishmania panamensis]
 gb|AIO02307.1| proteasome beta 5 subunit, putative [Leishmania panamensis]
Length=302

 Score = 78.2 bits (191),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D GYR DLSVE+A +LARRSI+HAT+RDG  GG+ +VYH   NGW  +S DD  +L+   
Sbjct  239  DTGYRKDLSVEDACDLARRSIFHATYRDGASGGIVTVYHIHANGWTKISRDDQTKLYDRY  298

Query  197  YP  192
            +P
Sbjct  299  FP  300



>gb|KIY94545.1| 20S proteasome subunit beta 5 [Monoraphidium neglectum]
Length=68

 Score = 74.7 bits (182),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = -1

Query  356  LSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXXYPVEAA  180
            +SVE+A EL RR+IYHATFRD   GG  SVYH   +GW  + GDDV ELH+  YP  AA
Sbjct  1    MSVEDAIELGRRAIYHATFRDCASGGTVSVYHVTEDGWTKVRGDDVTELHFKYYPDPAA  59



>gb|AAF37285.1|AF226674_1 20S proteasome beta 5 subunit [Trypanosoma brucei]
Length=250

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 47/66 (71%), Gaps = 1/66 (2%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D GYR +L+VEEA +LARRSI+HAT+RDG  GG+ +VYH  P GW  +S DD  +L Y  
Sbjct  186  DQGYRKNLTVEEACDLARRSIFHATYRDGASGGIVTVYHVHPKGWTQISRDDQTKL-YDR  244

Query  197  YPVEAA  180
            Y  ++A
Sbjct  245  YSSQSA  250



>gb|AGG11598.1| hypothetical protein, partial [Leptomonas pyrrhocoris]
Length=304

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D GYR DLSVEEA +LARRSI+HAT+RDG  GG+ +VYH    GW  +S DD  +L+   
Sbjct  241  DTGYRKDLSVEEACDLARRSIFHATYRDGASGGIVTVYHVHEKGWTKISRDDQTKLYERY  300

Query  197  YPVE  186
            +P  
Sbjct  301  FPAR  304



>gb|AGG11403.1| hypothetical protein, partial [Trypanosomatidae sp. TS-2013]
Length=304

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D GYR DL+VEEA +LARRSI+HAT+RD   GG+ SVYH   NGW  +S DD  +L    
Sbjct  240  DQGYRPDLTVEEACDLARRSIFHATYRDAGSGGIISVYHIHKNGWTKISRDDQTQLFARY  299

Query  197  YPVEA  183
            +P  A
Sbjct  300  FPQRA  304



>ref|XP_822850.1| proteasome subunit beta 5 [Trypanosoma brucei brucei TREU927]
 emb|CAC08538.1| proteasome PRCE (beta-5) subunit precursor [Trypanosoma brucei]
 gb|EAN78022.1| proteasome beta 5 subunit, putative [Trypanosoma brucei brucei 
TREU927]
 emb|CBH15656.1| proteasome beta 5 subunit, putative [Trypanosoma brucei gambiense 
DAL972]
Length=310

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 47/66 (71%), Gaps = 1/66 (2%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D GYR +L+VEEA +LARRSI+HAT+RDG  GG+ +VYH  P GW  +S DD  +L Y  
Sbjct  246  DQGYRKNLTVEEACDLARRSIFHATYRDGASGGIVTVYHVHPKGWTQISRDDQTKL-YDR  304

Query  197  YPVEAA  180
            Y  ++A
Sbjct  305  YSSQSA  310



>ref|XP_004333043.1| proteasome endopeptidase subunit, putative [Acanthamoeba castellanii 
str. Neff]
 gb|ELR11030.1| proteasome endopeptidase subunit, putative [Acanthamoeba castellanii 
str. Neff]
Length=275

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 46/75 (61%), Gaps = 1/75 (1%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D GYRFDL+VEEA EL RR+I+HA  RD   GG  +VYH    GWK +S  D  +L+Y  
Sbjct  201  DAGYRFDLTVEEACELGRRAIFHAAHRDAYSGGTINVYHISEQGWKHISAQDSNDLYYEQ  260

Query  197  YPVEAA-AVEHEMTE  156
            Y + A    E EM E
Sbjct  261  YGLAAREKAEKEMNE  275



>gb|EPY20654.1| 20S proteasome subunit beta 5 [Strigomonas culicis]
 gb|EPY20907.1| 20S proteasome subunit beta 5 [Strigomonas culicis]
 gb|EPY25672.1| 20S proteasome subunit beta 5 [Strigomonas culicis]
Length=308

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D GYR DL+VEEA +LARRSI+HAT+RDG  GG+ +VYH  P GW  +S D+  +L    
Sbjct  244  DAGYRKDLTVEEACDLARRSIFHATYRDGASGGIVTVYHVHPKGWTQISRDNQTDLFARY  303

Query  197  YP  192
            +P
Sbjct  304  FP  305



>ref|XP_001686739.1| putative proteasome beta 5 subunit [Leishmania major strain Friedlin]
 emb|CAJ09120.1| putative proteasome beta 5 subunit [Leishmania major strain Friedlin]
Length=302

 Score = 76.3 bits (186),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D GYR DLSVE+A +LARRSI+HAT+RDG  GG+ +VYH    GW  +S DD  +L+   
Sbjct  239  DTGYRKDLSVEDACDLARRSIFHATYRDGASGGIVTVYHVHEKGWTKISRDDQTKLYDRY  298

Query  197  YPVE  186
            +P +
Sbjct  299  FPSQ  302



>ref|XP_003874511.1| putative proteasome beta 5 subunit [Leishmania mexicana MHOM/GT/2001/U1103]
 emb|CBZ26011.1| putative proteasome beta 5 subunit [Leishmania mexicana MHOM/GT/2001/U1103]
Length=302

 Score = 76.3 bits (186),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D GYR DLSVE+A +LARRSI+HAT+RDG  GG+ +VYH    GW  +S DD  +L+   
Sbjct  239  DTGYRKDLSVEDACDLARRSIFHATYRDGASGGIVTVYHVHEKGWTKISRDDQTKLYDRY  298

Query  197  YPVE  186
            +P +
Sbjct  299  FPSQ  302



>ref|XP_001469755.1| putative proteasome beta 5 subunit [Leishmania infantum JPCM5]
 ref|XP_003865288.1| proteasome beta 5 subunit, putative [Leishmania donovani]
 emb|CAM72867.1| putative proteasome beta 5 subunit [Leishmania infantum JPCM5]
 emb|CBZ38611.1| proteasome beta 5 subunit, putative [Leishmania donovani]
Length=302

 Score = 76.3 bits (186),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D GYR DLSVE+A +LARRSI+HAT+RDG  GG+ +VYH    GW  +S DD  +L+   
Sbjct  239  DTGYRKDLSVEDACDLARRSIFHATYRDGASGGIVTVYHVHEKGWTKISRDDQTKLYDRY  298

Query  197  YPVE  186
            +P +
Sbjct  299  FPSQ  302



>ref|XP_011441202.1| PREDICTED: proteasome subunit beta type-5-like [Crassostrea gigas]
Length=275

 Score = 75.9 bits (185),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHY  204
            D+GYR+DLSVEEA +L RRSIYHAT RD   GGV ++YH   +GW+ +S  DV +LHY
Sbjct  209  DSGYRYDLSVEEAIDLGRRSIYHATHRDAYSGGVVNLYHMKESGWEFISQTDVFDLHY  266



>ref|XP_005825075.1| 20S proteasome subunit beta type 5 [Guillardia theta CCMP2712]
 gb|EKX38095.1| 20S proteasome subunit beta type 5 [Guillardia theta CCMP2712]
Length=290

 Score = 75.9 bits (185),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELH  207
            D GY+FD+S+++A EL RR+IYHATFRD   GG  SVYH   NGW  +S DDV  LH
Sbjct  217  DEGYKFDMSIDDACELGRRAIYHATFRDAMSGGRVSVYHVHENGWTKISMDDVQLLH  273



>emb|CCC93748.1| proteasome beta 5 subunit [Trypanosoma congolense IL3000]
Length=307

 Score = 75.9 bits (185),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELH  207
            D+GYR DL+VEEA +LARRSI+HAT+RDG  GG+ +VYH   NGW  +S DD  +L+
Sbjct  246  DHGYRKDLTVEEACDLARRSIFHATYRDGASGGIVTVYHVHSNGWTQISRDDQTKLY  302



>ref|XP_006682354.1| hypothetical protein BATDEDRAFT_14510, partial [Batrachochytrium 
dendrobatidis JAM81]
 gb|EGF76856.1| hypothetical protein BATDEDRAFT_14510, partial [Batrachochytrium 
dendrobatidis JAM81]
Length=267

 Score = 75.5 bits (184),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHY  204
            D GY +DLSV +A +LARRSIYHATFRD   GG  +VYH   +GWK +S  DV +LHY
Sbjct  146  DAGYDYDLSVNDAIDLARRSIYHATFRDAYSGGSVNVYHVQQDGWKFISNTDVMDLHY  203



>ref|XP_009311762.1| proteasome beta 5 subunit [Trypanosoma grayi]
 gb|KEG10005.1| proteasome beta 5 subunit [Trypanosoma grayi]
Length=311

 Score = 75.9 bits (185),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D GYR DL+VE+A +LARRSI+HAT+RDG  GG+ +VYH    GW  +S DD  +L+   
Sbjct  249  DQGYRKDLTVEQACDLARRSIFHATYRDGASGGIVTVYHVHQGGWTQISRDDQTKLYDRY  308

Query  197  YP  192
            YP
Sbjct  309  YP  310



>dbj|BAA10934.1| LMP7 [Ginglymostoma cirratum]
Length=278

 Score = 75.5 bits (184),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHY  204
            D+GYR+DL+VEEA +L RR+IYHAT RD   GG  ++YH   +GW  +S DDVGELH+
Sbjct  210  DSGYRYDLTVEEAYDLGRRAIYHATHRDAYTGGFVNMYHMREDGWIKVSKDDVGELHF  267



>ref|XP_009021669.1| hypothetical protein HELRODRAFT_83371 [Helobdella robusta]
 gb|ESO00235.1| hypothetical protein HELRODRAFT_83371 [Helobdella robusta]
Length=245

 Score = 75.1 bits (183),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHY  204
            D+GYR+DLS +EA +L RR+IYHAT+RD   GG+ S+YH   +GW  +S DDV +LHY
Sbjct  181  DSGYRYDLSDDEAYDLGRRAIYHATYRDAYSGGIVSLYHMKESGWVKISQDDVSDLHY  238



>ref|XP_005707411.1| 20S proteasome subunit beta 5 [Galdieria sulphuraria]
 gb|EME30891.1| 20S proteasome subunit beta 5 [Galdieria sulphuraria]
Length=275

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D GY++++SVEEA EL RRSIYHAT RD   GG  +VY+ GP+GWK +S +D G   +  
Sbjct  198  DQGYKWNMSVEEACELGRRSIYHATHRDAFSGGYINVYYIGPDGWKFISHEDSGFDKHYQ  257

Query  197  YPVEAAAVEHEMTEVPIA  144
            Y  + A       ++ I+
Sbjct  258  YAADKATEAQTQQQMSIS  275



>ref|XP_002063746.1| GK15836 [Drosophila willistoni]
 gb|EDW74732.1| GK15836 [Drosophila willistoni]
Length=283

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHY  204
            D+GY ++L  EEA EL RRSIYHATFRD   GG+  VYH  P GW  +S  D  ELHY
Sbjct  213  DSGYHWNLKDEEAQELGRRSIYHATFRDAYSGGIIRVYHMTPTGWINISNTDCMELHY  270



>ref|XP_002050049.1| GJ21921 [Drosophila virilis]
 gb|EDW61242.1| GJ21921 [Drosophila virilis]
Length=279

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHY  204
            D+GY +DL   EA EL RR+IYHATFRD   GG+  VYH  PNGW  +S  D  ELHY
Sbjct  213  DSGYHWDLKDTEAQELGRRAIYHATFRDAYSGGIVRVYHMTPNGWIKISETDCMELHY  270



>ref|XP_394680.3| PREDICTED: proteasome subunit beta type-5-like [Apis mellifera]
Length=282

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHY  204
            D+GYR+DLS EEA +L +RSIYHAT RD   GG+  VYH  P GW  +S +D  ELHY
Sbjct  214  DSGYRWDLSDEEAYQLGKRSIYHATHRDAYSGGIVRVYHIKPTGWVHISDEDCKELHY  271



>gb|AAL59862.1|AF363583_1 proteasome beta-subunit LMP7 [Heterodontus francisci]
Length=276

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHY  204
            D+GYR+DL+VEEA +L RR+IYHAT RD   GG  ++YH   +GW  +S D+VGELHY
Sbjct  208  DSGYRYDLTVEEAYDLGRRAIYHATHRDAYTGGFINMYHMREDGWIKVSKDNVGELHY  265



>gb|AAC97957.2| proteasome beta 5 subunit [Trypanosoma cruzi]
Length=261

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELH  207
            D GYR +L+VEEA ELARRSI+HAT+RDG  GG+ +VYH    GW  +S DD  +L+
Sbjct  200  DQGYRKNLTVEEACELARRSIFHATYRDGASGGIVTVYHVHQGGWTQISRDDQTKLY  256



>ref|XP_003394930.1| PREDICTED: proteasome subunit beta type-5-like [Bombus terrestris]
Length=282

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHY  204
            D+GYR+DL+ EEA EL RRSIYHAT RD   GG+  VYH  P GW  +S +D  +LHY
Sbjct  214  DSGYRWDLTDEEAYELGRRSIYHATHRDAYSGGIVRVYHMKPTGWVHISDEDCKDLHY  271



>ref|XP_003488646.1| PREDICTED: proteasome subunit beta type-5-like [Bombus impatiens]
Length=282

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHY  204
            D+GYR+DL+ EEA EL RRSIYHAT RD   GG+  VYH  P GW  +S +D  +LHY
Sbjct  214  DSGYRWDLTDEEAYELGRRSIYHATHRDAYSGGIVRVYHMKPTGWVHISDEDCKDLHY  271



>ref|XP_003694700.1| PREDICTED: proteasome subunit beta type-5-like [Apis florea]
Length=282

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHY  204
            D+GYR+DLS EEA EL +RSIYHAT RD   GG+  VYH  P GW  +S +D  +LHY
Sbjct  214  DSGYRWDLSDEEAYELGKRSIYHATHRDAYSGGIVRVYHIKPTGWVHISDEDCKDLHY  271



>emb|CCC51553.1| putative proteasome beta 5 subunit, fragment [Trypanosoma vivax 
Y486]
Length=292

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELH  207
            D GYR DL+VEEA +LARRSI+HAT+RDG  GG+ +VYH    GW  +S DD  +L+
Sbjct  231  DQGYRKDLTVEEACDLARRSIFHATYRDGASGGIVTVYHVHEKGWTQISRDDQTKLY  287



>ref|XP_005110562.1| PREDICTED: proteasome subunit beta type-5-like [Aplysia californica]
Length=281

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHY  204
            D+GY++DLSVEEA +L RR+IYHAT RD   GGV ++YH    GW+ +S  D  ELHY
Sbjct  213  DSGYKWDLSVEEAQDLGRRAIYHATHRDAYSGGVVNLYHMKQTGWEKISQTDTMELHY  270



>gb|KDD75121.1| proteasome subunit protein [Helicosporidium sp. ATCC 50920]
Length=241

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D GY +D+SVE+A EL +R+I+HAT RD   GG ASVYH   +GW  + GD VG+L+Y  
Sbjct  165  DTGYSWDMSVEDAVELGQRAIFHATSRDAASGGTASVYHVTESGWTKVRGDAVGDLYYKY  224

Query  197  YP  192
             P
Sbjct  225  NP  226



>dbj|GAM19629.1| hypothetical protein SAMD00019534_028040 [Acytostelium subglobosum 
LB1]
Length=280

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+G+++++S EEA EL RRS+YHAT RD   GG  +VYH   +GWK +S DD  +L+   
Sbjct  203  DSGFKWEMSNEEAYELGRRSVYHATNRDAMSGGFINVYHVQKDGWKKISSDDCFQLYQKY  262

Query  197  YPVEAAAVE  171
            Y V AA V+
Sbjct  263  YNVRAAGVD  271



>ref|XP_810086.1| proteasome beta 5 subunit [Trypanosoma cruzi strain CL Brener]
 gb|EAN88235.1| proteasome beta 5 subunit, putative [Trypanosoma cruzi]
Length=311

 Score = 73.6 bits (179),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELH  207
            D GYR +L+VEEA ELARRSI+HAT+RDG  GG+ +VYH    GW  +S DD  +L+
Sbjct  250  DQGYRKNLTVEEACELARRSIFHATYRDGASGGIVTVYHVHQGGWTQISRDDQTKLY  306



>gb|EKG04000.1| proteasome beta 5 subunit, putative [Trypanosoma cruzi]
Length=311

 Score = 73.6 bits (179),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELH  207
            D GYR +L+VEEA ELARRSI+HAT+RDG  GG+ +VYH    GW  +S DD  +L+
Sbjct  250  DQGYRKNLTVEEACELARRSIFHATYRDGASGGIVTVYHVHQGGWTQISRDDQTKLY  306



>gb|ESS68038.1| proteasome beta 5 subunit [Trypanosoma cruzi Dm28c]
Length=311

 Score = 73.6 bits (179),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELH  207
            D GYR +L+VEEA ELARRSI+HAT+RDG  GG+ +VYH    GW  +S DD  +L+
Sbjct  250  DQGYRKNLTVEEACELARRSIFHATYRDGASGGIVTVYHVHQGGWTQISRDDQTKLY  306



>ref|XP_810804.1| proteasome beta 5 subunit [Trypanosoma cruzi strain CL Brener]
 gb|EAN88953.1| proteasome beta 5 subunit, putative [Trypanosoma cruzi]
Length=311

 Score = 73.6 bits (179),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELH  207
            D GYR +L+VEEA ELARRSI+HAT+RDG  GG+ +VYH    GW  +S DD  +L+
Sbjct  250  DQGYRKNLTVEEACELARRSIFHATYRDGASGGIVTVYHVHQGGWTQISRDDQTKLY  306



>ref|XP_004994692.1| LMP X protein [Salpingoeca rosetta]
 gb|EGD72869.1| LMP X protein [Salpingoeca rosetta]
Length=292

 Score = 73.2 bits (178),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 43/59 (73%), Gaps = 1/59 (2%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGW-KXLSGDDVGELHY  204
            D GYR+DLSVEEA ELARR+IYHATFRD   GG  ++YH    GW + L+  DVG LHY
Sbjct  219  DAGYRWDLSVEEAHELARRAIYHATFRDAYSGGHINLYHMKETGWERILNMQDVGPLHY  277



>ref|XP_005994469.1| PREDICTED: proteasome subunit beta type-5-like [Latimeria chalumnae]
Length=260

 Score = 72.8 bits (177),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELH  207
            D GY FDLSVEEA +LARR+IYHAT+RD   GGV ++YH   +GW  +  DDV ELH
Sbjct  197  DRGYHFDLSVEEAYDLARRAIYHATYRDAYSGGVVNIYHVREDGWFRVFQDDVLELH  253



>gb|ESL07999.1| proteasome beta 5 subunit [Trypanosoma rangeli SC58]
Length=311

 Score = 73.6 bits (179),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELH  207
            D GYR DL+VE+A +LARRSI+HAT+RDG  GG+ +VYH    GW  +S DD  +L+
Sbjct  250  DQGYRKDLTVEQACDLARRSIFHATYRDGASGGIVTVYHVHQGGWTRISRDDQTQLY  306



>ref|XP_001361733.1| GA11556 [Drosophila pseudoobscura pseudoobscura]
 gb|EAL26312.1| GA11556 [Drosophila pseudoobscura pseudoobscura]
Length=279

 Score = 72.8 bits (177),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHY  204
            D+GYR+DL  +EA +L +R+IYHATFRD   GG+  VYH  P GW  +S  D  ELHY
Sbjct  213  DSGYRWDLQDKEAQDLGQRAIYHATFRDAYSGGIIRVYHMTPTGWINVSNTDCMELHY  270



>gb|EKF32460.1| proteasome beta 5 subunit, putative [Trypanosoma cruzi marinkellei]
Length=311

 Score = 73.2 bits (178),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELH  207
            D GYR +L+VEEA ELARRSI+HAT+RDG  GG+ +VYH    GW  +S DD  +L+
Sbjct  250  DQGYRKNLTVEEACELARRSIFHATYRDGASGGIVTVYHVHQGGWTQVSRDDQTKLY  306



>ref|XP_004534832.1| PREDICTED: proteasome subunit beta type-5-like [Ceratitis capitata]
Length=272

 Score = 72.8 bits (177),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHY  204
            D GY++DL  EEA +L RR+IYHATFRD   GG+  VYH   +GW  +S DD  +LHY
Sbjct  207  DKGYKYDLKDEEAYDLGRRAIYHATFRDAYSGGIVRVYHLKKDGWIKISEDDCKDLHY  264



>ref|XP_002678668.1| predicted protein [Naegleria gruberi]
 gb|EFC45924.1| predicted protein [Naegleria gruberi]
Length=300

 Score = 73.2 bits (178),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 44/70 (63%), Gaps = 0/70 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D GYR DL+ EEA EL RR+IYHAT RD   GG+ +VY    +GW  +S  D+ ELHY  
Sbjct  224  DQGYRADLTEEEACELGRRAIYHATHRDAYSGGIINVYLIRSDGWTKISSTDMNELHYGK  283

Query  197  YPVEAAAVEH  168
            Y  E   +++
Sbjct  284  YAPEKGILDN  293



>gb|AAI55951.1| LOC100127332 protein [Xenopus laevis]
Length=253

 Score = 72.4 bits (176),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELH  207
            D+GY ++L VEEA ELARRSIY AT+RD   GGV ++YH   +GW  +S DDV ELH
Sbjct  189  DSGYNYELEVEEAQELARRSIYQATYRDAYSGGVVNLYHVREDGWVRVSQDDVLELH  245



>dbj|BAM21000.1| proteasome subunit beta type-8, partial [Polypterus senegalus]
Length=226

 Score = 72.4 bits (176),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGEL  210
            D+GYR+DLSVEEA +L RR+I HAT RD   GGV ++YH   NGW  +S DDV EL
Sbjct  162  DSGYRYDLSVEEAYDLGRRAIAHATHRDAYSGGVVNMYHMKENGWIKVSKDDVAEL  217



>ref|XP_001986559.1| GH20460 [Drosophila grimshawi]
 gb|EDW01426.1| GH20460 [Drosophila grimshawi]
Length=280

 Score = 72.4 bits (176),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELH  207
            D+GY +DL   EA EL RR+IYHATFRD   GG+  VYH  PNGW  +S  D  ELH
Sbjct  213  DSGYHWDLKDTEAQELGRRAIYHATFRDAYSGGIVRVYHMTPNGWIKISDTDCMELH  269



>gb|EFX81688.1| hypothetical protein DAPPUDRAFT_303318 [Daphnia pulex]
Length=277

 Score = 72.4 bits (176),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHY  204
            D+GYR DLS EEA EL RR+IYHAT+RD   GG+  VYH    GW  +S  D  ELHY
Sbjct  210  DSGYRNDLSDEEAYELGRRAIYHATYRDASSGGIIRVYHIKSTGWVKISEQDCTELHY  267



>gb|EPY26658.1| 20S proteasome subunit beta 5 [Angomonas deanei]
Length=207

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D GYR +L+VEEA +LARRSI+HAT+RDG  GG+ +VYH   +G+  +S D+  +L Y  
Sbjct  144  DAGYRKNLTVEEACDLARRSIFHATYRDGASGGIVTVYHVHKDGYTRISRDNQTDLFYRY  203

Query  197  YP  192
            +P
Sbjct  204  FP  205



>ref|XP_007439509.1| PREDICTED: proteasome subunit beta type-5 [Python bivittatus]
Length=265

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELH  207
            D GY  DLSVEEA +LARR+IY AT+RD   GG  +VYH GP+GW  +S DDV  L 
Sbjct  197  DRGYSHDLSVEEAYDLARRAIYQATYRDAYSGGSVNVYHVGPDGWIRVSSDDVSNLR  253



>ref|XP_009061521.1| hypothetical protein LOTGIDRAFT_166223 [Lottia gigantea]
 gb|ESO87922.1| hypothetical protein LOTGIDRAFT_166223 [Lottia gigantea]
Length=263

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHY  204
            D+GY +DLSVE+A EL +RSIYHAT RD   GGV ++YH    GW  +S  DV ELHY
Sbjct  196  DSGYSWDLSVEDAYELGKRSIYHATHRDAYSGGVVNLYHMKQTGWIKVSQTDVKELHY  253



>gb|EPY31554.1| 20S proteasome subunit beta 5 [Angomonas deanei]
Length=267

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D GYR +L+VEEA +LARRSI+HAT+RDG  GG+ +VYH   +G+  +S D+  +L Y  
Sbjct  204  DAGYRKNLTVEEACDLARRSIFHATYRDGASGGIVTVYHVHKDGYTRISRDNQTDLFYRY  263

Query  197  YP  192
            +P
Sbjct  264  FP  265



>gb|EHJ72628.1| proteasome subunit beta 5 [Danaus plexippus]
Length=281

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHY  204
            D+GYR+DL  EEA EL RR+IYHAT RD   GG+  VYH    GW  +S +D  ELHY
Sbjct  213  DSGYRWDLEDEEAQELGRRAIYHATHRDAYSGGIIRVYHINDKGWVNISNEDCSELHY  270



>gb|AAY98499.1| LMP X [Swiftia exserta]
Length=268

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHY  204
            D+GYR DLSV+EA +L  R+IYHAT RD   GGV ++YH    GW  +S +DVG+LHY
Sbjct  204  DSGYRPDLSVQEAYDLGERAIYHATHRDAYSGGVVNMYHMQETGWVKVSQNDVGQLHY  261



>gb|ADL27419.1| proteasome subunit beta type [Pheronema raphanus]
Length=279

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHY  204
            D+GY++DLS +EA EL RRSIYHAT RD   GGV ++YH    GW  +S DDV  LHY
Sbjct  215  DSGYKWDLSDDEARELGRRSIYHATHRDAYSGGVVNLYHMKETGWIKISQDDVMTLHY  272



>gb|AJK90586.1| 20S proteasome beta5 subunit [Laodelphax striatella]
Length=275

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GY++DL+ EEA EL RR+IYHATFRD   GG+  VYH    GW  +S  D  +LHY  
Sbjct  210  DSGYKWDLTDEEAYELGRRAIYHATFRDSASGGIIRVYHIKETGWIKISEQDCMDLHYMY  269

Query  197  YPVEAA  180
               E A
Sbjct  270  KEKEKA  275



>ref|XP_002730946.1| PREDICTED: proteasome subunit beta type-5-like [Saccoglossus 
kowalevskii]
Length=277

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHY  204
            D+GYR++LSV+EA +L +R+IYHAT RD   GGV ++YH    GW  +S +DV ELHY
Sbjct  211  DSGYRYELSVQEAYDLGQRAIYHATHRDAYSGGVVNLYHMKETGWIKVSQNDVKELHY  268



>ref|XP_011182734.1| PREDICTED: proteasome subunit beta type-5-like [Bactrocera cucurbitae]
Length=272

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHY  204
            D+GY+++L  EEA +L RR+IYHATFRD   GG+  VYH   +GW  +S DD  ELHY
Sbjct  207  DSGYKYELEDEEAYDLGRRAIYHATFRDAYSGGIIRVYHLKEDGWIKISEDDCKELHY  264



>gb|ENN71488.1| hypothetical protein YQE_11784, partial [Dendroctonus ponderosae]
 gb|ERL87344.1| hypothetical protein D910_04739 [Dendroctonus ponderosae]
Length=279

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 47/72 (65%), Gaps = 1/72 (1%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GY++DL+ EEA +L RRSIYHAT RD   GG+  VYH    GW  +  +D  +LHY  
Sbjct  209  DSGYKWDLTDEEAYDLGRRSIYHATHRDAYSGGIVRVYHMKQTGWVHIDNNDCSDLHY-K  267

Query  197  YPVEAAAVEHEM  162
            Y  E  A+E+++
Sbjct  268  YQAEKEALENQV  279



>gb|EPY36607.1| 20S proteasome subunit beta 5 [Angomonas deanei]
 gb|EPY38653.1| 20S proteasome subunit beta 5 [Angomonas deanei]
Length=305

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D GYR +L+VEEA +LARRSI+HAT+RDG  GG+ +VYH   +G+  +S D+  +L Y  
Sbjct  242  DAGYRKNLTVEEACDLARRSIFHATYRDGASGGIVTVYHVHKDGYTRISRDNQTDLFYRY  301

Query  197  YP  192
            +P
Sbjct  302  FP  303



>emb|CAA66313.1| LMP7-like protein [Botryllus schlosseri]
Length=257

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHY  204
            D+GYR+DLSV EA +L +RSIYHAT RD   GGV ++YH    GW+ +S  DV ++HY
Sbjct  196  DSGYRYDLSVAEALDLGKRSIYHATHRDAYSGGVVNLYHMKETGWEFISQTDVLDIHY  253



>gb|AAR09671.1| similar to Drosophila melanogaster Prosbeta5, partial [Drosophila 
yakuba]
Length=161

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHY  204
            D+GY +DL  EEA EL RR+IYHATFRD   GG+  VYH   +GW  +S  D  ELHY
Sbjct  104  DSGYHWDLEDEEAQELGRRAIYHATFRDAYSGGIIRVYHIKEDGWVNISNTDCMELHY  161



>ref|XP_011214452.1| PREDICTED: proteasome subunit beta type-5-like [Bactrocera dorsalis]
Length=272

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHY  204
            D+GY+++L  EEA +L RR+IYHATFRD   GG+  VYH   +GW  +S DD  ELHY
Sbjct  207  DSGYKYELEDEEAYDLGRRAIYHATFRDAYSGGIIRVYHLKEDGWIKISEDDCKELHY  264



>dbj|BAA10933.1| LMP7 of nurse shark [Ginglymostoma cirratum]
Length=274

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHY  204
            D+GYR+DL+V+EA +LA+R+IYHAT RD   GG  ++YH   NGW  +S +DVG LH+
Sbjct  210  DSGYRYDLTVKEAYDLAQRAIYHATHRDAYSGGTVNMYHMRENGWIKVSQEDVGVLHH  267



>dbj|BAO50685.1| proteasome subunit beta type 8,F-type, partial [Gymnothorax kidako]
Length=204

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHY  204
            D+GYR+DL+V EA ELA+R+I+HAT RD   GG  ++YH   +GW  +S +DVG+L+Y
Sbjct  140  DSGYRYDLTVPEAYELAQRAIFHATCRDAYSGGTVNMYHMREDGWIKVSQEDVGDLYY  197



>ref|XP_002941560.1| PREDICTED: proteasome subunit beta type-5 [Xenopus (Silurana) 
tropicalis]
Length=257

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELH  207
            D GY +++ VEEA ELARRSIY AT+RD   GGV ++YH   +GW  +S DDV +LH
Sbjct  193  DRGYNYEMEVEEAQELARRSIYQATYRDAYSGGVVNLYHVREDGWVRVSQDDVADLH  249



>ref|XP_008543771.1| PREDICTED: proteasome subunit beta type-5 [Microplitis demolitor]
Length=281

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHY  204
            D+GYR+DL+ EEA +L RRSIYHAT RD   GG+  VYH    GW  +S DD  +LHY
Sbjct  214  DSGYRWDLTDEEAYDLGRRSIYHATHRDAYSGGIVRVYHMKETGWVRISDDDCKDLHY  271



>emb|CAA66312.1| LMP7-like protein [Geodia cydonium]
Length=280

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHY  204
            D+GY +DLSVEEA +L +R+IYHAT RD   GGV ++YH    GW  +S  DV ELHY
Sbjct  214  DSGYSYDLSVEEARDLGKRAIYHATHRDAYSGGVVNLYHMMETGWVKVSQTDVKELHY  271



>ref|XP_005188727.1| PREDICTED: proteasome subunit beta type-5 [Musca domestica]
Length=281

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELH  207
            D+GY +DL  E A EL RR+IYHAT+RD   GG+  VYH  PNGW  +S  D  ELH
Sbjct  213  DSGYHWDLEDEAAQELGRRAIYHATYRDAYSGGIVRVYHMTPNGWINISNTDCMELH  269



>emb|CCF75037.1| unnamed protein product [Babesia microti strain RI]
Length=234

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 40/58 (69%), Gaps = 1/58 (2%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGW-KXLSGDDVGELH  207
            D+GY+FDL+V+EA EL +R IY AT RDG  GG  +VYH   NGW K +   DV ELH
Sbjct  167  DDGYKFDLTVDEAVELGKRGIYQATLRDGGSGGCVTVYHVHQNGWTKVVDRQDVSELH  224



>emb|CEG76257.1| Putative Proteasome subunit beta type [Rhizopus microsporus]
Length=277

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHY  204
            D+GY FDLSV++A EL RRSIYHAT RD   GG  ++YH   NGW+     DVG+LH+
Sbjct  209  DSGYDFDLSVKDALELGRRSIYHATHRDAMSGGSVNLYHVTENGWEYHGNHDVGQLHW  266



>dbj|BAO50689.1| proteasome subunit beta type 8,A-type, partial [Conger japonicus]
Length=204

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHY  204
            D+GYR+DLSV EA +LA+R+I+HAT RD   GGV ++YH   +GW  +S DDVG+L++
Sbjct  140  DSGYRYDLSVPEAYDLAQRAIFHATHRDAYTGGVINMYHMREDGWIKVSQDDVGDLYH  197



>ref|XP_002080955.1| GD10758 [Drosophila simulans]
 gb|EDX06540.1| GD10758 [Drosophila simulans]
Length=282

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHY  204
            D+GY +DL  EEA EL RR+IYHATFRD   GG+  VYH   +GW  +S  D  ELHY
Sbjct  213  DSGYHWDLEDEEAQELGRRAIYHATFRDAYSGGIIRVYHIKEDGWVNISNTDCMELHY  270



>ref|XP_002033298.1| GM21240 [Drosophila sechellia]
 gb|EDW47311.1| GM21240 [Drosophila sechellia]
Length=282

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHY  204
            D+GY +DL  EEA EL RR+IYHATFRD   GG+  VYH   +GW  +S  D  ELHY
Sbjct  213  DSGYHWDLEDEEAQELGRRAIYHATFRDAYSGGIIRVYHIKEDGWVNISNTDCMELHY  270



>ref|XP_004347536.2| hypothetical protein CAOG_04785 [Capsaspora owczarzaki ATCC 30864]
 gb|KJE94093.1| hypothetical protein CAOG_004785 [Capsaspora owczarzaki ATCC 
30864]
Length=305

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHY  204
            D G+R+D++ EEA EL RRSIYHAT RD   GG  +VYH    GW  +S  DV +LHY
Sbjct  240  DAGFRYDMTPEEACELGRRSIYHATHRDAYSGGFVNVYHVREEGWVKISSTDVNQLHY  297



>gb|EFA82937.1| proteasome subunit beta type 5 [Polysphondylium pallidum PN500]
Length=277

 Score = 70.9 bits (172),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+G+ ++++ E+A EL RRS+YHAT RD   GG  +VYH   +GWK +S DD  +L+   
Sbjct  202  DSGFDWNMTDEQACELGRRSVYHATHRDAMSGGFINVYHVQKDGWKKISSDDCFQLYQKY  261

Query  197  YPVEAAAVE  171
            Y V+A  V+
Sbjct  262  YNVKATGVD  270



>ref|XP_001867951.1| proteasome subunit beta type 8 [Culex quinquefasciatus]
 gb|EDS45912.1| proteasome subunit beta type 8 [Culex quinquefasciatus]
Length=263

 Score = 70.5 bits (171),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHY  204
            D+GYR+DLS E+A +L RR+IYHAT RD   GG+  VYH  P GW  +S  D  +LH+
Sbjct  194  DSGYRWDLSDEDAQDLGRRAIYHATHRDAYSGGIVRVYHIKPTGWVNISNQDCMDLHF  251



>gb|EFX80663.1| hypothetical protein DAPPUDRAFT_303852 [Daphnia pulex]
Length=276

 Score = 70.5 bits (171),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHY  204
            D+GY+ DL+ EEA EL RR+IYHAT+RD   GG+  VYH    GW  +S  D  ELHY
Sbjct  209  DSGYKPDLTDEEAYELGRRAIYHATYRDASSGGIIRVYHIKSTGWVKISEQDCTELHY  266



>ref|XP_002062691.1| GK19557 [Drosophila willistoni]
 gb|EDW73677.1| GK19557 [Drosophila willistoni]
Length=362

 Score = 71.6 bits (174),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 57/97 (59%), Gaps = 2/97 (2%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELH--Y  204
            D GY++D++ +EA +LARR+IYHAT +D   GG+  +YH    GWK +   D  ELH  Y
Sbjct  211  DTGYKWDITDQEAYDLARRAIYHATSKDAYSGGIVRLYHITEKGWKNVGNTDCWELHEQY  270

Query  203  XXYPVEAAAVEHEMTEVPIA*TDPFLENKSVCSELKS  93
                 +    +H+  +   + T P++E K + +++++
Sbjct  271  SKEEQKREGGDHDQNQPCTSQTQPWIERKLIETQMEA  307



>gb|AEE61820.1| unknown [Dendroctonus ponderosae]
Length=279

 Score = 70.5 bits (171),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 47/72 (65%), Gaps = 1/72 (1%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GY++DL+ EEA +L RRSIYHAT RD   GG+  VYH    GW  +  +D  +LHY  
Sbjct  209  DSGYKWDLTDEEAYDLGRRSIYHATHRDAYSGGIVRVYHMKQTGWVHIDNNDCTDLHY-K  267

Query  197  YPVEAAAVEHEM  162
            Y  E  A+E+++
Sbjct  268  YQEEKEALENQV  279



>ref|XP_011184652.1| PREDICTED: proteasome subunit beta type-5-like [Bactrocera cucurbitae]
Length=268

 Score = 70.5 bits (171),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHY  204
            D+GY+ DL  +EA EL RR+IYHATFRD   GG+  VYH   +GW  +S DD  +LHY
Sbjct  204  DSGYKNDLEDQEAYELGRRAIYHATFRDAYSGGIIRVYHLKKDGWIKISEDDCKDLHY  261



>ref|XP_006619720.1| PREDICTED: proteasome subunit beta type-5-like [Apis dorsata]
Length=282

 Score = 70.5 bits (171),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHY  204
            D+GYR+DLS EEA EL +RSIYHAT RD   GG+  VYH    GW  +S +D  +LHY
Sbjct  214  DSGYRWDLSDEEAYELGKRSIYHATHRDAYSGGIVRVYHIKSTGWVHISDEDCKDLHY  271



>gb|EFA07659.1| hypothetical protein TcasGA2_TC030625 [Tribolium castaneum]
Length=273

 Score = 70.5 bits (171),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHY  204
            D+GY++DL+ EEA +L RRSIYHAT RD   GG+  VYH  P GW  +  +D  +LHY
Sbjct  203  DSGYKWDLTDEEAYDLGRRSIYHATHRDAYSGGIVRVYHMKPTGWVHIDNNDCMDLHY  260



>gb|ELT88834.1| hypothetical protein CAPTEDRAFT_150903 [Capitella teleta]
Length=275

 Score = 70.5 bits (171),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHY  204
            D+ YR+DLSVEEA  L  R+IYHA  RD   GGV ++YH   +GW  +S +D+GELHY
Sbjct  211  DSSYRWDLSVEEAYALGERAIYHAAHRDAFTGGVVNMYHMKESGWVKVSQNDIGELHY  268



>dbj|BAO50692.1| proteasome subunit beta type 8,A-type, partial [Anguilla japonica]
Length=204

 Score = 69.7 bits (169),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHY  204
            D+GYR+DL+V EA ELA+R+++HAT RD   GG+ ++YH   +GW  +S +DV +L+Y
Sbjct  140  DSGYRYDLTVPEAYELAQRAVFHATCRDAYSGGIVNMYHMRKDGWIKVSQEDVADLYY  197



>ref|XP_001745267.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ89845.1| predicted protein [Monosiga brevicollis MX1]
Length=247

 Score = 70.1 bits (170),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHY  204
            D GY++DLS EEA +L RR+IYHATFRD   GG  ++YH    GW  +S D V +LHY
Sbjct  179  DAGYKWDLSDEEAQDLGRRAIYHATFRDAYSGGTVNLYHMRQTGWVKISADSVHDLHY  236



>ref|XP_006832137.1| PREDICTED: proteasome subunit beta type-5-like [Chrysochloris 
asiatica]
Length=160

 Score = 69.3 bits (168),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELH  207
            D GY +DL VE+A +LARR+IY AT+RD   GGV ++YH   +GW  +S D+V ELH
Sbjct  96   DRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGVVNLYHVREDGWIRVSSDNVAELH  152



>ref|XP_011351485.1| PREDICTED: proteasome subunit beta type-5 [Cerapachys biroi]
 gb|EZA61045.1| Proteasome subunit beta type-5 [Cerapachys biroi]
Length=288

 Score = 70.5 bits (171),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GYR+DL+ E+A EL RRSIYHAT RD   GG+  VYH    GW  +S +D  +LHY  
Sbjct  214  DSGYRWDLTDEQAYELGRRSIYHATHRDAYSGGIIRVYHMKSTGWVHISDEDSKDLHYAY  273

Query  197  YPVEAAA  177
            +  + AA
Sbjct  274  HAEKKAA  280



>ref|XP_970194.1| PREDICTED: proteasome subunit beta type-5 [Tribolium castaneum]
Length=279

 Score = 70.5 bits (171),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHY  204
            D+GY++DL+ EEA +L RRSIYHAT RD   GG+  VYH  P GW  +  +D  +LHY
Sbjct  209  DSGYKWDLTDEEAYDLGRRSIYHATHRDAYSGGIVRVYHMKPTGWVHIDNNDCMDLHY  266



>gb|ETO17068.1| hypothetical protein RFI_20264 [Reticulomyxa filosa]
Length=1077

 Score = 72.8 bits (177),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 32/62 (52%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D  YR DLSVE+A  LA+R+IYHAT RD   GG  +VY   PNGW+ +S +D  +LH   
Sbjct  280  DTEYRSDLSVEDAIALAKRAIYHATHRDAYSGGFVNVYWVTPNGWRNISHEDSFDLHQRY  339

Query  197  YP  192
            +P
Sbjct  340  FP  341



>ref|XP_008292170.1| PREDICTED: proteasome subunit beta type-5 [Stegastes partitus]
Length=271

 Score = 70.1 bits (170),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELH  207
            D+G RFDL+VEEA ELARR+IY AT+RD   GG  ++YH    GW  +S DDV  LH
Sbjct  208  DSGLRFDLTVEEACELARRAIYQATYRDAYSGGQVNLYHVHGKGWTRVSQDDVLMLH  264



>dbj|BAM18296.1| proteasome beta5 subunit [Papilio xuthus]
Length=283

 Score = 70.1 bits (170),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHY  204
            D+GY++DL  +EA EL RR+IYHAT RD   GG+  VYH   NGW  +S +D  +LHY
Sbjct  213  DSGYKWDLEDKEAQELGRRAIYHATHRDAYSGGIIRVYHISENGWVNISNEDCSDLHY  270



>gb|AHC95478.1| proteasome subunit beta type-5-like protein, partial [Biomphalaria 
glabrata]
Length=123

 Score = 68.6 bits (166),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHY  204
            D+GY++DLS +EA EL +R IYHAT RD   GG+ S+YH    GW+ +S  DV +LHY
Sbjct  55   DSGYKWDLSDQEAYELGKRGIYHATHRDAYSGGIVSLYHMKQTGWEKISMTDVTDLHY  112



>gb|KFH65162.1| 20S proteasome subunit beta 5 [Mortierella verticillata NRRL 
6337]
Length=276

 Score = 70.1 bits (170),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 43/69 (62%), Gaps = 2/69 (3%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGEL--HY  204
            D G+RFD+SV EA EL +R++YHATFRD   GG   +YH   +GW+     DV +L  HY
Sbjct  208  DTGFRFDMSVPEALELGKRAVYHATFRDAYSGGSVHLYHVKSDGWEICGEFDVNQLHWHY  267

Query  203  XXYPVEAAA  177
               P EA A
Sbjct  268  KSQPKEAIA  276



>ref|XP_001663403.1| AAEL013236-PA [Aedes aegypti]
 gb|EAT34534.1| AAEL013236-PA [Aedes aegypti]
Length=282

 Score = 70.1 bits (170),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHY  204
            D+GY++DL+ EEA +L RR+IYHAT RD   GG+  VYH  P GW  +S  D  +LH+
Sbjct  213  DSGYKWDLTDEEAQDLGRRAIYHATHRDAYSGGIVRVYHIKPTGWVNISNQDCMDLHF  270



>ref|XP_001961263.1| GF13778 [Drosophila ananassae]
 gb|EDV38085.1| GF13778 [Drosophila ananassae]
Length=284

 Score = 70.1 bits (170),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHY  204
            D+GY +DL  + A EL RR+IYHATFRD   GG+  VYH  P GW  +S  D  ELHY
Sbjct  213  DSGYHWDLEDDVAQELGRRAIYHATFRDAYSGGIIRVYHMTPTGWIKISETDCMELHY  270



>dbj|BAO50693.1| proteasome subunit beta type 8,F-type, partial [Anguilla japonica]
Length=204

 Score = 69.3 bits (168),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHY  204
            D+GYR+DL+V EA ELA+R+I+HAT RD   GG  ++YH   +GW  +S +DV +L+Y
Sbjct  140  DSGYRYDLTVPEAYELAQRAIFHATCRDAYTGGTVNMYHMRKDGWIKVSQEDVADLYY  197



>dbj|BAO49776.1| proteasome subunit beta type 8,A-type-A, partial [Anguilla japonica]
Length=170

 Score = 68.9 bits (167),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHY  204
            D+GYR+DL+V EA ELA+R+I+HAT RD   GG  ++YH   +GW  +S +DV +L+Y
Sbjct  113  DSGYRYDLTVPEAYELAQRAIFHATCRDAYTGGTVNMYHMRKDGWIKVSQEDVADLYY  170



>ref|XP_002435468.1| 20S proteasome, regulatory subunit beta, putative [Ixodes scapularis]
 gb|EEC08298.1| 20S proteasome, regulatory subunit beta, putative [Ixodes scapularis]
Length=279

 Score = 69.7 bits (169),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 43/68 (63%), Gaps = 1/68 (1%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            DNGY+FD+   EA ELAR++IYHATFRD   GG+  VY     GW+ +S +D  +LHY  
Sbjct  213  DNGYKFDMEDGEAFELARKAIYHATFRDSASGGIVRVYRVTEAGWECISEEDCMDLHY-K  271

Query  197  YPVEAAAV  174
            Y  E   V
Sbjct  272  YQAEKMQV  279



>gb|AAL59861.1|AF363582_1 proteasome beta-subunit LMP7-like protein [Heterodontus francisci]
Length=285

 Score = 69.7 bits (169),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 46/65 (71%), Gaps = 1/65 (2%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GY++DLSV++A  LA+R+IYHAT RD   GG  ++YH   NGW  +S +DVG LH+  
Sbjct  210  DSGYKYDLSVQDAYNLAQRAIYHATHRDAYSGGTVNMYHMRDNGWIKVSQEDVGVLHH-K  268

Query  197  YPVEA  183
            Y  EA
Sbjct  269  YAAEA  273



>dbj|BAO50686.1| proteasome subunit beta type 8,A-type, partial [Nettastoma parviceps]
Length=204

 Score = 68.9 bits (167),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHY  204
            D+GYR+DLSV EA +LA+R+I+HAT RD   GG+ ++YH    GW  +S DDVG+L++
Sbjct  140  DSGYRYDLSVPEAYDLAQRAIFHATHRDAYTGGIINMYHMREEGWIKVSQDDVGDLYH  197



>ref|NP_652014.1| proteasome beta5 subunit, isoform A [Drosophila melanogaster]
 ref|NP_724974.1| proteasome beta5 subunit, isoform B [Drosophila melanogaster]
 gb|AAF58748.1| proteasome beta5 subunit, isoform A [Drosophila melanogaster]
 gb|AAL39526.1| LD08717p [Drosophila melanogaster]
 gb|AAM68751.1| proteasome beta5 subunit, isoform B [Drosophila melanogaster]
 gb|ACL83913.1| Prosbeta5-PA, partial [synthetic construct]
 gb|ACL89002.1| Prosbeta5-PA [synthetic construct]
Length=282

 Score = 69.7 bits (169),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHY  204
            D+GY +DL  +EA EL RR+IYHATFRD   GG+  VYH   +GW  +S  D  ELHY
Sbjct  213  DSGYHWDLEDKEAQELGRRAIYHATFRDAYSGGIIRVYHIKEDGWVNISNTDCMELHY  270



>ref|XP_004934300.1| PREDICTED: proteasome subunit beta type-5-like, partial [Bombyx 
mori]
Length=103

 Score = 67.4 bits (163),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHY  204
            D+GY +DLS E+A EL RR+IYHAT RD   GG+  VYH    GW  +S +D  +LHY
Sbjct  33   DSGYSWDLSDEDAQELGRRAIYHATHRDAYSGGIIRVYHINDKGWVNISNEDCSDLHY  90



>gb|EIE77859.1| proteasome component PRE2 [Rhizopus delemar RA 99-880]
Length=277

 Score = 69.7 bits (169),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHY  204
            D+GY +DLSV++A EL RRSIYHAT RD   GG  ++YH   NGW      DVGELH+
Sbjct  209  DSGYNYDLSVKDALELGRRSIYHATHRDAMSGGSVNLYHVTENGWDYHGNHDVGELHW  266



>gb|AAF26416.1|AF217726_1 20S proteasome beta5 subunit [Drosophila melanogaster]
Length=282

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHY  204
            D+GY +DL  +EA EL RR+IYHATFRD   GG+  VYH   +GW  +S  D  ELHY
Sbjct  213  DSGYHWDLEDKEAQELGRRAIYHATFRDAYSGGIIRVYHIKEDGWVNISNTDCMELHY  270



>gb|EIE87710.1| proteasome component PRE2 [Rhizopus delemar RA 99-880]
Length=187

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHY  204
            D+GY +DLSV++A EL RRSIYHAT RD   GG  ++YH   NGW      DVGELH+
Sbjct  119  DSGYDYDLSVKDALELGRRSIYHATHRDAMSGGSVNLYHVTENGWDYHGNHDVGELHW  176



>ref|XP_011407456.1| PREDICTED: proteasome subunit beta type-5-like, partial [Amphimedon 
queenslandica]
Length=162

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHY  204
            D+ Y++ +S+EEA EL +R+IYHAT+RD   GGV ++YH   +GW  +S  DV  LHY
Sbjct  96   DSTYKWSMSIEEARELGKRAIYHATYRDSYSGGVVNLYHVQEDGWTKVSQTDVKTLHY  153



>dbj|BAO50684.1| proteasome subunit beta type 8,A-type, partial [Gymnothorax kidako]
Length=204

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELH  207
            D+GYR+DL+V EA ELA+R+I+HAT RD   GG  ++YH   +GW  +S +DVG+L+
Sbjct  140  DSGYRYDLTVPEAYELAQRAIFHATCRDAYSGGTVNMYHMREDGWIKVSQEDVGDLY  196



>ref|XP_006835507.1| PREDICTED: proteasome subunit beta type-5 [Chrysochloris asiatica]
Length=263

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELH  207
            D GY +DL VE+A +LARR+IY AT+RD   GGV ++YH   +GW  +S D+V ELH
Sbjct  199  DRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGVVNLYHVREDGWIRVSSDNVAELH  255



>ref|XP_008332973.1| PREDICTED: proteasome subunit beta type-5 [Cynoglossus semilaevis]
Length=278

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELH  207
            D+G R+DLSV+EA EL RR+IY AT+RD   GG  ++YH    GW  +S DDV +LH
Sbjct  208  DSGLRYDLSVDEACELGRRAIYQATYRDAYSGGQVNLYHVQSEGWTRVSQDDVLKLH  264



>ref|XP_006001021.1| PREDICTED: proteasome subunit beta type-8-like [Latimeria chalumnae]
Length=271

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGEL  210
            D+GYR+DLSVEEA +L RR+I HAT RD   GGV ++YH   +GW  +  DDV EL
Sbjct  207  DSGYRYDLSVEEAYDLGRRAICHATHRDAYSGGVVNMYHMRQDGWIKVCKDDVAEL  262



>ref|XP_004474611.1| PREDICTED: proteasome subunit beta type-5 [Dasypus novemcinctus]
Length=262

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELH  207
            D GY +DL VEEA +LARR+IY AT+RD   GGV ++YH   +GW  +S D+V +LH
Sbjct  199  DRGYTYDLEVEEAYDLARRAIYQATYRDAYSGGVVNLYHVREDGWIRVSSDNVADLH  255



>ref|XP_007949375.1| PREDICTED: proteasome subunit beta type-5 isoform X2 [Orycteropus 
afer afer]
Length=160

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELH  207
            D GY +DL VE+A +LARR+IY AT+RD   GGV ++YH   +GW  +S D+V +LH
Sbjct  96   DRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGVVNLYHVREDGWIRVSSDNVADLH  152



>gb|AEL23024.1| proteasome subunit beta type 8 [Cherax quadricarinatus]
Length=96

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHY  204
            D+GYR D+S  EA EL RR+IYHAT RD   GGV  VYH   +GW  ++ +D  +LHY
Sbjct  28   DSGYRSDMSDTEAQELGRRAIYHATHRDAYSGGVVRVYHIKEDGWTKITEEDNKDLHY  85



>ref|XP_011254239.1| PREDICTED: proteasome subunit beta type-5 [Camponotus floridanus]
 gb|EFN69722.1| Proteasome subunit beta type-5 [Camponotus floridanus]
Length=286

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 42/66 (64%), Gaps = 1/66 (2%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GYR+DL+ E+A EL RRSIYHAT RD   GG+  VYH    GW  +S  D  +LHY  
Sbjct  214  DSGYRWDLTDEQAYELGRRSIYHATHRDAYSGGIIRVYHMKSTGWVHISDQDSKDLHY-A  272

Query  197  YPVEAA  180
            Y  E A
Sbjct  273  YQAEKA  278



>dbj|BAO50691.1| proteasome subunit beta type 8,A-type, partial [Conger myriaster]
Length=204

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHY  204
            D+GYR DLSV EA +LA+R+I+HAT RD   GG+ ++YH   +GW  +S DDVG+L++
Sbjct  140  DSGYRHDLSVPEAYDLAQRAIFHATHRDAYTGGIINMYHMREDGWIKVSQDDVGDLYH  197



>dbj|BAO50694.1| proteasome subunit beta type 8,F-type, partial [Pantodon buchholzi]
Length=204

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHY  204
            D+GYR+DL+V EA +LA+RSI+HAT RD   GG  ++YH    GW  +S +DVG+L++
Sbjct  140  DSGYRYDLTVPEAYDLAQRSIFHATHRDAYSGGTVNMYHMQETGWIKVSQEDVGDLYH  197



>dbj|BAO50690.1| proteasome subunit beta type 8,A-type, partial [Conger myriaster]
Length=204

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHY  204
            D+GYR DLSV EA +LA+R+I+HAT RD   GG+ ++YH   +GW  +S DDVG+L++
Sbjct  140  DSGYRHDLSVPEAYDLAQRAIFHATHRDAYTGGIINMYHMREDGWIKVSQDDVGDLYH  197



>ref|XP_003388964.1| PREDICTED: proteasome subunit beta type-5-like [Amphimedon queenslandica]
Length=280

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHY  204
            D+ Y++ +S+EEA EL +R+IYHAT+RD   GGV ++YH   +GW  +S  DV  LHY
Sbjct  207  DSTYKWSMSIEEARELGKRAIYHATYRDSYSGGVVNLYHVQEDGWTKVSQTDVKSLHY  264



>ref|XP_011502385.1| PREDICTED: proteasome subunit beta type-5 [Ceratosolen solmsi 
marchali]
Length=244

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 44/70 (63%), Gaps = 1/70 (1%)
 Frame = -1

Query  377  DNGYRFDLSVEEAAELARRSIYHATFRDGXXGGVASVYHXGPNGWKXLSGDDVGELHYXX  198
            D+GY ++L+ +EA EL RR+IYHAT RD   GG+  VYH    GW  +S  D  +LHY  
Sbjct  176  DSGYHWELTDQEAYELGRRAIYHATHRDAYSGGIVRVYHMKSTGWIHISDQDCKDLHY-T  234

Query  197  YPVEAAAVEH  168
            Y  E  AVE+
Sbjct  235  YTKEKVAVEN  244



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 554820161530