BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF007P14

Length=724
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009594768.1|  PREDICTED: multiple C2 and transmembrane dom...    306   4e-95   Nicotiana tomentosiformis
ref|XP_009614150.1|  PREDICTED: multiple C2 and transmembrane dom...    306   4e-95   Nicotiana tomentosiformis
ref|XP_009785357.1|  PREDICTED: multiple C2 and transmembrane dom...    306   6e-95   Nicotiana sylvestris
ref|XP_009799235.1|  PREDICTED: extended synaptotagmin-1-like           306   9e-95   Nicotiana sylvestris
ref|XP_004249277.1|  PREDICTED: extended synaptotagmin-1-like           305   2e-94   Solanum lycopersicum
emb|CDP10110.1|  unnamed protein product                                302   2e-93   Coffea canephora [robusta coffee]
ref|XP_011078851.1|  PREDICTED: multiple C2 and transmembrane dom...    301   3e-93   Sesamum indicum [beniseed]
gb|EYU20709.1|  hypothetical protein MIMGU_mgv1a001689mg                301   6e-93   Erythranthe guttata [common monkey flower]
ref|XP_004249278.1|  PREDICTED: multiple C2 and transmembrane dom...    300   1e-92   Solanum lycopersicum
ref|XP_006351338.1|  PREDICTED: multiple C2 and transmembrane dom...    300   2e-92   Solanum tuberosum [potatoes]
ref|XP_009587222.1|  PREDICTED: multiple C2 and transmembrane dom...    299   3e-92   Nicotiana tomentosiformis
ref|XP_006351337.1|  PREDICTED: multiple C2 and transmembrane dom...    298   5e-92   
gb|KDO57727.1|  hypothetical protein CISIN_1g004109mg                   296   2e-91   Citrus sinensis [apfelsine]
ref|XP_009369854.1|  PREDICTED: multiple C2 and transmembrane dom...    297   2e-91   Pyrus x bretschneideri [bai li]
ref|XP_009766493.1|  PREDICTED: multiple C2 and transmembrane dom...    296   2e-91   Nicotiana sylvestris
ref|XP_006437045.1|  hypothetical protein CICLE_v10030764mg             296   3e-91   Citrus clementina [clementine]
ref|XP_008387239.1|  PREDICTED: multiple C2 and transmembrane dom...    296   3e-91   
ref|XP_002322682.2|  hypothetical protein POPTR_0016s04960g             296   3e-91   
ref|XP_004304385.1|  PREDICTED: multiple C2 and transmembrane dom...    296   3e-91   Fragaria vesca subsp. vesca
ref|XP_010057953.1|  PREDICTED: extended synaptotagmin-1-like           296   4e-91   Eucalyptus grandis [rose gum]
ref|XP_007201936.1|  hypothetical protein PRUPE_ppa001850mg             295   5e-91   
gb|EPS67145.1|  hypothetical protein M569_07629                         296   5e-91   Genlisea aurea
ref|XP_008240960.1|  PREDICTED: multiple C2 and transmembrane dom...    296   6e-91   Prunus mume [ume]
ref|XP_008443079.1|  PREDICTED: extended synaptotagmin-1                295   7e-91   Cucumis melo [Oriental melon]
gb|KDP24596.1|  hypothetical protein JCGZ_25512                         295   7e-91   Jatropha curcas
gb|KJB36100.1|  hypothetical protein B456_006G141200                    295   9e-91   Gossypium raimondii
emb|CAN80955.1|  hypothetical protein VITISV_013781                     295   1e-90   Vitis vinifera
ref|XP_004249163.1|  PREDICTED: extended synaptotagmin-1-like           295   1e-90   Solanum lycopersicum
ref|XP_002278165.1|  PREDICTED: extended synaptotagmin-1                295   1e-90   Vitis vinifera
ref|XP_009376104.1|  PREDICTED: multiple C2 and transmembrane dom...    295   2e-90   Pyrus x bretschneideri [bai li]
gb|AAK74053.1|  F19C24.20/F19C24.20                                     280   3e-90   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007145661.1|  hypothetical protein PHAVU_007G257800g             293   4e-90   Phaseolus vulgaris [French bean]
ref|XP_006362239.1|  PREDICTED: multiple C2 and transmembrane dom...    293   5e-90   Solanum tuberosum [potatoes]
ref|XP_010111396.1|  Multiple C2 and transmembrane domain-contain...    293   5e-90   Morus notabilis
ref|XP_007028942.1|  Calcium-dependent lipid-binding (CaLB domain...    293   6e-90   Theobroma cacao [chocolate]
ref|XP_004493560.1|  PREDICTED: multiple C2 and transmembrane dom...    293   7e-90   Cicer arietinum [garbanzo]
ref|XP_003625221.1|  Anthranilate phosphoribosyltransferase-like ...    293   7e-90   Medicago truncatula
ref|XP_004136579.1|  PREDICTED: multiple C2 and transmembrane dom...    293   9e-90   Cucumis sativus [cucumbers]
ref|XP_010548191.1|  PREDICTED: multiple C2 and transmembrane dom...    293   9e-90   Tarenaya hassleriana [spider flower]
gb|KHN07409.1|  Multiple C2 and transmembrane domain-containing p...    292   1e-89   Glycine soja [wild soybean]
ref|XP_008360635.1|  PREDICTED: multiple C2 and transmembrane dom...    292   1e-89   
ref|XP_003521201.1|  PREDICTED: multiple C2 and transmembrane dom...    292   1e-89   Glycine max [soybeans]
ref|XP_010554852.1|  PREDICTED: multiple C2 and transmembrane dom...    292   2e-89   
ref|XP_010672701.1|  PREDICTED: multiple C2 and transmembrane dom...    292   2e-89   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007162297.1|  hypothetical protein PHAVU_001G140200g             291   2e-89   Phaseolus vulgaris [French bean]
gb|KHN26368.1|  Multiple C2 and transmembrane domain-containing p...    289   7e-89   Glycine soja [wild soybean]
gb|ACN28542.1|  unknown                                                 283   8e-89   Zea mays [maize]
ref|XP_003554197.1|  PREDICTED: multiple C2 and transmembrane dom...    290   1e-88   Glycine max [soybeans]
emb|CDX98254.1|  BnaC06g16150D                                          288   3e-88   
ref|XP_009104078.1|  PREDICTED: multiple C2 and transmembrane dom...    288   3e-88   Brassica rapa
emb|CDX67712.1|  BnaA07g17520D                                          288   4e-88   
emb|CDY69710.1|  BnaAnng31280D                                          288   4e-88   Brassica napus [oilseed rape]
ref|XP_009139005.1|  PREDICTED: extended synaptotagmin-1-like           288   5e-88   Brassica rapa
ref|XP_006402831.1|  hypothetical protein EUTSA_v10005798mg             288   6e-88   Eutrema salsugineum [saltwater cress]
ref|XP_004144665.1|  PREDICTED: uncharacterized protein LOC101203...    288   7e-88   Cucumis sativus [cucumbers]
ref|XP_008442250.1|  PREDICTED: multiple C2 and transmembrane dom...    288   7e-88   Cucumis melo [Oriental melon]
ref|XP_011033252.1|  PREDICTED: extended synaptotagmin-1                287   8e-88   Populus euphratica
emb|CDY47660.1|  BnaC04g23970D                                          288   1e-87   Brassica napus [oilseed rape]
ref|XP_007028941.1|  Calcium-dependent lipid-binding (CaLB domain...    289   1e-87   
ref|XP_004497931.1|  PREDICTED: uncharacterized protein LOC101499...    287   1e-87   Cicer arietinum [garbanzo]
gb|KEH16148.1|  C2 calcium/lipid-binding and GRAM domain protein        287   1e-87   Medicago truncatula
ref|NP_191347.1|  C2 domain-containing plant phosphoribosyltransf...    287   1e-87   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF01685.1|  anthranilate phosphoribosyltransferase-like protein    287   1e-87   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002878177.1|  C2 domain-containing protein                       287   1e-87   
gb|AAK53020.1|AF375436_1  AT3g57880/T10K17_90                           287   1e-87   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009417304.1|  PREDICTED: multiple C2 and transmembrane dom...    286   2e-87   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010265829.1|  PREDICTED: multiple C2 and transmembrane dom...    286   2e-87   Nelumbo nucifera [Indian lotus]
ref|XP_008778691.1|  PREDICTED: multiple C2 and transmembrane dom...    286   2e-87   Phoenix dactylifera
ref|XP_008787291.1|  PREDICTED: extended synaptotagmin-1-like           285   5e-87   Phoenix dactylifera
ref|XP_008782885.1|  PREDICTED: multiple C2 and transmembrane dom...    285   6e-87   Phoenix dactylifera
gb|KHN28751.1|  Multiple C2 and transmembrane domain-containing p...    284   7e-87   Glycine soja [wild soybean]
ref|XP_010928839.1|  PREDICTED: extended synaptotagmin-1-like           285   8e-87   Elaeis guineensis
ref|XP_006290627.1|  hypothetical protein CARUB_v10016719mg             285   8e-87   Capsella rubella
ref|XP_002894324.1|  C2 domain-containing protein                       284   1e-86   
ref|XP_003535846.1|  PREDICTED: multiple C2 and transmembrane dom...    284   1e-86   Glycine max [soybeans]
ref|XP_006306817.1|  hypothetical protein CARUB_v10008360mg             280   1e-86   
ref|NP_001055351.1|  Os05g0370600                                       284   2e-86   
ref|XP_008647970.1|  PREDICTED: phosphoribosylanthranilate transf...    284   2e-86   
ref|XP_006654319.1|  PREDICTED: multiple C2 and transmembrane dom...    284   2e-86   Oryza brachyantha
ref|XP_008658284.1|  PREDICTED: uncharacterized protein LOC100273...    283   3e-86   
ref|XP_010913922.1|  PREDICTED: multiple C2 and transmembrane dom...    283   3e-86   
ref|XP_002438680.1|  hypothetical protein SORBIDRAFT_10g024200          283   3e-86   Sorghum bicolor [broomcorn]
ref|XP_009395864.1|  PREDICTED: extended synaptotagmin-1-like           283   3e-86   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK35840.1|  hypothetical protein AALP_AA4G043900                    283   3e-86   Arabis alpina [alpine rockcress]
ref|XP_010504727.1|  PREDICTED: multiple C2 and transmembrane dom...    283   3e-86   Camelina sativa [gold-of-pleasure]
ref|XP_010516424.1|  PREDICTED: multiple C2 and transmembrane dom...    283   4e-86   Camelina sativa [gold-of-pleasure]
ref|NP_175568.1|  calcium-dependent lipid-binding (CaLB domain) p...    281   1e-85   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010227498.1|  PREDICTED: LOW QUALITY PROTEIN: multiple C2 ...    281   1e-85   
ref|XP_006393033.1|  hypothetical protein EUTSA_v10011254mg             281   2e-85   Eutrema salsugineum [saltwater cress]
ref|XP_006306818.1|  hypothetical protein CARUB_v10008360mg             281   2e-85   Capsella rubella
gb|EMS45217.1|  Multiple C2 and transmembrane domain-containing p...    281   3e-85   Triticum urartu
ref|XP_010500735.1|  PREDICTED: extended synaptotagmin-1-like           280   4e-85   Camelina sativa [gold-of-pleasure]
gb|KJB83481.1|  hypothetical protein B456_013G250100                    280   6e-85   Gossypium raimondii
ref|XP_007014901.1|  Calcium-dependent lipid-binding (CaLB domain...    280   6e-85   
ref|XP_009364728.1|  PREDICTED: multiple C2 and transmembrane dom...    279   1e-84   Pyrus x bretschneideri [bai li]
ref|XP_011020270.1|  PREDICTED: multiple C2 and transmembrane dom...    279   1e-84   Populus euphratica
ref|XP_009364713.1|  PREDICTED: multiple C2 and transmembrane dom...    279   1e-84   Pyrus x bretschneideri [bai li]
gb|KHG04257.1|  Multiple C2 and transmembrane domain-containing 1       278   2e-84   Gossypium arboreum [tree cotton]
dbj|BAB91449.1|  phosphoribosyltransferase                              261   4e-84   Sequoia sempervirens [California redwood]
dbj|BAE43607.2|  putative phosphoribosylanthranilate transferase        260   6e-84   Taxodium distichum var. imbricarium [pond-cypress]
dbj|BAB91448.1|  phosphoribosyltransferase                              260   6e-84   Taxodium distichum [bald cypress]
ref|XP_010479644.1|  PREDICTED: extended synaptotagmin-1-like iso...    277   7e-84   Camelina sativa [gold-of-pleasure]
dbj|BAB91450.1|  phosphoribosyltransferase                              260   8e-84   Chamaecyparis pisifera [sawara]
gb|KJB66120.1|  hypothetical protein B456_010G128400                    276   1e-83   Gossypium raimondii
ref|XP_007208351.1|  hypothetical protein PRUPE_ppa001743mg             276   2e-83   Prunus persica
ref|XP_010044995.1|  PREDICTED: multiple C2 and transmembrane dom...    276   2e-83   Eucalyptus grandis [rose gum]
ref|XP_002513446.1|  synaptotagmin, putative                            276   2e-83   Ricinus communis
ref|XP_006386096.1|  hypothetical protein POPTR_0003s22060g             275   3e-83   
ref|XP_003537951.1|  PREDICTED: multiple C2 and transmembrane dom...    275   4e-83   Glycine max [soybeans]
dbj|BAD02775.1|  putative phosphoribosylanthranilate transferase        258   4e-83   Cryptomeria japonica
dbj|BAE43599.1|  putative phosphoribosylanthranilate transferase        258   4e-83   Taxodium distichum var. distichum
dbj|BAB91454.1|  phosphoribosyltransferase                              258   4e-83   Cryptomeria japonica
dbj|BAE43594.1|  putative phosphoribosylanthranilate transferase        258   4e-83   Taxodium distichum var. distichum
dbj|BAB91451.1|  phosphoribosyltransferase                              258   4e-83   Thujopsis dolabrata [hiba arborvitae]
ref|XP_008243596.1|  PREDICTED: LOW QUALITY PROTEIN: multiple C2 ...    275   4e-83   Prunus mume [ume]
ref|XP_002297795.1|  C2 domain-containing family protein                275   5e-83   Populus trichocarpa [western balsam poplar]
gb|KHG19030.1|  Multiple C2 and transmembrane domain-containing 1       274   7e-83   Gossypium arboreum [tree cotton]
ref|XP_006850074.1|  hypothetical protein AMTR_s00022p00214560          274   7e-83   
dbj|BAE43588.1|  putative phosphoribosylanthranilate transferase        257   9e-83   Cryptomeria japonica
ref|XP_008358865.1|  PREDICTED: multiple C2 and transmembrane dom...    274   9e-83   
ref|XP_010519731.1|  PREDICTED: multiple C2 and transmembrane dom...    274   1e-82   Tarenaya hassleriana [spider flower]
ref|XP_004295231.1|  PREDICTED: multiple C2 and transmembrane dom...    274   1e-82   Fragaria vesca subsp. vesca
ref|XP_011037883.1|  PREDICTED: multiple C2 and transmembrane dom...    274   1e-82   Populus euphratica
dbj|BAE43593.2|  putative phosphoribosylanthranilate transferase        257   1e-82   Taxodium distichum var. distichum
ref|XP_006445975.1|  hypothetical protein CICLE_v10014352mg             273   1e-82   Citrus clementina [clementine]
dbj|BAE43606.1|  putative phosphoribosylanthranilate transferase        257   1e-82   Taxodium distichum var. imbricarium [pond-cypress]
ref|XP_006494723.1|  PREDICTED: multiple C2 and transmembrane dom...    273   2e-82   Citrus sinensis [apfelsine]
ref|XP_010091994.1|  Multiple C2 and transmembrane domain-contain...    273   2e-82   Morus notabilis
dbj|BAD02805.1|  putative phosphoribosylanthranilate transferase        256   3e-82   Cryptomeria japonica
dbj|BAB91447.1|  phosphoribosyltransferase                              256   4e-82   Glyptostrobus pensilis
ref|XP_006381053.1|  C2 domain-containing family protein                272   4e-82   Populus trichocarpa [western balsam poplar]
dbj|BAB91452.1|  phosphoribosyltransferase                              255   4e-82   Thuja standishii
dbj|BAE43597.2|  putative phosphoribosylanthranilate transferase        255   6e-82   Taxodium distichum var. distichum
gb|KDP20200.1|  hypothetical protein JCGZ_07920                         271   7e-82   Jatropha curcas
ref|XP_011025253.1|  PREDICTED: multiple C2 and transmembrane dom...    271   1e-81   Populus euphratica
emb|CDY68091.1|  BnaAnng26150D                                          269   6e-81   Brassica napus [oilseed rape]
ref|XP_006289947.1|  hypothetical protein CARUB_v10003573mg             268   1e-80   Capsella rubella
ref|NP_196801.1|  calcium-dependent lipid-binding domain-containi...    268   1e-80   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010419857.1|  PREDICTED: multiple C2 and transmembrane dom...    268   2e-80   Camelina sativa [gold-of-pleasure]
ref|XP_010492034.1|  PREDICTED: multiple C2 and transmembrane dom...    268   2e-80   Camelina sativa [gold-of-pleasure]
ref|XP_010419856.1|  PREDICTED: multiple C2 and transmembrane dom...    268   2e-80   
ref|XP_010089352.1|  hypothetical protein L484_000459                   251   3e-80   
ref|XP_010273065.1|  PREDICTED: uncharacterized protein LOC104608707    270   4e-80   Nelumbo nucifera [Indian lotus]
ref|XP_009374817.1|  PREDICTED: multiple C2 and transmembrane dom...    267   4e-80   Pyrus x bretschneideri [bai li]
ref|XP_002871539.1|  C2 domain-containing protein                       266   5e-80   
ref|XP_006399782.1|  hypothetical protein EUTSA_v10012747mg             266   9e-80   Eutrema salsugineum [saltwater cress]
ref|XP_010673580.1|  PREDICTED: multiple C2 and transmembrane dom...    266   1e-79   Beta vulgaris subsp. vulgaris [field beet]
gb|KHN25707.1|  Protein unc-13 like C                                   259   1e-79   Glycine soja [wild soybean]
emb|CDX78498.1|  BnaA03g04100D                                          265   2e-79   
ref|XP_009131306.1|  PREDICTED: multiple C2 and transmembrane dom...    265   2e-79   Brassica rapa
emb|CDX97214.1|  BnaC09g44110D                                          265   2e-79   
ref|XP_007131979.1|  hypothetical protein PHAVU_011G056600g             265   2e-79   Phaseolus vulgaris [French bean]
ref|XP_006445078.1|  hypothetical protein CICLE_v10018672mg             268   2e-79   Citrus clementina [clementine]
gb|KDP28646.1|  hypothetical protein JCGZ_14417                         268   3e-79   Jatropha curcas
emb|CDP08834.1|  unnamed protein product                                268   3e-79   Coffea canephora [robusta coffee]
emb|CDX70485.1|  BnaC03g05690D                                          265   3e-79   
gb|ACN33768.1|  unknown                                                 263   7e-79   Zea mays [maize]
gb|KDO86111.1|  hypothetical protein CISIN_1g001835mg                   266   8e-79   Citrus sinensis [apfelsine]
ref|XP_010660813.1|  PREDICTED: uncharacterized protein LOC100264973    266   9e-79   Vitis vinifera
ref|XP_009121819.1|  PREDICTED: extended synaptotagmin-1-like           263   1e-78   Brassica rapa
ref|XP_002511838.1|  synaptotagmin, putative                            266   1e-78   Ricinus communis
ref|XP_004298739.1|  PREDICTED: uncharacterized protein LOC101313...    266   1e-78   Fragaria vesca subsp. vesca
ref|XP_010113221.1|  Multiple C2 and transmembrane domain-contain...    263   1e-78   
ref|XP_010053272.1|  PREDICTED: uncharacterized protein LOC104441758    266   1e-78   
gb|KEH30271.1|  C2 calcium/lipid-binding and GRAM domain protein        263   2e-78   Medicago truncatula
ref|XP_009779007.1|  PREDICTED: multiple C2 and transmembrane dom...    266   2e-78   Nicotiana sylvestris
ref|NP_001152102.1|  phosphoribosylanthranilate transferase             263   2e-78   
ref|XP_009626688.1|  PREDICTED: multiple C2 and transmembrane dom...    265   3e-78   Nicotiana tomentosiformis
ref|XP_004244612.1|  PREDICTED: multiple C2 and transmembrane dom...    265   4e-78   Solanum lycopersicum
ref|XP_010255412.1|  PREDICTED: multiple C2 and transmembrane dom...    265   4e-78   Nelumbo nucifera [Indian lotus]
dbj|BAK05840.1|  predicted protein                                      258   5e-78   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001168012.1|  uncharacterized protein LOC100381735               264   7e-78   Zea mays [maize]
ref|XP_006653047.1|  PREDICTED: uncharacterized protein LOC102701166    264   9e-78   Oryza brachyantha
ref|XP_008775338.1|  PREDICTED: uncharacterized protein LOC103695724    263   1e-77   Phoenix dactylifera
dbj|BAK05882.1|  predicted protein                                      256   1e-77   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004306799.1|  PREDICTED: uncharacterized protein LOC101305880    263   2e-77   Fragaria vesca subsp. vesca
ref|XP_002299538.2|  hypothetical protein POPTR_0001s09250g             263   2e-77   
ref|XP_004960016.1|  PREDICTED: uncharacterized protein LOC101781...    263   2e-77   Setaria italica
dbj|BAD95264.1|  anthranilate phosphoribosyltransferase-like protein    241   2e-77   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010918556.1|  PREDICTED: uncharacterized protein LOC105042892    263   2e-77   Elaeis guineensis
ref|XP_006352275.1|  PREDICTED: uncharacterized protein LOC102594579    262   3e-77   Solanum tuberosum [potatoes]
ref|XP_008806876.1|  PREDICTED: multiple C2 and transmembrane dom...    262   3e-77   Phoenix dactylifera
ref|XP_002509788.1|  synaptotagmin, putative                            262   3e-77   
ref|XP_009419170.1|  PREDICTED: multiple C2 and transmembrane dom...    259   4e-77   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002303582.2|  C2 domain-containing family protein                262   4e-77   
ref|XP_011022713.1|  PREDICTED: multiple C2 and transmembrane dom...    260   5e-77   Populus euphratica
ref|XP_010934752.1|  PREDICTED: multiple C2 and transmembrane dom...    261   5e-77   Elaeis guineensis
ref|XP_010940465.1|  PREDICTED: multiple C2 and transmembrane dom...    261   8e-77   Elaeis guineensis
ref|XP_003611102.1|  Glutathione peroxidase                             261   9e-77   Medicago truncatula
gb|EYU23487.1|  hypothetical protein MIMGU_mgv1a000757mg                261   9e-77   Erythranthe guttata [common monkey flower]
ref|XP_011080971.1|  PREDICTED: uncharacterized protein LOC105164103    261   9e-77   Sesamum indicum [beniseed]
dbj|BAH20205.1|  AT1G22610                                              252   1e-76   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008238857.1|  PREDICTED: multiple C2 and transmembrane dom...    260   1e-76   Prunus mume [ume]
ref|XP_011022711.1|  PREDICTED: multiple C2 and transmembrane dom...    260   1e-76   Populus euphratica
ref|NP_001054305.1|  Os04g0683800                                       260   2e-76   
gb|KHG05718.1|  Multiple C2 and transmembrane domain-containing 1       260   2e-76   Gossypium arboreum [tree cotton]
ref|XP_006574306.1|  PREDICTED: uncharacterized protein LOC100817962    259   2e-76   Glycine max [soybeans]
ref|XP_008778754.1|  PREDICTED: LOW QUALITY PROTEIN: multiple C2 ...    260   2e-76   
ref|XP_011029251.1|  PREDICTED: multiple C2 and transmembrane dom...    260   2e-76   Populus euphratica
ref|XP_010324263.1|  PREDICTED: multiple C2 and transmembrane dom...    260   2e-76   Solanum lycopersicum
ref|XP_010032396.1|  PREDICTED: multiple C2 and transmembrane dom...    257   3e-76   Eucalyptus grandis [rose gum]
ref|XP_007220279.1|  hypothetical protein PRUPE_ppa000771mg             259   3e-76   Prunus persica
ref|XP_008449758.1|  PREDICTED: multiple C2 and transmembrane dom...    256   3e-76   Cucumis melo [Oriental melon]
ref|XP_008244912.1|  PREDICTED: uncharacterized protein LOC103343020    259   3e-76   Prunus mume [ume]
dbj|BAK04937.1|  predicted protein                                      259   3e-76   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002462865.1|  hypothetical protein SORBIDRAFT_02g033370          259   3e-76   Sorghum bicolor [broomcorn]
gb|KJB24703.1|  hypothetical protein B456_004G157900                    259   3e-76   Gossypium raimondii
ref|XP_008356954.1|  PREDICTED: uncharacterized protein LOC103420681    259   4e-76   
ref|XP_004142139.1|  PREDICTED: multiple C2 and transmembrane dom...    256   4e-76   Cucumis sativus [cucumbers]
ref|XP_010529567.1|  PREDICTED: multiple C2 and transmembrane dom...    259   4e-76   Tarenaya hassleriana [spider flower]
ref|XP_010529565.1|  PREDICTED: multiple C2 and transmembrane dom...    259   4e-76   Tarenaya hassleriana [spider flower]
ref|XP_008376022.1|  PREDICTED: uncharacterized protein LOC103439257    259   5e-76   
gb|KDO57729.1|  hypothetical protein CISIN_1g003882mg                   256   5e-76   Citrus sinensis [apfelsine]
ref|XP_006437049.1|  hypothetical protein CICLE_v10033973mg             256   5e-76   Citrus clementina [clementine]
ref|XP_003580853.1|  PREDICTED: multiple C2 and transmembrane dom...    259   5e-76   
ref|XP_002532394.1|  synaptotagmin, putative                            256   6e-76   Ricinus communis
gb|KJB25820.1|  hypothetical protein B456_004G210900                    259   6e-76   Gossypium raimondii
gb|KHG10339.1|  Multiple C2 and transmembrane domain-containing 1       259   6e-76   Gossypium arboreum [tree cotton]
gb|ADT92187.1|  unknown                                                 258   7e-76   Zea mays [maize]
ref|XP_008663748.1|  PREDICTED: uncharacterized protein LOC103642209    258   7e-76   
ref|XP_004957702.1|  PREDICTED: uncharacterized protein LOC101764...    258   7e-76   Setaria italica
gb|KDP25449.1|  hypothetical protein JCGZ_20605                         258   8e-76   Jatropha curcas
ref|XP_008383982.1|  PREDICTED: multiple C2 and transmembrane dom...    258   8e-76   
ref|XP_010672799.1|  PREDICTED: multiple C2 and transmembrane dom...    258   8e-76   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006476597.1|  PREDICTED: multiple C2 and transmembrane dom...    258   8e-76   Citrus sinensis [apfelsine]
ref|XP_009346959.1|  PREDICTED: uncharacterized protein LOC103938656    258   9e-76   Pyrus x bretschneideri [bai li]
ref|XP_007210407.1|  hypothetical protein PRUPE_ppa000781mg             258   9e-76   Prunus persica
gb|KDO76164.1|  hypothetical protein CISIN_1g045058mg                   258   1e-75   Citrus sinensis [apfelsine]
ref|XP_003543552.1|  PREDICTED: multiple C2 and transmembrane dom...    255   1e-75   Glycine max [soybeans]
ref|XP_006439584.1|  hypothetical protein CICLE_v10023869mg             258   1e-75   
ref|XP_011015655.1|  PREDICTED: multiple C2 and transmembrane dom...    258   1e-75   Populus euphratica
ref|XP_011023361.1|  PREDICTED: multiple C2 and transmembrane dom...    258   1e-75   Populus euphratica
gb|KDP43429.1|  hypothetical protein JCGZ_16716                         258   1e-75   Jatropha curcas
ref|XP_004965887.1|  PREDICTED: uncharacterized protein LOC101774861    256   1e-75   Setaria italica
ref|XP_009596255.1|  PREDICTED: multiple C2 and transmembrane dom...    258   1e-75   Nicotiana tomentosiformis
ref|XP_006348415.1|  PREDICTED: multiple C2 and transmembrane dom...    255   1e-75   Solanum tuberosum [potatoes]
ref|NP_001058075.1|  Os06g0614000                                       252   1e-75   
ref|XP_003546988.1|  PREDICTED: multiple C2 and transmembrane dom...    255   2e-75   Glycine max [soybeans]
ref|XP_009339918.1|  PREDICTED: multiple C2 and transmembrane dom...    258   2e-75   Pyrus x bretschneideri [bai li]
ref|XP_006289911.1|  hypothetical protein CARUB_v10003526mg             258   2e-75   Capsella rubella
ref|XP_002298449.2|  C2 domain-containing family protein                258   2e-75   Populus trichocarpa [western balsam poplar]
gb|KHN33324.1|  Multiple C2 and transmembrane domain-containing p...    254   2e-75   Glycine soja [wild soybean]
ref|XP_011025028.1|  PREDICTED: multiple C2 and transmembrane dom...    257   2e-75   Populus euphratica
ref|XP_009798416.1|  PREDICTED: multiple C2 and transmembrane dom...    257   2e-75   Nicotiana sylvestris
gb|KJB36093.1|  hypothetical protein B456_006G140900                    254   3e-75   Gossypium raimondii
ref|XP_011092017.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    257   3e-75   
ref|XP_002320122.2|  hypothetical protein POPTR_0014s07750g             257   3e-75   Populus trichocarpa [western balsam poplar]
ref|XP_008649064.1|  PREDICTED: uncharacterized protein LOC103629...    254   4e-75   Zea mays [maize]
ref|XP_006339547.1|  PREDICTED: multiple C2 and transmembrane dom...    256   4e-75   Solanum tuberosum [potatoes]
ref|XP_008393597.1|  PREDICTED: uncharacterized protein LOC103455751    256   4e-75   
ref|XP_003563626.1|  PREDICTED: uncharacterized protein LOC100829273    254   4e-75   Brachypodium distachyon [annual false brome]
ref|XP_009399655.1|  PREDICTED: multiple C2 and transmembrane dom...    254   4e-75   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAC25524.1|  Strong similarity to phosphoribosylanthranilate t...    254   4e-75   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009773349.1|  PREDICTED: multiple C2 and transmembrane dom...    253   5e-75   Nicotiana sylvestris
emb|CDP07723.1|  unnamed protein product                                256   5e-75   Coffea canephora [robusta coffee]
ref|XP_006366499.1|  PREDICTED: multiple C2 and transmembrane dom...    256   5e-75   
ref|XP_010928529.1|  PREDICTED: LOW QUALITY PROTEIN: multiple C2 ...    256   5e-75   
ref|XP_011093374.1|  PREDICTED: multiple C2 and transmembrane dom...    256   5e-75   
gb|KDP24593.1|  hypothetical protein JCGZ_25509                         253   5e-75   Jatropha curcas
gb|ABR16393.1|  unknown                                                 253   6e-75   Picea sitchensis
ref|XP_007052594.1|  C2 calcium/lipid-binding plant phosphoribosy...    256   6e-75   
ref|XP_007150401.1|  hypothetical protein PHAVU_005G150300g             253   6e-75   Phaseolus vulgaris [French bean]
ref|XP_010695175.1|  PREDICTED: multiple C2 and transmembrane dom...    256   6e-75   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010434689.1|  PREDICTED: multiple C2 and transmembrane dom...    256   6e-75   
ref|XP_011093373.1|  PREDICTED: multiple C2 and transmembrane dom...    256   7e-75   Sesamum indicum [beniseed]
ref|XP_010455572.1|  PREDICTED: multiple C2 and transmembrane dom...    256   7e-75   Camelina sativa [gold-of-pleasure]
ref|XP_010461991.1|  PREDICTED: uncharacterized protein LOC104742671    235   7e-75   Camelina sativa [gold-of-pleasure]
ref|XP_002874704.1|  NADPH-dependent thioredoxin reductase B            256   7e-75   
ref|XP_011035993.1|  PREDICTED: multiple C2 and transmembrane dom...    255   8e-75   Populus euphratica
dbj|BAK01357.1|  predicted protein                                      255   8e-75   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010943582.1|  PREDICTED: multiple C2 and transmembrane dom...    253   1e-74   Elaeis guineensis
ref|XP_008375143.1|  PREDICTED: multiple C2 and transmembrane dom...    255   1e-74   
ref|XP_009383872.1|  PREDICTED: multiple C2 and transmembrane dom...    255   1e-74   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008670402.1|  PREDICTED: uncharacterized protein LOC103647671    255   1e-74   Zea mays [maize]
ref|XP_003563116.1|  PREDICTED: uncharacterized protein LOC100824776    255   1e-74   Brachypodium distachyon [annual false brome]
ref|XP_002890521.1|  C2 domain-containing protein                       255   1e-74   Arabidopsis lyrata subsp. lyrata
emb|CAB39932.1|  putative phosphoribosylanthranilate transferase        253   1e-74   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009623389.1|  PREDICTED: uncharacterized protein LOC104114611    255   1e-74   Nicotiana tomentosiformis
ref|XP_007040201.1|  C2 calcium/lipid-binding plant phosphoribosy...    254   1e-74   
gb|KJB83485.1|  hypothetical protein B456_013G250100                    251   1e-74   
emb|CDY21373.1|  BnaA09g30540D                                          254   2e-74   
ref|XP_008653084.1|  PREDICTED: multiple C2 and transmembrane dom...    254   2e-74   
emb|CDY04800.1|  BnaC05g17890D                                          254   2e-74   
ref|XP_010477520.1|  PREDICTED: multiple C2 and transmembrane dom...    254   2e-74   
ref|XP_009115621.1|  PREDICTED: multiple C2 and transmembrane dom...    254   2e-74   
ref|XP_010460017.1|  PREDICTED: multiple C2 and transmembrane dom...    254   2e-74   
ref|NP_173675.1|  C2 calcium/lipid-binding plant phosphoribosyltr...    254   2e-74   
emb|CAN75086.1|  hypothetical protein VITISV_010815                     252   2e-74   
ref|XP_009795430.1|  PREDICTED: multiple C2 and transmembrane dom...    254   2e-74   
ref|XP_009354691.1|  PREDICTED: multiple C2 and transmembrane dom...    254   2e-74   
ref|XP_004228622.1|  PREDICTED: multiple C2 and transmembrane dom...    251   2e-74   
ref|XP_002277970.2|  PREDICTED: multiple C2 and transmembrane dom...    252   2e-74   
emb|CAN79812.1|  hypothetical protein VITISV_018822                     254   2e-74   
ref|XP_002271590.1|  PREDICTED: uncharacterized protein LOC100253432    254   2e-74   
ref|XP_009386410.1|  PREDICTED: multiple C2 and transmembrane dom...    254   2e-74   
ref|XP_006304546.1|  hypothetical protein CARUB_v10011531mg             254   3e-74   
gb|KEH16165.1|  calcium-dependent lipid-binding (CaLB domain) fam...    252   3e-74   
ref|XP_006396881.1|  hypothetical protein EUTSA_v10028390mg             254   3e-74   
gb|EMT11702.1|  hypothetical protein F775_07618                         251   3e-74   
ref|XP_009588959.1|  PREDICTED: multiple C2 and transmembrane dom...    251   3e-74   
gb|KFK31920.1|  hypothetical protein AALP_AA6G176000                    254   3e-74   
ref|NP_192898.2|  C2 calcium/lipid-binding plant phosphoribosyltr...    254   3e-74   
gb|KFK31919.1|  hypothetical protein AALP_AA6G176000                    254   3e-74   
ref|XP_007028936.1|  C2 calcium/lipid-binding plant phosphoribosy...    251   3e-74   
ref|XP_007220593.1|  hypothetical protein PRUPE_ppa000616mg             254   3e-74   
emb|CDX86768.1|  BnaA09g21580D                                          254   4e-74   
gb|EAZ01666.1|  hypothetical protein OsI_23701                          252   4e-74   
ref|XP_010498740.1|  PREDICTED: LOW QUALITY PROTEIN: multiple C2 ...    255   4e-74   
gb|EAZ37635.1|  hypothetical protein OsJ_21968                          252   4e-74   
ref|XP_009386055.1|  PREDICTED: uncharacterized protein LOC103973268    253   4e-74   
emb|CDP10108.1|  unnamed protein product                                251   5e-74   
ref|XP_006416181.1|  hypothetical protein EUTSA_v10006627mg             254   5e-74   
ref|XP_003538346.1|  PREDICTED: uncharacterized protein LOC100777...    253   5e-74   
ref|XP_003518076.1|  PREDICTED: multiple C2 and transmembrane dom...    251   5e-74   
gb|KHN35016.1|  Multiple C2 and transmembrane domain-containing p...    253   6e-74   
gb|KJB41306.1|  hypothetical protein B456_007G098200                    253   6e-74   
gb|KFK44354.1|  hypothetical protein AALP_AA1G246600                    253   7e-74   
ref|XP_010241420.1|  PREDICTED: multiple C2 and transmembrane dom...    253   7e-74   
gb|EPS58331.1|  hypothetical protein M569_16484                         253   8e-74   
gb|KDP35107.1|  hypothetical protein JCGZ_10949                         253   8e-74   
ref|XP_010682530.1|  PREDICTED: uncharacterized protein LOC104897368    250   1e-73   
ref|XP_004511581.1|  PREDICTED: multiple C2 and transmembrane dom...    252   1e-73   
ref|XP_002325538.2|  hypothetical protein POPTR_0019s10910g             252   1e-73   
ref|XP_008231337.1|  PREDICTED: multiple C2 and transmembrane dom...    252   1e-73   
ref|XP_008231335.1|  PREDICTED: multiple C2 and transmembrane dom...    252   1e-73   
ref|XP_008231338.1|  PREDICTED: multiple C2 and transmembrane dom...    252   1e-73   
ref|XP_008231334.1|  PREDICTED: multiple C2 and transmembrane dom...    252   1e-73   
gb|EMT19394.1|  hypothetical protein F775_16907                         249   1e-73   
emb|CDP09751.1|  unnamed protein product                                252   1e-73   
ref|NP_001059647.1|  Os07g0483500                                       252   1e-73   
gb|EAZ03872.1|  hypothetical protein OsI_26008                          252   1e-73   
ref|XP_011074957.1|  PREDICTED: multiple C2 and transmembrane dom...    252   1e-73   
ref|XP_011078852.1|  PREDICTED: multiple C2 and transmembrane dom...    249   1e-73   
ref|XP_010111400.1|  Multiple C2 and transmembrane domain-contain...    249   2e-73   
ref|XP_010244838.1|  PREDICTED: multiple C2 and transmembrane dom...    252   2e-73   
ref|XP_006483676.1|  PREDICTED: multiple C2 and transmembrane dom...    252   2e-73   
gb|KDO83484.1|  hypothetical protein CISIN_1g001696mg                   251   2e-73   
ref|XP_006439068.1|  hypothetical protein CICLE_v10030600mg             251   2e-73   
ref|XP_008783369.1|  PREDICTED: uncharacterized protein LOC103702639    251   3e-73   
ref|XP_009391825.1|  PREDICTED: uncharacterized protein LOC103977897    251   4e-73   
ref|XP_010105960.1|  Multiple C2 and transmembrane domain-contain...    251   4e-73   
ref|XP_004229889.1|  PREDICTED: multiple C2 and transmembrane dom...    251   4e-73   
dbj|BAJ93730.1|  predicted protein                                      249   4e-73   
ref|XP_009108158.1|  PREDICTED: uncharacterized protein LOC103833855    250   5e-73   
ref|XP_002513191.1|  synaptotagmin, putative                            251   5e-73   
emb|CDX81020.1|  BnaC03g02740D                                          239   6e-73   
ref|XP_002301353.2|  hypothetical protein POPTR_0002s15950g             250   6e-73   
ref|XP_006381052.1|  hypothetical protein POPTR_0006s05760g             248   6e-73   
ref|XP_007225292.1|  hypothetical protein PRUPE_ppa001339mg             249   6e-73   
ref|XP_011001083.1|  PREDICTED: multiple C2 and transmembrane dom...    250   7e-73   
gb|EMS45806.1|  Multiple C2 and transmembrane domain-containing p...    252   7e-73   
ref|XP_006850085.1|  hypothetical protein AMTR_s00022p00218970          250   8e-73   
ref|XP_006376235.1|  hypothetical protein POPTR_0013s11220g             250   8e-73   
ref|XP_010534142.1|  PREDICTED: multiple C2 and transmembrane dom...    249   1e-72   
ref|XP_007020084.1|  C2 calcium/lipid-binding plant phosphoribosy...    249   1e-72   
gb|EYU28228.1|  hypothetical protein MIMGU_mgv1a000659mg                249   2e-72   
ref|XP_003635987.1|  Multiple C2 and transmembrane domain-contain...    251   2e-72   
ref|XP_006598248.1|  PREDICTED: multiple C2 and transmembrane dom...    247   2e-72   
gb|KHN49030.1|  Putative Ras GTPase-activating protein 4B               246   3e-72   
ref|XP_008350856.1|  PREDICTED: LOW QUALITY PROTEIN: multiple C2 ...    248   3e-72   
gb|EMS62772.1|  Multiple C2 and transmembrane domain-containing p...    245   3e-72   
dbj|BAJ91162.1|  predicted protein                                      248   3e-72   
gb|KEH29293.1|  calcium-dependent lipid-binding (CaLB domain) fam...    248   3e-72   
ref|XP_009611365.1|  PREDICTED: uncharacterized protein LOC104104885    246   3e-72   
ref|XP_007149059.1|  hypothetical protein PHAVU_005G037500g             246   3e-72   
ref|XP_007131292.1|  hypothetical protein PHAVU_011G001600g             248   3e-72   
ref|XP_004299880.1|  PREDICTED: multiple C2 and transmembrane dom...    248   4e-72   
ref|XP_006586753.1|  PREDICTED: multiple C2 and transmembrane dom...    249   4e-72   
ref|XP_011468807.1|  PREDICTED: LOW QUALITY PROTEIN: multiple C2 ...    248   4e-72   
ref|XP_007204276.1|  hypothetical protein PRUPE_ppa001596mg             246   5e-72   
gb|KJB25055.1|  hypothetical protein B456_004G174500                    246   5e-72   
ref|XP_010908865.1|  PREDICTED: uncharacterized protein LOC105035134    248   5e-72   
ref|XP_003537180.1|  PREDICTED: multiple C2 and transmembrane dom...    246   5e-72   
ref|XP_008240964.1|  PREDICTED: multiple C2 and transmembrane dom...    246   5e-72   
ref|XP_010452629.1|  PREDICTED: multiple C2 and transmembrane dom...    246   5e-72   
ref|XP_004506399.1|  PREDICTED: uncharacterized protein LOC101494825    250   6e-72   
ref|XP_009587334.1|  PREDICTED: uncharacterized protein LOC104085087    247   6e-72   
gb|KHN15528.1|  Multiple C2 and transmembrane domain-containing p...    245   6e-72   
ref|XP_010423287.1|  PREDICTED: multiple C2 and transmembrane dom...    245   7e-72   
ref|XP_009418126.1|  PREDICTED: uncharacterized protein LOC103998104    245   7e-72   
ref|XP_009781014.1|  PREDICTED: uncharacterized protein LOC104229981    247   8e-72   
ref|XP_006827676.1|  hypothetical protein AMTR_s00009p00255480          247   9e-72   
ref|XP_004149608.1|  PREDICTED: multiple C2 and transmembrane dom...    247   9e-72   
ref|XP_008800662.1|  PREDICTED: multiple C2 and transmembrane dom...    245   9e-72   
ref|XP_008461778.1|  PREDICTED: LOW QUALITY PROTEIN: multiple C2 ...    247   1e-71   
ref|XP_002265157.2|  PREDICTED: multiple C2 and transmembrane dom...    247   1e-71   
ref|XP_002285588.1|  PREDICTED: multiple C2 and transmembrane dom...    244   1e-71   
gb|AAL15320.1|  AT5g06850/MOJ9_2                                        243   1e-71   
ref|XP_009369878.1|  PREDICTED: multiple C2 and transmembrane dom...    244   1e-71   
ref|XP_011007360.1|  PREDICTED: LOW QUALITY PROTEIN: multiple C2 ...    246   1e-71   
ref|XP_011033255.1|  PREDICTED: multiple C2 and transmembrane dom...    244   1e-71   
gb|EMT16292.1|  hypothetical protein F775_12047                         244   1e-71   
ref|XP_010491269.1|  PREDICTED: multiple C2 and transmembrane dom...    244   1e-71   
gb|KHN29203.1|  Putative Ras GTPase-activating protein 4B               244   2e-71   
gb|EYU27217.1|  hypothetical protein MIMGU_mgv1a019601mg                240   2e-71   
ref|XP_008219001.1|  PREDICTED: multiple C2 and transmembrane dom...    246   2e-71   
ref|XP_010672707.1|  PREDICTED: multiple C2 and transmembrane dom...    244   2e-71   
ref|XP_006350321.1|  PREDICTED: extended synaptotagmin-1-like           246   2e-71   
ref|XP_006585748.1|  PREDICTED: multiple C2 and transmembrane dom...    246   2e-71   
gb|KHM98828.1|  Multiple C2 and transmembrane domain-containing p...    246   2e-71   
ref|XP_010057923.1|  PREDICTED: multiple C2 and transmembrane dom...    244   2e-71   
ref|XP_006657700.1|  PREDICTED: uncharacterized protein LOC102709856    246   2e-71   
ref|XP_006592975.1|  PREDICTED: multiple C2 and transmembrane dom...    245   2e-71   
gb|KHN19431.1|  Multiple C2 and transmembrane domain-containing p...    247   2e-71   
ref|XP_004506488.1|  PREDICTED: uncharacterized protein LOC101502479    246   3e-71   
ref|XP_009763246.1|  PREDICTED: uncharacterized protein LOC104215187    243   3e-71   
gb|AFN53655.1|  putative synaptotagmin protein                          243   3e-71   
dbj|BAJ90708.1|  predicted protein                                      244   3e-71   
ref|XP_002323292.2|  hypothetical protein POPTR_0016s04980g             243   3e-71   
ref|XP_006379108.1|  C2 domain-containing family protein                245   3e-71   
ref|XP_003539651.1|  PREDICTED: multiple C2 and transmembrane dom...    246   3e-71   
ref|NP_568175.2|  FT-interacting protein 1                              243   4e-71   
ref|XP_006585342.1|  PREDICTED: multiple C2 and transmembrane dom...    243   4e-71   
gb|KHN32471.1|  Multiple C2 and transmembrane domain-containing p...    245   4e-71   
ref|XP_008799189.1|  PREDICTED: uncharacterized protein LOC103713915    245   4e-71   
ref|XP_003539945.1|  PREDICTED: multiple C2 and transmembrane dom...    245   4e-71   
emb|CBI16433.3|  unnamed protein product                                240   4e-71   
ref|XP_010053690.1|  PREDICTED: multiple C2 and transmembrane dom...    245   4e-71   
ref|XP_004250430.1|  PREDICTED: multiple C2 and transmembrane dom...    245   5e-71   
ref|XP_003599053.1|  Glutathione peroxidase                             243   5e-71   
ref|XP_002521817.1|  synaptotagmin, putative                            245   5e-71   
ref|XP_008387247.1|  PREDICTED: multiple C2 and transmembrane dom...    243   5e-71   
ref|XP_010534658.1|  PREDICTED: multiple C2 and transmembrane dom...    242   5e-71   
ref|XP_008460787.1|  PREDICTED: multiple C2 and transmembrane dom...    243   5e-71   
ref|XP_003580895.1|  PREDICTED: multiple C2 and transmembrane dom...    244   6e-71   
ref|XP_009362439.1|  PREDICTED: uncharacterized protein LOC103952559    244   6e-71   
ref|XP_009130968.1|  PREDICTED: multiple C2 and transmembrane dom...    243   7e-71   
emb|CDP14088.1|  unnamed protein product                                242   8e-71   
ref|XP_006399161.1|  hypothetical protein EUTSA_v10012726mg             242   8e-71   
ref|XP_008458254.1|  PREDICTED: uncharacterized protein LOC103497726    244   8e-71   
ref|XP_007133848.1|  hypothetical protein PHAVU_011G214100g             243   8e-71   
ref|XP_010928846.1|  PREDICTED: multiple C2 and transmembrane dom...    242   8e-71   
ref|XP_004514073.1|  PREDICTED: multiple C2 and transmembrane dom...    243   9e-71   
gb|KHN42205.1|  hypothetical protein glysoja_021695                     227   9e-71   
ref|XP_006434690.1|  hypothetical protein CICLE_v10000127mg             244   9e-71   
ref|XP_004959939.1|  PREDICTED: multiple C2 and transmembrane dom...    244   1e-70   
ref|XP_004161406.1|  PREDICTED: LOW QUALITY PROTEIN: multiple C2 ...    244   1e-70   
ref|XP_006473257.1|  PREDICTED: multiple C2 and transmembrane dom...    244   1e-70   
ref|XP_006287093.1|  hypothetical protein CARUB_v10000256mg             242   1e-70   
ref|XP_010682327.1|  PREDICTED: multiple C2 and transmembrane dom...    244   1e-70   
ref|XP_011003982.1|  PREDICTED: multiple C2 and transmembrane dom...    243   2e-70   
ref|XP_008782890.1|  PREDICTED: multiple C2 and transmembrane dom...    241   2e-70   
ref|XP_007133849.1|  hypothetical protein PHAVU_011G214100g             244   2e-70   
ref|XP_004150160.1|  PREDICTED: multiple C2 and transmembrane dom...    241   2e-70   
gb|EYU31344.1|  hypothetical protein MIMGU_mgv1a023675mg                241   3e-70   
ref|XP_011031493.1|  PREDICTED: multiple C2 and transmembrane dom...    242   4e-70   
ref|XP_009350731.1|  PREDICTED: extended synaptotagmin-1-like           241   4e-70   
ref|XP_011020275.1|  PREDICTED: multiple C2 and transmembrane dom...    241   4e-70   
ref|XP_010535240.1|  PREDICTED: multiple C2 and transmembrane dom...    242   4e-70   
ref|XP_011080250.1|  PREDICTED: multiple C2 and transmembrane dom...    240   4e-70   
ref|XP_007158492.1|  hypothetical protein PHAVU_002G157000g             242   5e-70   
gb|AES87259.2|  calcium-dependent lipid-binding (CaLB domain) fam...    242   8e-70   
ref|XP_003605062.1|  Phosphoribosyltransferase                          242   9e-70   
ref|NP_001182939.1|  uncharacterized protein LOC100501234               231   9e-70   
ref|XP_010910862.1|  PREDICTED: uncharacterized protein LOC105036827    241   1e-69   
emb|CDP10669.1|  unnamed protein product                                241   1e-69   
ref|XP_008669128.1|  PREDICTED: multiple C2 and transmembrane dom...    241   1e-69   
ref|XP_010521156.1|  PREDICTED: multiple C2 and transmembrane dom...    241   1e-69   
ref|XP_004166328.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    241   2e-69   
ref|XP_002873282.1|  hypothetical protein ARALYDRAFT_908616             239   2e-69   
ref|XP_004138509.1|  PREDICTED: uncharacterized protein LOC101203632    240   2e-69   
ref|XP_004497937.1|  PREDICTED: multiple C2 and transmembrane dom...    239   2e-69   
ref|XP_010557779.1|  PREDICTED: extended synaptotagmin-1                240   2e-69   
ref|XP_002447382.1|  hypothetical protein SORBIDRAFT_06g034070          240   2e-69   
ref|XP_010238001.1|  PREDICTED: LOW QUALITY PROTEIN: extended syn...    238   2e-69   
tpg|DAA62703.1|  TPA: hypothetical protein ZEAMMB73_297136              221   3e-69   
emb|CAN71789.1|  hypothetical protein VITISV_004288                     239   3e-69   
ref|XP_008392066.1|  PREDICTED: LOW QUALITY PROTEIN: multiple C2 ...    238   3e-69   
ref|XP_008459677.1|  PREDICTED: multiple C2 and transmembrane dom...    239   4e-69   
ref|XP_002273003.1|  PREDICTED: multiple C2 and transmembrane dom...    239   4e-69   
ref|XP_009393442.1|  PREDICTED: uncharacterized protein LOC103979123    239   4e-69   
gb|ACN27041.1|  unknown                                                 233   5e-69   
gb|AAC13630.1|  F6N23.8 gene product                                    235   7e-69   
gb|EYU32100.1|  hypothetical protein MIMGU_mgv1a000762mg                238   1e-68   
ref|XP_006342310.1|  PREDICTED: multiple C2 and transmembrane dom...    236   1e-68   
gb|EAY96165.1|  hypothetical protein OsI_18047                          238   1e-68   
ref|NP_001054362.1|  Os04g0691800                                       238   2e-68   
gb|EAZ32519.1|  hypothetical protein OsJ_16741                          238   2e-68   
ref|XP_007145658.1|  hypothetical protein PHAVU_007G257600g             236   2e-68   
ref|XP_004963752.1|  PREDICTED: multiple C2 and transmembrane dom...    235   2e-68   
gb|EYU20710.1|  hypothetical protein MIMGU_mgv1a023485mg                235   3e-68   
ref|XP_004162856.1|  PREDICTED: uncharacterized protein LOC101229308    237   4e-68   
ref|XP_004141565.1|  PREDICTED: uncharacterized protein LOC101209530    236   4e-68   
gb|AES80126.2|  calcium-dependent lipid-binding (CaLB domain) fam...    236   4e-68   
ref|XP_004309445.1|  PREDICTED: multiple C2 and transmembrane dom...    234   6e-68   
ref|XP_002875019.1|  C2 domain-containing protein                       236   6e-68   
ref|XP_010062431.1|  PREDICTED: uncharacterized protein LOC104449847    236   8e-68   
ref|XP_004492713.1|  PREDICTED: multiple C2 and transmembrane dom...    236   9e-68   
ref|XP_008795741.1|  PREDICTED: multiple C2 and transmembrane dom...    235   1e-67   
ref|XP_003623908.1|  Extended synaptotagmin-2                           236   1e-67   
gb|ABD33426.2|  C2                                                      236   1e-67   
ref|NP_191979.2|  C2 calcium/lipid-binding plant phosphoribosyltr...    235   1e-67   
gb|EMS60507.1|  Multiple C2 and transmembrane domain-containing p...    231   1e-67   
ref|XP_010104492.1|  Multiple C2 and transmembrane domain-contain...    235   2e-67   
ref|XP_009607021.1|  PREDICTED: multiple C2 and transmembrane dom...    234   2e-67   
gb|AFW81852.1|  phosphoribosylanthranilate transferase, mRNA            233   2e-67   
ref|XP_009379435.1|  PREDICTED: multiple C2 and transmembrane dom...    234   2e-67   
dbj|BAA13032.1|  phosphoribosylanthranilate transferase                 223   3e-67   
ref|XP_002441149.1|  hypothetical protein SORBIDRAFT_09g021260          233   3e-67   
ref|XP_010672179.1|  PREDICTED: multiple C2 and transmembrane dom...    234   4e-67   



>ref|XP_009594768.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Nicotiana tomentosiformis]
Length=774

 Score =   306 bits (785),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 143/150 (95%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WYYRWRPRNPPHMDTR+SCADNAHPDELDEEFDTFPTSRPPD+VRMRYDRLRS
Sbjct  625  YLFLIGVWYYRWRPRNPPHMDTRLSCADNAHPDELDEEFDTFPTSRPPDIVRMRYDRLRS  684

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCL+AAIVLYVTPFQVVALL GFY
Sbjct  685  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLIAAIVLYVTPFQVVALLTGFY  744

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPS PLNFFRRLPARTDCML
Sbjct  745  VLRHPRFRHKLPSAPLNFFRRLPARTDCML  774



>ref|XP_009614150.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Nicotiana tomentosiformis]
Length=774

 Score =   306 bits (785),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 143/150 (95%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WYYRWRPRNPPHMDTR+SCADNAHPDELDEEFDTFPTSRPPD+VRMRYDRLRS
Sbjct  625  YLFLIGVWYYRWRPRNPPHMDTRLSCADNAHPDELDEEFDTFPTSRPPDIVRMRYDRLRS  684

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCL+AAIVLYVTPFQVVALL GFY
Sbjct  685  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLIAAIVLYVTPFQVVALLTGFY  744

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPS PLNFFRRLPARTDCML
Sbjct  745  VLRHPRFRHKLPSAPLNFFRRLPARTDCML  774



>ref|XP_009785357.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Nicotiana sylvestris]
 ref|XP_009785358.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Nicotiana sylvestris]
 ref|XP_009785359.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Nicotiana sylvestris]
Length=774

 Score =   306 bits (784),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 143/150 (95%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WYYRWRPRNPPHMDTR+SCADNAHPDELDEEFDTFPTSRPPD+VRMRYDRLRS
Sbjct  625  YLFLIGVWYYRWRPRNPPHMDTRLSCADNAHPDELDEEFDTFPTSRPPDIVRMRYDRLRS  684

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCL+AAIVLYVTPFQVVALL GFY
Sbjct  685  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLIAAIVLYVTPFQVVALLTGFY  744

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPS PLNFFRRLPARTDCML
Sbjct  745  VLRHPRFRHKLPSAPLNFFRRLPARTDCML  774



>ref|XP_009799235.1| PREDICTED: extended synaptotagmin-1-like [Nicotiana sylvestris]
Length=776

 Score =   306 bits (783),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 142/150 (95%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WYYRWRPRNPPHMDTR+SCADNAHPDELDEEFDTFPTSRPPD+VRMRYDRLRS
Sbjct  627  YLFLIGVWYYRWRPRNPPHMDTRLSCADNAHPDELDEEFDTFPTSRPPDIVRMRYDRLRS  686

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGERLQSLLSWRDPRAT+LFVIFCL+AAIVLYVTPFQVVALL GFY
Sbjct  687  IAGRIQTVVGDLATQGERLQSLLSWRDPRATSLFVIFCLIAAIVLYVTPFQVVALLTGFY  746

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPS PLNFFRRLPARTDCML
Sbjct  747  VLRHPRFRHKLPSAPLNFFRRLPARTDCML  776



>ref|XP_004249277.1| PREDICTED: extended synaptotagmin-1-like [Solanum lycopersicum]
Length=775

 Score =   305 bits (781),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 142/150 (95%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WYYRWRPR+PPHMDTR+SCADNAHPDELDEEFDTFPTSRPPD+VRMRYDRLRS
Sbjct  626  YLFLIGVWYYRWRPRHPPHMDTRLSCADNAHPDELDEEFDTFPTSRPPDIVRMRYDRLRS  685

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCL+AAIVLYVTPFQVVALL+GFY
Sbjct  686  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLIAAIVLYVTPFQVVALLSGFY  745

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPS PLNFFRRLPARTDCML
Sbjct  746  VLRHPRFRHKLPSAPLNFFRRLPARTDCML  775



>emb|CDP10110.1| unnamed protein product [Coffea canephora]
Length=775

 Score =   302 bits (774),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 142/150 (95%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WYYRWRPRNPPHMDTR+SCADNAHPDELDEEFD+FPTSRP D+VRMRYDRLRS
Sbjct  626  YLFLIGVWYYRWRPRNPPHMDTRLSCADNAHPDELDEEFDSFPTSRPADIVRMRYDRLRS  685

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALL GFY
Sbjct  686  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLTGFY  745

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFR+KLPSVPLNFFRRLPARTDCML
Sbjct  746  VLRHPRFRYKLPSVPLNFFRRLPARTDCML  775



>ref|XP_011078851.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Sesamum indicum]
Length=772

 Score =   301 bits (772),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 142/150 (95%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WYYRWRPR+PPHMDTR+SCADNAHPDELDEEFDTFPTSRP D+VRMRYDRLRS
Sbjct  623  YLFLIGVWYYRWRPRHPPHMDTRLSCADNAHPDELDEEFDTFPTSRPADIVRMRYDRLRS  682

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALL GFY
Sbjct  683  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLTGFY  742

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFR+KLPSVPLNFFRRLPARTDCML
Sbjct  743  VLRHPRFRYKLPSVPLNFFRRLPARTDCML  772



>gb|EYU20709.1| hypothetical protein MIMGU_mgv1a001689mg [Erythranthe guttata]
Length=772

 Score =   301 bits (770),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 141/150 (94%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WYYRWRPR+PPHMDTR+SCADNAHPDELDEEFDTFPTSRP D+VRMRYDRLRS
Sbjct  623  YLFLIGVWYYRWRPRHPPHMDTRLSCADNAHPDELDEEFDTFPTSRPADIVRMRYDRLRS  682

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCL+AAIVLYVTPFQVVALL GFY
Sbjct  683  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLIAAIVLYVTPFQVVALLTGFY  742

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFR+KLPSVPLNFFRRLPARTDCML
Sbjct  743  VLRHPRFRYKLPSVPLNFFRRLPARTDCML  772



>ref|XP_004249278.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Solanum lycopersicum]
Length=774

 Score =   300 bits (769),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 139/150 (93%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WYYRWRPR+PPHMDTR+SCADNAHPDELDEEFDTFPTSRPPD+VRMRYDRLRS
Sbjct  625  YLFLIGVWYYRWRPRHPPHMDTRLSCADNAHPDELDEEFDTFPTSRPPDIVRMRYDRLRS  684

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCL+AAI LYVTPFQVVAL+ GFY
Sbjct  685  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLIAAIALYVTPFQVVALVNGFY  744

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPS P+NFFRRLPARTDCML
Sbjct  745  VLRHPRFRHKLPSTPVNFFRRLPARTDCML  774



>ref|XP_006351338.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Solanum tuberosum]
Length=773

 Score =   300 bits (767),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 138/150 (92%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WYYRWRPR+PPHMDTR+SCADNAHPDELDEEFDTFPTSRPPD+VRMRYDR+RS
Sbjct  624  YLFLIGVWYYRWRPRHPPHMDTRLSCADNAHPDELDEEFDTFPTSRPPDIVRMRYDRMRS  683

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCL+AAI LYVTPFQVVAL+ GFY
Sbjct  684  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLIAAIALYVTPFQVVALVTGFY  743

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPS P+NFFRRLPARTDCML
Sbjct  744  VLRHPRFRHKLPSTPVNFFRRLPARTDCML  773



>ref|XP_009587222.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Nicotiana tomentosiformis]
 ref|XP_009587223.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Nicotiana tomentosiformis]
Length=773

 Score =   299 bits (766),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 140/150 (93%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIGIWYYRWRPR+PPHMDTR+SCAD AHPDELDEEFDTFPTSRPPD++RMRYDR+RS
Sbjct  624  YLFLIGIWYYRWRPRHPPHMDTRLSCADAAHPDELDEEFDTFPTSRPPDIIRMRYDRIRS  683

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQ VALL GFY
Sbjct  684  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQAVALLTGFY  743

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFR+KLPSVPLNFFRRLPARTDCML
Sbjct  744  VLRHPRFRYKLPSVPLNFFRRLPARTDCML  773



>ref|XP_006351337.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Solanum tuberosum]
Length=774

 Score =   298 bits (764),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 139/150 (93%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WYYRWRPR+PPHMDTR+SCADNA+PDELDEEFDTFPT RPPD+VRMRYDRLRS
Sbjct  625  YLFLIGVWYYRWRPRHPPHMDTRLSCADNANPDELDEEFDTFPTPRPPDIVRMRYDRLRS  684

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFV+FCL+AAIVLYVTPFQVVALL+GFY
Sbjct  685  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVLFCLIAAIVLYVTPFQVVALLSGFY  744

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPS PLNFFRRLPARTDCML
Sbjct  745  VLRHPRFRHKLPSAPLNFFRRLPARTDCML  774



>gb|KDO57727.1| hypothetical protein CISIN_1g004109mg [Citrus sinensis]
Length=763

 Score =   296 bits (759),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 140/150 (93%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WYYRWRPR+PPHMDTR+S AD+AHPDELDEEFDTFPTSRP D+VRMRYDRLRS
Sbjct  614  YLFLIGVWYYRWRPRHPPHMDTRLSHADSAHPDELDEEFDTFPTSRPSDIVRMRYDRLRS  673

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCL+AAIVLYVTPFQVVALL GFY
Sbjct  674  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLIAAIVLYVTPFQVVALLTGFY  733

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPSVPLNFFRRLPARTDCML
Sbjct  734  VLRHPRFRHKLPSVPLNFFRRLPARTDCML  763



>ref|XP_009369854.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Pyrus x bretschneideri]
Length=774

 Score =   297 bits (760),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 140/150 (93%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WYYRWRPR+PPHMDTR+S AD+AHPDELDEEFDTFPTSRP D+VRMRYDRLRS
Sbjct  625  YLFLIGVWYYRWRPRHPPHMDTRLSHADSAHPDELDEEFDTFPTSRPSDIVRMRYDRLRS  684

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFV+FCL+AAIVLYVTPFQVVALLAGFY
Sbjct  685  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVLFCLIAAIVLYVTPFQVVALLAGFY  744

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPSVPLNFFRRLPARTDCML
Sbjct  745  VLRHPRFRHKLPSVPLNFFRRLPARTDCML  774



>ref|XP_009766493.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Nicotiana sylvestris]
Length=774

 Score =   296 bits (759),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 139/150 (93%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIGIWYYRWRPR+PPHMDTR+SCAD AHPDELDEEFDTFPTSRPPD++RMRYDR+RS
Sbjct  625  YLFLIGIWYYRWRPRHPPHMDTRLSCADAAHPDELDEEFDTFPTSRPPDIIRMRYDRIRS  684

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYV PFQ VALL GFY
Sbjct  685  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVMPFQAVALLTGFY  744

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFR+KLPSVPLNFFRRLPARTDCML
Sbjct  745  VLRHPRFRYKLPSVPLNFFRRLPARTDCML  774



>ref|XP_006437045.1| hypothetical protein CICLE_v10030764mg [Citrus clementina]
 ref|XP_006485025.1| PREDICTED: extended synaptotagmin-1-like isoform X1 [Citrus sinensis]
 ref|XP_006485026.1| PREDICTED: extended synaptotagmin-1-like isoform X2 [Citrus sinensis]
 gb|ESR50285.1| hypothetical protein CICLE_v10030764mg [Citrus clementina]
 gb|KDO57725.1| hypothetical protein CISIN_1g004109mg [Citrus sinensis]
 gb|KDO57726.1| hypothetical protein CISIN_1g004109mg [Citrus sinensis]
Length=773

 Score =   296 bits (759),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 140/150 (93%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WYYRWRPR+PPHMDTR+S AD+AHPDELDEEFDTFPTSRP D+VRMRYDRLRS
Sbjct  624  YLFLIGVWYYRWRPRHPPHMDTRLSHADSAHPDELDEEFDTFPTSRPSDIVRMRYDRLRS  683

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCL+AAIVLYVTPFQVVALL GFY
Sbjct  684  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLIAAIVLYVTPFQVVALLTGFY  743

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPSVPLNFFRRLPARTDCML
Sbjct  744  VLRHPRFRHKLPSVPLNFFRRLPARTDCML  773



>ref|XP_008387239.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Malus domestica]
 ref|XP_008387240.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Malus domestica]
 ref|XP_008387241.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Malus domestica]
 ref|XP_008387242.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Malus domestica]
Length=774

 Score =   296 bits (759),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 140/150 (93%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WYYRWRPR+PPHMDTR+S AD+AHPDELDEEFDTFPTSRP D+VRMRYDRLRS
Sbjct  625  YLFLIGVWYYRWRPRHPPHMDTRLSHADSAHPDELDEEFDTFPTSRPSDIVRMRYDRLRS  684

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFV+FCL+AAIVLYVTPFQVVALLAGFY
Sbjct  685  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVLFCLIAAIVLYVTPFQVVALLAGFY  744

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPSVPLNFFRRLPARTDCML
Sbjct  745  VLRHPRFRHKLPSVPLNFFRRLPARTDCML  774



>ref|XP_002322682.2| hypothetical protein POPTR_0016s04960g [Populus trichocarpa]
 ref|XP_006373765.1| hypothetical protein POPTR_0016s04960g [Populus trichocarpa]
 ref|XP_006373766.1| hypothetical protein POPTR_0016s04960g [Populus trichocarpa]
 ref|XP_006373767.1| C2 domain-containing family protein [Populus trichocarpa]
 gb|EEF04443.2| hypothetical protein POPTR_0016s04960g [Populus trichocarpa]
 gb|ERP51562.1| hypothetical protein POPTR_0016s04960g [Populus trichocarpa]
 gb|ERP51563.1| hypothetical protein POPTR_0016s04960g [Populus trichocarpa]
 gb|ERP51564.1| C2 domain-containing family protein [Populus trichocarpa]
Length=774

 Score =   296 bits (759),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 139/150 (93%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WYYRWRPR+PPHMDTR+S A++AHPDELDEEFDTFPTSRPPD+VRMRYDRLRS
Sbjct  625  YLFLIGVWYYRWRPRHPPHMDTRLSHAESAHPDELDEEFDTFPTSRPPDIVRMRYDRLRS  684

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFV+FCL+AAIVLYVTPFQVVALL GFY
Sbjct  685  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVLFCLIAAIVLYVTPFQVVALLTGFY  744

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPSVPLNFFRRLPARTDCML
Sbjct  745  VLRHPRFRHKLPSVPLNFFRRLPARTDCML  774



>ref|XP_004304385.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Fragaria vesca subsp. vesca]
 ref|XP_011468070.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Fragaria vesca subsp. vesca]
Length=774

 Score =   296 bits (758),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 139/150 (93%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WYYRWRPR+PPHMDTR+S AD+AHPDELDEEFDTFPTSRP D+VRMRYDRLRS
Sbjct  625  YLFLIGVWYYRWRPRHPPHMDTRLSHADSAHPDELDEEFDTFPTSRPSDIVRMRYDRLRS  684

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFV+FCL+AAIVLYVTPFQ+VALLAGFY
Sbjct  685  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVLFCLIAAIVLYVTPFQIVALLAGFY  744

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPSVPLNFFRRLPARTDCML
Sbjct  745  VLRHPRFRHKLPSVPLNFFRRLPARTDCML  774



>ref|XP_010057953.1| PREDICTED: extended synaptotagmin-1-like [Eucalyptus grandis]
 ref|XP_010057962.1| PREDICTED: extended synaptotagmin-1-like [Eucalyptus grandis]
 ref|XP_010057968.1| PREDICTED: extended synaptotagmin-1-like [Eucalyptus grandis]
 gb|KCW90293.1| hypothetical protein EUGRSUZ_A02437 [Eucalyptus grandis]
Length=777

 Score =   296 bits (758),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 140/150 (93%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLF+IG+WYYRWRPR+PPHMDTR+S AD+AHPDELDEEFDTFPTSRP D+VRMRYDRLRS
Sbjct  628  YLFMIGVWYYRWRPRHPPHMDTRLSHADSAHPDELDEEFDTFPTSRPTDIVRMRYDRLRS  687

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALL GFY
Sbjct  688  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLTGFY  747

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPSVPLNFFRRLPARTDCML
Sbjct  748  VLRHPRFRHKLPSVPLNFFRRLPARTDCML  777



>ref|XP_007201936.1| hypothetical protein PRUPE_ppa001850mg [Prunus persica]
 gb|EMJ03135.1| hypothetical protein PRUPE_ppa001850mg [Prunus persica]
Length=756

 Score =   295 bits (756),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 139/150 (93%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WYYRWRPR+PPHMDTR+S AD+AHPDELDEEFDTFPTSRP D+VRMRYDRLRS
Sbjct  607  YLFLIGVWYYRWRPRHPPHMDTRLSHADSAHPDELDEEFDTFPTSRPSDIVRMRYDRLRS  666

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGERLQSLLSWRDPRAT+LFV+FCL+AAIVLYVTPFQVVALLAGFY
Sbjct  667  IAGRIQTVVGDLATQGERLQSLLSWRDPRATSLFVLFCLIAAIVLYVTPFQVVALLAGFY  726

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPSVPLNFFRRLPARTDCML
Sbjct  727  VLRHPRFRHKLPSVPLNFFRRLPARTDCML  756



>gb|EPS67145.1| hypothetical protein M569_07629 [Genlisea aurea]
Length=772

 Score =   296 bits (757),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 138/150 (92%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WYYRWRPR+PPHMDTR+SCADNAHPDELDEEFD+FPTSRP DVVRMRYDRLRS
Sbjct  623  YLFLIGVWYYRWRPRHPPHMDTRLSCADNAHPDELDEEFDSFPTSRPADVVRMRYDRLRS  682

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCL AA+VLYVTPFQ VAL+A FY
Sbjct  683  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLAAAVVLYVTPFQAVALVAVFY  742

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPSVPLNFFRRLPA+TDCML
Sbjct  743  VLRHPRFRHKLPSVPLNFFRRLPAKTDCML  772



>ref|XP_008240960.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Prunus mume]
Length=774

 Score =   296 bits (757),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 139/150 (93%), Positives = 148/150 (99%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WYYRWRPR+PPHMDTR+S AD+AHPDELDEEFDTFPTSRP D+VRMRYDRLRS
Sbjct  625  YLFLIGVWYYRWRPRHPPHMDTRLSHADSAHPDELDEEFDTFPTSRPSDIVRMRYDRLRS  684

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGERLQSLLSWRDPRAT+LFV+FCL+AAIVLYVTPFQVVALLAGFY
Sbjct  685  IAGRIQTVVGDLATQGERLQSLLSWRDPRATSLFVLFCLIAAIVLYVTPFQVVALLAGFY  744

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPSVPLNFFRRLPARTDCML
Sbjct  745  VLRHPRFRHKLPSVPLNFFRRLPARTDCML  774



>ref|XP_008443079.1| PREDICTED: extended synaptotagmin-1 [Cucumis melo]
Length=774

 Score =   295 bits (756),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 140/150 (93%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WYYRWRPR+PPHMDTR+S AD+AHPDELDEEFDTFPTSRP D+VRMRYDRLRS
Sbjct  625  YLFLIGVWYYRWRPRHPPHMDTRLSHADSAHPDELDEEFDTFPTSRPGDIVRMRYDRLRS  684

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFV+FCLVAAIVLYVTPFQVVALL GFY
Sbjct  685  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVLFCLVAAIVLYVTPFQVVALLTGFY  744

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPSVPLNFFRRLPARTDCML
Sbjct  745  VLRHPRFRHKLPSVPLNFFRRLPARTDCML  774



>gb|KDP24596.1| hypothetical protein JCGZ_25512 [Jatropha curcas]
Length=776

 Score =   295 bits (756),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 140/150 (93%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WYYRWRPR+PPHMDTR+S A++AHPDELDEEFDTFPTSRP D+VRMRYDRLRS
Sbjct  627  YLFLIGVWYYRWRPRHPPHMDTRLSHAESAHPDELDEEFDTFPTSRPSDIVRMRYDRLRS  686

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALL GFY
Sbjct  687  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLTGFY  746

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPSVPLNFFRRLPARTDCML
Sbjct  747  VLRHPRFRHKLPSVPLNFFRRLPARTDCML  776



>gb|KJB36100.1| hypothetical protein B456_006G141200 [Gossypium raimondii]
 gb|KJB36101.1| hypothetical protein B456_006G141200 [Gossypium raimondii]
 gb|KJB36102.1| hypothetical protein B456_006G141200 [Gossypium raimondii]
 gb|KJB36103.1| hypothetical protein B456_006G141200 [Gossypium raimondii]
Length=775

 Score =   295 bits (755),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 141/150 (94%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WYYRWRPR+PPHMDTR+S AD+AHPDELDEEFDTFPTSRP D+VRMRYDRLRS
Sbjct  626  YLFLIGVWYYRWRPRHPPHMDTRLSHADSAHPDELDEEFDTFPTSRPSDIVRMRYDRLRS  685

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY
Sbjct  686  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  745

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPSVPLNFFRRLPARTD ML
Sbjct  746  ILRHPRFRHKLPSVPLNFFRRLPARTDSML  775



>emb|CAN80955.1| hypothetical protein VITISV_013781 [Vitis vinifera]
Length=752

 Score =   295 bits (754),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 140/150 (93%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WY+RWRPR+PPHMDTR+S AD+AHPDELDEEFDTFPTSRP DVVRMRYDRLRS
Sbjct  603  YLFLIGVWYFRWRPRHPPHMDTRLSHADSAHPDELDEEFDTFPTSRPSDVVRMRYDRLRS  662

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFV+FCLVAAIVLYVTPFQVVALL GFY
Sbjct  663  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVLFCLVAAIVLYVTPFQVVALLTGFY  722

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPSVPLNFFRRLPARTDCML
Sbjct  723  VLRHPRFRHKLPSVPLNFFRRLPARTDCML  752



>ref|XP_004249163.1| PREDICTED: extended synaptotagmin-1-like [Solanum lycopersicum]
Length=772

 Score =   295 bits (755),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 137/150 (91%), Positives = 145/150 (97%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIGIWYYRWRPR+PPHMDTR+SCAD AHPDELDEEFDTFPTSR PD++RMRYDR+RS
Sbjct  623  YLFLIGIWYYRWRPRHPPHMDTRLSCADTAHPDELDEEFDTFPTSRSPDIIRMRYDRIRS  682

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAA+VLYVTPFQ V LL GFY
Sbjct  683  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAVVLYVTPFQAVGLLTGFY  742

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFR+KLPSVPLNFFRRLPARTDCML
Sbjct  743  VLRHPRFRYKLPSVPLNFFRRLPARTDCML  772



>ref|XP_002278165.1| PREDICTED: extended synaptotagmin-1 [Vitis vinifera]
 ref|XP_010653909.1| PREDICTED: extended synaptotagmin-1 [Vitis vinifera]
 ref|XP_010653910.1| PREDICTED: extended synaptotagmin-1 [Vitis vinifera]
Length=777

 Score =   295 bits (754),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 140/150 (93%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WY+RWRPR+PPHMDTR+S AD+AHPDELDEEFDTFPTSRP DVVRMRYDRLRS
Sbjct  628  YLFLIGVWYFRWRPRHPPHMDTRLSHADSAHPDELDEEFDTFPTSRPSDVVRMRYDRLRS  687

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFV+FCLVAAIVLYVTPFQVVALL GFY
Sbjct  688  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVLFCLVAAIVLYVTPFQVVALLTGFY  747

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPSVPLNFFRRLPARTDCML
Sbjct  748  VLRHPRFRHKLPSVPLNFFRRLPARTDCML  777



>ref|XP_009376104.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Pyrus x bretschneideri]
Length=771

 Score =   295 bits (754),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 138/150 (92%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WYYRWRPR+PPHMDTR+S AD+AHPDELDEEFDTFPTSRP D+VRMRYDRLRS
Sbjct  622  YLFLIGVWYYRWRPRHPPHMDTRLSHADSAHPDELDEEFDTFPTSRPSDIVRMRYDRLRS  681

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFV+FCL+AAI+LYVTPFQVVALL GFY
Sbjct  682  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVLFCLIAAIILYVTPFQVVALLTGFY  741

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPSVPLNFFRRLPARTDCML
Sbjct  742  VLRHPRFRHKLPSVPLNFFRRLPARTDCML  771



>gb|AAK74053.1| F19C24.20/F19C24.20 [Arabidopsis thaliana]
 gb|AAL06816.1| At1g51570/F19C24.20 [Arabidopsis thaliana]
Length=290

 Score =   280 bits (716),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 142/150 (95%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WYYRWRPR+PPHMDTR+S AD+AHPDELDEEFDTFPTSRP D+VRMRYDRLRS
Sbjct  141  YLFLIGVWYYRWRPRHPPHMDTRLSHADSAHPDELDEEFDTFPTSRPSDIVRMRYDRLRS  200

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGER QSLLSWRDPRATALFV+FCL+AA++LY+TPFQVVA   G Y
Sbjct  201  IAGRIQTVVGDLATQGERFQSLLSWRDPRATALFVLFCLIAAVILYITPFQVVAFAIGLY  260

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPR R+KLPSVPLNFFRRLPARTDCML
Sbjct  261  VLRHPRLRYKLPSVPLNFFRRLPARTDCML  290



>ref|XP_007145661.1| hypothetical protein PHAVU_007G257800g [Phaseolus vulgaris]
 ref|XP_007145662.1| hypothetical protein PHAVU_007G257800g [Phaseolus vulgaris]
 gb|ESW17655.1| hypothetical protein PHAVU_007G257800g [Phaseolus vulgaris]
 gb|ESW17656.1| hypothetical protein PHAVU_007G257800g [Phaseolus vulgaris]
Length=774

 Score =   293 bits (751),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 139/150 (93%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIGIWYYRWRPR PPHMDTR+S AD+AHPDELDEEFDTFPTSRP D+VRMRYDRLRS
Sbjct  625  YLFLIGIWYYRWRPRQPPHMDTRLSHADSAHPDELDEEFDTFPTSRPNDIVRMRYDRLRS  684

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGERLQSLLSWRDPRAT+LFV+FCL+AAIVLYVTPFQVVALLAG Y
Sbjct  685  IAGRIQTVVGDLATQGERLQSLLSWRDPRATSLFVLFCLIAAIVLYVTPFQVVALLAGIY  744

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPSVPLNFFRRLPARTDCML
Sbjct  745  VLRHPRFRHKLPSVPLNFFRRLPARTDCML  774



>ref|XP_006362239.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Solanum tuberosum]
Length=773

 Score =   293 bits (751),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 136/150 (91%), Positives = 144/150 (96%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIGIWYYRWRPR+PPHMDTR+SCAD AHPDELDEEFDTFPTSR PD++RMRYDR+RS
Sbjct  624  YLFLIGIWYYRWRPRHPPHMDTRLSCADTAHPDELDEEFDTFPTSRSPDIIRMRYDRIRS  683

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCL AA+VLYVTPFQ V LL GFY
Sbjct  684  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLAAAVVLYVTPFQAVGLLTGFY  743

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFR+KLPSVPLNFFRRLPARTDCML
Sbjct  744  VLRHPRFRYKLPSVPLNFFRRLPARTDCML  773



>ref|XP_010111396.1| Multiple C2 and transmembrane domain-containing protein 2 [Morus 
notabilis]
 gb|EXC30874.1| Multiple C2 and transmembrane domain-containing protein 2 [Morus 
notabilis]
Length=774

 Score =   293 bits (750),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 138/150 (92%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WYYRWRPR+PPHMDTR+S AD+AHPDELDEEFDTFPTSRP D+VRMRYDRLRS
Sbjct  625  YLFLIGVWYYRWRPRHPPHMDTRLSHADSAHPDELDEEFDTFPTSRPMDIVRMRYDRLRS  684

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFV+FCL+AAIVLYVTPFQVVALL GFY
Sbjct  685  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVLFCLIAAIVLYVTPFQVVALLTGFY  744

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLP+VPLNFFRRLPARTDCML
Sbjct  745  VLRHPRFRHKLPAVPLNFFRRLPARTDCML  774



>ref|XP_007028942.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 2 [Theobroma cacao]
 ref|XP_007028943.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 2 [Theobroma cacao]
 ref|XP_007028944.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 2 [Theobroma cacao]
 gb|EOY09444.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 2 [Theobroma cacao]
 gb|EOY09445.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 2 [Theobroma cacao]
 gb|EOY09446.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 2 [Theobroma cacao]
Length=776

 Score =   293 bits (750),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 140/150 (93%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WYYRWRPR+PPHMDTR+S AD++HPDELDEEFDTFPTSRP DVVRMRYDRLRS
Sbjct  627  YLFLIGVWYYRWRPRHPPHMDTRLSHADSSHPDELDEEFDTFPTSRPSDVVRMRYDRLRS  686

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALL GFY
Sbjct  687  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLTGFY  746

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPSVPLNFFRRLPARTD ML
Sbjct  747  ILRHPRFRHKLPSVPLNFFRRLPARTDSML  776



>ref|XP_004493560.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Cicer arietinum]
Length=776

 Score =   293 bits (750),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 138/150 (92%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIGIWYYRWRPR+PPHMDTR+S AD+AHPDELDEEFDTFPT+RP D+VRMRYDRLRS
Sbjct  627  YLFLIGIWYYRWRPRHPPHMDTRLSHADSAHPDELDEEFDTFPTTRPSDIVRMRYDRLRS  686

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFV+FCL+AAIVLYVTPFQVVALL G Y
Sbjct  687  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVLFCLIAAIVLYVTPFQVVALLTGIY  746

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPSVPLNFFRRLPARTDCML
Sbjct  747  VLRHPRFRHKLPSVPLNFFRRLPARTDCML  776



>ref|XP_003625221.1| Anthranilate phosphoribosyltransferase-like protein [Medicago 
truncatula]
 gb|ABN08649.1| C2 [Medicago truncatula]
 gb|AES81439.1| C2 calcium/lipid-binding and GRAM domain protein [Medicago truncatula]
Length=775

 Score =   293 bits (749),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 137/150 (91%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WYYRWRPR+PPHMDTR+S AD+AHPDELDEEFDTFPT+RP D+VRMRYDRLRS
Sbjct  626  YLFLIGVWYYRWRPRHPPHMDTRLSHADSAHPDELDEEFDTFPTTRPSDIVRMRYDRLRS  685

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFV+FCL+AAIVLYVTPFQVVALL+G Y
Sbjct  686  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVLFCLIAAIVLYVTPFQVVALLSGIY  745

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPSVPLNFFRRLPARTDCML
Sbjct  746  VLRHPRFRHKLPSVPLNFFRRLPARTDCML  775



>ref|XP_004136579.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Cucumis sativus]
 ref|XP_004161488.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Cucumis sativus]
 gb|KGN59322.1| hypothetical protein Csa_3G809980 [Cucumis sativus]
Length=774

 Score =   293 bits (749),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 139/150 (93%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WYYRWRPR+PPHMDTR+S AD+AHPDELDEEFDTFPTSR  D+VRMRYDRLRS
Sbjct  625  YLFLIGVWYYRWRPRHPPHMDTRLSHADSAHPDELDEEFDTFPTSRGGDIVRMRYDRLRS  684

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFV+FCLVAAIVLYVTPFQVVALL GFY
Sbjct  685  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVLFCLVAAIVLYVTPFQVVALLTGFY  744

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPSVPLNFFRRLPARTDCML
Sbjct  745  VLRHPRFRHKLPSVPLNFFRRLPARTDCML  774



>ref|XP_010548191.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Tarenaya hassleriana]
 ref|XP_010548275.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Tarenaya hassleriana]
Length=774

 Score =   293 bits (749),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 139/150 (93%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WYYRWRPR+PP+MDTR+S AD+AHPDELDEEFDTFPTSRP D+VRMRYDRLRS
Sbjct  625  YLFLIGVWYYRWRPRHPPYMDTRLSHADSAHPDELDEEFDTFPTSRPSDIVRMRYDRLRS  684

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGER QSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALL GFY
Sbjct  685  IAGRIQTVVGDLATQGERFQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLTGFY  744

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPSVPLNFFRRLPARTDCML
Sbjct  745  VLRHPRFRHKLPSVPLNFFRRLPARTDCML  774



>gb|KHN07409.1| Multiple C2 and transmembrane domain-containing protein 2 [Glycine 
soja]
Length=775

 Score =   292 bits (748),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 137/150 (91%), Positives = 145/150 (97%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WYYRWRPR+PPHMDTR+S AD+AHPDELDEEFDTFPT+RP D+VRMRYDRLRS
Sbjct  626  YLFLIGVWYYRWRPRHPPHMDTRLSHADSAHPDELDEEFDTFPTTRPSDIVRMRYDRLRS  685

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQ+VAL  G Y
Sbjct  686  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQIVALFTGIY  745

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPSVPLNFFRRLPARTDCML
Sbjct  746  VLRHPRFRHKLPSVPLNFFRRLPARTDCML  775



>ref|XP_008360635.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Malus domestica]
Length=774

 Score =   292 bits (748),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 137/150 (91%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WYYRWRPR+PPHMDTR+S AD+AHPDELDEEFDTFPTSRP ++VRMRYDRLRS
Sbjct  625  YLFLIGVWYYRWRPRHPPHMDTRLSHADSAHPDELDEEFDTFPTSRPSEIVRMRYDRLRS  684

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFV+FCL+AAI LYVTPFQVVALL GFY
Sbjct  685  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVLFCLIAAIXLYVTPFQVVALLTGFY  744

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPSVPLNFFRRLPARTDCML
Sbjct  745  VLRHPRFRHKLPSVPLNFFRRLPARTDCML  774



>ref|XP_003521201.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like isoformX1 [Glycine max]
 ref|XP_003521202.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like isoformX2 [Glycine max]
 ref|XP_006576848.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like isoform X3 [Glycine max]
 ref|XP_006576849.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like isoform X4 [Glycine max]
Length=775

 Score =   292 bits (747),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 137/150 (91%), Positives = 145/150 (97%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WYYRWRPR+PPHMDTR+S AD+AHPDELDEEFDTFPT+RP D+VRMRYDRLRS
Sbjct  626  YLFLIGVWYYRWRPRHPPHMDTRLSHADSAHPDELDEEFDTFPTTRPSDIVRMRYDRLRS  685

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQ+VAL  G Y
Sbjct  686  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQIVALFTGIY  745

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPSVPLNFFRRLPARTDCML
Sbjct  746  VLRHPRFRHKLPSVPLNFFRRLPARTDCML  775



>ref|XP_010554852.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Tarenaya hassleriana]
 ref|XP_010554853.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Tarenaya hassleriana]
 ref|XP_010554854.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Tarenaya hassleriana]
 ref|XP_010554855.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Tarenaya hassleriana]
Length=773

 Score =   292 bits (747),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 136/150 (91%), Positives = 145/150 (97%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLF IG+WYYRWRPR+PPHMDTR+S AD+AHPDELDEEFDTFPTSRP D+VRMRYDRLRS
Sbjct  624  YLFFIGVWYYRWRPRHPPHMDTRLSHADSAHPDELDEEFDTFPTSRPSDIVRMRYDRLRS  683

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGER QSLLSWRDPRATALFV+FCL+AA+VLYVTPFQVVALL GFY
Sbjct  684  IAGRIQTVVGDLATQGERFQSLLSWRDPRATALFVVFCLIAAVVLYVTPFQVVALLTGFY  743

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPSVPLNFFRRLPARTDCML
Sbjct  744  VLRHPRFRHKLPSVPLNFFRRLPARTDCML  773



>ref|XP_010672701.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Beta vulgaris subsp. vulgaris]
Length=775

 Score =   292 bits (747),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 138/150 (92%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WYYRWRPR+PPHMDTR+S AD+AHPDELDEEFDTFPTS+P D+VRMRYDRLRS
Sbjct  626  YLFLIGVWYYRWRPRHPPHMDTRLSHADSAHPDELDEEFDTFPTSKPADIVRMRYDRLRS  685

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCL+AAIVLYVTPFQVVALL GFY
Sbjct  686  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLIAAIVLYVTPFQVVALLTGFY  745

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPSVPLNFFRRLPARTD ML
Sbjct  746  VLRHPRFRHKLPSVPLNFFRRLPARTDSML  775



>ref|XP_007162297.1| hypothetical protein PHAVU_001G140200g [Phaseolus vulgaris]
 gb|ESW34291.1| hypothetical protein PHAVU_001G140200g [Phaseolus vulgaris]
Length=775

 Score =   291 bits (746),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 138/150 (92%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WYYRWRPR+PPHMDTR+S AD+AHPDELDEEFDTFPT+R  D+VRMRYDRLRS
Sbjct  626  YLFLIGVWYYRWRPRHPPHMDTRLSHADSAHPDELDEEFDTFPTTRHSDIVRMRYDRLRS  685

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALL+G Y
Sbjct  686  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLSGIY  745

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPSVPLNFFRRLPARTDCML
Sbjct  746  VLRHPRFRHKLPSVPLNFFRRLPARTDCML  775



>gb|KHN26368.1| Multiple C2 and transmembrane domain-containing protein 2 [Glycine 
soja]
Length=738

 Score =   289 bits (740),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 136/150 (91%), Positives = 144/150 (96%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WYYRWRPR+PPHMDTR+S AD+AHPDELDEEFDTFPT+R  D+VRMRYDRLRS
Sbjct  589  YLFLIGVWYYRWRPRHPPHMDTRLSHADSAHPDELDEEFDTFPTTRASDIVRMRYDRLRS  648

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQ+VAL  G Y
Sbjct  649  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQIVALFTGIY  708

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPSVPLNFFRRLPARTDCML
Sbjct  709  VLRHPRFRHKLPSVPLNFFRRLPARTDCML  738



>gb|ACN28542.1| unknown [Zea mays]
Length=490

 Score =   283 bits (723),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 134/150 (89%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WYYRWR R PPHMDTR+S A+ AHPDELDEEFDTFPTSRPPDVVRMRYDRLRS
Sbjct  341  YLFLIGVWYYRWRLRQPPHMDTRLSHAETAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  400

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            +AGRIQTVVGDLATQGERLQSLLSWRDPRATALFV+FC VAAIVLYVTPF+VV  LAG Y
Sbjct  401  VAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVVFCFVAAIVLYVTPFRVVVFLAGLY  460

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            MLRHPRFRHK+PSVPLNFFRRLPARTD ML
Sbjct  461  MLRHPRFRHKMPSVPLNFFRRLPARTDSML  490



>ref|XP_003554197.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Glycine max]
Length=775

 Score =   290 bits (741),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 136/150 (91%), Positives = 144/150 (96%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WYYRWRPR+PPHMDTR+S AD+AHPDELDEEFDTFPT+R  D+VRMRYDRLRS
Sbjct  626  YLFLIGVWYYRWRPRHPPHMDTRLSHADSAHPDELDEEFDTFPTTRASDIVRMRYDRLRS  685

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQ+VAL  G Y
Sbjct  686  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQIVALFTGIY  745

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPSVPLNFFRRLPARTDCML
Sbjct  746  VLRHPRFRHKLPSVPLNFFRRLPARTDCML  775



>emb|CDX98254.1| BnaC06g16150D [Brassica napus]
Length=774

 Score =   288 bits (738),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 135/150 (90%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WYYRWRPR+PPHMDTR+S AD+AHPDELDEEFDTFPTSRP D+VRMRYDRLRS
Sbjct  625  YLFLIGVWYYRWRPRHPPHMDTRLSHADSAHPDELDEEFDTFPTSRPSDIVRMRYDRLRS  684

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFV+FCL+AA+VLYVTPFQVVALL G Y
Sbjct  685  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVLFCLIAAVVLYVTPFQVVALLVGIY  744

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFR++LPSVPLNFFRRLPARTDCML
Sbjct  745  VLRHPRFRYRLPSVPLNFFRRLPARTDCML  774



>ref|XP_009104078.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Brassica rapa]
 ref|XP_009104079.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Brassica rapa]
Length=774

 Score =   288 bits (738),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 135/150 (90%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WYYRWRPR+PPHMDTR+S AD+AHPDELDEEFDTFPTSRP D+VRMRYDRLRS
Sbjct  625  YLFLIGVWYYRWRPRHPPHMDTRLSHADSAHPDELDEEFDTFPTSRPSDIVRMRYDRLRS  684

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFV+FCL+AA+VLYVTPFQVVALL G Y
Sbjct  685  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVLFCLIAAVVLYVTPFQVVALLVGIY  744

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFR++LPSVPLNFFRRLPARTDCML
Sbjct  745  VLRHPRFRYRLPSVPLNFFRRLPARTDCML  774



>emb|CDX67712.1| BnaA07g17520D [Brassica napus]
Length=774

 Score =   288 bits (738),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 135/150 (90%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WYYRWRPR+PPHMDTR+S AD+AHPDELDEEFDTFPTSRP D+VRMRYDRLRS
Sbjct  625  YLFLIGVWYYRWRPRHPPHMDTRLSHADSAHPDELDEEFDTFPTSRPSDIVRMRYDRLRS  684

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFV+FCL+AA+VLYVTPFQVVALL G Y
Sbjct  685  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVLFCLIAAVVLYVTPFQVVALLVGIY  744

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFR++LPSVPLNFFRRLPARTDCML
Sbjct  745  VLRHPRFRYRLPSVPLNFFRRLPARTDCML  774



>emb|CDY69710.1| BnaAnng31280D [Brassica napus]
Length=779

 Score =   288 bits (738),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 135/150 (90%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WYYRWRPR+PPHMDTR+S AD+AHPDELDEEFDTFPTSRP D+VRMRYDRLRS
Sbjct  630  YLFLIGVWYYRWRPRHPPHMDTRLSHADSAHPDELDEEFDTFPTSRPSDIVRMRYDRLRS  689

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFV+FCL+AA+VLYVTPFQVVALL G Y
Sbjct  690  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVLFCLIAAVVLYVTPFQVVALLVGIY  749

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFR++LPSVPLNFFRRLPARTDCML
Sbjct  750  VLRHPRFRYRLPSVPLNFFRRLPARTDCML  779



>ref|XP_009139005.1| PREDICTED: extended synaptotagmin-1-like [Brassica rapa]
 ref|XP_009139006.1| PREDICTED: extended synaptotagmin-1-like [Brassica rapa]
Length=778

 Score =   288 bits (737),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 135/150 (90%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WYYRWRPR+PPHMDTR+S AD+AHPDELDEEFDTFPTSRP D+VRMRYDRLRS
Sbjct  629  YLFLIGVWYYRWRPRHPPHMDTRLSHADSAHPDELDEEFDTFPTSRPSDIVRMRYDRLRS  688

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFV+FCL+AA+VLYVTPFQVVALL G Y
Sbjct  689  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVLFCLIAAVVLYVTPFQVVALLVGIY  748

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFR++LPSVPLNFFRRLPARTDCML
Sbjct  749  VLRHPRFRYRLPSVPLNFFRRLPARTDCML  778



>ref|XP_006402831.1| hypothetical protein EUTSA_v10005798mg [Eutrema salsugineum]
 ref|XP_006402832.1| hypothetical protein EUTSA_v10005798mg [Eutrema salsugineum]
 gb|ESQ44284.1| hypothetical protein EUTSA_v10005798mg [Eutrema salsugineum]
 gb|ESQ44285.1| hypothetical protein EUTSA_v10005798mg [Eutrema salsugineum]
Length=774

 Score =   288 bits (736),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 135/150 (90%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WYYRWRPR+PPHMDTR+S AD+AHPDELDEEFDTFPTSRP D+VRMRYDRLRS
Sbjct  625  YLFLIGVWYYRWRPRHPPHMDTRLSHADSAHPDELDEEFDTFPTSRPSDIVRMRYDRLRS  684

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGERLQSLLSWRDPRATA+FV+FCL+AAIVLYVTPFQVVALL G Y
Sbjct  685  IAGRIQTVVGDLATQGERLQSLLSWRDPRATAIFVLFCLIAAIVLYVTPFQVVALLIGIY  744

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFR++LPSVPLNFFRRLPARTDCML
Sbjct  745  VLRHPRFRYRLPSVPLNFFRRLPARTDCML  774



>ref|XP_004144665.1| PREDICTED: uncharacterized protein LOC101203090 isoform 1 [Cucumis 
sativus]
 ref|XP_004144666.1| PREDICTED: uncharacterized protein LOC101203090 isoform 2 [Cucumis 
sativus]
 ref|XP_004168423.1| PREDICTED: uncharacterized LOC101203090 [Cucumis sativus]
 gb|KGN54869.1| hypothetical protein Csa_4G567200 [Cucumis sativus]
Length=776

 Score =   288 bits (736),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 135/150 (90%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+W+YRWRPR+PPHMDTR+S AD++HPDELDEEFDTFPTSRP D+VRMRYDRLRS
Sbjct  627  YLFLIGVWHYRWRPRHPPHMDTRLSHADSSHPDELDEEFDTFPTSRPADIVRMRYDRLRS  686

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGERLQSLLSWRDPRA+ALFVIFCLV+AIVLYVTPFQVVALL+G Y
Sbjct  687  IAGRIQTVVGDLATQGERLQSLLSWRDPRASALFVIFCLVSAIVLYVTPFQVVALLSGIY  746

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFR+KLPSVPLNFFRRLPARTDCML
Sbjct  747  VLRHPRFRYKLPSVPLNFFRRLPARTDCML  776



>ref|XP_008442250.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Cucumis melo]
 ref|XP_008442251.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Cucumis melo]
 ref|XP_008442253.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Cucumis melo]
Length=776

 Score =   288 bits (736),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 135/150 (90%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+W+YRWRPR+PPHMDTR+S AD++HPDELDEEFDTFPTSRP D+VRMRYDRLRS
Sbjct  627  YLFLIGVWHYRWRPRHPPHMDTRLSHADSSHPDELDEEFDTFPTSRPADIVRMRYDRLRS  686

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGERLQSLLSWRDPRA+ALFVIFCLV+AIVLYVTPFQVVALL+G Y
Sbjct  687  IAGRIQTVVGDLATQGERLQSLLSWRDPRASALFVIFCLVSAIVLYVTPFQVVALLSGIY  746

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFR+KLPSVPLNFFRRLPARTDCML
Sbjct  747  VLRHPRFRYKLPSVPLNFFRRLPARTDCML  776



>ref|XP_011033252.1| PREDICTED: extended synaptotagmin-1 [Populus euphratica]
 ref|XP_011033253.1| PREDICTED: extended synaptotagmin-1 [Populus euphratica]
 ref|XP_011033254.1| PREDICTED: extended synaptotagmin-1 [Populus euphratica]
Length=774

 Score =   287 bits (735),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 135/150 (90%), Positives = 145/150 (97%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WYYRWRPR+PPHMDTR+S A++AHPDELDEEFDTFPTS+  D+VRMRYDRLRS
Sbjct  625  YLFLIGVWYYRWRPRHPPHMDTRLSHAESAHPDELDEEFDTFPTSQTADIVRMRYDRLRS  684

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFV+FCL+AAIVLYVTPFQVVALL G Y
Sbjct  685  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVLFCLIAAIVLYVTPFQVVALLIGLY  744

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPSVPLNFFRRLPARTDCML
Sbjct  745  VLRHPRFRHKLPSVPLNFFRRLPARTDCML  774



>emb|CDY47660.1| BnaC04g23970D [Brassica napus]
Length=828

 Score =   288 bits (737),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 135/150 (90%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WYYRWRPR+PPHMDTR+S AD+AHPDELDEEFDTFPTSRP D+VRMRYDRLRS
Sbjct  679  YLFLIGVWYYRWRPRHPPHMDTRLSHADSAHPDELDEEFDTFPTSRPSDIVRMRYDRLRS  738

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFV+FCL+AA+VLYVTPFQVVALL G Y
Sbjct  739  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVLFCLIAAVVLYVTPFQVVALLVGIY  798

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFR++LPSVPLNFFRRLPARTDCML
Sbjct  799  VLRHPRFRYRLPSVPLNFFRRLPARTDCML  828



>ref|XP_007028941.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 1 [Theobroma cacao]
 gb|EOY09443.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 1 [Theobroma cacao]
Length=877

 Score =   289 bits (740),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 138/149 (93%), Positives = 145/149 (97%), Gaps = 0/149 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WYYRWRPR+PPHMDTR+S AD++HPDELDEEFDTFPTSRP DVVRMRYDRLRS
Sbjct  627  YLFLIGVWYYRWRPRHPPHMDTRLSHADSSHPDELDEEFDTFPTSRPSDVVRMRYDRLRS  686

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALL GFY
Sbjct  687  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLTGFY  746

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCM  277
            +LRHPRFRHKLPSVPLNFFRRLPARTD +
Sbjct  747  ILRHPRFRHKLPSVPLNFFRRLPARTDSI  775



>ref|XP_004497931.1| PREDICTED: uncharacterized protein LOC101499168 isoform X1 [Cicer 
arietinum]
 ref|XP_004497932.1| PREDICTED: uncharacterized protein LOC101499168 isoform X2 [Cicer 
arietinum]
 ref|XP_004497933.1| PREDICTED: uncharacterized protein LOC101499168 isoform X3 [Cicer 
arietinum]
 ref|XP_004497934.1| PREDICTED: uncharacterized protein LOC101499168 isoform X4 [Cicer 
arietinum]
Length=774

 Score =   287 bits (734),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 135/150 (90%), Positives = 144/150 (96%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIGIW+YRWRPR+PPHMDTR+S AD++HPDELDEEFDTFPTSRP D+VRMRYDRLRS
Sbjct  625  YLFLIGIWHYRWRPRHPPHMDTRLSHADSSHPDELDEEFDTFPTSRPSDIVRMRYDRLRS  684

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLV A VLYVTPFQ+VA+L G Y
Sbjct  685  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVVATVLYVTPFQMVAILTGIY  744

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPSVPLNFFRRLPARTDCML
Sbjct  745  VLRHPRFRHKLPSVPLNFFRRLPARTDCML  774



>gb|KEH16148.1| C2 calcium/lipid-binding and GRAM domain protein [Medicago truncatula]
Length=774

 Score =   287 bits (734),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 136/150 (91%), Positives = 145/150 (97%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIGIW+YRWRPR+PP+MDTR+S AD+AHPDELDEEFDTFPTSRP D+VRMRYDRLRS
Sbjct  625  YLFLIGIWHYRWRPRHPPNMDTRLSHADSAHPDELDEEFDTFPTSRPSDIVRMRYDRLRS  684

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCL+AA +LYVTPFQVVALL G Y
Sbjct  685  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLLAATILYVTPFQVVALLTGIY  744

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPSVPLNFFRRLPARTDCML
Sbjct  745  VLRHPRFRHKLPSVPLNFFRRLPARTDCML  774



>ref|NP_191347.1| C2 domain-containing plant phosphoribosyltransferase-like protein 
[Arabidopsis thaliana]
 emb|CAB67616.1| anthranilate phosphoribosyltransferase-like protein [Arabidopsis 
thaliana]
 gb|AEE79712.1| C2 domain-containing plant phosphoribosyltransferase-like protein 
[Arabidopsis thaliana]
Length=773

 Score =   287 bits (734),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 135/150 (90%), Positives = 144/150 (96%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIGIWYYRWRPR+PPHMDTR+S AD+AHPDELDEEFDTFPTSRP D+VRMRYDRLRS
Sbjct  624  YLFLIGIWYYRWRPRHPPHMDTRLSHADSAHPDELDEEFDTFPTSRPSDIVRMRYDRLRS  683

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFV+FCL+AA++LYVTPFQVVAL  G Y
Sbjct  684  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVLFCLIAAVILYVTPFQVVALCIGIY  743

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
             LRHPRFR+KLPSVPLNFFRRLPARTDCML
Sbjct  744  ALRHPRFRYKLPSVPLNFFRRLPARTDCML  773



>dbj|BAF01685.1| anthranilate phosphoribosyltransferase-like protein [Arabidopsis 
thaliana]
Length=773

 Score =   287 bits (734),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 135/150 (90%), Positives = 144/150 (96%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIGIWYYRWRPR+PPHMDTR+S AD+AHPDELDEEFDTFPTSRP D+VRMRYDRLRS
Sbjct  624  YLFLIGIWYYRWRPRHPPHMDTRLSHADSAHPDELDEEFDTFPTSRPSDIVRMRYDRLRS  683

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFV+FCL+AA++LYVTPFQVVAL  G Y
Sbjct  684  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVLFCLIAAVILYVTPFQVVALCIGIY  743

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
             LRHPRFR+KLPSVPLNFFRRLPARTDCML
Sbjct  744  ALRHPRFRYKLPSVPLNFFRRLPARTDCML  773



>ref|XP_002878177.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54436.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=773

 Score =   287 bits (734),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 134/150 (89%), Positives = 145/150 (97%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WYYRWRPR+PPHMDTR+S AD+AHPDELDEEFDTFPTSRP D+VRMRYDRLRS
Sbjct  624  YLFLIGVWYYRWRPRHPPHMDTRLSHADSAHPDELDEEFDTFPTSRPSDIVRMRYDRLRS  683

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFV+FCL+AA++LYVTPFQVVAL  G Y
Sbjct  684  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVLFCLIAAVILYVTPFQVVALCIGIY  743

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFR+KLPSVPLNFFRRLPARTDCML
Sbjct  744  VLRHPRFRYKLPSVPLNFFRRLPARTDCML  773



>gb|AAK53020.1|AF375436_1 AT3g57880/T10K17_90 [Arabidopsis thaliana]
 gb|AAM52232.1| AT3g57880/T10K17_90 [Arabidopsis thaliana]
Length=773

 Score =   287 bits (734),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 135/150 (90%), Positives = 144/150 (96%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIGIWYYRWRPR+PPHMDTR+S AD+AHPDELDEEFDTFPTSRP D+VRMRYDRLRS
Sbjct  624  YLFLIGIWYYRWRPRHPPHMDTRLSHADSAHPDELDEEFDTFPTSRPSDIVRMRYDRLRS  683

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFV+FCL+AA++LYVTPFQVVAL  G Y
Sbjct  684  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVLFCLIAAVILYVTPFQVVALCIGIY  743

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
             LRHPRFR+KLPSVPLNFFRRLPARTDCML
Sbjct  744  ALRHPRFRYKLPSVPLNFFRRLPARTDCML  773



>ref|XP_009417304.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Musa acuminata subsp. malaccensis]
Length=777

 Score =   286 bits (733),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 134/150 (89%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WYYRWRPR PPHMDTR+S AD AHPDELDEEFDTFPTSRPP++VRMRYDRLRS
Sbjct  628  YLFLIGVWYYRWRPRKPPHMDTRLSHADTAHPDELDEEFDTFPTSRPPEIVRMRYDRLRS  687

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            +AGR+QTVVGDLATQGER QSLLSWRDPRATALF+IFCL AAIVLYVTPFQVVALL GFY
Sbjct  688  VAGRVQTVVGDLATQGERFQSLLSWRDPRATALFLIFCLAAAIVLYVTPFQVVALLTGFY  747

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRH+LPSVPLNFFRRLPARTD ML
Sbjct  748  VLRHPRFRHRLPSVPLNFFRRLPARTDSML  777



>ref|XP_010265829.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Nelumbo nucifera]
 ref|XP_010265830.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Nelumbo nucifera]
Length=776

 Score =   286 bits (733),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 134/150 (89%), Positives = 144/150 (96%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WY+RWRPRNPPHMDTR+S A+NAHPDELDEEFDTFPTSRP D+VRMRYDRLRS
Sbjct  627  YLFLIGVWYFRWRPRNPPHMDTRLSHAENAHPDELDEEFDTFPTSRPADIVRMRYDRLRS  686

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            +AGRIQTVVGDLATQGERLQSLLSWRDPRATALFV FCL+AAIVLYVTPF+VVALL G Y
Sbjct  687  VAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVTFCLIAAIVLYVTPFRVVALLTGIY  746

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRH+LPSVPLNFFRRLPARTD ML
Sbjct  747  VLRHPRFRHRLPSVPLNFFRRLPARTDSML  776



>ref|XP_008778691.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Phoenix dactylifera]
 ref|XP_008778692.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Phoenix dactylifera]
 ref|XP_008778693.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Phoenix dactylifera]
 ref|XP_008778694.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Phoenix dactylifera]
 ref|XP_008778695.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Phoenix dactylifera]
Length=773

 Score =   286 bits (732),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 132/150 (88%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WYYRWRPR PPHMDTR+S ADNAHPDELDEE DTFPTSRPPD+VRMRYDRLRS
Sbjct  624  YLFLIGVWYYRWRPRQPPHMDTRLSHADNAHPDELDEESDTFPTSRPPDIVRMRYDRLRS  683

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            +AGR+QTVVGDLATQGER+QSLLSWRDPRATALFVIFC +AAIVLYVTPF+VVALL G Y
Sbjct  684  VAGRVQTVVGDLATQGERMQSLLSWRDPRATALFVIFCFIAAIVLYVTPFRVVALLTGLY  743

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRH+LPSVPLNFFRRLPARTD +L
Sbjct  744  VLRHPRFRHRLPSVPLNFFRRLPARTDSLL  773



>ref|XP_008787291.1| PREDICTED: extended synaptotagmin-1-like [Phoenix dactylifera]
Length=776

 Score =   285 bits (730),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 134/150 (89%), Positives = 145/150 (97%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WY+RWRPR+PPHMDTR+S A++AHPDELDEEFDTFPTSRPPD+VRMRYDRLRS
Sbjct  627  YLFLIGVWYFRWRPRHPPHMDTRLSHAESAHPDELDEEFDTFPTSRPPDLVRMRYDRLRS  686

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            +AGRIQTVVGDLATQGERLQSLLSWRDPRATALFV FCL+AAIVLYVTPF+VVALL G Y
Sbjct  687  VAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVTFCLIAAIVLYVTPFRVVALLTGLY  746

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPSVPLNFFRRLPARTD ML
Sbjct  747  VLRHPRFRHKLPSVPLNFFRRLPARTDSML  776



>ref|XP_008782885.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Phoenix dactylifera]
 ref|XP_008782886.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Phoenix dactylifera]
 ref|XP_008782888.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Phoenix dactylifera]
Length=775

 Score =   285 bits (730),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 133/150 (89%), Positives = 144/150 (96%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WY+RWRPR PPHMDTR+S A++AHPDELDEEFDTFPTSRPPD+VRMRYDRLRS
Sbjct  626  YLFLIGVWYFRWRPRQPPHMDTRLSHAESAHPDELDEEFDTFPTSRPPDMVRMRYDRLRS  685

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            +AGR+QTVVGDLATQGERLQSLLSWRDPRATALFV FCL+AAIVLYVTPF+VVALL G Y
Sbjct  686  VAGRVQTVVGDLATQGERLQSLLSWRDPRATALFVTFCLIAAIVLYVTPFRVVALLTGLY  745

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPSVPLNFFRRLPARTD ML
Sbjct  746  VLRHPRFRHKLPSVPLNFFRRLPARTDSML  775



>gb|KHN28751.1| Multiple C2 and transmembrane domain-containing protein 2 [Glycine 
soja]
Length=736

 Score =   284 bits (727),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 136/150 (91%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIGIWYYRWRPR+PPHMDTR+S AD+AHPDELDEEFDTFPTSRP D+VRMRYDRLRS
Sbjct  587  YLFLIGIWYYRWRPRHPPHMDTRLSHADSAHPDELDEEFDTFPTSRPNDLVRMRYDRLRS  646

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGERLQSLLSWRDPRAT+LFVIFCLVAA VLYVTPFQVVAL  G Y
Sbjct  647  IAGRIQTVVGDLATQGERLQSLLSWRDPRATSLFVIFCLVAATVLYVTPFQVVALFTGIY  706

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFR+ LPSVPLNFFRRLPARTDCML
Sbjct  707  VLRHPRFRYMLPSVPLNFFRRLPARTDCML  736



>ref|XP_010928839.1| PREDICTED: extended synaptotagmin-1-like [Elaeis guineensis]
 ref|XP_010928840.1| PREDICTED: extended synaptotagmin-1-like [Elaeis guineensis]
Length=774

 Score =   285 bits (729),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 132/150 (88%), Positives = 144/150 (96%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WY+RWRPR PPHMDTR+S A++AHPDELDEEFDTFPTSRPPD+VRMRYDRLRS
Sbjct  625  YLFLIGVWYFRWRPRQPPHMDTRLSHAESAHPDELDEEFDTFPTSRPPDIVRMRYDRLRS  684

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            +AGR+QTVVGDLATQGERLQSLLSWRDPRATALFV FCL+AAIVLYVTPF+VVALL G Y
Sbjct  685  VAGRVQTVVGDLATQGERLQSLLSWRDPRATALFVTFCLIAAIVLYVTPFRVVALLTGLY  744

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRH+LPSVPLNFFRRLPARTD ML
Sbjct  745  VLRHPRFRHRLPSVPLNFFRRLPARTDSML  774



>ref|XP_006290627.1| hypothetical protein CARUB_v10016719mg [Capsella rubella]
 ref|XP_006290628.1| hypothetical protein CARUB_v10016719mg [Capsella rubella]
 gb|EOA23525.1| hypothetical protein CARUB_v10016719mg [Capsella rubella]
 gb|EOA23526.1| hypothetical protein CARUB_v10016719mg [Capsella rubella]
Length=773

 Score =   285 bits (728),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 134/150 (89%), Positives = 145/150 (97%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WYYRWRPR+PPHMDTR+S AD+AHPDELDEEFDTFPTSRP D+VRMRYDRLRS
Sbjct  624  YLFLIGVWYYRWRPRHPPHMDTRLSHADSAHPDELDEEFDTFPTSRPSDIVRMRYDRLRS  683

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFV+FCL+AAI+LYVTPFQVVALL G Y
Sbjct  684  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVLFCLIAAIILYVTPFQVVALLIGIY  743

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFR++LPS PLNFFRRLPARTDCML
Sbjct  744  VLRHPRFRYRLPSPPLNFFRRLPARTDCML  773



>ref|XP_002894324.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70583.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=776

 Score =   284 bits (727),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 133/150 (89%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WYYRWRPR+PPHMDTR+S AD+AHPDELDEEFDTFPTSRP D+VRMRYDRLRS
Sbjct  627  YLFLIGVWYYRWRPRHPPHMDTRLSHADSAHPDELDEEFDTFPTSRPSDIVRMRYDRLRS  686

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGER QSLLSWRDPRATALFV+FCL+AA+VLYVTPFQVVA L G Y
Sbjct  687  IAGRIQTVVGDLATQGERFQSLLSWRDPRATALFVLFCLIAAVVLYVTPFQVVAFLIGLY  746

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPR R+KLPSVPLNFFRRLPARTDCML
Sbjct  747  VLRHPRLRYKLPSVPLNFFRRLPARTDCML  776



>ref|XP_003535846.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like isoform X1 [Glycine max]
 ref|XP_006588908.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like isoform X2 [Glycine max]
 ref|XP_006588909.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like isoform X3 [Glycine max]
Length=773

 Score =   284 bits (727),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 136/150 (91%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIGIWYYRWRPR+PPHMDTR+S AD+AHPDELDEEFDTFPTSRP D+VRMRYDRLRS
Sbjct  624  YLFLIGIWYYRWRPRHPPHMDTRLSHADSAHPDELDEEFDTFPTSRPNDLVRMRYDRLRS  683

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGERLQSLLSWRDPRAT+LFVIFCLVAA VLYVTPFQVVAL  G Y
Sbjct  684  IAGRIQTVVGDLATQGERLQSLLSWRDPRATSLFVIFCLVAATVLYVTPFQVVALFTGIY  743

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFR+ LPSVPLNFFRRLPARTDCML
Sbjct  744  VLRHPRFRYMLPSVPLNFFRRLPARTDCML  773



>ref|XP_006306817.1| hypothetical protein CARUB_v10008360mg [Capsella rubella]
 gb|EOA39715.1| hypothetical protein CARUB_v10008360mg [Capsella rubella]
Length=618

 Score =   280 bits (717),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 131/150 (87%), Positives = 142/150 (95%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WYYRWRPR+PPHMDTR+S AD+AHPDELDEEFDTFPTSRP D+VRMRYDRLRS
Sbjct  469  YLFLIGVWYYRWRPRHPPHMDTRLSHADSAHPDELDEEFDTFPTSRPSDIVRMRYDRLRS  528

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFV+FCL+AA+VLYVTPFQ VA   G Y
Sbjct  529  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVLFCLIAAVVLYVTPFQFVAFFIGLY  588

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPR R++LPSVPLNFFRRLPARTDCML
Sbjct  589  VLRHPRLRYRLPSVPLNFFRRLPARTDCML  618



>ref|NP_001055351.1| Os05g0370600 [Oryza sativa Japonica Group]
 gb|AAV31232.1| putative anthranilate phosphoribosyltransferase [Oryza sativa 
Japonica Group]
 dbj|BAF17265.1| Os05g0370600 [Oryza sativa Japonica Group]
 gb|EAY97780.1| hypothetical protein OsI_19693 [Oryza sativa Indica Group]
 gb|EEE63479.1| hypothetical protein OsJ_18293 [Oryza sativa Japonica Group]
Length=774

 Score =   284 bits (726),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 133/150 (89%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WYYRWRPR PPHMDTR+S A++AHPDELDEEFDTFPTSRPPD+VRMRYDRLRS
Sbjct  625  YLFLIGVWYYRWRPRQPPHMDTRLSHAESAHPDELDEEFDTFPTSRPPDIVRMRYDRLRS  684

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            +AGRIQTVVGDLATQGERLQSLLSWRDPRATALFV FC VAAIVLYVTPF+VV  LAG Y
Sbjct  685  VAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVTFCFVAAIVLYVTPFRVVVFLAGLY  744

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
             LRHPRFRHK+PSVPLNFFRRLPARTD ML
Sbjct  745  TLRHPRFRHKMPSVPLNFFRRLPARTDSML  774



>ref|XP_008647970.1| PREDICTED: phosphoribosylanthranilate transferase isoform X1 
[Zea mays]
 ref|XP_008647971.1| PREDICTED: phosphoribosylanthranilate transferase isoform X1 
[Zea mays]
 gb|AFW76297.1| phosphoribosylanthranilate transferase isoform 1 [Zea mays]
 gb|AFW76298.1| phosphoribosylanthranilate transferase isoform 2 [Zea mays]
 gb|AFW76299.1| phosphoribosylanthranilate transferase isoform 3 [Zea mays]
Length=774

 Score =   284 bits (726),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 134/150 (89%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WYYRWR R PPHMDTR+S A+ AHPDELDEEFDTFPTSRPPDVVRMRYDRLRS
Sbjct  625  YLFLIGVWYYRWRLRQPPHMDTRLSHAETAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  684

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            +AGRIQTVVGDLATQGERLQSLLSWRDPRATALFV+FC VAAIVLYVTPF+VV  LAG Y
Sbjct  685  VAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVVFCFVAAIVLYVTPFRVVVFLAGLY  744

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            MLRHPRFRHK+PSVPLNFFRRLPARTD ML
Sbjct  745  MLRHPRFRHKMPSVPLNFFRRLPARTDSML  774



>ref|XP_006654319.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Oryza brachyantha]
Length=774

 Score =   284 bits (726),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 133/150 (89%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WYYRWRPR PPHMDTR+S A++AHPDELDEEFDTFPTSRPPD+VRMRYDRLRS
Sbjct  625  YLFLIGVWYYRWRPRQPPHMDTRLSHAESAHPDELDEEFDTFPTSRPPDIVRMRYDRLRS  684

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            +AGRIQTVVGDLATQGERLQSLLSWRDPRATALFV FC VAAIVLYVTPF+VV  LAG Y
Sbjct  685  VAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVTFCFVAAIVLYVTPFRVVVFLAGLY  744

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
             LRHPRFRHK+PSVPLNFFRRLPARTD ML
Sbjct  745  TLRHPRFRHKMPSVPLNFFRRLPARTDSML  774



>ref|XP_008658284.1| PREDICTED: uncharacterized protein LOC100273873 isoform X1 [Zea 
mays]
 ref|XP_008658285.1| PREDICTED: uncharacterized protein LOC100273873 isoform X1 [Zea 
mays]
 ref|XP_008658286.1| PREDICTED: uncharacterized protein LOC100273873 isoform X1 [Zea 
mays]
 gb|AFW87459.1| hypothetical protein ZEAMMB73_550028 [Zea mays]
 gb|AFW87460.1| hypothetical protein ZEAMMB73_550028 [Zea mays]
Length=775

 Score =   283 bits (725),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 132/150 (88%), Positives = 142/150 (95%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WYYRWRPR PPHMDTR+S A+ AHPDELDEEFDTFPTSRPPD+VRMRYD+LRS
Sbjct  626  YLFLIGVWYYRWRPRQPPHMDTRLSHAETAHPDELDEEFDTFPTSRPPDLVRMRYDKLRS  685

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            +AGRIQTVVGDLATQGERLQSLLSWRDPRATALFV+FC VAAIVLYVTPF+VV  LAG Y
Sbjct  686  VAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVVFCFVAAIVLYVTPFRVVVFLAGLY  745

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHK+PSVPLNFFRRLPARTD ML
Sbjct  746  VLRHPRFRHKMPSVPLNFFRRLPARTDSML  775



>ref|XP_010913922.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Elaeis guineensis]
Length=776

 Score =   283 bits (725),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 133/150 (89%), Positives = 144/150 (96%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WY+RWR R+PPHMDTR+S A++AHPDELDEEFDTFPTSRPPD+VRMRYDRLRS
Sbjct  627  YLFLIGVWYFRWRTRHPPHMDTRLSHAESAHPDELDEEFDTFPTSRPPDLVRMRYDRLRS  686

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            +AGRIQTVVGDLATQGERLQSLLSWRDPRATALFV FCL+AAIVLYVTPF+VVALL G Y
Sbjct  687  VAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVTFCLIAAIVLYVTPFRVVALLTGLY  746

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPSVPLNFFRRLPARTD ML
Sbjct  747  VLRHPRFRHKLPSVPLNFFRRLPARTDSML  776



>ref|XP_002438680.1| hypothetical protein SORBIDRAFT_10g024200 [Sorghum bicolor]
 gb|EER90047.1| hypothetical protein SORBIDRAFT_10g024200 [Sorghum bicolor]
Length=775

 Score =   283 bits (724),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 131/150 (87%), Positives = 142/150 (95%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WYYRWRPR PPHMDTR+S A+ AHPDELDEEFDTFPTSRPPD+VRMRYDRLRS
Sbjct  626  YLFLIGVWYYRWRPRQPPHMDTRLSHAETAHPDELDEEFDTFPTSRPPDIVRMRYDRLRS  685

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            +AGRIQTVVGDLATQGERLQSLLSWRDPRATALFV+FC +AAIVLYVTPF+VV  LAG Y
Sbjct  686  VAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVVFCFIAAIVLYVTPFRVVVFLAGLY  745

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRH++PSVPLNFFRRLPARTD ML
Sbjct  746  VLRHPRFRHRMPSVPLNFFRRLPARTDSML  775



>ref|XP_009395864.1| PREDICTED: extended synaptotagmin-1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009395871.1| PREDICTED: extended synaptotagmin-1-like [Musa acuminata subsp. 
malaccensis]
Length=776

 Score =   283 bits (724),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 133/150 (89%), Positives = 142/150 (95%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WY+RWRPR PP+MDTR+S AD AHPDELDEEFDTFPTSRPPD+VRMRYDRLRS
Sbjct  627  YLFLIGVWYFRWRPRQPPYMDTRLSHADTAHPDELDEEFDTFPTSRPPDIVRMRYDRLRS  686

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            +AGRIQTVVGDLATQGERLQSLLSWRDPRATALFV FCLVAA+VLYVTPF+VVA L G Y
Sbjct  687  VAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVTFCLVAAVVLYVTPFRVVAFLTGLY  746

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPSVPLNFFRRLPARTD ML
Sbjct  747  VLRHPRFRHKLPSVPLNFFRRLPARTDSML  776



>gb|KFK35840.1| hypothetical protein AALP_AA4G043900 [Arabis alpina]
Length=775

 Score =   283 bits (724),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 132/150 (88%), Positives = 144/150 (96%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WYYRWRPR+PPHMDTR+S AD+AHPDELDEEFDTFPTSRP D+VRMRYDRLRS
Sbjct  626  YLFLIGVWYYRWRPRHPPHMDTRLSHADSAHPDELDEEFDTFPTSRPADIVRMRYDRLRS  685

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGER QSLLSWRDPRATALFV+FCL+AA++LYVTPFQVVALL G Y
Sbjct  686  IAGRIQTVVGDLATQGERFQSLLSWRDPRATALFVLFCLLAAVILYVTPFQVVALLIGLY  745

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPR R++LPSVPLNFFRRLPARTDCML
Sbjct  746  VLRHPRLRYRLPSVPLNFFRRLPARTDCML  775



>ref|XP_010504727.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Camelina sativa]
Length=773

 Score =   283 bits (724),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 132/150 (88%), Positives = 145/150 (97%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WYYRWRPR+PPHMDTR+S AD+AHPDELDEEFDTFPTSRP D+VRMRYDRLRS
Sbjct  624  YLFLIGVWYYRWRPRHPPHMDTRLSHADSAHPDELDEEFDTFPTSRPSDIVRMRYDRLRS  683

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGER+QSLLSWRDPRATALFV+FCL+AA++LYVTPFQVVALL G Y
Sbjct  684  IAGRIQTVVGDLATQGERVQSLLSWRDPRATALFVLFCLIAAVILYVTPFQVVALLIGIY  743

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFR++LPS PLNFFRRLPARTDCML
Sbjct  744  VLRHPRFRYRLPSPPLNFFRRLPARTDCML  773



>ref|XP_010516424.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like isoform X1 [Camelina sativa]
 ref|XP_010516425.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like isoform X2 [Camelina sativa]
 ref|XP_010516426.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like isoform X1 [Camelina sativa]
 ref|XP_010427678.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Camelina sativa]
 ref|XP_010427679.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Camelina sativa]
 ref|XP_010427680.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Camelina sativa]
 ref|XP_010427681.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Camelina sativa]
Length=773

 Score =   283 bits (724),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 132/150 (88%), Positives = 145/150 (97%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WYYRWRPR+PPHMDTR+S AD+AHPDELDEEFDTFPTSRP D+VRMRYDRLRS
Sbjct  624  YLFLIGVWYYRWRPRHPPHMDTRLSHADSAHPDELDEEFDTFPTSRPSDIVRMRYDRLRS  683

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGER+QSLLSWRDPRATALFV+FCL+AA++LYVTPFQVVALL G Y
Sbjct  684  IAGRIQTVVGDLATQGERVQSLLSWRDPRATALFVLFCLIAAVILYVTPFQVVALLIGIY  743

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFR++LPS PLNFFRRLPARTDCML
Sbjct  744  VLRHPRFRYRLPSPPLNFFRRLPARTDCML  773



>ref|NP_175568.1| calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein [Arabidopsis thaliana]
 gb|AAG50882.1|AC025294_20 unknown protein [Arabidopsis thaliana]
 gb|AEE32684.1| calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein [Arabidopsis thaliana]
Length=776

 Score =   281 bits (720),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 142/150 (95%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WYYRWRPR+PPHMDTR+S AD+AHPDELDEEFDTFPTSRP D+VRMRYDRLRS
Sbjct  627  YLFLIGVWYYRWRPRHPPHMDTRLSHADSAHPDELDEEFDTFPTSRPSDIVRMRYDRLRS  686

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGER QSLLSWRDPRATALFV+FCL+AA++LY+TPFQVVA   G Y
Sbjct  687  IAGRIQTVVGDLATQGERFQSLLSWRDPRATALFVLFCLIAAVILYITPFQVVAFAIGLY  746

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPR R+KLPSVPLNFFRRLPARTDCML
Sbjct  747  VLRHPRLRYKLPSVPLNFFRRLPARTDCML  776



>ref|XP_010227498.1| PREDICTED: LOW QUALITY PROTEIN: multiple C2 and transmembrane 
domain-containing protein 2-like [Brachypodium distachyon]
Length=774

 Score =   281 bits (720),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 131/150 (87%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WYYRWRPR PPHMDTR+S A+ AHPDELDEEFDTFPTSRPPD+VR+RYDRLRS
Sbjct  625  YLFLIGVWYYRWRPRQPPHMDTRLSHAETAHPDELDEEFDTFPTSRPPDIVRVRYDRLRS  684

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            +AGRIQTVVGDLATQGERLQSLLSWRDPRATALFV FC +AAIVLYVTPF+VV  LAG Y
Sbjct  685  VAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVTFCFIAAIVLYVTPFRVVVFLAGLY  744

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
             LRHPRFRHK+PSVPLNFFRRLPARTD ML
Sbjct  745  TLRHPRFRHKMPSVPLNFFRRLPARTDSML  774



>ref|XP_006393033.1| hypothetical protein EUTSA_v10011254mg [Eutrema salsugineum]
 gb|ESQ30319.1| hypothetical protein EUTSA_v10011254mg [Eutrema salsugineum]
Length=778

 Score =   281 bits (719),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 131/150 (87%), Positives = 144/150 (96%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+W YRWRPR+PPHMDTR+S AD+AHPDELDEEFDTFPTSRP D+VRMRYDRLRS
Sbjct  629  YLFLIGVWNYRWRPRHPPHMDTRLSHADSAHPDELDEEFDTFPTSRPADIVRMRYDRLRS  688

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFV+FCL+AA+VLYVTPFQ+VAL+ G Y
Sbjct  689  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVLFCLIAAVVLYVTPFQLVALIIGLY  748

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPR R++LPSVPLNFFRRLPARTDCML
Sbjct  749  VLRHPRLRYRLPSVPLNFFRRLPARTDCML  778



>ref|XP_006306818.1| hypothetical protein CARUB_v10008360mg [Capsella rubella]
 gb|EOA39716.1| hypothetical protein CARUB_v10008360mg [Capsella rubella]
Length=774

 Score =   281 bits (718),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 131/150 (87%), Positives = 142/150 (95%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WYYRWRPR+PPHMDTR+S AD+AHPDELDEEFDTFPTSRP D+VRMRYDRLRS
Sbjct  625  YLFLIGVWYYRWRPRHPPHMDTRLSHADSAHPDELDEEFDTFPTSRPSDIVRMRYDRLRS  684

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFV+FCL+AA+VLYVTPFQ VA   G Y
Sbjct  685  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVLFCLIAAVVLYVTPFQFVAFFIGLY  744

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPR R++LPSVPLNFFRRLPARTDCML
Sbjct  745  VLRHPRLRYRLPSVPLNFFRRLPARTDCML  774



>gb|EMS45217.1| Multiple C2 and transmembrane domain-containing protein 1 [Triticum 
urartu]
Length=774

 Score =   281 bits (718),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 131/150 (87%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WYYRWR R PPHMDTR+S A+ AHPDELDEEFDTFPTSRPPD+VRMRYDRLRS
Sbjct  625  YLFLIGVWYYRWRSRQPPHMDTRLSHAETAHPDELDEEFDTFPTSRPPDIVRMRYDRLRS  684

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            +AGRIQTVVGDLATQGERLQSLLSWRDPRATALFV FC +AAIVLYVTPF+VV  LAG Y
Sbjct  685  VAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVTFCFIAAIVLYVTPFRVVVFLAGLY  744

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
             LRHPRFRHK+PSVPLNFFRRLPARTD ML
Sbjct  745  TLRHPRFRHKMPSVPLNFFRRLPARTDSML  774



>ref|XP_010500735.1| PREDICTED: extended synaptotagmin-1-like [Camelina sativa]
Length=776

 Score =   280 bits (717),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WYYRWRPR+PPHMDTR+S AD+AHPDELDEEFDTFPTSRP D+VRMRYDRLRS
Sbjct  627  YLFLIGVWYYRWRPRHPPHMDTRLSHADSAHPDELDEEFDTFPTSRPSDIVRMRYDRLRS  686

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFV+FCL+AA++LYVTPFQ VA + G Y
Sbjct  687  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVLFCLIAAVILYVTPFQWVAFIIGLY  746

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPR R++LPSVPLNFFRRLPARTDCML
Sbjct  747  VLRHPRLRYRLPSVPLNFFRRLPARTDCML  776



>gb|KJB83481.1| hypothetical protein B456_013G250100 [Gossypium raimondii]
 gb|KJB83482.1| hypothetical protein B456_013G250100 [Gossypium raimondii]
 gb|KJB83483.1| hypothetical protein B456_013G250100 [Gossypium raimondii]
 gb|KJB83484.1| hypothetical protein B456_013G250100 [Gossypium raimondii]
 gb|KJB83486.1| hypothetical protein B456_013G250100 [Gossypium raimondii]
 gb|KJB83487.1| hypothetical protein B456_013G250100 [Gossypium raimondii]
 gb|KJB83488.1| hypothetical protein B456_013G250100 [Gossypium raimondii]
Length=771

 Score =   280 bits (715),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 131/150 (87%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIGIW YRWRPR+PPHMDTR+S AD AHPDELDEEFDTFPTSRP D+VRMRYDRLRS
Sbjct  622  YLFLIGIWNYRWRPRHPPHMDTRLSHADAAHPDELDEEFDTFPTSRPSDIVRMRYDRLRS  681

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGR+QTV+GDLATQGER QSLLSWRDPRAT LFV FCL+AA+VLYVTPFQVVALLAG Y
Sbjct  682  IAGRVQTVIGDLATQGERFQSLLSWRDPRATTLFVTFCLIAALVLYVTPFQVVALLAGIY  741

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPS PLNFFRRLPAR+D ML
Sbjct  742  ILRHPRFRHKLPSTPLNFFRRLPARSDSML  771



>ref|XP_007014901.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 1 [Theobroma cacao]
 ref|XP_007014902.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 1 [Theobroma cacao]
 ref|XP_007014903.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 1 [Theobroma cacao]
 ref|XP_007014904.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 1 [Theobroma cacao]
 gb|EOY32520.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 1 [Theobroma cacao]
 gb|EOY32521.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 1 [Theobroma cacao]
 gb|EOY32522.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 1 [Theobroma cacao]
 gb|EOY32523.1| Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase 
family protein isoform 1 [Theobroma cacao]
Length=771

 Score =   280 bits (715),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 132/150 (88%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIGIW YRWRPR+PPHMDTR+S AD AHPDELDEEFDTFPTSRP D+VRMRYDRLRS
Sbjct  622  YLFLIGIWNYRWRPRHPPHMDTRLSHADAAHPDELDEEFDTFPTSRPSDIVRMRYDRLRS  681

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGR+QTV+GDLATQGER QSLLSWRDPRAT LFV FCL+AAIVLYVTPFQVVALL G Y
Sbjct  682  IAGRVQTVIGDLATQGERFQSLLSWRDPRATTLFVTFCLIAAIVLYVTPFQVVALLIGLY  741

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
             LRHPRFRHKLPSVPLNFFRRLPAR+D ML
Sbjct  742  ALRHPRFRHKLPSVPLNFFRRLPARSDSML  771



>ref|XP_009364728.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Pyrus x bretschneideri]
Length=772

 Score =   279 bits (714),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 132/150 (88%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIGIW YRWRPR+PPHMDTR+S AD AHPDE DEEFDTFPTSRP D+VRMRYDRLRS
Sbjct  623  YLFLIGIWNYRWRPRHPPHMDTRLSHADAAHPDERDEEFDTFPTSRPADIVRMRYDRLRS  682

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGR+QTVVGDLATQGER QSLLSWRDPRAT LF+ FCL+AAIVLYVTPFQVVALLAG Y
Sbjct  683  IAGRVQTVVGDLATQGERFQSLLSWRDPRATTLFITFCLIAAIVLYVTPFQVVALLAGIY  742

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPSVPLNFFRRLPAR+D ML
Sbjct  743  VLRHPRFRHKLPSVPLNFFRRLPARSDSML  772



>ref|XP_011020270.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Populus euphratica]
 ref|XP_011020271.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Populus euphratica]
Length=775

 Score =   279 bits (714),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 133/150 (89%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WYYR RPR+PPHMDTR+S A++AHPDELDEEFDTFPTS+  D+VRMRYDRLRS
Sbjct  626  YLFLIGVWYYRLRPRHPPHMDTRLSHAESAHPDELDEEFDTFPTSQTADIVRMRYDRLRS  685

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFV+FCL+AAIVLYVTPFQVVALL G Y
Sbjct  686  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVLFCLIAAIVLYVTPFQVVALLIGLY  745

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPSVPLNFFRRLPARTD ML
Sbjct  746  VLRHPRFRHKLPSVPLNFFRRLPARTDSML  775



>ref|XP_009364713.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Pyrus x bretschneideri]
Length=772

 Score =   279 bits (714),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 132/150 (88%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIGIW YRWRPR+PPHMDTR+S AD AHPDE DEEFDTFPTSRP D+VRMRYDRLRS
Sbjct  623  YLFLIGIWNYRWRPRHPPHMDTRLSHADAAHPDERDEEFDTFPTSRPADIVRMRYDRLRS  682

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGR+QTVVGDLATQGER QSLLSWRDPRAT LF+ FCL+AAIVLYVTPFQVVALLAG Y
Sbjct  683  IAGRVQTVVGDLATQGERFQSLLSWRDPRATTLFITFCLIAAIVLYVTPFQVVALLAGIY  742

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPSVPLNFFRRLPAR+D ML
Sbjct  743  VLRHPRFRHKLPSVPLNFFRRLPARSDSML  772



>gb|KHG04257.1| Multiple C2 and transmembrane domain-containing 1 [Gossypium 
arboreum]
Length=771

 Score =   278 bits (711),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIGIW YRWRPR+PPHMDTR+S AD AHPDELDEEFD FPTSRP D+VRMRYDRLRS
Sbjct  622  YLFLIGIWNYRWRPRHPPHMDTRLSHADAAHPDELDEEFDNFPTSRPSDIVRMRYDRLRS  681

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGR+QTV+GDLATQGER QSLLSWRDPRAT LFV FCL+AA+VLYVTPFQVVALLAG Y
Sbjct  682  IAGRVQTVIGDLATQGERFQSLLSWRDPRATTLFVTFCLIAALVLYVTPFQVVALLAGIY  741

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPS PLNFFRRLPAR+D ML
Sbjct  742  VLRHPRFRHKLPSTPLNFFRRLPARSDSML  771



>dbj|BAB91449.1| phosphoribosyltransferase [Sequoia sempervirens]
Length=191

 Score =   261 bits (666),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 122/150 (81%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            Y+FLIGIW++R+RPR+PPHMDTRIS AD  H DELDEEFDTFPTS+  D+VRMRYDRLRS
Sbjct  42   YMFLIGIWHFRFRPRHPPHMDTRISHADIVHSDELDEEFDTFPTSKSSDIVRMRYDRLRS  101

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            +AGR+QTVVGD+ATQGER Q+LLSWRDPRATA+FV+FCL+AAIVLYVTPFQV+A+L G Y
Sbjct  102  VAGRLQTVVGDMATQGERFQALLSWRDPRATAIFVLFCLIAAIVLYVTPFQVIAVLFGIY  161

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPSVPLNFFRRLPAR+D ML
Sbjct  162  VLRHPRFRHKLPSVPLNFFRRLPARSDSML  191



>dbj|BAE43607.2| putative phosphoribosylanthranilate transferase [Taxodium distichum 
var. imbricatum]
Length=191

 Score =   260 bits (665),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 122/150 (81%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            Y+FLIGIW++R+RPR+PPHMDTRIS AD  HPDELDEEFDTFPTS+  DVVRMRYDRLRS
Sbjct  42   YMFLIGIWHFRFRPRHPPHMDTRISNADAVHPDELDEEFDTFPTSKSSDVVRMRYDRLRS  101

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            +AGR+QTVVGD+ATQGER Q+LLSWRDPRATA+FV+FCL AAIVLYVTPFQV+A+L G Y
Sbjct  102  VAGRLQTVVGDIATQGERFQALLSWRDPRATAIFVLFCLFAAIVLYVTPFQVIAVLFGJY  161

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHP+FRH+LPSVPLNFFRRLPAR+D ML
Sbjct  162  VLRHPKFRHRLPSVPLNFFRRLPARSDSML  191



>dbj|BAB91448.1| phosphoribosyltransferase [Taxodium distichum]
 dbj|BAE43598.1| putative phosphoribosylanthranilate transferase [Taxodium distichum 
var. distichum]
 dbj|BAE43603.1| putative phosphoribosylanthranilate transferase [Taxodium distichum 
var. imbricatum]
Length=191

 Score =   260 bits (665),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 122/150 (81%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            Y+FLIGIW++R+RPR+PPHMDTRIS AD  HPDELDEEFDTFPTS+  DVVRMRYDRLRS
Sbjct  42   YMFLIGIWHFRFRPRHPPHMDTRISNADAVHPDELDEEFDTFPTSKSSDVVRMRYDRLRS  101

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            +AGR+QTVVGD+ATQGER Q+LLSWRDPRATA+FV+FCL AAIVLYVTPFQV+A+L G Y
Sbjct  102  VAGRLQTVVGDIATQGERFQALLSWRDPRATAIFVLFCLFAAIVLYVTPFQVIAVLFGLY  161

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHP+FRH+LPSVPLNFFRRLPAR+D ML
Sbjct  162  VLRHPKFRHRLPSVPLNFFRRLPARSDSML  191



>ref|XP_010479644.1| PREDICTED: extended synaptotagmin-1-like isoform X1 [Camelina 
sativa]
 ref|XP_010479645.1| PREDICTED: extended synaptotagmin-1-like isoform X2 [Camelina 
sativa]
Length=776

 Score =   277 bits (708),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WYYRWRPR+PPHMDTR+S AD+AHPDELDEEFDTFPTSRP D+VRMRYDRLRS
Sbjct  627  YLFLIGVWYYRWRPRHPPHMDTRLSHADSAHPDELDEEFDTFPTSRPSDIVRMRYDRLRS  686

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFV+FCL+A ++LYVTPFQ VA + G Y
Sbjct  687  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVLFCLIAVVILYVTPFQWVAFIIGLY  746

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPR R++LPS PLNFFRRLPARTDCML
Sbjct  747  VLRHPRLRYRLPSAPLNFFRRLPARTDCML  776



>dbj|BAB91450.1| phosphoribosyltransferase [Chamaecyparis pisifera]
 dbj|BAB91453.1| phosphoribosyltransferase [Chamaecyparis obtusa]
Length=191

 Score =   260 bits (664),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 121/150 (81%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            Y+FLIGIW+YR+RPR+PPHMDTRIS AD  HPDELDEEFDTFPTS+  DVVRMRYDRLRS
Sbjct  42   YMFLIGIWHYRFRPRHPPHMDTRISHADVVHPDELDEEFDTFPTSKSSDVVRMRYDRLRS  101

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            +AGR+QT+VGD+ATQGER Q+LLSWRDPRATA+FV+FCL+A+IVLYVTPFQV+++L G Y
Sbjct  102  VAGRLQTLVGDMATQGERFQALLSWRDPRATAIFVLFCLLASIVLYVTPFQVISVLNGIY  161

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRH+LPSVPLNFFRRLPAR+D ML
Sbjct  162  VLRHPRFRHRLPSVPLNFFRRLPARSDSML  191



>gb|KJB66120.1| hypothetical protein B456_010G128400 [Gossypium raimondii]
 gb|KJB66121.1| hypothetical protein B456_010G128400 [Gossypium raimondii]
 gb|KJB66122.1| hypothetical protein B456_010G128400 [Gossypium raimondii]
Length=772

 Score =   276 bits (707),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 131/150 (87%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIGIW YRWRP +PPHMDTR+S AD AHPDELDEEFDTFPTSRP D+VRMRYDRLRS
Sbjct  623  YLFLIGIWNYRWRPLHPPHMDTRLSHADAAHPDELDEEFDTFPTSRPSDIVRMRYDRLRS  682

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            I GR+QTV+GDLATQGERLQSLLSWRDPRAT LFV FCL+AAIVLYVTPFQVVALL G Y
Sbjct  683  IGGRVQTVIGDLATQGERLQSLLSWRDPRATTLFVTFCLIAAIVLYVTPFQVVALLIGLY  742

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
             LRHPRFRHKLPSVPLNFFRRLPAR+D ML
Sbjct  743  ALRHPRFRHKLPSVPLNFFRRLPARSDSML  772



>ref|XP_007208351.1| hypothetical protein PRUPE_ppa001743mg [Prunus persica]
 gb|EMJ09550.1| hypothetical protein PRUPE_ppa001743mg [Prunus persica]
Length=772

 Score =   276 bits (706),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIGIW +RWRPR+PPHMDTR+S AD AHPDE DEEFDTFPTSRP D+VRMRYDRLRS
Sbjct  623  YLFLIGIWNFRWRPRHPPHMDTRLSHADAAHPDERDEEFDTFPTSRPSDIVRMRYDRLRS  682

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGR+QTVVGDLATQGER QSLLSWRDPRAT LFV FCL+AAIVLYVTPFQVVALL G Y
Sbjct  683  IAGRVQTVVGDLATQGERFQSLLSWRDPRATTLFVTFCLIAAIVLYVTPFQVVALLGGIY  742

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPS PLNFFRRLPAR+D ML
Sbjct  743  VLRHPRFRHKLPSAPLNFFRRLPARSDSML  772



>ref|XP_010044995.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Eucalyptus grandis]
 gb|KCW87135.1| hypothetical protein EUGRSUZ_B03663 [Eucalyptus grandis]
Length=775

 Score =   276 bits (706),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLF+IGIW YRWRPR+PPHMD R+S AD  HPDELDEEFDTFPTS+P D+VRMRYDRLRS
Sbjct  626  YLFIIGIWNYRWRPRHPPHMDIRLSHADAVHPDELDEEFDTFPTSKPSDIVRMRYDRLRS  685

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGR+QTVVGDLATQGER QSLLSWRDPRAT +FV FCL+AA+VLYVTPFQVVALL GFY
Sbjct  686  IAGRVQTVVGDLATQGERFQSLLSWRDPRATTIFVTFCLIAAVVLYVTPFQVVALLTGFY  745

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPSVPLNFFRRLPAR+D ML
Sbjct  746  VLRHPRFRHKLPSVPLNFFRRLPARSDSML  775



>ref|XP_002513446.1| synaptotagmin, putative [Ricinus communis]
 gb|EEF48849.1| synaptotagmin, putative [Ricinus communis]
Length=772

 Score =   276 bits (705),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIGIW +RWRPR+PPHMDTR+S AD AHPDELDEEFDTFPT++  D+VRMRYDRLRS
Sbjct  623  YLFLIGIWNFRWRPRHPPHMDTRLSHADAAHPDELDEEFDTFPTTKSSDMVRMRYDRLRS  682

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGR+QTVVGDLATQGER QSLLSWRDPRAT LFVIFCL+AA+VLYVTPFQVVALL G Y
Sbjct  683  IAGRVQTVVGDLATQGERFQSLLSWRDPRATTLFVIFCLIAALVLYVTPFQVVALLVGIY  742

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            MLRHPRFRHKLPSVPLNFFRRLPAR+D M+
Sbjct  743  MLRHPRFRHKLPSVPLNFFRRLPARSDSMI  772



>ref|XP_006386096.1| hypothetical protein POPTR_0003s22060g [Populus trichocarpa]
 gb|ERP63893.1| hypothetical protein POPTR_0003s22060g [Populus trichocarpa]
Length=772

 Score =   275 bits (704),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+W YRWRPR+PPHMDTR+S AD AHPDELDEEFD+FPTSRP D+VRMRYDRLRS
Sbjct  623  YLFLIGLWNYRWRPRHPPHMDTRLSHADAAHPDELDEEFDSFPTSRPSDIVRMRYDRLRS  682

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGR+QTVVGDLATQGER QSL+SWRDPRAT LFV FCL+AAIVLYVTPFQV+ALL G Y
Sbjct  683  IAGRVQTVVGDLATQGERFQSLISWRDPRATTLFVTFCLIAAIVLYVTPFQVLALLIGLY  742

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPSVP+NFFRRLPAR+D ML
Sbjct  743  VLRHPRFRHKLPSVPINFFRRLPARSDSML  772



>ref|XP_003537951.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like isoform X1 [Glycine max]
 ref|XP_006590953.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like isoform X2 [Glycine max]
 gb|KHN21877.1| Multiple C2 and transmembrane domain-containing protein 1 [Glycine 
soja]
Length=777

 Score =   275 bits (703),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIGIW +RWRPR+PPHMDTR+S AD AHPDELDEEFDTFPTSR  D+VRMRYDRLRS
Sbjct  628  YLFLIGIWNFRWRPRHPPHMDTRLSHADAAHPDELDEEFDTFPTSRSSDIVRMRYDRLRS  687

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGR+Q+VVGDL TQGER QSLLSWRDPRAT LFV FC VAAIVLYVTPFQVV+LL GF+
Sbjct  688  IAGRVQSVVGDLGTQGERFQSLLSWRDPRATTLFVTFCFVAAIVLYVTPFQVVSLLIGFF  747

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            MLRHPRFRHKLPSVPLNFFRRLPAR+D ML
Sbjct  748  MLRHPRFRHKLPSVPLNFFRRLPARSDSML  777



>dbj|BAD02775.1| putative phosphoribosylanthranilate transferase [Cryptomeria 
japonica]
 dbj|BAD02793.1| putative phosphoribosylanthranilate transferase, partial [Cryptomeria 
japonica]
 dbj|BAD02798.1| putative phosphoribosylanthranilate transferase, partial [Cryptomeria 
japonica]
 dbj|BAD02801.1| putative phosphoribosylanthranilate transferase, partial [Cryptomeria 
japonica]
 dbj|BAD02803.1| putative phosphoribosylanthranilate transferase, partial [Cryptomeria 
japonica]
 dbj|BAD02804.1| putative phosphoribosylanthranilate transferase, partial [Cryptomeria 
japonica]
 dbj|BAD02806.1| putative phosphoribosylanthranilate transferase, partial [Cryptomeria 
japonica]
 dbj|BAD02808.1| putative phosphoribosylanthranilate transferase, partial [Cryptomeria 
japonica]
 dbj|BAD02810.1| putative phosphoribosylanthranilate transferase, partial [Cryptomeria 
japonica]
 dbj|BAD02819.1| putative phosphoribosylanthranilate transferase, partial [Cryptomeria 
japonica]
 dbj|BAE43589.1| putative phosphoribosylanthranilate transferase [Cryptomeria 
japonica]
Length=191

 Score =   258 bits (660),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 122/150 (81%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            Y+FLIGIW++R+RPR+PPHMDTRIS AD  H DELDEEFDTFPTS+  DVVRMRYDRLRS
Sbjct  42   YMFLIGIWHFRFRPRDPPHMDTRISHADAVHQDELDEEFDTFPTSKSSDVVRMRYDRLRS  101

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            +AGR+QTVVGD+ATQGER Q+LLSWRDPRATA+FV+FCL AAIVLYVTPFQV+A+L G Y
Sbjct  102  VAGRLQTVVGDIATQGERFQALLSWRDPRATAIFVLFCLFAAIVLYVTPFQVIAVLFGIY  161

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRH+LPSVPLNFFRRLPAR+D ML
Sbjct  162  VLRHPRFRHRLPSVPLNFFRRLPARSDSML  191



>dbj|BAE43599.1| putative phosphoribosylanthranilate transferase [Taxodium distichum 
var. distichum]
 dbj|BAE43602.1| putative phosphoribosylanthranilate transferase, partial [Taxodium 
distichum var. imbricarium]
 dbj|BAE43605.1| putative phosphoribosylanthranilate transferase, partial [Taxodium 
distichum var. imbricarium]
 dbj|BAE43608.1| putative phosphoribosylanthranilate transferase, partial [Taxodium 
distichum var. imbricarium]
Length=191

 Score =   258 bits (659),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 121/150 (81%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            Y+FLIGIW++R+RPR+PPHMDTRIS AD  HPDELDEEFDTFPTS+  DVVRMRYDRLRS
Sbjct  42   YMFLIGIWHFRFRPRHPPHMDTRISNADAVHPDELDEEFDTFPTSKSSDVVRMRYDRLRS  101

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            +AGR+QTVVGD+ATQGER Q+LLSWRDPRATA+FV+FCL AAIVLYVTPFQV+A+L G Y
Sbjct  102  VAGRLQTVVGDIATQGERFQALLSWRDPRATAIFVLFCLFAAIVLYVTPFQVIAVLFGLY  161

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHP+FRH+LPSVPLNFFRRLPA +D ML
Sbjct  162  VLRHPKFRHRLPSVPLNFFRRLPAXSDSML  191



>dbj|BAB91454.1| phosphoribosyltransferase [Cryptomeria japonica]
 dbj|BAD02776.1| putative phosphoribosylanthranilate transferase [Cryptomeria 
japonica]
 dbj|BAD02777.1| putative phosphoribosylanthranilate transferase [Cryptomeria 
japonica]
 dbj|BAD02778.1| putative phosphoribosylanthranilate transferase, partial [Cryptomeria 
japonica]
 dbj|BAD02779.1| putative phosphoribosylanthranilate transferase, partial [Cryptomeria 
japonica]
 dbj|BAD02780.1| putative phosphoribosylanthranilate transferase, partial [Cryptomeria 
japonica]
 dbj|BAD02781.1| putative phosphoribosylanthranilate transferase, partial [Cryptomeria 
japonica]
 dbj|BAD02782.1| putative phosphoribosylanthranilate transferase, partial [Cryptomeria 
japonica]
 dbj|BAD02783.1| putative phosphoribosylanthranilate transferase, partial [Cryptomeria 
japonica]
 dbj|BAD02784.1| putative phosphoribosylanthranilate transferase [Cryptomeria 
japonica]
 dbj|BAD02785.1| putative phosphoribosylanthranilate transferase, partial [Cryptomeria 
japonica]
 dbj|BAD02786.1| putative phosphoribosylanthranilate transferase, partial [Cryptomeria 
japonica]
 dbj|BAD02787.1| putative phosphoribosylanthranilate transferase, partial [Cryptomeria 
japonica]
 dbj|BAD02788.1| putative phosphoribosylanthranilate transferase, partial [Cryptomeria 
japonica]
 dbj|BAD02789.1| putative phosphoribosylanthranilate transferase, partial [Cryptomeria 
japonica]
 dbj|BAD02790.1| putative phosphoribosylanthranilate transferase, partial [Cryptomeria 
japonica]
 dbj|BAD02791.1| putative phosphoribosylanthranilate transferase, partial [Cryptomeria 
japonica]
 dbj|BAD02792.1| putative phosphoribosylanthranilate transferase, partial [Cryptomeria 
japonica]
 dbj|BAD02794.1| putative phosphoribosylanthranilate transferase, partial [Cryptomeria 
japonica]
 dbj|BAD02795.1| putative phosphoribosylanthranilate transferase, partial [Cryptomeria 
japonica]
 dbj|BAD02796.1| putative phosphoribosylanthranilate transferase, partial [Cryptomeria 
japonica]
 dbj|BAD02797.1| putative phosphoribosylanthranilate transferase, partial [Cryptomeria 
japonica]
 dbj|BAD02799.1| putative phosphoribosylanthranilate transferase, partial [Cryptomeria 
japonica]
 dbj|BAD02800.1| putative phosphoribosylanthranilate transferase, partial [Cryptomeria 
japonica]
 dbj|BAD02802.1| putative phosphoribosylanthranilate transferase, partial [Cryptomeria 
japonica]
 dbj|BAD02807.1| putative phosphoribosylanthranilate transferase, partial [Cryptomeria 
japonica]
 dbj|BAD02809.1| putative phosphoribosylanthranilate transferase, partial [Cryptomeria 
japonica]
 dbj|BAD02811.1| putative phosphoribosylanthranilate transferase, partial [Cryptomeria 
japonica]
 dbj|BAD02812.1| putative phosphoribosylanthranilate transferase, partial [Cryptomeria 
japonica]
 dbj|BAD02813.1| putative phosphoribosylanthranilate transferase, partial [Cryptomeria 
japonica]
 dbj|BAD02814.1| putative phosphoribosylanthranilate transferase, partial [Cryptomeria 
japonica]
 dbj|BAD02815.1| putative phosphoribosylanthranilate transferase, partial [Cryptomeria 
japonica]
 dbj|BAD02816.1| putative phosphoribosylanthranilate transferase, partial [Cryptomeria 
japonica]
 dbj|BAD02817.1| putative phosphoribosylanthranilate transferase, partial [Cryptomeria 
japonica]
 dbj|BAD02818.1| putative phosphoribosylanthranilate transferase, partial [Cryptomeria 
japonica]
 dbj|BAD02820.1| putative phosphoribosylanthranilate transferase, partial [Cryptomeria 
japonica]
 dbj|BAD02821.1| putative phosphoribosylanthranilate transferase, partial [Cryptomeria 
japonica]
 dbj|BAD02822.1| putative phosphoribosylanthranilate transferase, partial [Cryptomeria 
japonica]
 dbj|BAE43590.1| putative phosphoribosylanthranilate transferase [Cryptomeria 
japonica]
 dbj|BAE43592.1| putative phosphoribosylanthranilate transferase [Cryptomeria 
japonica]
 dbj|BAE43587.1| putative phosphoribosylanthranilate transferase [Cryptomeria 
japonica]
 dbj|BAE43562.1| putative phosphoribosylanthranilate transferase, partial [Cryptomeria 
japonica]
 dbj|BAE43563.1| putative phosphoribosylanthranilate transferase, partial [Cryptomeria 
japonica]
 dbj|BAE43564.1| putative phosphoribosylanthranilate transferase, partial [Cryptomeria 
japonica]
 dbj|BAE43565.1| putative phosphoribosylanthranilate transferase, partial [Cryptomeria 
japonica]
 dbj|BAE43566.1| putative phosphoribosylanthranilate transferase [Cryptomeria 
japonica]
 dbj|BAE43567.1| putative phosphoribosylanthranilate transferase, partial [Cryptomeria 
japonica]
 dbj|BAE43569.1| putative phosphoribosylanthranilate transferase, partial [Cryptomeria 
japonica]
 dbj|BAE43570.1| putative phosphoribosylanthranilate transferase, partial [Cryptomeria 
japonica]
 dbj|BAE43572.1| putative phosphoribosylanthranilate transferase, partial [Cryptomeria 
japonica]
 dbj|BAE43575.1| putative phosphoribosylanthranilate transferase, partial [Cryptomeria 
japonica]
 dbj|BAE43577.1| putative phosphoribosylanthranilate transferase, partial [Cryptomeria 
japonica]
 dbj|BAE43578.1| putative phosphoribosylanthranilate transferase, partial [Cryptomeria 
japonica]
 dbj|BAE43579.1| putative phosphoribosylanthranilate transferase, partial [Cryptomeria 
japonica]
 dbj|BAE43580.1| putative phosphoribosylanthranilate transferase, partial [Cryptomeria 
japonica]
 dbj|BAE43581.1| putative phosphoribosylanthranilate transferase, partial [Cryptomeria 
japonica]
 dbj|BAE43582.1| putative phosphoribosylanthranilate transferase, partial [Cryptomeria 
japonica]
 dbj|BAE43583.1| putative phosphoribosylanthranilate transferase, partial [Cryptomeria 
japonica]
 dbj|BAE43584.1| putative phosphoribosylanthranilate transferase, partial [Cryptomeria 
japonica]
 dbj|BAE43585.1| putative phosphoribosylanthranilate transferase, partial [Cryptomeria 
japonica]
 dbj|BAE43586.1| putative phosphoribosylanthranilate transferase [Cryptomeria 
japonica]
Length=191

 Score =   258 bits (659),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 122/150 (81%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            Y+FLIGIW++R+RPR+PPHMDTRIS AD  H DELDEEFDTFPTS+  DVVRMRYDRLRS
Sbjct  42   YMFLIGIWHFRFRPRHPPHMDTRISHADAVHQDELDEEFDTFPTSKSSDVVRMRYDRLRS  101

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            +AGR+QTVVGD+ATQGER Q+LLSWRDPRATA+FV+FCL AAIVLYVTPFQV+A+L G Y
Sbjct  102  VAGRLQTVVGDIATQGERFQALLSWRDPRATAIFVLFCLFAAIVLYVTPFQVIAVLFGIY  161

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRH+LPSVPLNFFRRLPAR+D ML
Sbjct  162  VLRHPRFRHRLPSVPLNFFRRLPARSDSML  191



>dbj|BAE43594.1| putative phosphoribosylanthranilate transferase [Taxodium distichum 
var. distichum]
 dbj|BAE43596.1| putative phosphoribosylanthranilate transferase [Taxodium distichum 
var. distichum]
Length=191

 Score =   258 bits (659),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 121/150 (81%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            Y+FLIGIW++R+RPR+PPHMDTRIS AD  HPDELDEEFDTFPTS+  DVVRMRYDRLRS
Sbjct  42   YMFLIGIWHFRFRPRHPPHMDTRISNADAVHPDELDEEFDTFPTSKSSDVVRMRYDRLRS  101

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            +A R+QTVVGD+ATQGER Q+LLSWRDPRATA+FV+FCL AAIVLYVTPFQV+A+L G Y
Sbjct  102  VAARLQTVVGDIATQGERFQALLSWRDPRATAIFVLFCLFAAIVLYVTPFQVIAVLFGIY  161

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHP+FRH+LPSVPLNFFRRLPAR+D ML
Sbjct  162  VLRHPKFRHRLPSVPLNFFRRLPARSDSML  191



>dbj|BAB91451.1| phosphoribosyltransferase [Thujopsis dolabrata]
Length=191

 Score =   258 bits (659),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 122/150 (81%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            Y+FLIGIW++R+RPR+PPHMDTRIS AD  HPDELDEEFDTFPTS+  DVVRMRYDRLRS
Sbjct  42   YMFLIGIWHFRFRPRHPPHMDTRISHADVVHPDELDEEFDTFPTSKSSDVVRMRYDRLRS  101

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            +A R+QTVVGD+ATQGER Q+LLSWRDPRATA+FV+FCL+AAIVLYVTPFQV+A+L G Y
Sbjct  102  VAERLQTVVGDMATQGERFQALLSWRDPRATAIFVLFCLLAAIVLYVTPFQVIAVLFGIY  161

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRH+LPSVPLNFFRRLPAR+D ML
Sbjct  162  VLRHPRFRHRLPSVPLNFFRRLPARSDSML  191



>ref|XP_008243596.1| PREDICTED: LOW QUALITY PROTEIN: multiple C2 and transmembrane 
domain-containing protein 2 [Prunus mume]
Length=755

 Score =   275 bits (702),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIGIW +RWRPR+PPHMDTR+S AD AHPDE DEEFDTFPTSRP D+VRMRYDRLRS
Sbjct  606  YLFLIGIWNFRWRPRHPPHMDTRLSHADAAHPDERDEEFDTFPTSRPSDIVRMRYDRLRS  665

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGR+QTVVGDLATQGER QSLLSWRDPRAT LFV FCL+ AIVLYVTPFQVVALLAG Y
Sbjct  666  IAGRVQTVVGDLATQGERFQSLLSWRDPRATTLFVTFCLIVAIVLYVTPFQVVALLAGIY  725

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPS PLNFFRRLPAR+D M+
Sbjct  726  VLRHPRFRHKLPSAPLNFFRRLPARSDSMI  755



>ref|XP_002297795.1| C2 domain-containing family protein [Populus trichocarpa]
 gb|EEE82600.1| C2 domain-containing family protein [Populus trichocarpa]
Length=772

 Score =   275 bits (702),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLF+IG+W +RWRPR+PPHMDTR+S AD AHPDELDEEFDTFPTSRP D+VRMRYDRLRS
Sbjct  623  YLFVIGLWNFRWRPRHPPHMDTRLSHADAAHPDELDEEFDTFPTSRPSDIVRMRYDRLRS  682

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGR+QTVVGDLATQGER QSLLSWRDPRAT LFV FCL+AAIVLYVTPFQVV LL G Y
Sbjct  683  IAGRVQTVVGDLATQGERFQSLLSWRDPRATTLFVTFCLIAAIVLYVTPFQVVGLLIGIY  742

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPSVPLNFFRRLPAR+D ML
Sbjct  743  VLRHPRFRHKLPSVPLNFFRRLPARSDSML  772



>gb|KHG19030.1| Multiple C2 and transmembrane domain-containing 1 [Gossypium 
arboreum]
Length=772

 Score =   274 bits (701),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIGIW YRWRP +PPHMDTR+S AD AHPDELDEEFD FPTSRP D++RMRYDRLRS
Sbjct  623  YLFLIGIWNYRWRPLHPPHMDTRVSHADAAHPDELDEEFDAFPTSRPSDIIRMRYDRLRS  682

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            I GR+QTV+GDLATQGERLQSLLSWRDPRAT LFV FCL+AAIVLYVTPFQVVALL G Y
Sbjct  683  IGGRVQTVIGDLATQGERLQSLLSWRDPRATTLFVTFCLIAAIVLYVTPFQVVALLIGLY  742

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
             LRHPRFRHKLPSVPLNFFRRLPAR+D ML
Sbjct  743  ALRHPRFRHKLPSVPLNFFRRLPARSDSML  772



>ref|XP_006850074.1| hypothetical protein AMTR_s00022p00214560 [Amborella trichopoda]
 gb|ERN11655.1| hypothetical protein AMTR_s00022p00214560 [Amborella trichopoda]
Length=772

 Score =   274 bits (701),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            Y+FLIGIW+YRWRPR PP+MDTR+S A+N HPDELDEEFDTFPTSR  D+VRMRYDRLRS
Sbjct  623  YMFLIGIWHYRWRPRQPPYMDTRLSHAENVHPDELDEEFDTFPTSRHSDIVRMRYDRLRS  682

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            +AGRIQTVVGD+ATQGERLQSLLSWRDPRATALFV FC +AAIVLYVTPF+VVA+L  FY
Sbjct  683  VAGRIQTVVGDMATQGERLQSLLSWRDPRATALFVTFCFLAAIVLYVTPFRVVAILTAFY  742

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPSVPLNFFRRLPA+TD ML
Sbjct  743  VLRHPRFRHKLPSVPLNFFRRLPAKTDSML  772



>dbj|BAE43588.1| putative phosphoribosylanthranilate transferase [Cryptomeria 
japonica]
 dbj|BAE43591.1| putative phosphoribosylanthranilate transferase [Cryptomeria 
japonica]
 dbj|BAE43561.1| putative phosphoribosylanthranilate transferase, partial [Cryptomeria 
japonica]
 dbj|BAE43568.1| putative phosphoribosylanthranilate transferase [Cryptomeria 
japonica]
 dbj|BAE43571.1| putative phosphoribosylanthranilate transferase, partial [Cryptomeria 
japonica]
 dbj|BAE43573.1| putative phosphoribosylanthranilate transferase, partial [Cryptomeria 
japonica]
 dbj|BAE43574.1| putative phosphoribosylanthranilate transferase, partial [Cryptomeria 
japonica]
 dbj|BAE43576.1| putative phosphoribosylanthranilate transferase, partial [Cryptomeria 
japonica]
Length=191

 Score =   257 bits (657),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 122/150 (81%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            Y+FLIGIW++R+RPR PPHMDTRIS AD  H DELDEEFDTFPTS+  DVVRMRYDRLRS
Sbjct  42   YMFLIGIWHFRFRPRXPPHMDTRISHADAVHQDELDEEFDTFPTSKSSDVVRMRYDRLRS  101

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            +AGR+QTVVGD+ATQGER Q+LLSWRDPRATA+FV+FCL AAIVLYVTPFQV+A+L G Y
Sbjct  102  VAGRLQTVVGDIATQGERFQALLSWRDPRATAIFVLFCLFAAIVLYVTPFQVIAVLFGIY  161

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRH+LPSVPLNFFRRLPAR+D ML
Sbjct  162  VLRHPRFRHRLPSVPLNFFRRLPARSDSML  191



>ref|XP_008358865.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Malus domestica]
Length=772

 Score =   274 bits (701),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 131/150 (87%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIGIW YRWRPR+PPHMDTR+S AD AHPDE DEEFDTFPTSR  D+VRMRYDRLRS
Sbjct  623  YLFLIGIWNYRWRPRHPPHMDTRLSHADAAHPDERDEEFDTFPTSRXSDIVRMRYDRLRS  682

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGR+QTVVGDLATQGER QSLLSWRDPRAT LFV FCL+AAIVLYVTPFQVVALLAG Y
Sbjct  683  IAGRVQTVVGDLATQGERFQSLLSWRDPRATTLFVTFCLIAAIVLYVTPFQVVALLAGXY  742

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPR RHKLPSVPLNFFRRLPAR+D ML
Sbjct  743  VLRHPRLRHKLPSVPLNFFRRLPARSDSML  772



>ref|XP_010519731.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Tarenaya hassleriana]
 ref|XP_010519732.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Tarenaya hassleriana]
Length=768

 Score =   274 bits (700),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIGIW +RWRPR+PPHMDTR+S AD  HPDELDEEFDTFPTSRP D+VRMRYDRLRS
Sbjct  619  YLFLIGIWNFRWRPRHPPHMDTRLSHADAVHPDELDEEFDTFPTSRPSDIVRMRYDRLRS  678

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGR+QTV+GDLATQGER QSLLSWRDPRAT LFV+FCLVAA+VLYVTPFQVVALL G Y
Sbjct  679  IAGRVQTVIGDLATQGERFQSLLSWRDPRATTLFVMFCLVAAVVLYVTPFQVVALLTGIY  738

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFR+KLPS PLNFFRRLPAR+D ML
Sbjct  739  VLRHPRFRYKLPSAPLNFFRRLPARSDSML  768



>ref|XP_004295231.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Fragaria vesca subsp. vesca]
 ref|XP_011461911.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Fragaria vesca subsp. vesca]
Length=772

 Score =   274 bits (700),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIGIW +RWRPR+PPHMDTR+S AD AHPDE DEEFDTFPTSRP D+VRMRYDRLRS
Sbjct  623  YLFLIGIWNFRWRPRHPPHMDTRLSHADAAHPDERDEEFDTFPTSRPSDIVRMRYDRLRS  682

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGR+QTVVGD+ATQGER QSLLSWRDPRAT LFV FCL+AAIVLYVTPFQVV+LL G Y
Sbjct  683  IAGRVQTVVGDMATQGERFQSLLSWRDPRATTLFVTFCLIAAIVLYVTPFQVVSLLTGIY  742

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPS PLNFFRRLPAR+D ML
Sbjct  743  VLRHPRFRHKLPSAPLNFFRRLPARSDSML  772



>ref|XP_011037883.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 isoform X1 [Populus euphratica]
 ref|XP_011037884.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 isoform X2 [Populus euphratica]
Length=772

 Score =   274 bits (700),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLF+IG+W +RWRPR+PPHMDTR+S AD AHPDELDEEFDTFPTSRP D+VRMRYDRLRS
Sbjct  623  YLFVIGLWNFRWRPRHPPHMDTRLSHADAAHPDELDEEFDTFPTSRPSDIVRMRYDRLRS  682

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGR+QTVVGDLATQGER QSLLSWRDPRAT LFV FCL+AAIVLYVTPFQVV LL G Y
Sbjct  683  IAGRVQTVVGDLATQGERFQSLLSWRDPRATTLFVTFCLIAAIVLYVTPFQVVGLLIGIY  742

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPSVPLNFFRRLP R+D ML
Sbjct  743  VLRHPRFRHKLPSVPLNFFRRLPTRSDSML  772



>dbj|BAE43593.2| putative phosphoribosylanthranilate transferase [Taxodium distichum 
var. distichum]
 dbj|BAE43595.2| putative phosphoribosylanthranilate transferase, partial [Taxodium 
distichum var. distichum]
 dbj|BAE43600.2| putative phosphoribosylanthranilate transferase, partial [Taxodium 
distichum var. distichum]
 dbj|BAE43601.2| putative phosphoribosylanthranilate transferase, partial [Taxodium 
distichum var. imbricarium]
 dbj|BAE43604.2| putative phosphoribosylanthranilate transferase, partial [Taxodium 
distichum var. imbricarium]
Length=191

 Score =   257 bits (656),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 121/150 (81%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            Y+FLIGIW++R+RPR+PPHMDTRIS AD  HPDELDEEFDTFPTS+  DVVRMRYDRLRS
Sbjct  42   YMFLIGIWHFRFRPRHPPHMDTRISNADAVHPDELDEEFDTFPTSKSSDVVRMRYDRLRS  101

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            +A R+QTVVGD+ATQGER Q+LLSWRDPRATA+FV+FCL AAIVLYVTPFQV+A+L G Y
Sbjct  102  VAXRLQTVVGDIATQGERFQALLSWRDPRATAIFVLFCLFAAIVLYVTPFQVIAVLFGXY  161

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHP+FRH+LPSVPLNFFRRLPAR+D ML
Sbjct  162  VLRHPKFRHRLPSVPLNFFRRLPARSDSML  191



>ref|XP_006445975.1| hypothetical protein CICLE_v10014352mg [Citrus clementina]
 gb|ESR59215.1| hypothetical protein CICLE_v10014352mg [Citrus clementina]
Length=772

 Score =   273 bits (699),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIGIW +RWRPR+PPHMDTR+S A+ AHPDELDEEFDTFPT++  D+VRMRYDRLRS
Sbjct  623  YLFLIGIWNFRWRPRHPPHMDTRLSHAEAAHPDELDEEFDTFPTTKGSDIVRMRYDRLRS  682

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGR+QTV+GDLATQGER QSL+SWRDPRAT LFV FCL+AAIVLYVTPFQVVALLAG Y
Sbjct  683  IAGRVQTVIGDLATQGERFQSLISWRDPRATTLFVTFCLIAAIVLYVTPFQVVALLAGIY  742

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPSVPLNFFRRLPAR+D ML
Sbjct  743  VLRHPRFRHKLPSVPLNFFRRLPARSDSML  772



>dbj|BAE43606.1| putative phosphoribosylanthranilate transferase [Taxodium distichum 
var. imbricatum]
Length=191

 Score =   257 bits (656),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 121/150 (81%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            Y+FLIGIW++R+RPR+PPHMDTRIS AD  HPDELDEEFDTFPTS+  DVVRMRYDRLRS
Sbjct  42   YMFLIGIWHFRFRPRHPPHMDTRISNADAVHPDELDEEFDTFPTSKSSDVVRMRYDRLRS  101

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            +AGR+QTVVGD+ATQGER Q+LLSWRDPRATA+FV+FCL AAIVLYVTPFQV+A+L G Y
Sbjct  102  VAGRLQTVVGDIATQGERFQALLSWRDPRATAIFVLFCLFAAIVLYVTPFQVIAVLFGLY  161

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHP+FRH+LPSVPLNFFRRLPA +D ML
Sbjct  162  VLRHPKFRHRLPSVPLNFFRRLPACSDSML  191



>ref|XP_006494723.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Citrus sinensis]
 gb|KDO64911.1| hypothetical protein CISIN_1g004127mg [Citrus sinensis]
Length=772

 Score =   273 bits (699),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIGIW +RWRPR+PPHMDTR+S A+ AHPDELDEEFDTFPT++  D+VRMRYDRLRS
Sbjct  623  YLFLIGIWNFRWRPRHPPHMDTRLSHAEAAHPDELDEEFDTFPTTKGSDIVRMRYDRLRS  682

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGR+QTV+GDLATQGER QSL+SWRDPRAT LFV FCL+AAIVLYVTPFQVVALLAG Y
Sbjct  683  IAGRVQTVIGDLATQGERFQSLISWRDPRATTLFVTFCLIAAIVLYVTPFQVVALLAGIY  742

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPSVPLNFFRRLPAR+D ML
Sbjct  743  VLRHPRFRHKLPSVPLNFFRRLPARSDSML  772



>ref|XP_010091994.1| Multiple C2 and transmembrane domain-containing protein 2 [Morus 
notabilis]
 gb|EXB48400.1| Multiple C2 and transmembrane domain-containing protein 2 [Morus 
notabilis]
Length=772

 Score =   273 bits (698),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIGIW +RWRPR+PPHMDTR+S AD  HPDELDEEFDTFPTS+  D+VRMRYDRLRS
Sbjct  623  YLFLIGIWNFRWRPRHPPHMDTRLSHADAVHPDELDEEFDTFPTSKASDIVRMRYDRLRS  682

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGR+QTVVGDLATQGER QSLLSWRDPRA+ LFV FCL+AAIVLYVTPFQVV LLAG Y
Sbjct  683  IAGRVQTVVGDLATQGERFQSLLSWRDPRASTLFVTFCLIAAIVLYVTPFQVVGLLAGLY  742

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
             LRHPRFRHKLPSVPLNFFRRLPAR+D ML
Sbjct  743  TLRHPRFRHKLPSVPLNFFRRLPARSDSML  772



>dbj|BAD02805.1| putative phosphoribosylanthranilate transferase [Cryptomeria 
japonica]
Length=191

 Score =   256 bits (654),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 121/150 (81%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            Y+FLIGIW++R+RPR+PPHMDTRIS AD  H DELDEEFDTFPTS+  DVVRMRYDRLRS
Sbjct  42   YMFLIGIWHFRFRPRHPPHMDTRISHADAVHQDELDEEFDTFPTSKSSDVVRMRYDRLRS  101

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            +AGR+QTVVGD+ATQGER Q+LLSWRDPRATA+FV+FCL AAIVLYVT FQV+A+L G Y
Sbjct  102  VAGRLQTVVGDIATQGERFQALLSWRDPRATAIFVLFCLFAAIVLYVTSFQVIAVLFGIY  161

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRH+LPSVPLNFFRRLPAR+D ML
Sbjct  162  VLRHPRFRHRLPSVPLNFFRRLPARSDSML  191



>dbj|BAB91447.1| phosphoribosyltransferase, partial [Glyptostrobus pensilis]
Length=191

 Score =   256 bits (653),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 121/150 (81%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            Y+FLIGIW +R+RPR+PPHMDTR+S AD  HPDELDEEFDTFPTS+  DVVRMRYDRLRS
Sbjct  42   YMFLIGIWQFRFRPRHPPHMDTRVSHADAVHPDELDEEFDTFPTSKSSDVVRMRYDRLRS  101

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            +AGR+QTVVGD+ATQ ER Q+LLSWRDPRATA+FV+FCL AAIVLYVTPFQV+A+L G Y
Sbjct  102  VAGRLQTVVGDIATQVERFQALLSWRDPRATAIFVLFCLFAAIVLYVTPFQVIAVLFGIY  161

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRH+LPSVPLNFFRRLPAR+D ML
Sbjct  162  VLRHPRFRHRLPSVPLNFFRRLPARSDSML  191



>ref|XP_006381053.1| C2 domain-containing family protein [Populus trichocarpa]
 gb|ERP58850.1| C2 domain-containing family protein [Populus trichocarpa]
Length=775

 Score =   272 bits (696),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 142/150 (95%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+W+YR R R+PPHMDTR+S A++AHPDELDEEFDTFPTS+  D+VRMRYDRLRS
Sbjct  626  YLFLIGVWHYRRRSRHPPHMDTRLSHAESAHPDELDEEFDTFPTSQSADIVRMRYDRLRS  685

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFV+FCL+AAIVLY+TPFQVVA+L G Y
Sbjct  686  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVLFCLIAAIVLYITPFQVVAVLIGLY  745

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPSVPLNFFRRLPARTD ML
Sbjct  746  VLRHPRFRHKLPSVPLNFFRRLPARTDSML  775



>dbj|BAB91452.1| phosphoribosyltransferase [Thuja standishii]
Length=191

 Score =   255 bits (652),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            Y+FLIGIW++R+RPR+PPHMDTRIS AD  HPDELDEEFDT PTS+  DVVR+RYDRLRS
Sbjct  42   YMFLIGIWHFRFRPRHPPHMDTRISHADVVHPDELDEEFDTLPTSKSSDVVRIRYDRLRS  101

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            +AG++QTVVGD+ATQGER Q+LLSWRDPRA+A+FV+FCL+AAIVLYVTPFQV+A+L G Y
Sbjct  102  VAGKLQTVVGDMATQGERFQALLSWRDPRASAIFVLFCLLAAIVLYVTPFQVIAVLFGIY  161

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRH+LPSVPLNFFRRLPAR+D ML
Sbjct  162  VLRHPRFRHRLPSVPLNFFRRLPARSDSML  191



>dbj|BAE43597.2| putative phosphoribosylanthranilate transferase [Taxodium distichum 
var. distichum]
Length=191

 Score =   255 bits (652),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            Y+FLIGIW++R+RPR+PPHMDTRIS AD  HPDELDEEFDTFPTS+  DVVRMRYDRLRS
Sbjct  42   YMFLIGIWHFRFRPRHPPHMDTRISNADAVHPDELDEEFDTFPTSKSSDVVRMRYDRLRS  101

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            +A R+QTVVGD+ATQGER Q+LLSWRDPRATA+FV+FCL AAIVLYVTPFQV+A+L G Y
Sbjct  102  VAXRLQTVVGDIATQGERFQALLSWRDPRATAIFVLFCLFAAIVLYVTPFQVIAVLFGJY  161

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHP+FRH+LPSVPLNFFRRLPA +D ML
Sbjct  162  VLRHPKFRHRLPSVPLNFFRRLPAXSDSML  191



>gb|KDP20200.1| hypothetical protein JCGZ_07920 [Jatropha curcas]
Length=773

 Score =   271 bits (694),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIGIW YRWRPR+PPHMD R+S AD AHPDELDEEFDTFPT++P D+VRMRYDRLRS
Sbjct  624  YLFLIGIWNYRWRPRHPPHMDIRLSHADAAHPDELDEEFDTFPTTKPSDIVRMRYDRLRS  683

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGR+QTVVGDLATQGER QSLLSWRDPRAT LFVIFCL AA++LYVTPFQVVALL G Y
Sbjct  684  IAGRVQTVVGDLATQGERFQSLLSWRDPRATTLFVIFCLKAAVILYVTPFQVVALLVGLY  743

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPSV LNFFRRLPAR+D M+
Sbjct  744  VLRHPRFRHKLPSVHLNFFRRLPARSDSMI  773



>ref|XP_011025253.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Populus euphratica]
Length=772

 Score =   271 bits (693),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+W YR RPR+PPHMDTR+S AD AHPDELDEEFD+FPTSRP D+VRMRYDRLRS
Sbjct  623  YLFLIGLWNYRRRPRHPPHMDTRLSHADAAHPDELDEEFDSFPTSRPSDIVRMRYDRLRS  682

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGR+QTVVGDLATQGER QSL+SWRDPRAT LFV FCL+AAIVLYVTPFQV+ALL G Y
Sbjct  683  IAGRVQTVVGDLATQGERFQSLISWRDPRATTLFVTFCLIAAIVLYVTPFQVLALLIGLY  742

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPSVPLNFFRRLPAR+D ML
Sbjct  743  VLRHPRFRHKLPSVPLNFFRRLPARSDSML  772



>emb|CDY68091.1| BnaAnng26150D [Brassica napus]
Length=769

 Score =   269 bits (688),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 123/150 (82%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+W +RWRPR+PPHMDTR+S AD  HPDELDEEFDTFPTSR P++VRMRYDRLRS
Sbjct  620  YLFLIGVWNFRWRPRHPPHMDTRLSHADAVHPDELDEEFDTFPTSRSPEIVRMRYDRLRS  679

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            I GR+QTVVGDLATQGER  SLLSWRDPRAT LFV FCL+AA+VLYVTPFQVVA+LAG Y
Sbjct  680  IGGRVQTVVGDLATQGERFSSLLSWRDPRATTLFVFFCLIAAVVLYVTPFQVVAMLAGIY  739

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFR++LPSVPLN FRRLPAR+DC+L
Sbjct  740  VLRHPRFRYRLPSVPLNLFRRLPARSDCLL  769



>ref|XP_006289947.1| hypothetical protein CARUB_v10003573mg [Capsella rubella]
 gb|EOA22845.1| hypothetical protein CARUB_v10003573mg [Capsella rubella]
Length=769

 Score =   268 bits (685),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/150 (83%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIGIW +RWRPR+PPHMDTR+S AD  HPDELDEEFDTFPTSR  ++VRMRYDRLRS
Sbjct  620  YLFLIGIWNFRWRPRHPPHMDTRLSHADAVHPDELDEEFDTFPTSRSSEIVRMRYDRLRS  679

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            I GR+QTV+GDLATQGER  SLLSWRDPRAT LFV+FCL+AAIVLYVTPFQVVALLAG Y
Sbjct  680  IGGRVQTVIGDLATQGERFLSLLSWRDPRATTLFVLFCLIAAIVLYVTPFQVVALLAGIY  739

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPSVPLN FRRLPAR+D +L
Sbjct  740  VLRHPRFRHKLPSVPLNLFRRLPARSDSLL  769



>ref|NP_196801.1| calcium-dependent lipid-binding domain-containing plant phosphoribosyltransferase-like 
protein [Arabidopsis thaliana]
 emb|CAB88261.1| anthranilate phosphoribosyltransferase-like protein [Arabidopsis 
thaliana]
 gb|AED91836.1| calcium-dependent lipid-binding domain-containing plant phosphoribosyltransferase-like 
protein [Arabidopsis thaliana]
Length=769

 Score =   268 bits (685),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/150 (83%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIGIW +RWRPR+PPHMDTR+S AD  HPDELDEEFDTFPTSR  ++VRMRYDRLRS
Sbjct  620  YLFLIGIWNFRWRPRHPPHMDTRLSHADAVHPDELDEEFDTFPTSRSSEIVRMRYDRLRS  679

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            I GR+QTV+GDLATQGER  SLLSWRDPRAT LFV+FCL+AAIVLYVTPFQVVALLAG Y
Sbjct  680  IGGRVQTVIGDLATQGERFLSLLSWRDPRATTLFVLFCLIAAIVLYVTPFQVVALLAGIY  739

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPSVPLN FRRLPAR+D +L
Sbjct  740  VLRHPRFRHKLPSVPLNLFRRLPARSDSLL  769



>ref|XP_010419857.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 isoform X2 [Camelina sativa]
Length=769

 Score =   268 bits (684),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/150 (83%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIGIW +RWRPR+PPHMDTR+S AD  HPDELDEEFDTFPTSR  ++VRMRYDRLRS
Sbjct  620  YLFLIGIWNFRWRPRHPPHMDTRLSHADAVHPDELDEEFDTFPTSRSSEIVRMRYDRLRS  679

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            I GR+QTV+GDLATQGER  SLLSWRDPRAT LFV+FCL+AAIVLYVTPFQVVALLAG Y
Sbjct  680  IGGRVQTVIGDLATQGERFLSLLSWRDPRATTLFVLFCLIAAIVLYVTPFQVVALLAGIY  739

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPSVPLN FRRLPAR+D +L
Sbjct  740  VLRHPRFRHKLPSVPLNLFRRLPARSDSLL  769



>ref|XP_010492034.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Camelina sativa]
 ref|XP_010492035.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Camelina sativa]
 ref|XP_010492036.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Camelina sativa]
 ref|XP_010492037.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Camelina sativa]
Length=769

 Score =   268 bits (684),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/150 (83%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIGIW +RWRPR+PPHMDTR+S AD  HPDELDEEFDTFPTSR  ++VRMRYDRLRS
Sbjct  620  YLFLIGIWNFRWRPRHPPHMDTRLSHADAVHPDELDEEFDTFPTSRSSEIVRMRYDRLRS  679

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            I GR+QTV+GDLATQGER  SLLSWRDPRAT LFV+FCL+AAIVLYVTPFQVVALLAG Y
Sbjct  680  IGGRVQTVIGDLATQGERFLSLLSWRDPRATTLFVLFCLIAAIVLYVTPFQVVALLAGIY  739

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPSVPLN FRRLPAR+D +L
Sbjct  740  VLRHPRFRHKLPSVPLNLFRRLPARSDSLL  769



>ref|XP_010419856.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 isoform X1 [Camelina sativa]
 ref|XP_010419858.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 isoform X1 [Camelina sativa]
Length=769

 Score =   268 bits (684),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/150 (83%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIGIW +RWRPR+PPHMDTR+S AD  HPDELDEEFDTFPTSR  ++VRMRYDRLRS
Sbjct  620  YLFLIGIWNFRWRPRHPPHMDTRLSHADAVHPDELDEEFDTFPTSRSSEIVRMRYDRLRS  679

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            I GR+QTV+GDLATQGER  SLLSWRDPRAT LFV+FCL+AAIVLYVTPFQVVALLAG Y
Sbjct  680  IGGRVQTVIGDLATQGERFLSLLSWRDPRATTLFVLFCLIAAIVLYVTPFQVVALLAGIY  739

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPSVPLN FRRLPAR+D +L
Sbjct  740  VLRHPRFRHKLPSVPLNLFRRLPARSDSLL  769



>ref|XP_010089352.1| hypothetical protein L484_000459 [Morus notabilis]
 gb|EXC36234.1| hypothetical protein L484_000459 [Morus notabilis]
Length=199

 Score =   251 bits (642),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            Y+ LIG+W YR+RPR+PPHMDTR+S A+  HPDELDEEFDTFPTSRP D VRMRYDRLRS
Sbjct  50   YMLLIGMWNYRFRPRHPPHMDTRLSWAEAVHPDELDEEFDTFPTSRPNDAVRMRYDRLRS  109

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            +AGRIQTVVGD+ATQGER+QSLLSWRDPRAT+LFV+FCL AA+VLY TPF+VVAL+AG Y
Sbjct  110  VAGRIQTVVGDMATQGERVQSLLSWRDPRATSLFVVFCLCAAVVLYATPFRVVALVAGLY  169

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
             LRHPRFR KLPSVP NFFRRL ARTD +L
Sbjct  170  YLRHPRFRSKLPSVPANFFRRLTARTDSLL  199



>ref|XP_010273065.1| PREDICTED: uncharacterized protein LOC104608707 [Nelumbo nucifera]
Length=1009

 Score =   270 bits (691),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = -2

Query  723   YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
             Y+FLIGIW YR+RP+ PPHM+TRISCA+  HPDELDEEFDTFPTSR P++VRMRYDRLRS
Sbjct  860   YMFLIGIWNYRYRPQYPPHMNTRISCAEAVHPDELDEEFDTFPTSRSPELVRMRYDRLRS  919

Query  543   IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
             +AGR+QTVVGD+ATQGER+Q+LLSWRDPRATA+FV+FCL+AA+VLYVTPFQVVA++AG Y
Sbjct  920   VAGRVQTVVGDVATQGERIQALLSWRDPRATAIFVLFCLIAALVLYVTPFQVVAVVAGIY  979

Query  363   MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
             ++RHPRFRH+LPSVP+NFFRRLPA+TD ML
Sbjct  980   LMRHPRFRHRLPSVPINFFRRLPAKTDSML  1009



>ref|XP_009374817.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Pyrus x bretschneideri]
Length=774

 Score =   267 bits (682),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIGIW +R RPR+PPHMD R+S AD AHPDELDEEFDTFPT+RP D+VRMRYDRLRS
Sbjct  625  YLFLIGIWNFRRRPRHPPHMDIRLSHADAAHPDELDEEFDTFPTTRPSDIVRMRYDRLRS  684

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGR+QTVVGDL TQGER QSLLSWRDPRAT LFV FCL+AAIVLYVTPFQVVALLAG Y
Sbjct  685  IAGRVQTVVGDLGTQGERFQSLLSWRDPRATTLFVTFCLIAAIVLYVTPFQVVALLAGIY  744

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            MLRHP+FR KLPS PLNFFRRLPAR+D ML
Sbjct  745  MLRHPKFRTKLPSAPLNFFRRLPARSDSML  774



>ref|XP_002871539.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47798.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=769

 Score =   266 bits (681),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 124/150 (83%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIGIW +RWRPR+PPHMDTR+S AD  HPDELDEEFDTFPTSR  ++VRMRYDRLRS
Sbjct  620  YLFLIGIWNFRWRPRHPPHMDTRLSHADAVHPDELDEEFDTFPTSRSSEIVRMRYDRLRS  679

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            I GR+QTV+GDLATQGER  SLLSWRDPRAT LFV+FCL+AAIVLYVTPFQVVALL G Y
Sbjct  680  IGGRVQTVIGDLATQGERFLSLLSWRDPRATTLFVLFCLIAAIVLYVTPFQVVALLVGIY  739

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPSVPLN FRRLPAR+D +L
Sbjct  740  VLRHPRFRHKLPSVPLNLFRRLPARSDSLL  769



>ref|XP_006399782.1| hypothetical protein EUTSA_v10012747mg [Eutrema salsugineum]
 gb|ESQ41235.1| hypothetical protein EUTSA_v10012747mg [Eutrema salsugineum]
Length=769

 Score =   266 bits (679),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 124/150 (83%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIGIW +RWRPR+PPHMDTR+S AD  HPDELDEEFDTFPTSR  ++VRMRYDRLRS
Sbjct  620  YLFLIGIWNFRWRPRHPPHMDTRLSHADAVHPDELDEEFDTFPTSRSSEIVRMRYDRLRS  679

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGR+QTV+GDLATQGER  SLLSWRDPRAT LFV FCL+AA+VLYVTPFQVVALLAG Y
Sbjct  680  IAGRVQTVIGDLATQGERFLSLLSWRDPRATTLFVFFCLIAAVVLYVTPFQVVALLAGIY  739

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPSVPLN  RRLPAR+D +L
Sbjct  740  VLRHPRFRHKLPSVPLNLLRRLPARSDSLL  769



>ref|XP_010673580.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010673581.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010673582.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Beta vulgaris subsp. vulgaris]
Length=770

 Score =   266 bits (679),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIGIW YRWRPR+PPHMDTR+S AD AHPDELDEEFDTFPTSR  D++RMRYDR+RS
Sbjct  621  YLFLIGIWNYRWRPRHPPHMDTRLSHADGAHPDELDEEFDTFPTSRGNDIIRMRYDRVRS  680

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGRIQTVVGDLATQGER QSLLSWRDPRATALFV FCLVAAIVLYVTPF+V  L  G Y
Sbjct  681  IAGRIQTVVGDLATQGERFQSLLSWRDPRATALFVTFCLVAAIVLYVTPFKVCILFYGIY  740

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFR +LPSVP+N+FRRLPARTD ML
Sbjct  741  VLRHPRFRKRLPSVPINYFRRLPARTDSML  770



>gb|KHN25707.1| Protein unc-13 like C [Glycine soja]
Length=487

 Score =   259 bits (661),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            Y+FLIG+W +R+RPR PPHM+TRIS A+  HPDELDEEFDTFPT+R PD+VRMRYDRLRS
Sbjct  338  YMFLIGVWNFRYRPRYPPHMNTRISQAEAVHPDELDEEFDTFPTNRSPDLVRMRYDRLRS  397

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            +AGRIQTVVGDLA+QGER+Q+LLSWRDPRAT++F+  CL++A+VLYVTPFQ VA LAGFY
Sbjct  398  VAGRIQTVVGDLASQGERIQALLSWRDPRATSIFITLCLLSALVLYVTPFQAVAGLAGFY  457

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            ++RHPRFRH+LP  P+NFFRRLPARTDCML
Sbjct  458  IMRHPRFRHRLPCTPVNFFRRLPARTDCML  487



>emb|CDX78498.1| BnaA03g04100D [Brassica napus]
Length=769

 Score =   265 bits (678),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 122/150 (81%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIGIW +RWRPR+PPHMDTR+S AD  HPDELDEEFDTFPTSR P++VRMRYDRLRS
Sbjct  620  YLFLIGIWNFRWRPRHPPHMDTRLSHADAVHPDELDEEFDTFPTSRSPEIVRMRYDRLRS  679

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            I GR+QTV+GDLATQGER  SLLSWRDPRAT LF+ FCL+AA+VLYVTPFQVVALL G Y
Sbjct  680  IGGRVQTVIGDLATQGERFLSLLSWRDPRATTLFLFFCLIAAVVLYVTPFQVVALLTGIY  739

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPSVPLN FRRLPAR+D ++
Sbjct  740  VLRHPRFRHKLPSVPLNLFRRLPARSDSLI  769



>ref|XP_009131306.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Brassica rapa]
 ref|XP_009131307.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Brassica rapa]
 ref|XP_009131308.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Brassica rapa]
Length=769

 Score =   265 bits (678),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 122/150 (81%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIGIW +RWRPR+PPHMDTR+S AD  HPDELDEEFDTFPTSR P++VRMRYDRLRS
Sbjct  620  YLFLIGIWNFRWRPRHPPHMDTRLSHADAVHPDELDEEFDTFPTSRSPEIVRMRYDRLRS  679

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            I GR+QTV+GDLATQGER  SLLSWRDPRAT LF+ FCL+AA+VLYVTPFQVVALL G Y
Sbjct  680  IGGRVQTVIGDLATQGERFLSLLSWRDPRATTLFLFFCLIAAVVLYVTPFQVVALLTGIY  739

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPSVPLN FRRLPAR+D ++
Sbjct  740  VLRHPRFRHKLPSVPLNLFRRLPARSDSLI  769



>emb|CDX97214.1| BnaC09g44110D [Brassica napus]
Length=769

 Score =   265 bits (677),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 124/150 (83%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIGIW +RWRPR+PPHMDTR+S AD  HPDELDEEFDTFPTSR P++VRMRYDRLRS
Sbjct  620  YLFLIGIWNFRWRPRHPPHMDTRLSHADAVHPDELDEEFDTFPTSRSPEIVRMRYDRLRS  679

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            I GR+QTVVGDLATQGER  SLLSWRDPRAT LFV FCLVAA+VLYVTPFQVVALL G Y
Sbjct  680  IGGRVQTVVGDLATQGERFSSLLSWRDPRATTLFVFFCLVAAVVLYVTPFQVVALLYGIY  739

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFR++LPSVPLN FRRLPAR+D +L
Sbjct  740  VLRHPRFRYRLPSVPLNLFRRLPARSDSLL  769



>ref|XP_007131979.1| hypothetical protein PHAVU_011G056600g [Phaseolus vulgaris]
 gb|ESW03973.1| hypothetical protein PHAVU_011G056600g [Phaseolus vulgaris]
Length=775

 Score =   265 bits (677),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/150 (82%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIGIW +RWRPR+PPHMDTR+S AD AHPDELDEEFD+FPTSR PD+VRMRYDRLRS
Sbjct  626  YLFLIGIWNFRWRPRHPPHMDTRLSHADAAHPDELDEEFDSFPTSRSPDIVRMRYDRLRS  685

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGR+Q+VVGDL TQGER +SLLSWRDPRAT LF+ FCL+AAIVLYVTPFQVV+L  GFY
Sbjct  686  IAGRVQSVVGDLGTQGERFRSLLSWRDPRATTLFLTFCLLAAIVLYVTPFQVVSLFFGFY  745

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
             LRHPRFR +LPSVPLNFFRR+PAR+D ML
Sbjct  746  TLRHPRFRRRLPSVPLNFFRRMPARSDSML  775



>ref|XP_006445078.1| hypothetical protein CICLE_v10018672mg [Citrus clementina]
 ref|XP_006491075.1| PREDICTED: uncharacterized protein LOC102617920 [Citrus sinensis]
 gb|ESR58318.1| hypothetical protein CICLE_v10018672mg [Citrus clementina]
Length=1008

 Score =   268 bits (685),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 122/150 (81%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  723   YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
             Y+F+IG+W YR+RPR PPHM+TRIS AD  HPDELDEEFDTFPT+R PD+VRMRYDRLRS
Sbjct  859   YMFMIGLWNYRYRPRYPPHMNTRISYADAVHPDELDEEFDTFPTTRSPDIVRMRYDRLRS  918

Query  543   IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
             +AGRIQTVVGD+ATQGER+Q+LLSWRDPRA A+FVIFCLVAA+VLYVTPFQV+ALLAG Y
Sbjct  919   VAGRIQTVVGDVATQGERIQALLSWRDPRAAAIFVIFCLVAAVVLYVTPFQVLALLAGCY  978

Query  363   MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
             ++RHPRFRHK PS P+NFFRRLPARTD ML
Sbjct  979   IMRHPRFRHKTPSAPINFFRRLPARTDSML  1008



>gb|KDP28646.1| hypothetical protein JCGZ_14417 [Jatropha curcas]
Length=1025

 Score =   268 bits (685),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 121/150 (81%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  723   YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
             Y+FLIG+W YR+RPR PPHM+TRISCAD  HPDELDEEFDTFPT+R  ++VRMRYDRLRS
Sbjct  876   YMFLIGLWNYRFRPRYPPHMNTRISCADAVHPDELDEEFDTFPTTRSAEIVRMRYDRLRS  935

Query  543   IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
             +AGRIQTVVGD+ATQGER+QSLLSWRDPRATA+FV FCLVAAIVLY TPFQV+AL+ GFY
Sbjct  936   VAGRIQTVVGDMATQGERIQSLLSWRDPRATAIFVTFCLVAAIVLYATPFQVLALVGGFY  995

Query  363   MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
              +RHPRFRH+ PS P+NFFRRLPARTD ML
Sbjct  996   HMRHPRFRHRTPSAPINFFRRLPARTDSML  1025



>emb|CDP08834.1| unnamed protein product [Coffea canephora]
Length=1004

 Score =   268 bits (684),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 123/150 (82%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  723   YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
             Y+F+IGIW YR+RP+ PPHM+TRIS AD  HPDELDEEFDTFPT++  D+VRMRYDRLRS
Sbjct  855   YMFVIGIWNYRYRPKYPPHMNTRISYADAVHPDELDEEFDTFPTTKSSDLVRMRYDRLRS  914

Query  543   IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
             +AGRIQTVVGDLATQGER+Q+LLSWRDPRATA+FV FCLVAAIVLYVTPFQ +AL+AGFY
Sbjct  915   VAGRIQTVVGDLATQGERIQALLSWRDPRATAIFVTFCLVAAIVLYVTPFQALALMAGFY  974

Query  363   MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
             ++RHPRFRHKLP VPLNFFRRLPARTD ML
Sbjct  975   VMRHPRFRHKLPPVPLNFFRRLPARTDSML  1004



>emb|CDX70485.1| BnaC03g05690D [Brassica napus]
Length=769

 Score =   265 bits (676),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 122/150 (81%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIGIW +RWRPR+PPHMDTR+S AD  HPDELDEEFDTFPTSR P +VRMRYDRLRS
Sbjct  620  YLFLIGIWNFRWRPRHPPHMDTRLSHADAVHPDELDEEFDTFPTSRSPAIVRMRYDRLRS  679

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            I GR+QTV+GDLATQGER  SLLSWRDPRAT LF+ FCL+AA+VLYVTPFQVVALL G Y
Sbjct  680  IGGRVQTVIGDLATQGERFLSLLSWRDPRATTLFLFFCLIAAVVLYVTPFQVVALLTGIY  739

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPSVPLN FRRLPAR+D ++
Sbjct  740  LLRHPRFRHKLPSVPLNLFRRLPARSDSLI  769



>gb|ACN33768.1| unknown [Zea mays]
Length=723

 Score =   263 bits (671),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 121/150 (81%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            Y+FLIGIW +R+RPR PPHM+T+IS A+  HPDELDEEFDTFPTSR P+VVRMRYDRLRS
Sbjct  574  YMFLIGIWNFRYRPRYPPHMNTKISHAEAVHPDELDEEFDTFPTSRNPEVVRMRYDRLRS  633

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            +AGRIQTVVGD+ATQGER+Q+LLSWRDPRATA+FV+FCLVAAIV YVTP QV+A L GFY
Sbjct  634  VAGRIQTVVGDIATQGERVQALLSWRDPRATAVFVLFCLVAAIVFYVTPLQVIAALGGFY  693

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            ++RHPRFRH+LPSVP+NFFRRLPARTD ML
Sbjct  694  VMRHPRFRHRLPSVPVNFFRRLPARTDSML  723



>gb|KDO86111.1| hypothetical protein CISIN_1g001835mg [Citrus sinensis]
 gb|KDO86112.1| hypothetical protein CISIN_1g001835mg [Citrus sinensis]
Length=1008

 Score =   266 bits (681),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 121/150 (81%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  723   YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
             Y+F+IG+W YR+RPR PPHM+TRIS AD  HPDELDEEFDTFPT+R PD+VRMRYDRLRS
Sbjct  859   YMFMIGLWNYRYRPRYPPHMNTRISYADAVHPDELDEEFDTFPTTRSPDIVRMRYDRLRS  918

Query  543   IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
             +AGRIQTVVGD+ATQGER+Q+LLSWRDPRA A+FVIFCLVAA+VLYVTPFQ++ALLAG Y
Sbjct  919   VAGRIQTVVGDVATQGERIQALLSWRDPRAAAIFVIFCLVAAVVLYVTPFQLLALLAGCY  978

Query  363   MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
             ++RHPRFRHK PS P+NFFRRLPARTD ML
Sbjct  979   IMRHPRFRHKTPSAPINFFRRLPARTDSML  1008



>ref|XP_010660813.1| PREDICTED: uncharacterized protein LOC100264973 [Vitis vinifera]
 ref|XP_010660820.1| PREDICTED: uncharacterized protein LOC100264973 [Vitis vinifera]
 ref|XP_010660822.1| PREDICTED: uncharacterized protein LOC100264973 [Vitis vinifera]
Length=1002

 Score =   266 bits (681),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 122/150 (81%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  723   YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
             Y+FLIG+W +R+RPR PPHM+TRIS AD  HPDELDEEFDTFPTSR P++VR+RYDRLRS
Sbjct  853   YMFLIGVWNFRYRPRYPPHMNTRISQADAVHPDELDEEFDTFPTSRSPELVRLRYDRLRS  912

Query  543   IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
             +AGRIQTVVGD+ATQGER+QSLLSWRDPRATA+FV FCLVAA+VLYVTPFQV+A LAGFY
Sbjct  913   VAGRIQTVVGDVATQGERVQSLLSWRDPRATAIFVTFCLVAALVLYVTPFQVIAALAGFY  972

Query  363   MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
             M+RHPRFR++LPS P+NFFRRLPARTD ML
Sbjct  973   MMRHPRFRYRLPSAPINFFRRLPARTDSML  1002



>ref|XP_009121819.1| PREDICTED: extended synaptotagmin-1-like [Brassica rapa]
 ref|XP_009121820.1| PREDICTED: extended synaptotagmin-1-like [Brassica rapa]
Length=769

 Score =   263 bits (672),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 122/150 (81%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+W +RWRPR+PPHMDTR+S AD  HPDELDEEFDTFPTSR P++VRMRYDRLRS
Sbjct  620  YLFLIGVWNFRWRPRHPPHMDTRLSHADAVHPDELDEEFDTFPTSRSPEIVRMRYDRLRS  679

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            I GR+QTVVGDLATQGER  SLLSWRDPRAT LFV F L+AA+VLYVTPFQVVALLAG Y
Sbjct  680  IGGRVQTVVGDLATQGERFSSLLSWRDPRATTLFVFFSLIAAVVLYVTPFQVVALLAGIY  739

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFR++LPSVPLN FRRLPAR+D +L
Sbjct  740  VLRHPRFRYRLPSVPLNLFRRLPARSDSLL  769



>ref|XP_002511838.1| synaptotagmin, putative [Ricinus communis]
 gb|EEF50507.1| synaptotagmin, putative [Ricinus communis]
Length=1017

 Score =   266 bits (680),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  723   YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
             Y+FLIG W YR+RPR PPHM+TRISCAD  HPDELDEEFDTFPT+R P++VRMRYDRLRS
Sbjct  868   YMFLIGFWNYRFRPRYPPHMNTRISCADAVHPDELDEEFDTFPTTRSPEIVRMRYDRLRS  927

Query  543   IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
             +AGRIQTVVGD+ATQGER+QSLLSWRDPRAT +F+ FC VAA+VLY TPFQV+AL+AGFY
Sbjct  928   VAGRIQTVVGDVATQGERVQSLLSWRDPRATTIFLTFCFVAAVVLYATPFQVLALVAGFY  987

Query  363   MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
              +RHPRFRH+ PS+P+NFFRRLPARTD ML
Sbjct  988   SMRHPRFRHRTPSIPINFFRRLPARTDSML  1017



>ref|XP_004298739.1| PREDICTED: uncharacterized protein LOC101313699 isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011463849.1| PREDICTED: uncharacterized protein LOC101313699 isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011463850.1| PREDICTED: uncharacterized protein LOC101313699 isoform X2 [Fragaria 
vesca subsp. vesca]
 ref|XP_011463851.1| PREDICTED: uncharacterized protein LOC101313699 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=1007

 Score =   266 bits (680),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/150 (81%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  723   YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
             Y+FLIG+W +R+RPR PPHM+T+IS AD  HPDELDEEFDTFPTSR P++VRMRYDRLRS
Sbjct  858   YMFLIGVWNFRYRPRYPPHMNTKISQADLVHPDELDEEFDTFPTSRNPELVRMRYDRLRS  917

Query  543   IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
             +AGRIQTVVGD+ATQGERLQ+LLSWRDPRATALFV FCL+AA+V+YVTPFQVVA LAGF+
Sbjct  918   VAGRIQTVVGDVATQGERLQALLSWRDPRATALFVTFCLIAALVMYVTPFQVVAALAGFF  977

Query  363   MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
             M+RHPRFRH++PS P+NFFRRLPARTD ML
Sbjct  978   MMRHPRFRHRMPSAPINFFRRLPARTDSML  1007



>ref|XP_010113221.1| Multiple C2 and transmembrane domain-containing protein 1 [Morus 
notabilis]
 gb|EXC74799.1| Multiple C2 and transmembrane domain-containing protein 1 [Morus 
notabilis]
Length=796

 Score =   263 bits (673),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            Y+FLIG+W YR+RPR PPHM+TRIS A+  HPDE+DEEFDTFPTSR PD+VRMRYDRLRS
Sbjct  647  YMFLIGVWNYRYRPRYPPHMNTRISQAEAVHPDEMDEEFDTFPTSRNPDIVRMRYDRLRS  706

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            +AGRIQTVVGD+ATQGER+Q+LLSWRDPRATA+F+ FCLVAA+VLYVTPFQVVA L GFY
Sbjct  707  VAGRIQTVVGDVATQGERVQALLSWRDPRATAMFITFCLVAALVLYVTPFQVVAALMGFY  766

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            ++RHPRFRH+LP VP+NFFRRLP+RTD ML
Sbjct  767  VMRHPRFRHRLPPVPVNFFRRLPSRTDSML  796



>ref|XP_010053272.1| PREDICTED: uncharacterized protein LOC104441758 [Eucalyptus grandis]
 ref|XP_010053273.1| PREDICTED: uncharacterized protein LOC104441758 [Eucalyptus grandis]
 ref|XP_010053274.1| PREDICTED: uncharacterized protein LOC104441758 [Eucalyptus grandis]
 ref|XP_010053275.1| PREDICTED: uncharacterized protein LOC104441758 [Eucalyptus grandis]
 ref|XP_010053276.1| PREDICTED: uncharacterized protein LOC104441758 [Eucalyptus grandis]
 ref|XP_010053277.1| PREDICTED: uncharacterized protein LOC104441758 [Eucalyptus grandis]
 ref|XP_010053278.1| PREDICTED: uncharacterized protein LOC104441758 [Eucalyptus grandis]
 gb|KCW77541.1| hypothetical protein EUGRSUZ_D01859 [Eucalyptus grandis]
Length=1009

 Score =   266 bits (679),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 122/150 (81%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  723   YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
             Y+FLIG+W +R+RPR PPHM+T+IS A+  HPDELDEEFDTFPT+R PD+VRMRYDRLRS
Sbjct  860   YMFLIGVWNFRYRPRYPPHMNTKISQAEAVHPDELDEEFDTFPTTRSPDLVRMRYDRLRS  919

Query  543   IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
             +AGRIQTVVGD+ATQGERLQ+LLSWRDPRATA+FV FCLVAA+VLYVTPFQ VA LAGFY
Sbjct  920   VAGRIQTVVGDVATQGERLQALLSWRDPRATAIFVTFCLVAALVLYVTPFQAVAGLAGFY  979

Query  363   MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
             M+RHPRFRH+LPS P+NFFRRLPARTD ML
Sbjct  980   MMRHPRFRHRLPSAPINFFRRLPARTDSML  1009



>gb|KEH30271.1| C2 calcium/lipid-binding and GRAM domain protein [Medicago truncatula]
Length=770

 Score =   263 bits (671),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 121/150 (81%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            Y+F+IGIW +RWRPR+PPHMDTR+S AD A P+ELDEEFDTFPTSR  D+VRMRYDRLRS
Sbjct  621  YMFMIGIWNFRWRPRHPPHMDTRLSHADAAFPNELDEEFDTFPTSRSSDIVRMRYDRLRS  680

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            I GR+Q+VVGDLATQGER QSLLSWRDPRAT LFV FC VAA++LYVTPFQVV L+ GFY
Sbjct  681  IGGRVQSVVGDLATQGERFQSLLSWRDPRATTLFVTFCFVAAMILYVTPFQVVLLITGFY  740

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFR KLPSVPLNFFRRLPAR+D ML
Sbjct  741  VLRHPRFRQKLPSVPLNFFRRLPARSDSML  770



>ref|XP_009779007.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Nicotiana sylvestris]
 ref|XP_009779009.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Nicotiana sylvestris]
Length=1002

 Score =   266 bits (679),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 121/150 (81%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  723   YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
             Y+FLIG+W YR+RPR PPHM+T++S A++ HPDELDEEFDTFPTSR P++VRMRYDRLRS
Sbjct  853   YMFLIGVWNYRYRPRYPPHMNTKLSQAESVHPDELDEEFDTFPTSRSPELVRMRYDRLRS  912

Query  543   IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
             +AGRIQTVVGD+ATQGER QSLLSWRDPRATALFV FCL+AA+VLYVTPFQV+A L G Y
Sbjct  913   VAGRIQTVVGDVATQGERFQSLLSWRDPRATALFVTFCLIAALVLYVTPFQVIAALIGIY  972

Query  363   MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
             M+RHPRFRH+LPSVP+NFFRRLPARTD ML
Sbjct  973   MMRHPRFRHRLPSVPINFFRRLPARTDSML  1002



>ref|NP_001152102.1| phosphoribosylanthranilate transferase [Zea mays]
 gb|ACG45776.1| phosphoribosylanthranilate transferase [Zea mays]
Length=774

 Score =   263 bits (671),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+WYYR R R PPHMDTR+  A+ AHPDELDEEFDTFPTSRPPDVVRM   RL S
Sbjct  625  YLFLIGVWYYRXRLRQPPHMDTRLXHAETAHPDELDEEFDTFPTSRPPDVVRMXXXRLXS  684

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            +AGRI T VGDLATQGERLQSLLSWRDPRATALFV+FC VAAIVLYVTPF+VV  LAG Y
Sbjct  685  VAGRIXTXVGDLATQGERLQSLLSWRDPRATALFVVFCFVAAIVLYVTPFRVVVFLAGLY  744

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            MLRHPRFRHK+PSVPLNFFRRLPARTD ML
Sbjct  745  MLRHPRFRHKMPSVPLNFFRRLPARTDSML  774



>ref|XP_009626688.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Nicotiana tomentosiformis]
 ref|XP_009626690.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Nicotiana tomentosiformis]
Length=1001

 Score =   265 bits (677),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 121/150 (81%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  723   YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
             Y+FLIG+W YR+RPR PPHM+T++S A++ HPDELDEEFDTFPTSR P++VRMRYDRLRS
Sbjct  852   YMFLIGVWNYRYRPRYPPHMNTKLSQAESVHPDELDEEFDTFPTSRGPELVRMRYDRLRS  911

Query  543   IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
             +AGRIQTVVGD+ATQGER QSLLSWRDPRATALFV FCL+AA+VLYVTPFQV+A L G Y
Sbjct  912   VAGRIQTVVGDVATQGERFQSLLSWRDPRATALFVTFCLIAALVLYVTPFQVIAALIGIY  971

Query  363   MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
             M+RHPRFRH+LPSVP+NFFRRLPARTD ML
Sbjct  972   MMRHPRFRHRLPSVPINFFRRLPARTDSML  1001



>ref|XP_004244612.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Solanum lycopersicum]
 ref|XP_010324629.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Solanum lycopersicum]
 ref|XP_010324630.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Solanum lycopersicum]
Length=1000

 Score =   265 bits (677),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 121/150 (81%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            Y+FLIG+W YR+RPR PPHM+T++S A++ HPDELDEEFDTFPTSR P++VRMRYDRLRS
Sbjct  851  YMFLIGVWNYRYRPRYPPHMNTKLSQAESVHPDELDEEFDTFPTSRSPELVRMRYDRLRS  910

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            +AGRIQTVVGD+ATQGERLQSLLSWRDPRATALFV FCLVAA+ +YVTPFQV+A L G Y
Sbjct  911  VAGRIQTVVGDVATQGERLQSLLSWRDPRATALFVTFCLVAALAMYVTPFQVIAALIGIY  970

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            M+RHPRFRH+LPSVP+NFFRRLPARTD ML
Sbjct  971  MMRHPRFRHRLPSVPVNFFRRLPARTDSML  1000



>ref|XP_010255412.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2 [Nelumbo nucifera]
 ref|XP_010255414.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2 [Nelumbo nucifera]
 ref|XP_010255415.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2 [Nelumbo nucifera]
Length=1011

 Score =   265 bits (676),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  723   YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
             Y+FLIG+W +R+RPR PPHM+TRISCA+  HPDELDEEFDTFPTSR  ++VRMRYDRLRS
Sbjct  862   YMFLIGLWNFRYRPRYPPHMNTRISCAEGLHPDELDEEFDTFPTSRSQELVRMRYDRLRS  921

Query  543   IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
             +AGR+QTVVGD+ATQGER+Q+LLSWRDPRATA+FV+FCL+AA+VLYVTPFQVVA++ G Y
Sbjct  922   VAGRVQTVVGDIATQGERVQALLSWRDPRATAIFVMFCLIAALVLYVTPFQVVAVVIGIY  981

Query  363   MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
              +RHPRFRHKLPSVP+NFFRRLPARTD ML
Sbjct  982   WMRHPRFRHKLPSVPINFFRRLPARTDSML  1011



>dbj|BAK05840.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=604

 Score =   258 bits (659),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            Y+FLIGIW YR+RPR PPHM+T+IS A+  HPDELDEEFDTFPTSR  ++VRMRYDRLRS
Sbjct  455  YMFLIGIWNYRYRPRYPPHMNTKISHAEAVHPDELDEEFDTFPTSRSQEIVRMRYDRLRS  514

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            +AGRIQTVVGD+ATQGER+Q+LLSWRDPRATA+FV+FC +AAIVLYVTP QV+A L GFY
Sbjct  515  VAGRIQTVVGDIATQGERVQALLSWRDPRATAIFVLFCFIAAIVLYVTPLQVLAALGGFY  574

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
             +RHPRFRH+LPS P+NFFRRLPARTD ML
Sbjct  575  AMRHPRFRHRLPSTPVNFFRRLPARTDSML  604



>ref|NP_001168012.1| uncharacterized protein LOC100381735 [Zea mays]
 gb|ACN26830.1| unknown [Zea mays]
 tpg|DAA35284.1| TPA: hypothetical protein ZEAMMB73_455623 [Zea mays]
 tpg|DAA35285.1| TPA: hypothetical protein ZEAMMB73_455623 [Zea mays]
Length=1012

 Score =   264 bits (675),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 121/150 (81%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  723   YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
             Y+FLIGIW +R+RPR PPHM+T+IS A+  HPDELDEEFDTFPTSR P+VVRMRYDRLRS
Sbjct  863   YMFLIGIWNFRYRPRYPPHMNTKISHAEAVHPDELDEEFDTFPTSRNPEVVRMRYDRLRS  922

Query  543   IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
             +AGRIQTVVGD+ATQGER+Q+LLSWRDPRATA+FV+FCLVAAIV YVTP QV+A L GFY
Sbjct  923   VAGRIQTVVGDIATQGERVQALLSWRDPRATAVFVLFCLVAAIVFYVTPLQVIAALGGFY  982

Query  363   MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
             ++RHPRFRH+LPSVP+NFFRRLPARTD ML
Sbjct  983   VMRHPRFRHRLPSVPVNFFRRLPARTDSML  1012



>ref|XP_006653047.1| PREDICTED: uncharacterized protein LOC102701166 [Oryza brachyantha]
Length=1009

 Score =   264 bits (674),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = -2

Query  723   YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
             Y+FLIGIW YR+RPR PPHM+T+IS A+  HPDELDEEFDTFPTSR P++VRMRYDRLRS
Sbjct  860   YMFLIGIWNYRYRPRYPPHMNTKISHAEAVHPDELDEEFDTFPTSRSPEIVRMRYDRLRS  919

Query  543   IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
             +AGRIQTVVGD+ATQGER+Q+LLSWRDPRATA+FV+FCL+AAIVLYVTP QV+A LAGFY
Sbjct  920   VAGRIQTVVGDIATQGERVQALLSWRDPRATAIFVLFCLIAAIVLYVTPLQVLAALAGFY  979

Query  363   MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
             ++RHPRFR++LPS+P+NFFRRLPARTD ML
Sbjct  980   VMRHPRFRYRLPSIPVNFFRRLPARTDSML  1009



>ref|XP_008775338.1| PREDICTED: uncharacterized protein LOC103695724 [Phoenix dactylifera]
Length=1003

 Score =   263 bits (673),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 122/150 (81%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = -2

Query  723   YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
             Y+FLIG+W YR+RPR PPHM+TRIS AD AHPDELDEEFDTFPTSR  ++VRMRYDRLRS
Sbjct  854   YMFLIGLWNYRFRPRYPPHMNTRISHADAAHPDELDEEFDTFPTSRGAELVRMRYDRLRS  913

Query  543   IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
             +AGRIQTVVGD+ATQGERLQ LLSWRDPRAT +F+IFCL+AA+VLYVTPFQVVA++AGFY
Sbjct  914   VAGRIQTVVGDVATQGERLQLLLSWRDPRATMMFLIFCLLAALVLYVTPFQVVAVIAGFY  973

Query  363   MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
             ++RHP+FRHK+PSVPLNFFRRLPARTD +L
Sbjct  974   LMRHPKFRHKMPSVPLNFFRRLPARTDSLL  1003



>dbj|BAK05882.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=550

 Score =   256 bits (653),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 136/151 (90%), Gaps = 1/151 (1%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIG+W+YRWRPR PPHMDTR+S A+ ++PDE DEEFDTFPTSR  DVVRMRYDRLRS
Sbjct  400  YLFLIGVWFYRWRPRQPPHMDTRLSHAETSNPDEFDEEFDTFPTSRAQDVVRMRYDRLRS  459

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGR+QTVVGDLATQGERLQSLL+WRDPRATA+FV FCL+A +VLY+ PF++V L+AG Y
Sbjct  460  IAGRVQTVVGDLATQGERLQSLLNWRDPRATAIFVSFCLIAGVVLYLAPFRMVVLIAGLY  519

Query  363  MLRHPRF-RHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRF RH LPS PLNFFRRLPA+TD +L
Sbjct  520  VLRHPRFRRHGLPSAPLNFFRRLPAKTDSLL  550



>ref|XP_004306799.1| PREDICTED: uncharacterized protein LOC101305880 [Fragaria vesca 
subsp. vesca]
Length=1012

 Score =   263 bits (672),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/150 (81%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = -2

Query  723   YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
             Y+FLIGIW +R+RPR PPHM+TRIS AD  HPDELDEEFDTFPTSR  D+VRMRYDRLRS
Sbjct  863   YMFLIGIWNFRYRPRYPPHMNTRISYADAVHPDELDEEFDTFPTSRGTDIVRMRYDRLRS  922

Query  543   IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
             +AGRIQTVVGD+ATQGER+QSLLSWRDPRAT LF+ FCLVAAIVLYVTPFQV+ LL G Y
Sbjct  923   VAGRIQTVVGDVATQGERIQSLLSWRDPRATMLFITFCLVAAIVLYVTPFQVLVLLGGVY  982

Query  363   MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
              +RHPRFRHK+PS P+NFFRRLPARTD ML
Sbjct  983   FMRHPRFRHKMPSAPVNFFRRLPARTDSML  1012



>ref|XP_002299538.2| hypothetical protein POPTR_0001s09250g [Populus trichocarpa]
 gb|EEE84343.2| hypothetical protein POPTR_0001s09250g [Populus trichocarpa]
Length=1008

 Score =   263 bits (671),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  723   YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
             Y+FLIGIW YR+RPR PPHM+T+IS A+  HPDELDEEFDTFPTSR P++VRMRYDRLRS
Sbjct  859   YMFLIGIWNYRYRPRYPPHMNTKISQAEVVHPDELDEEFDTFPTSRSPELVRMRYDRLRS  918

Query  543   IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
             ++GRIQTVVGD+ATQGER Q+LLSWRDPRATA+FVIFCLVAA+VL+VTPFQV+A LAGFY
Sbjct  919   VSGRIQTVVGDIATQGERFQALLSWRDPRATAIFVIFCLVAALVLFVTPFQVIAALAGFY  978

Query  363   MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
             M+RHPRFR++ PSVP+NFFRRLP+RTD ML
Sbjct  979   MMRHPRFRYRTPSVPINFFRRLPSRTDSML  1008



>ref|XP_004960016.1| PREDICTED: uncharacterized protein LOC101781845 isoform X1 [Setaria 
italica]
 ref|XP_004960017.1| PREDICTED: uncharacterized protein LOC101781845 isoform X2 [Setaria 
italica]
Length=1012

 Score =   263 bits (671),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  723   YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
             Y+FLIGIW +R+RPR PPHM+T+IS A+  HPDELDEEFDTFPTSR P++VRMRYDRLRS
Sbjct  863   YMFLIGIWNFRYRPRYPPHMNTKISHAEAVHPDELDEEFDTFPTSRNPEIVRMRYDRLRS  922

Query  543   IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
             +AGRIQTVVGD+ATQGER+Q+LLSWRDPRAT +FV+FCL+AA+VLYVTP QV+A LAGFY
Sbjct  923   VAGRIQTVVGDIATQGERVQALLSWRDPRATGVFVLFCLIAAVVLYVTPVQVLAALAGFY  982

Query  363   MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
             ++RHPRFRH+LPSVP+NFFRRLPARTD ML
Sbjct  983   VMRHPRFRHRLPSVPVNFFRRLPARTDSML  1012



>dbj|BAD95264.1| anthranilate phosphoribosyltransferase-like protein [Arabidopsis 
thaliana]
Length=131

 Score =   241 bits (615),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = -2

Query  666  MDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRSIAGRIQTVVGDLATQGERL  487
            MDTR+S AD+AHPDELDEEFDTFPTSRP D+VRMRYDRLRSIAGRIQTVVGDLATQGERL
Sbjct  1    MDTRLSHADSAHPDELDEEFDTFPTSRPSDIVRMRYDRLRSIAGRIQTVVGDLATQGERL  60

Query  486  QSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFYMLRHPRFRHKLPSVPLNFF  307
            QSLLSWRDPRATALFV+FCL+AA++LYVTPFQVVAL  G Y LRHPRFR+KLPSVPLNFF
Sbjct  61   QSLLSWRDPRATALFVLFCLIAAVILYVTPFQVVALCIGIYALRHPRFRYKLPSVPLNFF  120

Query  306  RRLPARTDCML  274
            RRLPARTDCML
Sbjct  121  RRLPARTDCML  131



>ref|XP_010918556.1| PREDICTED: uncharacterized protein LOC105042892 [Elaeis guineensis]
Length=1004

 Score =   263 bits (671),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 121/150 (81%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = -2

Query  723   YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
             Y+FLIG+W YR+RPR PPHM+TRIS AD AHPDELDEEFDTFPTSR  ++VRMRYDRLRS
Sbjct  855   YMFLIGLWNYRFRPRYPPHMNTRISHADAAHPDELDEEFDTFPTSRGAELVRMRYDRLRS  914

Query  543   IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
             +AGRIQTVVGD+ATQGERLQ LLSWRDPRAT +F++FCL+AA+VLYVTPFQVVA++AGFY
Sbjct  915   VAGRIQTVVGDVATQGERLQLLLSWRDPRATMMFLVFCLLAAMVLYVTPFQVVAVIAGFY  974

Query  363   MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
             ++RHPRFRHK+PS+PLNFFRRLPARTD +L
Sbjct  975   LMRHPRFRHKMPSLPLNFFRRLPARTDSLL  1004



>ref|XP_006352275.1| PREDICTED: uncharacterized protein LOC102594579 [Solanum tuberosum]
Length=1001

 Score =   262 bits (670),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = -2

Query  723   YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
             Y+FLIG+W YR+RPR PPHM+T++S A++ HPDELDEEFDTFPTSR P++VRMRYDRLRS
Sbjct  852   YMFLIGVWNYRYRPRYPPHMNTKLSQAESVHPDELDEEFDTFPTSRSPELVRMRYDRLRS  911

Query  543   IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
             +AGRIQTVVGD+ATQGERLQSLLSWRDPRATALFV FCLVAA+ +YVTPFQV+A L G +
Sbjct  912   VAGRIQTVVGDVATQGERLQSLLSWRDPRATALFVTFCLVAALAMYVTPFQVIAALIGIF  971

Query  363   MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
             M+RHPRFRH+LPSVP NFFRRLPARTD ML
Sbjct  972   MMRHPRFRHRLPSVPANFFRRLPARTDSML  1001



>ref|XP_008806876.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Phoenix dactylifera]
 ref|XP_008806877.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Phoenix dactylifera]
Length=1002

 Score =   262 bits (670),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  723   YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
             Y+FLIG+W YR+RPR PPHM+T+IS A+  HPDELDEEFDTFPTSR  D+VRMRYDRLRS
Sbjct  853   YMFLIGLWNYRYRPRYPPHMNTKISHAEAVHPDELDEEFDTFPTSRGADLVRMRYDRLRS  912

Query  543   IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
             +AGRIQTVVGD+ATQGER+Q+LLSWRDPRATA+FV+FCLVAA+VLYVTPFQV+A LAGFY
Sbjct  913   VAGRIQTVVGDVATQGERIQALLSWRDPRATAIFVLFCLVAALVLYVTPFQVLAALAGFY  972

Query  363   MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
             ++RHPRFRH++PS P+NFFRRLPARTD ML
Sbjct  973   IMRHPRFRHRMPSAPVNFFRRLPARTDSML  1002



>ref|XP_002509788.1| synaptotagmin, putative [Ricinus communis]
 gb|EEF51175.1| synaptotagmin, putative [Ricinus communis]
Length=980

 Score =   262 bits (669),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            Y+FLIG+W YR+RPR PPHM+T+IS A+  HPDELDEEFDTFPTSR P++VRMRYDRLRS
Sbjct  831  YMFLIGVWNYRYRPRYPPHMNTKISQAETVHPDELDEEFDTFPTSRSPELVRMRYDRLRS  890

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            +AGRIQTVVGD+ATQGER QSLLSWRDPRATA+F++FCLVAA+VL+VTPFQV+A L+GFY
Sbjct  891  VAGRIQTVVGDIATQGERFQSLLSWRDPRATAIFILFCLVAALVLFVTPFQVIAALSGFY  950

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
             +RHPRFR++ PSVP+NFFRRLPARTD ML
Sbjct  951  AMRHPRFRYRTPSVPINFFRRLPARTDSML  980



>ref|XP_009419170.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Musa acuminata subsp. malaccensis]
 ref|XP_009419171.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Musa acuminata subsp. malaccensis]
 ref|XP_009419173.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Musa acuminata subsp. malaccensis]
Length=797

 Score =   259 bits (663),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            Y+FLIG+W YR+RPR+PPHMDT++S A+  HPDELDEEFDTFPT++  D+VRMRYDRLRS
Sbjct  648  YMFLIGLWSYRFRPRHPPHMDTKLSAAEVIHPDELDEEFDTFPTTKSHDIVRMRYDRLRS  707

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            +AGRIQTVVGDLA QGERLQSLLSWRDPRAT+LFV+FCLVAA++LYVTPFQ+VALLAG Y
Sbjct  708  VAGRIQTVVGDLAMQGERLQSLLSWRDPRATSLFVVFCLVAAVMLYVTPFQMVALLAGLY  767

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            MLRHPRFR KLPSVP NFF+RLP+R D ML
Sbjct  768  MLRHPRFRSKLPSVPNNFFKRLPSRIDSML  797



>ref|XP_002303582.2| C2 domain-containing family protein [Populus trichocarpa]
 gb|EEE78561.2| C2 domain-containing family protein [Populus trichocarpa]
Length=1009

 Score =   262 bits (669),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  723   YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
             Y+FLIGIW YR+RPR PPHM+T+IS A+  HPDELDEEFDTFPTSR P++V MRYDRLRS
Sbjct  860   YMFLIGIWNYRYRPRYPPHMNTKISQAEAVHPDELDEEFDTFPTSRSPELVGMRYDRLRS  919

Query  543   IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
             +AGRIQTV+GD+ATQGER Q+LLSWRDPRATA+FVIFCLVAA+VL+VTPFQV+A LAGFY
Sbjct  920   VAGRIQTVIGDIATQGERFQALLSWRDPRATAIFVIFCLVAALVLFVTPFQVIAALAGFY  979

Query  363   MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
             M+RHPRFR++ PSVP+NFFRRLPARTD ML
Sbjct  980   MMRHPRFRYRTPSVPINFFRRLPARTDSML  1009



>ref|XP_011022713.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like isoform X2 [Populus euphratica]
Length=848

 Score =   260 bits (664),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            Y+FLIGIW YR+RPR PPHM+T+IS A+  HPDELDEEFDTFPTSR P++V MRYDRLRS
Sbjct  699  YMFLIGIWNYRYRPRYPPHMNTKISQAEAVHPDELDEEFDTFPTSRSPELVGMRYDRLRS  758

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            +AGRIQTV+GD+ATQGER Q+LLSWRDPRATA+FVIFCLVAA+VL+VTPFQV+A LAGFY
Sbjct  759  VAGRIQTVIGDIATQGERFQALLSWRDPRATAIFVIFCLVAALVLFVTPFQVIAALAGFY  818

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            M+RHPRFR++ PSVP+NFFRRLP RTD ML
Sbjct  819  MMRHPRFRYRTPSVPINFFRRLPVRTDSML  848



>ref|XP_010934752.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Elaeis guineensis]
 ref|XP_010934753.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Elaeis guineensis]
 ref|XP_010934755.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Elaeis guineensis]
Length=1004

 Score =   261 bits (668),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = -2

Query  723   YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
             Y+FLIG+W YR+RPR PPHM+T+IS A+  HPDELDEEFDTFPTSR  D+VRMRYDRLRS
Sbjct  855   YMFLIGLWNYRYRPRYPPHMNTKISHAEAVHPDELDEEFDTFPTSRSADLVRMRYDRLRS  914

Query  543   IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
             +AGRIQTVVGD+ATQGER+Q+LLSWRDPRATA+FV+FCL+AA+VLYVTPFQV+A+LAGFY
Sbjct  915   VAGRIQTVVGDVATQGERIQALLSWRDPRATAIFVLFCLMAALVLYVTPFQVLAVLAGFY  974

Query  363   MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
             ++RHPRFRH++PS PLNFFRRLPARTD ML
Sbjct  975   IMRHPRFRHRMPSPPLNFFRRLPARTDSML  1004



>ref|XP_010940465.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Elaeis guineensis]
 ref|XP_010940466.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Elaeis guineensis]
 ref|XP_010940467.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Elaeis guineensis]
Length=1004

 Score =   261 bits (667),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = -2

Query  723   YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
             Y+FLIG+W YR+RPR PPHM+T+IS A+  HPDELDEEFD FPT+R P++VRMRYDRLRS
Sbjct  855   YMFLIGVWNYRYRPRYPPHMNTKISHAEAVHPDELDEEFDEFPTNRSPELVRMRYDRLRS  914

Query  543   IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
             +AGRIQTVVGD+ATQGER+Q+LLSWRDPRATA+FV+FCL+AA+VLYVTPFQV+A+LAGFY
Sbjct  915   VAGRIQTVVGDVATQGERIQALLSWRDPRATAIFVLFCLIAALVLYVTPFQVLAVLAGFY  974

Query  363   MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
             ++RHPRFRH++PS P+NFFRRLPARTD ML
Sbjct  975   VMRHPRFRHRMPSAPINFFRRLPARTDSML  1004



>ref|XP_003611102.1| Glutathione peroxidase [Medicago truncatula]
 gb|AES94060.1| calcium-dependent lipid-binding (CaLB domain) family protein 
[Medicago truncatula]
Length=1007

 Score =   261 bits (667),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = -2

Query  723   YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
             YLFLIG+W +R+RPR PPHM+TRIS AD  HPDE+DEEFDTFPTS+ PD+VRMRYDRLRS
Sbjct  858   YLFLIGVWNFRYRPRYPPHMNTRISQADVVHPDEMDEEFDTFPTSKNPDLVRMRYDRLRS  917

Query  543   IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
             +AGRIQTVVGDLA+QGER+ +LLSWRDPRAT+LF+ FCL+AA+VLYVTPFQ+VA LAGFY
Sbjct  918   VAGRIQTVVGDLASQGERIHALLSWRDPRATSLFITFCLLAALVLYVTPFQMVAGLAGFY  977

Query  363   MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
              +RHPRFRH+LPS P+NFFRRLPARTD ML
Sbjct  978   FMRHPRFRHRLPSAPINFFRRLPARTDSML  1007



>gb|EYU23487.1| hypothetical protein MIMGU_mgv1a000757mg [Erythranthe guttata]
Length=993

 Score =   261 bits (666),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            Y+FLIG+W +R+RPR PPHM+T+IS A+  HPDELDEEFDTFPTSR PD+VRMRYDRLRS
Sbjct  844  YMFLIGVWNFRFRPRYPPHMNTKISQAEAVHPDELDEEFDTFPTSRNPDLVRMRYDRLRS  903

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            +AGRIQTVVGD+ATQGER+ SLLSWRDPRATA+FV FCLVAA+VLYVTPFQV+A LAG Y
Sbjct  904  VAGRIQTVVGDVATQGERVHSLLSWRDPRATAIFVTFCLVAAVVLYVTPFQVIAALAGVY  963

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
             +RHPRFR++LPSVP+NFFRRLPARTD ML
Sbjct  964  AMRHPRFRYRLPSVPVNFFRRLPARTDSML  993



>ref|XP_011080971.1| PREDICTED: uncharacterized protein LOC105164103 [Sesamum indicum]
 ref|XP_011080972.1| PREDICTED: uncharacterized protein LOC105164103 [Sesamum indicum]
 ref|XP_011080973.1| PREDICTED: uncharacterized protein LOC105164103 [Sesamum indicum]
 ref|XP_011080974.1| PREDICTED: uncharacterized protein LOC105164103 [Sesamum indicum]
 ref|XP_011080975.1| PREDICTED: uncharacterized protein LOC105164103 [Sesamum indicum]
Length=1001

 Score =   261 bits (666),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  723   YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
             Y+FLIG+W +R+RPR PPHM+T+IS A+  HPDELDEEFDTFPTSR PD+VRMRYDRLRS
Sbjct  852   YMFLIGVWNFRYRPRYPPHMNTKISQAEAVHPDELDEEFDTFPTSRNPDLVRMRYDRLRS  911

Query  543   IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
             +AGRIQTVVGD+ATQGER+ SLLSWRDPRATA+FV FCLVAA+VLYVTPFQV+A LAG +
Sbjct  912   VAGRIQTVVGDIATQGERVHSLLSWRDPRATAIFVTFCLVAALVLYVTPFQVIAALAGIF  971

Query  363   MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
             M+RHPRFR+++PSVP+NFFRRLPARTD ML
Sbjct  972   MMRHPRFRYRVPSVPVNFFRRLPARTDSML  1001



>dbj|BAH20205.1| AT1G22610 [Arabidopsis thaliana]
Length=501

 Score =   252 bits (643),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLF+IG+W YR+RPR+PPHMD R+S ADNAHPDELDEEFDTFPTSRP D+VRMRYDRLRS
Sbjct  352  YLFVIGMWNYRYRPRHPPHMDARVSQADNAHPDELDEEFDTFPTSRPADIVRMRYDRLRS  411

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            + GR+QTVVGDLATQGER+Q+LLSWRDPRATALF++F L+ A+ +YVTPFQV+A++ G +
Sbjct  412  VGGRVQTVVGDLATQGERIQALLSWRDPRATALFIVFALIWAVFIYVTPFQVIAIIIGLF  471

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            MLRHPRFR ++PSVP NFF+RLPA++D +L
Sbjct  472  MLRHPRFRSRMPSVPANFFKRLPAKSDMLL  501



>ref|XP_008238857.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Prunus mume]
 ref|XP_008238858.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Prunus mume]
 ref|XP_008238859.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Prunus mume]
 ref|XP_008238860.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Prunus mume]
Length=1005

 Score =   260 bits (665),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = -2

Query  723   YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
             Y+FLIGIW +R+RPR PPHM+T+IS A+  HPDELDEEFDTFPTSR P++VRMRYDRLRS
Sbjct  856   YMFLIGIWNFRYRPRYPPHMNTKISQAELVHPDELDEEFDTFPTSRNPELVRMRYDRLRS  915

Query  543   IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
             +AGRIQTVVGD+ATQGER Q+LLSWRDPRA+ALFV FCL+AA+V+YVTPFQVVA L GF+
Sbjct  916   VAGRIQTVVGDIATQGERFQALLSWRDPRASALFVTFCLIAALVMYVTPFQVVAALVGFF  975

Query  363   MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
             M+RHPRFRH+LPS P+NFFRRLP+RTD ML
Sbjct  976   MMRHPRFRHRLPSAPINFFRRLPSRTDSML  1005



>ref|XP_011022711.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like isoform X1 [Populus euphratica]
 ref|XP_011022712.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like isoform X1 [Populus euphratica]
Length=1009

 Score =   260 bits (665),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = -2

Query  723   YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
             Y+FLIGIW YR+RPR PPHM+T+IS A+  HPDELDEEFDTFPTSR P++V MRYDRLRS
Sbjct  860   YMFLIGIWNYRYRPRYPPHMNTKISQAEAVHPDELDEEFDTFPTSRSPELVGMRYDRLRS  919

Query  543   IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
             +AGRIQTV+GD+ATQGER Q+LLSWRDPRATA+FVIFCLVAA+VL+VTPFQV+A LAGFY
Sbjct  920   VAGRIQTVIGDIATQGERFQALLSWRDPRATAIFVIFCLVAALVLFVTPFQVIAALAGFY  979

Query  363   MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
             M+RHPRFR++ PSVP+NFFRRLP RTD ML
Sbjct  980   MMRHPRFRYRTPSVPINFFRRLPVRTDSML  1009



>ref|NP_001054305.1| Os04g0683800 [Oryza sativa Japonica Group]
 emb|CAE03445.1| OSJNBa0088H09.3 [Oryza sativa Japonica Group]
 dbj|BAF16219.1| Os04g0683800 [Oryza sativa Japonica Group]
 dbj|BAG95778.1| unnamed protein product [Oryza sativa Japonica Group]
Length=1011

 Score =   260 bits (665),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  723   YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
             Y+FLIG+W YR+RP  PPHM+T+IS A+  HPDELDEEFDTFPTSR PDV+RMRYDRLRS
Sbjct  862   YMFLIGVWNYRYRPCYPPHMNTKISHAEAVHPDELDEEFDTFPTSRSPDVIRMRYDRLRS  921

Query  543   IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
             +AGRIQTVVGD+ATQGER+Q+LLSWRDPRATA+FV+FCL+AAIVLYVTP QV+A LAGFY
Sbjct  922   VAGRIQTVVGDIATQGERVQALLSWRDPRATAIFVLFCLIAAIVLYVTPLQVLAALAGFY  981

Query  363   MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
             ++RHPRFR++LPS P+NFFRRLPARTD ML
Sbjct  982   VMRHPRFRYRLPSTPVNFFRRLPARTDSML  1011



>gb|KHG05718.1| Multiple C2 and transmembrane domain-containing 1 [Gossypium 
arboreum]
Length=985

 Score =   260 bits (664),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            Y+FLIG+W YR+RPR PPHM+T +SCAD   PDELDEEF+TFP S+  D+VRMRYDRLRS
Sbjct  836  YMFLIGVWNYRYRPRYPPHMNTSLSCADAVSPDELDEEFETFPASKSSDIVRMRYDRLRS  895

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            +AGRIQTVVGD+ATQGERLQ+LLSWRDPRAT +FV+ CLVAAIVLYV PFQ++ALLAGFY
Sbjct  896  VAGRIQTVVGDIATQGERLQALLSWRDPRATTIFVLLCLVAAIVLYVAPFQMIALLAGFY  955

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            ++RHPRFRHK PS P+NFFRRLPARTD ML
Sbjct  956  VMRHPRFRHKTPSAPINFFRRLPARTDSML  985



>ref|XP_006574306.1| PREDICTED: uncharacterized protein LOC100817962, partial [Glycine 
max]
Length=947

 Score =   259 bits (663),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            Y+FLIG+W +R+RPR PPHM+TRIS A+  HPDELDEEFDTFPT+R PD+VRMRYDRLRS
Sbjct  798  YMFLIGVWNFRYRPRYPPHMNTRISQAEAVHPDELDEEFDTFPTNRSPDLVRMRYDRLRS  857

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            +AGRIQTVVGDLA+QGER+Q+LLSWRDPRAT++F+  CL++A+VLYVTPFQ VA LAGFY
Sbjct  858  VAGRIQTVVGDLASQGERIQALLSWRDPRATSIFITLCLLSALVLYVTPFQAVAGLAGFY  917

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            ++RHPRFRH+LP  P+NFFRRLPARTDCML
Sbjct  918  IMRHPRFRHRLPCTPVNFFRRLPARTDCML  947



>ref|XP_008778754.1| PREDICTED: LOW QUALITY PROTEIN: multiple C2 and transmembrane 
domain-containing protein 1-like [Phoenix dactylifera]
Length=1005

 Score =   260 bits (664),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  723   YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
             Y+FLIG+W YR+RPR PPHM+T+IS A+  HPDELDEEFDTFPTSR  ++VRMRYDRLRS
Sbjct  856   YMFLIGVWNYRYRPRYPPHMNTKISHAEAVHPDELDEEFDTFPTSRSAELVRMRYDRLRS  915

Query  543   IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
             +AGRIQTVVGD+A+QGER+Q+LLSWRDPRATA+FV+FCL+AA+VLYVTPFQV+A +AGFY
Sbjct  916   VAGRIQTVVGDVASQGERIQALLSWRDPRATAIFVLFCLIAALVLYVTPFQVLAAVAGFY  975

Query  363   MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
             ++RHPRFRH++PS PLNFFRRLPARTD ML
Sbjct  976   VMRHPRFRHRMPSAPLNFFRRLPARTDSML  1005



>ref|XP_011029251.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2 isoform X1 [Populus euphratica]
 ref|XP_011029252.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2 isoform X2 [Populus euphratica]
Length=1007

 Score =   260 bits (664),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  723   YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
             Y+FLIGIW YR+RPR PPHM+T+IS A+  +PDELDEEFDTFPTSR P++VRMRYDRLRS
Sbjct  858   YMFLIGIWNYRYRPRYPPHMNTKISQAEVVNPDELDEEFDTFPTSRSPELVRMRYDRLRS  917

Query  543   IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
             ++GRIQTVVGD+ATQGER Q+LLSWRDPRATA+FVIFCLVAA+VL+VTPFQV+A LAGFY
Sbjct  918   VSGRIQTVVGDIATQGERFQALLSWRDPRATAIFVIFCLVAALVLFVTPFQVIAALAGFY  977

Query  363   MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
             M+RHPRFR++ PSVP+NFFRRLP+RTD ML
Sbjct  978   MMRHPRFRYRTPSVPINFFRRLPSRTDSML  1007



>ref|XP_010324263.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Solanum lycopersicum]
Length=1087

 Score =   260 bits (664),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  723   YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
             Y+FLIG+W YR+RPR+PPHMDT++S A+ AHPDELDEEFDTFPTSRP D+VRMRYDRLRS
Sbjct  938   YMFLIGLWNYRFRPRHPPHMDTKLSWAETAHPDELDEEFDTFPTSRPHDIVRMRYDRLRS  997

Query  543   IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
             +AGRIQTVVGD+ATQGERLQ +LSWRDPRAT+LF++F L AA++LYVTPF+VVAL+AG Y
Sbjct  998   VAGRIQTVVGDIATQGERLQGVLSWRDPRATSLFIMFSLFAAVMLYVTPFRVVALVAGLY  1057

Query  363   MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
             MLRHPRFR K+PSVP NFF+RLPARTD ML
Sbjct  1058  MLRHPRFRSKMPSVPSNFFKRLPARTDSML  1087



>ref|XP_010032396.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Eucalyptus grandis]
Length=798

 Score =   257 bits (657),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 121/150 (81%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            Y+FLIG+W YR+RPR+PPHMDT+IS A+ A+PDELDEEFDTFPTSRP DVVRMRYDRLRS
Sbjct  649  YMFLIGLWNYRFRPRHPPHMDTKISWAEAAYPDELDEEFDTFPTSRPHDVVRMRYDRLRS  708

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            +AGRIQTVVGD+ATQGERLQSLL WRDPRAT LF++FCL AA+VLYVTPF+VVAL+ G Y
Sbjct  709  VAGRIQTVVGDIATQGERLQSLLVWRDPRATGLFIMFCLCAAVVLYVTPFKVVALVTGLY  768

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
             LRHPRFR KLPSVP NFF+RLPARTD +L
Sbjct  769  YLRHPRFRSKLPSVPSNFFKRLPARTDGLL  798



>ref|XP_007220279.1| hypothetical protein PRUPE_ppa000771mg [Prunus persica]
 gb|EMJ21478.1| hypothetical protein PRUPE_ppa000771mg [Prunus persica]
Length=1009

 Score =   259 bits (663),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = -2

Query  723   YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
             Y+FLIGIW +R+RPR PPHM+TRIS AD  HPDELDEEFDTFPTSR  D+VRMRYDRLRS
Sbjct  860   YMFLIGIWNWRYRPRYPPHMNTRISYADAVHPDELDEEFDTFPTSRGSDIVRMRYDRLRS  919

Query  543   IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
             +AGRIQTVVGD+ATQGERLQ+LLSWRDPRAT L++ FCLVAAIVLYVTPFQV+ LL G Y
Sbjct  920   VAGRIQTVVGDVATQGERLQALLSWRDPRATTLYITFCLVAAIVLYVTPFQVLVLLGGVY  979

Query  363   MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
             ++RHPRFR K+PS P+NFFRRLPARTD ML
Sbjct  980   LMRHPRFRGKMPSAPVNFFRRLPARTDSML  1009



>ref|XP_008449758.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Cucumis melo]
Length=771

 Score =   256 bits (655),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLF+IGIW +R RPR+P HMDTR+S AD  HPDELDEEFDTFPTSR  D VRMRYDRLRS
Sbjct  622  YLFVIGIWNFRRRPRHPQHMDTRLSHADATHPDELDEEFDTFPTSRSSDTVRMRYDRLRS  681

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGR+QTVVGDLATQGER QSLLSWRDPRA+ALFV FCL+AAI+LYVTPFQV+ L+ G Y
Sbjct  682  IAGRVQTVVGDLATQGERFQSLLSWRDPRASALFVTFCLIAAIILYVTPFQVICLVGGIY  741

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPSVP  FFRRLPAR+D +L
Sbjct  742  VLRHPRFRHKLPSVPSTFFRRLPARSDSLL  771



>ref|XP_008244912.1| PREDICTED: uncharacterized protein LOC103343020 [Prunus mume]
Length=1009

 Score =   259 bits (663),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = -2

Query  723   YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
             Y+FLIGIW +R+RPR PPHM+TRIS AD  HPDELDEEFDTFPTSR  D+VRMRYDRLRS
Sbjct  860   YMFLIGIWNWRYRPRYPPHMNTRISYADAVHPDELDEEFDTFPTSRGSDIVRMRYDRLRS  919

Query  543   IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
             +AGRIQTVVGD+ATQGERLQ+LLSWRDPRAT L++ FCLVAAIVLYVTPFQV+ LL G Y
Sbjct  920   VAGRIQTVVGDVATQGERLQALLSWRDPRATTLYITFCLVAAIVLYVTPFQVLVLLGGVY  979

Query  363   MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
             ++RHPRFR K+PS P+NFFRRLPARTD ML
Sbjct  980   LMRHPRFRGKMPSAPVNFFRRLPARTDSML  1009



>dbj|BAK04937.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1016

 Score =   259 bits (663),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  723   YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
             Y+FLIGIW YR+RPR PPHM+T+IS A+  HPDELDEEFDTFPTSR  ++VRMRYDRLRS
Sbjct  867   YMFLIGIWNYRYRPRYPPHMNTKISHAEAVHPDELDEEFDTFPTSRSQEIVRMRYDRLRS  926

Query  543   IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
             +AGRIQTVVGD+ATQGER+Q+LLSWRDPRATA+FV+FC +AAIVLYVTP QV+A L GFY
Sbjct  927   VAGRIQTVVGDIATQGERVQALLSWRDPRATAIFVLFCFIAAIVLYVTPLQVLAALGGFY  986

Query  363   MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
              +RHPRFRH+LPS P+NFFRRLPARTD ML
Sbjct  987   AMRHPRFRHRLPSTPVNFFRRLPARTDSML  1016



>ref|XP_002462865.1| hypothetical protein SORBIDRAFT_02g033370 [Sorghum bicolor]
 gb|EER99386.1| hypothetical protein SORBIDRAFT_02g033370 [Sorghum bicolor]
Length=1006

 Score =   259 bits (662),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  723   YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
             Y+FLIG+W YR+RPR PPHM+TRIS AD AHPDELDEEFDTFPTSR PD++RMRYDRLR 
Sbjct  857   YMFLIGLWNYRFRPRFPPHMNTRISYADVAHPDELDEEFDTFPTSRSPDLIRMRYDRLRH  916

Query  543   IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
             +AGRIQTVVGD+ATQGERLQSLLSWRDPRATA+F+IFCL+ AI+LYVTPFQV+AL  GF+
Sbjct  917   VAGRIQTVVGDIATQGERLQSLLSWRDPRATAMFLIFCLITAIILYVTPFQVIALCLGFF  976

Query  363   MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
              +RHPRFRHK+PS P NFFRRLPA+TD +L
Sbjct  977   WMRHPRFRHKVPSAPANFFRRLPAKTDSLL  1006



>gb|KJB24703.1| hypothetical protein B456_004G157900 [Gossypium raimondii]
 gb|KJB24706.1| hypothetical protein B456_004G157900 [Gossypium raimondii]
 gb|KJB24707.1| hypothetical protein B456_004G157900 [Gossypium raimondii]
 gb|KJB24708.1| hypothetical protein B456_004G157900 [Gossypium raimondii]
Length=991

 Score =   259 bits (662),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            Y+FL G+W YR+RPR PPHM+T +SCAD   PDELDEEF++FP S+  D+VRMRYDRLRS
Sbjct  842  YMFLTGVWNYRYRPRYPPHMNTSLSCADAVSPDELDEEFESFPASKSSDIVRMRYDRLRS  901

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            +AGRIQTVVGD+ATQGERLQ+LLSWRDPRAT +FV+ CLVAAIVLYVTPFQ++ALLAGFY
Sbjct  902  VAGRIQTVVGDIATQGERLQALLSWRDPRATTIFVLLCLVAAIVLYVTPFQMIALLAGFY  961

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            ++RHPRFRHK PS P+NFFRRLPARTD ML
Sbjct  962  VMRHPRFRHKTPSAPINFFRRLPARTDSML  991



>ref|XP_008356954.1| PREDICTED: uncharacterized protein LOC103420681 [Malus domestica]
Length=1009

 Score =   259 bits (662),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = -2

Query  723   YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
             Y+FLIGIW +R+RPR PPHM+TRIS AD  HPDELDEEFDTFPTSR  D+VRMRYDRLRS
Sbjct  860   YMFLIGIWNWRYRPRYPPHMNTRISYADAVHPDELDEEFDTFPTSRGSDIVRMRYDRLRS  919

Query  543   IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
             +AGRIQTVVGD+ATQGERLQ+LLSWRDPRAT L++ FCLVAAIVLYVTPFQV+ LL G Y
Sbjct  920   VAGRIQTVVGDVATQGERLQALLSWRDPRATTLYITFCLVAAIVLYVTPFQVLVLLGGIY  979

Query  363   MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
             ++RHPRFR K+PS P+NFFRRLPARTD ML
Sbjct  980   LMRHPRFRGKMPSAPINFFRRLPARTDSML  1009



>ref|XP_004142139.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Cucumis sativus]
 ref|XP_004162018.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Cucumis sativus]
 gb|KGN54116.1| hypothetical protein Csa_4G286400 [Cucumis sativus]
Length=771

 Score =   256 bits (655),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLF+IGIW ++ RPR+P HMDTR+S AD  HPDELDEEFDTFPTSR  D VRMRYDRLRS
Sbjct  622  YLFVIGIWNFKHRPRHPQHMDTRLSHADATHPDELDEEFDTFPTSRSSDTVRMRYDRLRS  681

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAGR+QTVVGDLATQGER QSLLSWRDPRA+ALFV FCL+AAI+LYVTPFQV+ L+ G Y
Sbjct  682  IAGRVQTVVGDLATQGERFQSLLSWRDPRASALFVTFCLIAAIILYVTPFQVICLVGGIY  741

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLPSVP  FFRRLPAR+D +L
Sbjct  742  VLRHPRFRHKLPSVPSTFFRRLPARSDSLL  771



>ref|XP_010529567.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 isoform X2 [Tarenaya hassleriana]
Length=1008

 Score =   259 bits (662),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = -2

Query  723   YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
             Y+FLIG+W YR+RPR PPHM+T+IS A+  +PDELDEEFDTFPT+R PD+VRMRYDRLRS
Sbjct  859   YMFLIGLWNYRFRPRYPPHMNTKISQAEAVNPDELDEEFDTFPTTRSPDMVRMRYDRLRS  918

Query  543   IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
             +AGRIQTV+GDLATQGER+Q+LLSWRDPRATA+FVIFC V+AIV +VTPFQVV  L GFY
Sbjct  919   VAGRIQTVIGDLATQGERIQALLSWRDPRATAIFVIFCFVSAIVFFVTPFQVVVALVGFY  978

Query  363   MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
             ++RHPRFRH+LPSVP+NFFRRLPARTD ML
Sbjct  979   VMRHPRFRHRLPSVPVNFFRRLPARTDSML  1008



>ref|XP_010529565.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 isoform X1 [Tarenaya hassleriana]
 ref|XP_010529566.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 isoform X1 [Tarenaya hassleriana]
Length=1010

 Score =   259 bits (662),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = -2

Query  723   YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
             Y+FLIG+W YR+RPR PPHM+T+IS A+  +PDELDEEFDTFPT+R PD+VRMRYDRLRS
Sbjct  861   YMFLIGLWNYRFRPRYPPHMNTKISQAEAVNPDELDEEFDTFPTTRSPDMVRMRYDRLRS  920

Query  543   IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
             +AGRIQTV+GDLATQGER+Q+LLSWRDPRATA+FVIFC V+AIV +VTPFQVV  L GFY
Sbjct  921   VAGRIQTVIGDLATQGERIQALLSWRDPRATAIFVIFCFVSAIVFFVTPFQVVVALVGFY  980

Query  363   MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
             ++RHPRFRH+LPSVP+NFFRRLPARTD ML
Sbjct  981   VMRHPRFRHRLPSVPVNFFRRLPARTDSML  1010



>ref|XP_008376022.1| PREDICTED: uncharacterized protein LOC103439257 [Malus domestica]
Length=1009

 Score =   259 bits (661),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = -2

Query  723   YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
             Y+FLIGIW +R+RPR PPHM+TRIS AD  HPDELDEEFDTFPTSR  D+VRMRYDRLRS
Sbjct  860   YMFLIGIWNWRYRPRYPPHMNTRISYADAVHPDELDEEFDTFPTSRGSDIVRMRYDRLRS  919

Query  543   IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
             +AGRIQTVVGD+ATQGERLQ+LLSWRDPRAT L++ FCLVAAIVLYVTPFQV+ LL G Y
Sbjct  920   VAGRIQTVVGDVATQGERLQALLSWRDPRATTLYITFCLVAAIVLYVTPFQVLVLLGGIY  979

Query  363   MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
             ++RHPRFR K+PS P+NFFRRLPARTD ML
Sbjct  980   LMRHPRFRGKMPSXPINFFRRLPARTDSML  1009



>gb|KDO57729.1| hypothetical protein CISIN_1g003882mg [Citrus sinensis]
Length=789

 Score =   256 bits (655),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            Y+FLIGIW YR+RPR+PPHMDT++S AD  HPDELDEEFDTFPTS+  DVVRMRYDRLRS
Sbjct  640  YMFLIGIWNYRFRPRHPPHMDTKLSWADAVHPDELDEEFDTFPTSKQQDVVRMRYDRLRS  699

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            +AGRIQTVVGD+ATQGER Q+LLSWRDPRAT+LFVIFCL+AA+VLYVTPF+++ L+AG +
Sbjct  700  VAGRIQTVVGDMATQGERFQALLSWRDPRATSLFVIFCLIAAVVLYVTPFKIITLVAGLF  759

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
             LRHPRFR KLPS+P NFFRRLP+R D ML
Sbjct  760  WLRHPRFRSKLPSIPSNFFRRLPSRADTML  789



>ref|XP_006437049.1| hypothetical protein CICLE_v10033973mg [Citrus clementina]
 ref|XP_006485020.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Citrus sinensis]
 gb|ESR50289.1| hypothetical protein CICLE_v10033973mg [Citrus clementina]
Length=789

 Score =   256 bits (655),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            Y+FLIGIW YR+RPR+PPHMDT++S AD  HPDELDEEFDTFPTS+  DVVRMRYDRLRS
Sbjct  640  YMFLIGIWNYRFRPRHPPHMDTKLSWADAVHPDELDEEFDTFPTSKQQDVVRMRYDRLRS  699

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            +AGRIQTVVGD+ATQGER Q+LLSWRDPRAT+LFVIFCL+AA+VLYVTPF+++ L+AG +
Sbjct  700  VAGRIQTVVGDMATQGERFQALLSWRDPRATSLFVIFCLIAAVVLYVTPFKIITLVAGLF  759

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
             LRHPRFR KLPS+P NFFRRLP+R D ML
Sbjct  760  WLRHPRFRSKLPSIPSNFFRRLPSRADTML  789



>ref|XP_003580853.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2 [Brachypodium distachyon]
Length=1009

 Score =   259 bits (661),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  723   YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
             Y+FLIGIW YR+RPR PPHM+T+IS A+  HPDELDEEFDTFPTSR  ++VRMRYDRLRS
Sbjct  860   YMFLIGIWNYRYRPRYPPHMNTKISHAEAVHPDELDEEFDTFPTSRSQEIVRMRYDRLRS  919

Query  543   IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
             +AGRIQTVVGD+ATQGER+Q+LLSWRDPRATA+FV+FC  AAIVLYVTP QV+A L GFY
Sbjct  920   VAGRIQTVVGDIATQGERVQALLSWRDPRATAIFVLFCFTAAIVLYVTPLQVLAALGGFY  979

Query  363   MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
              +RHPRFRH+LPS+P+NFFRR+PARTD ML
Sbjct  980   AMRHPRFRHRLPSIPVNFFRRMPARTDSML  1009



>ref|XP_002532394.1| synaptotagmin, putative [Ricinus communis]
 gb|EEF29979.1| synaptotagmin, putative [Ricinus communis]
Length=793

 Score =   256 bits (654),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            Y+FLIGIW YR+RPR+PPHMDT++SCA+  HPDELDEEFDTFPTS+  DV RMRYDRLRS
Sbjct  644  YMFLIGIWNYRFRPRHPPHMDTKLSCAEVVHPDELDEEFDTFPTSKQQDVARMRYDRLRS  703

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            +AGRIQTVVGD+ATQGER Q+LLSWRDPRAT+L+VIFC +AA+VLY+TPF+++AL+AG +
Sbjct  704  VAGRIQTVVGDMATQGERFQALLSWRDPRATSLYVIFCFIAAVVLYITPFKIIALVAGLF  763

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
             LRHPRFR KLPSVP NFFRRLP+R D ML
Sbjct  764  WLRHPRFRSKLPSVPSNFFRRLPSRADSML  793



>gb|KJB25820.1| hypothetical protein B456_004G210900 [Gossypium raimondii]
Length=1011

 Score =   259 bits (661),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  723   YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
             Y+FLIG+W +R+RPR PPHM+T++S A+  HPDELDEEFDTFPTS+ P++VRMRYDRLRS
Sbjct  862   YMFLIGVWNFRYRPRYPPHMNTKVSQAEAVHPDELDEEFDTFPTSKSPELVRMRYDRLRS  921

Query  543   IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
             +AGRIQTV+GD+ATQGER Q+LLSWRDPRATA+F+ FCL+AAIVL+VTPFQV+A LAGFY
Sbjct  922   VAGRIQTVIGDIATQGERFQALLSWRDPRATAIFITFCLIAAIVLFVTPFQVIAALAGFY  981

Query  363   MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
              +RHPRFR++LP+VP+NFFRRLPARTD ML
Sbjct  982   AMRHPRFRYRLPAVPINFFRRLPARTDSML  1011



>gb|KHG10339.1| Multiple C2 and transmembrane domain-containing 1 [Gossypium 
arboreum]
Length=1011

 Score =   259 bits (661),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  723   YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
             Y+FLIG+W +R+RPR PPHM+T++S A+  HPDELDEEFDTFPTS+ P++VRMRYDRLRS
Sbjct  862   YMFLIGVWNFRYRPRYPPHMNTKVSQAEAVHPDELDEEFDTFPTSKSPELVRMRYDRLRS  921

Query  543   IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
             +AGRIQTV+GD+ATQGER Q+LLSWRDPRATA+F+ FCL+AAIVL+VTPFQV+A LAGFY
Sbjct  922   VAGRIQTVIGDIATQGERFQALLSWRDPRATAIFITFCLIAAIVLFVTPFQVIAALAGFY  981

Query  363   MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
              +RHPRFR++LP+VP+NFFRRLPARTD ML
Sbjct  982   AMRHPRFRYRLPAVPINFFRRLPARTDSML  1011



>gb|ADT92187.1| unknown [Zea mays]
 gb|AFW59953.1| hypothetical protein ZEAMMB73_497249 [Zea mays]
Length=1025

 Score =   258 bits (660),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  723   YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
             Y+FLIGIW +R+RPR PPHM+T+IS A+  HPDELDEEFDTFPTSR P++VR+RYDRLRS
Sbjct  876   YMFLIGIWNFRYRPRYPPHMNTKISHAEAVHPDELDEEFDTFPTSRNPEIVRVRYDRLRS  935

Query  543   IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
             +AGRIQ VVGD+ATQGER+Q+LLSWRDPRAT++FV+FCL+AAIVLYVTP QV+A L GFY
Sbjct  936   VAGRIQIVVGDIATQGERVQALLSWRDPRATSVFVLFCLIAAIVLYVTPLQVLAALGGFY  995

Query  363   MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
             ++RHPRFRH+LPSVP+NFFRRLPARTD ML
Sbjct  996   VMRHPRFRHRLPSVPVNFFRRLPARTDSML  1025



>ref|XP_008663748.1| PREDICTED: uncharacterized protein LOC103642209 [Zea mays]
Length=990

 Score =   258 bits (660),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            Y+FLIGIW +R+RPR PPHM+T+IS A+  HPDELDEEFDTFPTSR P++VR+RYDRLRS
Sbjct  841  YMFLIGIWNFRYRPRYPPHMNTKISHAEAVHPDELDEEFDTFPTSRNPEIVRVRYDRLRS  900

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            +AGRIQ VVGD+ATQGER+Q+LLSWRDPRAT++FV+FCL+AAIVLYVTP QV+A L GFY
Sbjct  901  VAGRIQIVVGDIATQGERVQALLSWRDPRATSVFVLFCLIAAIVLYVTPLQVLAALGGFY  960

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            ++RHPRFRH+LPSVP+NFFRRLPARTD ML
Sbjct  961  VMRHPRFRHRLPSVPVNFFRRLPARTDSML  990



>ref|XP_004957702.1| PREDICTED: uncharacterized protein LOC101764947 isoform X1 [Setaria 
italica]
 ref|XP_004957703.1| PREDICTED: uncharacterized protein LOC101764947 isoform X2 [Setaria 
italica]
Length=1007

 Score =   258 bits (660),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = -2

Query  723   YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
             Y+FLIG+W YR+RPR PPHM+TRIS AD AHPDELDEEFDTFPTS+ PD+VRMRYDRLR 
Sbjct  858   YMFLIGLWNYRFRPRFPPHMNTRISYADVAHPDELDEEFDTFPTSKSPDLVRMRYDRLRH  917

Query  543   IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
             +AGRIQTVVGD+ATQGERLQSLLSWRDPRATA+F+IFCL+ AI+LYVTPFQV+AL  GF+
Sbjct  918   VAGRIQTVVGDIATQGERLQSLLSWRDPRATAMFLIFCLITAIILYVTPFQVIALCLGFF  977

Query  363   MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
              +RHPRFRHK+P+ P+NFFRRLPA+TD +L
Sbjct  978   WMRHPRFRHKVPAAPVNFFRRLPAKTDSLL  1007



>gb|KDP25449.1| hypothetical protein JCGZ_20605 [Jatropha curcas]
Length=1005

 Score =   258 bits (660),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  723   YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
             Y+FLIGIW +R+RPR PPHM+T+IS A+  HPDELDEEFDTFPTS+ P++VRMRYDRLRS
Sbjct  856   YMFLIGIWNFRYRPRYPPHMNTKISQAETVHPDELDEEFDTFPTSKSPELVRMRYDRLRS  915

Query  543   IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
             +AGRIQTVVGD+ATQGER QSLLSWRDPRATA+F++FCLVAA+VL+VTPFQV+A LAGF+
Sbjct  916   VAGRIQTVVGDIATQGERFQSLLSWRDPRATAIFILFCLVAALVLFVTPFQVIAALAGFF  975

Query  363   MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
             ++RHPRFR++ PS P+NFFRRLPARTD ML
Sbjct  976   IMRHPRFRYRTPSAPINFFRRLPARTDSML  1005



>ref|XP_008383982.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Malus domestica]
Length=1011

 Score =   258 bits (660),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  723   YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
             Y+FLIGIW +R+RPR PPHM+T+IS A+  HPDELDEEFDTFPTS+ P++VRMRYDRLRS
Sbjct  862   YMFLIGIWNFRYRPRYPPHMNTKISQAELVHPDELDEEFDTFPTSKNPELVRMRYDRLRS  921

Query  543   IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
             +AGRIQTVVGD+ATQGER Q+LLSWRDPRA+ALFV FCL+AA+V+YVTPFQVVA LAGF+
Sbjct  922   VAGRIQTVVGDVATQGERFQALLSWRDPRASALFVTFCLIAALVMYVTPFQVVAALAGFF  981

Query  363   MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
             M+RHPRFR++LPS P+NFFRRLP+RTD ML
Sbjct  982   MMRHPRFRNRLPSAPINFFRRLPSRTDSML  1011



>ref|XP_010672799.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Beta vulgaris subsp. vulgaris]
 ref|XP_010672802.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Beta vulgaris subsp. vulgaris]
Length=1007

 Score =   258 bits (659),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  723   YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
             Y+FLIG+W YR+RPR PPHM+ +IS AD + PDELDEEFDTFPTS+ P++VRMRYDRLRS
Sbjct  858   YMFLIGVWNYRYRPRYPPHMNIKISQADTSLPDELDEEFDTFPTSKSPELVRMRYDRLRS  917

Query  543   IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
             +AGR+QTVVGD+ATQGER Q+LLSWRDPRATA+FV FCLVAAIVLYVTPFQV+A L GFY
Sbjct  918   VAGRMQTVVGDIATQGERFQALLSWRDPRATAIFVTFCLVAAIVLYVTPFQVIAALTGFY  977

Query  363   MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
              +RHPRFR++LPSVP+NFFRRLPARTD ML
Sbjct  978   AMRHPRFRYRLPSVPINFFRRLPARTDSML  1007



>ref|XP_006476597.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Citrus sinensis]
Length=1006

 Score =   258 bits (659),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  723   YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
             Y+FLIGIW YR+RPR PPHM+ +IS A+  HPDELDEEFDTFPTSR P++VRMRYDRLRS
Sbjct  857   YMFLIGIWNYRYRPRYPPHMNIKISQAEAVHPDELDEEFDTFPTSRSPEMVRMRYDRLRS  916

Query  543   IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
             +AGRIQTVVGD+ATQGERLQ+L+SWRDPRATA+F+ FCLVAA+VL++TPFQV+A LAGF+
Sbjct  917   VAGRIQTVVGDVATQGERLQALISWRDPRATAIFITFCLVAALVLFLTPFQVIAALAGFW  976

Query  363   MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
             ++RHPRFR +LPSVP+NFFRRLPARTD ML
Sbjct  977   VMRHPRFRRRLPSVPINFFRRLPARTDSML  1006



>ref|XP_009346959.1| PREDICTED: uncharacterized protein LOC103938656 [Pyrus x bretschneideri]
Length=1008

 Score =   258 bits (659),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = -2

Query  723   YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
             Y+FLIGIW +R+RPR PPHM+TRIS AD  HPDELDEEFDTFPTSR  D+VRMRYDRLRS
Sbjct  859   YMFLIGIWNWRYRPRYPPHMNTRISYADAVHPDELDEEFDTFPTSRGSDIVRMRYDRLRS  918

Query  543   IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
             +AGRIQTVVGD+ATQGERLQ+LLSWRDPRAT L++ FCL+AAIVLYVTPFQV+ LL G Y
Sbjct  919   VAGRIQTVVGDVATQGERLQALLSWRDPRATTLYITFCLMAAIVLYVTPFQVLVLLGGVY  978

Query  363   MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
             ++RHPRFR K+PS P+NFFRRLPARTD ML
Sbjct  979   LMRHPRFRGKMPSAPINFFRRLPARTDSML  1008



>ref|XP_007210407.1| hypothetical protein PRUPE_ppa000781mg [Prunus persica]
 gb|EMJ11606.1| hypothetical protein PRUPE_ppa000781mg [Prunus persica]
Length=1005

 Score =   258 bits (659),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  723   YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
             Y+FLIGIW +R+RPR PPHM+T+IS A+  HPDELDEEFDTFPTSR P++VRMRYDRLRS
Sbjct  856   YMFLIGIWNFRYRPRYPPHMNTKISQAELVHPDELDEEFDTFPTSRNPELVRMRYDRLRS  915

Query  543   IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
             +AGRIQTVVGD+ATQGER Q+LLSWRDPRA+ALFV  CL+AA+V+YVTPFQVVA L GF+
Sbjct  916   VAGRIQTVVGDIATQGERFQALLSWRDPRASALFVTLCLIAALVMYVTPFQVVAALVGFF  975

Query  363   MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
             M+RHPRFRH+LPS P+NFFRRLP+RTD ML
Sbjct  976   MMRHPRFRHRLPSAPINFFRRLPSRTDSML  1005



>gb|KDO76164.1| hypothetical protein CISIN_1g045058mg [Citrus sinensis]
Length=1005

 Score =   258 bits (659),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  723   YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
             Y+FLIGIW YR+RPR PPHM+ +IS A+  HPDELDEEFDTFPTSR P++VRMRYDRLRS
Sbjct  856   YMFLIGIWNYRYRPRYPPHMNIKISQAEAVHPDELDEEFDTFPTSRSPELVRMRYDRLRS  915

Query  543   IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
             +AGRIQTVVGD+ATQGERLQ+L+SWRDPRATA+F+ FCLVAA+VL++TPFQV+A LAGF+
Sbjct  916   VAGRIQTVVGDVATQGERLQALISWRDPRATAIFITFCLVAALVLFLTPFQVIAALAGFW  975

Query  363   MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
             ++RHPRFR +LPSVP+NFFRRLPARTD ML
Sbjct  976   VMRHPRFRRRLPSVPINFFRRLPARTDSML  1005



>ref|XP_003543552.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like isoform X1 [Glycine max]
 ref|XP_006595053.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like isoform X2 [Glycine max]
 gb|KHN30112.1| Multiple C2 and transmembrane domain-containing protein 2 [Glycine 
soja]
Length=775

 Score =   255 bits (652),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 132/150 (88%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFL+GIW +RWRPR+PPHMDTR+S AD AHPDELDEEFDTFPTSR  D+VRMRYDRLRS
Sbjct  626  YLFLVGIWNFRWRPRHPPHMDTRLSHADAAHPDELDEEFDTFPTSRSSDMVRMRYDRLRS  685

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAG++QTVVGDLATQGER  +LLSWRD RAT LFV FC +AA+VLYVTPFQVV LL GFY
Sbjct  686  IAGKVQTVVGDLATQGERFHNLLSWRDTRATTLFVTFCFIAAVVLYVTPFQVVFLLIGFY  745

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFR K PSVP N+F+RLPAR D +L
Sbjct  746  LLRHPRFRQKHPSVPFNYFKRLPARVDSIL  775



>ref|XP_006439584.1| hypothetical protein CICLE_v10023869mg [Citrus clementina]
 gb|ESR52824.1| hypothetical protein CICLE_v10023869mg [Citrus clementina]
Length=1005

 Score =   258 bits (659),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  723   YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
             Y+FLIGIW YR+RPR PPHM+ +IS A+  HPDELDEEFDTFPTSR P++VRMRYDRLRS
Sbjct  856   YMFLIGIWNYRYRPRYPPHMNIKISQAEAVHPDELDEEFDTFPTSRSPELVRMRYDRLRS  915

Query  543   IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
             +AGRIQTVVGD+ATQGERLQ+L+SWRDPRATA+F+ FCLVAA+VL++TPFQV+A LAGF+
Sbjct  916   VAGRIQTVVGDVATQGERLQALISWRDPRATAIFITFCLVAALVLFLTPFQVIAALAGFW  975

Query  363   MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
             ++RHPRFR +LPSVP+NFFRRLPARTD ML
Sbjct  976   VMRHPRFRRRLPSVPINFFRRLPARTDSML  1005



>ref|XP_011015655.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Populus euphratica]
Length=1007

 Score =   258 bits (659),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = -2

Query  723   YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
             Y+FLIG+W Y +RPR PPHM+TRISC+D   PDELDEEFDTFP+ + P+VVR RYDRLRS
Sbjct  858   YMFLIGVWNYHFRPRYPPHMNTRISCSDAVSPDELDEEFDTFPSRQSPEVVRFRYDRLRS  917

Query  543   IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
             +AGRIQTVVGD+ATQGER+Q+LLSWRDPRAT +F+IFCLVAAIVLY TPFQV+ALL GFY
Sbjct  918   VAGRIQTVVGDVATQGERVQALLSWRDPRATTIFLIFCLVAAIVLYATPFQVLALLGGFY  977

Query  363   MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
              +RHPRFRH++PS P+NFFRRLPARTD ML
Sbjct  978   FMRHPRFRHRVPSAPVNFFRRLPARTDSML  1007



>ref|XP_011023361.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Populus euphratica]
Length=1007

 Score =   258 bits (659),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = -2

Query  723   YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
             Y+FLIG+W Y +RPR PPHM+TRISC+D   PDELDEEFDTFP+ + P+VVR RYDRLRS
Sbjct  858   YMFLIGVWNYHFRPRYPPHMNTRISCSDAVSPDELDEEFDTFPSRQSPEVVRFRYDRLRS  917

Query  543   IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
             +AGRIQTVVGD+ATQGER+Q+LLSWRDPRAT +F+IFCLVAAIVLY TPFQV+ALL GFY
Sbjct  918   VAGRIQTVVGDVATQGERVQALLSWRDPRATTIFLIFCLVAAIVLYATPFQVLALLGGFY  977

Query  363   MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
              +RHPRFRH++PS P+NFFRRLPARTD ML
Sbjct  978   FMRHPRFRHRVPSAPVNFFRRLPARTDSML  1007



>gb|KDP43429.1| hypothetical protein JCGZ_16716 [Jatropha curcas]
Length=1030

 Score =   258 bits (659),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  723   YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
             Y+FLIG+W YR+RPR+PPHMDT++S A+  HPDELDEEFDTFPTS+P D+VRMRYDRLRS
Sbjct  881   YMFLIGLWNYRFRPRHPPHMDTKLSWAEAVHPDELDEEFDTFPTSKPHDIVRMRYDRLRS  940

Query  543   IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
             +AGRIQTVVGD+ATQGER  SLLSWRDPRAT+LFV+FCL AA+VLYVTPF+VVAL+AG Y
Sbjct  941   VAGRIQTVVGDIATQGERFGSLLSWRDPRATSLFVMFCLCAAVVLYVTPFRVVALVAGLY  1000

Query  363   MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
              LRHPRFR KLPSVP NFFRRLPA+TD +L
Sbjct  1001  YLRHPRFRSKLPSVPSNFFRRLPAKTDSLL  1030



>ref|XP_004965887.1| PREDICTED: uncharacterized protein LOC101774861 [Setaria italica]
Length=817

 Score =   256 bits (653),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            Y+FLIG+W YR RPR+PPHMDT++S A+ AHPDELDEEFDTFPTSRP DVV MRYDRLRS
Sbjct  668  YMFLIGLWNYRRRPRHPPHMDTKMSWAEAAHPDELDEEFDTFPTSRPQDVVYMRYDRLRS  727

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            +AGRIQTVVGD+ATQGERLQSLLSWRDPRAT LFV+FCL+AA+VLYVTPF+VVAL+AG Y
Sbjct  728  VAGRIQTVVGDMATQGERLQSLLSWRDPRATCLFVLFCLLAAVVLYVTPFRVVALVAGLY  787

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFR ++P+VP NFFRRLP+R D ML
Sbjct  788  VLRHPRFRSRMPAVPSNFFRRLPSRADSML  817



>ref|XP_009596255.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Nicotiana tomentosiformis]
 ref|XP_009596256.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Nicotiana tomentosiformis]
 ref|XP_009596257.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Nicotiana tomentosiformis]
Length=1009

 Score =   258 bits (658),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  723   YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
             Y+ LIG+W Y++RPR PPHM+TRIS AD+ HPDELDEEFDTFPTSR  ++VRMRYDRLRS
Sbjct  860   YMCLIGLWNYQYRPRYPPHMNTRISHADSTHPDELDEEFDTFPTSRSSELVRMRYDRLRS  919

Query  543   IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
             +AGRIQTVVGD+ATQGER+Q+LLSWRDPRAT LF+IFCL+AAIVLY TPFQV  +L+GFY
Sbjct  920   LAGRIQTVVGDVATQGERIQALLSWRDPRATILFIIFCLLAAIVLYATPFQVFGVLSGFY  979

Query  363   MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
              +RHPRFRHKLPS PLNFFRRLPA+TD ML
Sbjct  980   AMRHPRFRHKLPSAPLNFFRRLPAKTDSML  1009



>ref|XP_006348415.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Solanum tuberosum]
Length=768

 Score =   255 bits (651),  Expect = 1e-75, Method: Composition-based stats.
 Identities = 118/150 (79%), Positives = 129/150 (86%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLFLIGIW+YR +PR+PPHMD  IS A    PD+LDEEFDTFPTSR  D VRMRYDRLRS
Sbjct  619  YLFLIGIWHYRLKPRHPPHMDIHISHAHGVFPDDLDEEFDTFPTSRGSDKVRMRYDRLRS  678

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            I GRIQTV+GDLATQGERL SLLSWRDPRA+ALFV FCL AAIV+YVTPFQVVALL G Y
Sbjct  679  IGGRIQTVIGDLATQGERLHSLLSWRDPRASALFVTFCLFAAIVMYVTPFQVVALLIGIY  738

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFRHKLP +  +FF+RLPAR DCML
Sbjct  739  VLRHPRFRHKLPPLSTSFFKRLPARADCML  768



>ref|NP_001058075.1| Os06g0614000 [Oryza sativa Japonica Group]
 dbj|BAD35565.1| anthranilate phosphoribosyltransferase-like protein [Oryza sativa 
Japonica Group]
 dbj|BAD35910.1| anthranilate phosphoribosyltransferase-like protein [Oryza sativa 
Japonica Group]
 dbj|BAF19989.1| Os06g0614000 [Oryza sativa Japonica Group]
Length=632

 Score =   252 bits (643),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            Y+F+IG+W YR RPR+PPHMDT++S A+  HPDELDEEFDTFPTSR  DVV MRYDRLRS
Sbjct  483  YMFMIGLWNYRRRPRHPPHMDTKMSWAEAVHPDELDEEFDTFPTSRQQDVVYMRYDRLRS  542

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            +AGRIQTVVGD+ATQGERLQSLL WRDPRAT LFV+FCLVAA+VLYVTPF+VVAL+AG Y
Sbjct  543  VAGRIQTVVGDMATQGERLQSLLGWRDPRATCLFVVFCLVAAVVLYVTPFRVVALVAGLY  602

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFR +LP+VP NFFRRLP+R D ML
Sbjct  603  LLRHPRFRSRLPAVPSNFFRRLPSRADSML  632



>ref|XP_003546988.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Glycine max]
Length=774

 Score =   255 bits (651),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 132/150 (88%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLF++GIW +RWRPR+PPHMDTR+S AD AHPDELDEEFDTFPTSR  D+VRMRYDRLRS
Sbjct  625  YLFMVGIWNFRWRPRHPPHMDTRLSHADAAHPDELDEEFDTFPTSRSSDMVRMRYDRLRS  684

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAG++QTVVGDLATQGER  +LLSWRD RAT LFV FC +AAIVLYVTPFQVV LL GFY
Sbjct  685  IAGKVQTVVGDLATQGERFHNLLSWRDTRATTLFVTFCFIAAIVLYVTPFQVVFLLIGFY  744

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFR K PSVP N+F+RLPAR D +L
Sbjct  745  VLRHPRFRQKHPSVPFNYFKRLPARVDSIL  774



>ref|XP_009339918.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 [Pyrus x bretschneideri]
Length=1011

 Score =   258 bits (658),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  723   YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
             Y+FLIGIW +R+RPR PPHM+T+IS A+  HPDELDEEFDTFPTS+ P++VRMRYDRLRS
Sbjct  862   YMFLIGIWNFRYRPRYPPHMNTKISQAELVHPDELDEEFDTFPTSKYPELVRMRYDRLRS  921

Query  543   IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
             +AGRIQTVVGD+ATQGER Q+LLSWRDPRA+ALFV FCL+AA+V+YVTPFQVVA LAGF+
Sbjct  922   VAGRIQTVVGDVATQGERFQALLSWRDPRASALFVTFCLIAALVMYVTPFQVVAALAGFF  981

Query  363   MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
             M+RHPRFR++LPS P+NFFRRLP+RTD ML
Sbjct  982   MMRHPRFRNRLPSAPINFFRRLPSRTDSML  1011



>ref|XP_006289911.1| hypothetical protein CARUB_v10003526mg [Capsella rubella]
 gb|EOA22809.1| hypothetical protein CARUB_v10003526mg [Capsella rubella]
Length=1012

 Score =   258 bits (658),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  723   YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
             Y+FLIG+W YR+RPR PPHM+T+IS A+  HPDELDEEFDTFPT+R PD+VR+RYDRLRS
Sbjct  863   YMFLIGLWNYRFRPRYPPHMNTKISQAEAVHPDELDEEFDTFPTTRSPDMVRLRYDRLRS  922

Query  543   IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
             +AGRIQTV+GDLATQGER Q+LLSWRDPRATA+FVIFC +AAIV ++TP Q+V  LAGF+
Sbjct  923   VAGRIQTVIGDLATQGERFQALLSWRDPRATAIFVIFCFLAAIVFFITPIQIVVALAGFF  982

Query  363   MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
             M+RHPRFRH+LPSVP+NFFRRLPARTD ML
Sbjct  983   MMRHPRFRHRLPSVPVNFFRRLPARTDSML  1012



>ref|XP_002298449.2| C2 domain-containing family protein [Populus trichocarpa]
 gb|EEE83254.2| C2 domain-containing family protein [Populus trichocarpa]
Length=1051

 Score =   258 bits (658),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  723   YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
             Y+FLIGIW YR+RPR+PPHMDT++S A+  HPDELDEEFDTFPTS+  D+VRMRYDRLR 
Sbjct  902   YMFLIGIWNYRFRPRHPPHMDTKLSWAEAVHPDELDEEFDTFPTSKSHDIVRMRYDRLRG  961

Query  543   IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
             +AGRIQTVVGD+ATQGER QSLLSWRDPRAT+LF++FCL AA+VLYVTPF+VVAL+AG Y
Sbjct  962   VAGRIQTVVGDIATQGERFQSLLSWRDPRATSLFIVFCLCAAVVLYVTPFRVVALVAGLY  1021

Query  363   MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
              LRHPRFR KLPSVP NFF+RLPARTD +L
Sbjct  1022  YLRHPRFRSKLPSVPSNFFKRLPARTDSLL  1051



>gb|KHN33324.1| Multiple C2 and transmembrane domain-containing protein 1 [Glycine 
soja]
Length=774

 Score =   254 bits (650),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 132/150 (88%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            YLF++GIW +RWRPR+PPHMDTR+S AD AHPDELDEEFDTFPTSR  D+VRMRYDRLRS
Sbjct  625  YLFMVGIWNFRWRPRHPPHMDTRLSHADAAHPDELDEEFDTFPTSRSSDMVRMRYDRLRS  684

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            IAG++QTVVGDLATQGER  +LLSWRD RAT LFV FC +AAIVLYVTPFQVV LL GFY
Sbjct  685  IAGKVQTVVGDLATQGERFHNLLSWRDTRATTLFVTFCFIAAIVLYVTPFQVVFLLIGFY  744

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFR K PSVP N+F+RLPAR D +L
Sbjct  745  VLRHPRFRQKHPSVPFNYFKRLPARVDSIL  774



>ref|XP_011025028.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1 isoform X1 [Populus euphratica]
Length=1052

 Score =   257 bits (657),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  723   YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
             Y+FLIGIW YR+RPR+PPHMDT++S A+  HPDELDEEFDTFPTS+  D+VRMRYDRLR 
Sbjct  903   YMFLIGIWNYRFRPRHPPHMDTKLSWAEAVHPDELDEEFDTFPTSKSHDIVRMRYDRLRG  962

Query  543   IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
             +AGRIQTVVGD+ATQGER QSLLSWRDPRAT+LF++FCL AA+VLYVTPF+VVAL+AG Y
Sbjct  963   VAGRIQTVVGDIATQGERFQSLLSWRDPRATSLFIVFCLCAAVVLYVTPFRVVALVAGLY  1022

Query  363   MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
              LRHPRFR KLPSVP NFF+RLPARTD +L
Sbjct  1023  YLRHPRFRSKLPSVPSNFFKRLPARTDSLL  1052



>ref|XP_009798416.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
1-like [Nicotiana sylvestris]
Length=1009

 Score =   257 bits (656),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  723   YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
             Y+ LIG+W Y++RPR PPHMDTRIS A + HPDELDEEFDTFPTSR  ++VRMRYDRLRS
Sbjct  860   YMCLIGLWNYQYRPRYPPHMDTRISHAVSTHPDELDEEFDTFPTSRSSELVRMRYDRLRS  919

Query  543   IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
             +AGRIQTVVGD+ATQGER+Q+LLSWRDPRAT LF+IFCL+AAIVLY TPFQV A+L+GFY
Sbjct  920   LAGRIQTVVGDMATQGERIQALLSWRDPRATILFIIFCLLAAIVLYSTPFQVFAVLSGFY  979

Query  363   MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
              +RHPRFRHKLPS PLNFFRRLPA+TD ML
Sbjct  980   AMRHPRFRHKLPSAPLNFFRRLPAKTDSML  1009



>gb|KJB36093.1| hypothetical protein B456_006G140900 [Gossypium raimondii]
 gb|KJB36094.1| hypothetical protein B456_006G140900 [Gossypium raimondii]
Length=789

 Score =   254 bits (649),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            Y+FLIG+W YR+RPR+PPHMDT++S A+ AHPDELDEEFDTFPTS+  DV+RMRYDRLRS
Sbjct  640  YMFLIGVWNYRYRPRHPPHMDTKLSWAEVAHPDELDEEFDTFPTSKAQDVIRMRYDRLRS  699

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            +AGRIQTVVGD+ATQGER  +LLSWRDPRAT+LFV+FCLVAA+ LYVTPF+++AL+AG Y
Sbjct  700  VAGRIQTVVGDMATQGERFLALLSWRDPRATSLFVLFCLVAAVALYVTPFKIMALVAGLY  759

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
             LRHPRFR KLPSVP NFFRRLP+R D ML
Sbjct  760  WLRHPRFRSKLPSVPSNFFRRLPSRADSML  789



>ref|XP_011092017.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105172331 
[Sesamum indicum]
Length=1001

 Score =   257 bits (656),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  723   YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
             Y+FLIG+W YR+RP+ PPHM+TR+SCAD  HPDELDEEFDTFPT+R  D+VRMRYDRLRS
Sbjct  852   YMFLIGLWNYRYRPKYPPHMNTRLSCADAVHPDELDEEFDTFPTTRSSDIVRMRYDRLRS  911

Query  543   IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
             +AGRIQTV+GD+A+QGER+Q+LLSWRDPRAT +F+ FC+VAA+VLY  PFQ++ ++AG Y
Sbjct  912   VAGRIQTVIGDIASQGERIQALLSWRDPRATVIFMAFCIVAAVVLYAVPFQLLIVMAGLY  971

Query  363   MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
             ++RHPRFRHKLP VPLNFFRRLPARTD ML
Sbjct  972   VMRHPRFRHKLPPVPLNFFRRLPARTDSML  1001



>ref|XP_002320122.2| hypothetical protein POPTR_0014s07750g [Populus trichocarpa]
 gb|EEE98437.2| hypothetical protein POPTR_0014s07750g [Populus trichocarpa]
Length=1008

 Score =   257 bits (656),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = -2

Query  723   YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
             Y+FLIG+W YR+RPR PPHM+TRIS AD  +PDELDEEFDTFP+ + P++VR RYDRLRS
Sbjct  859   YMFLIGVWNYRFRPRYPPHMNTRISHADAVNPDELDEEFDTFPSRQSPEIVRFRYDRLRS  918

Query  543   IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
             +AGRIQTVVGD+ATQGER+Q+LLSWRDPRAT +F+IFCLV AIVLY TPFQV+ALL GFY
Sbjct  919   VAGRIQTVVGDVATQGERVQALLSWRDPRATTIFLIFCLVVAIVLYATPFQVLALLGGFY  978

Query  363   MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
              +RHPRFRHK PS P+NFFRRLPARTD ML
Sbjct  979   FMRHPRFRHKTPSAPINFFRRLPARTDSML  1008



>ref|XP_008649064.1| PREDICTED: uncharacterized protein LOC103629725 isoform X2 [Zea 
mays]
 gb|AFW76302.1| hypothetical protein ZEAMMB73_250349 [Zea mays]
 gb|AFW76303.1| hypothetical protein ZEAMMB73_250349 [Zea mays]
Length=808

 Score =   254 bits (649),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 136/150 (91%), Gaps = 0/150 (0%)
 Frame = -2

Query  723  YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
            Y+FLIG+W YR RPR+PPHMDT++S A+ AHPDELDEEFDTFPTSRP DVV MRYDRLRS
Sbjct  659  YMFLIGLWNYRRRPRHPPHMDTKMSWAEAAHPDELDEEFDTFPTSRPQDVVYMRYDRLRS  718

Query  543  IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
            +AGRIQTV GD+ATQGERLQSLL WRDPRAT LFV+FCL+AA+VLYVTPF++VAL+AG Y
Sbjct  719  VAGRIQTVAGDMATQGERLQSLLGWRDPRATCLFVVFCLLAAVVLYVTPFRIVALVAGLY  778

Query  363  MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
            +LRHPRFR +LPSVP NFFRRLP+R D ML
Sbjct  779  VLRHPRFRSRLPSVPSNFFRRLPSRADSML  808



>ref|XP_006339547.1| PREDICTED: multiple C2 and transmembrane domain-containing protein 
2-like [Solanum tuberosum]
Length=1009

 Score =   256 bits (655),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = -2

Query  723   YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
             Y+ LIG+W Y++RPR PPHM+ RIS AD+ HPDELDEEFDTFPTSR  D+VRMRYDRLRS
Sbjct  860   YMCLIGLWNYQYRPRYPPHMNIRISHADSTHPDELDEEFDTFPTSRSSDLVRMRYDRLRS  919

Query  543   IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
             +AGRIQTVVGD+ATQGER+Q+LLSWRDPRAT LF+IFCL+AAIVLY TPFQ+ A L+GFY
Sbjct  920   LAGRIQTVVGDVATQGERIQALLSWRDPRATVLFIIFCLLAAIVLYSTPFQIFAGLSGFY  979

Query  363   MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
              +RHPRFRHKLPS PLNFFRRLPA+TD ML
Sbjct  980   AMRHPRFRHKLPSAPLNFFRRLPAQTDSML  1009



>ref|XP_008393597.1| PREDICTED: uncharacterized protein LOC103455751 [Malus domestica]
 ref|XP_008393671.1| PREDICTED: uncharacterized protein LOC103455751 [Malus domestica]
Length=1014

 Score =   256 bits (655),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = -2

Query  723   YLFLIGIWYYRWRPRNPPHMDTRISCADNAHPDELDEEFDTFPTSRPPDVVRMRYDRLRS  544
             Y+FLIGIW +R+RPR PPHM+TRIS AD  HPDELDEEFDTFPT+R  D+VRMRYDRLRS
Sbjct  865   YMFLIGIWNWRYRPRYPPHMNTRISYADAVHPDELDEEFDTFPTTRSSDIVRMRYDRLRS  924

Query  543   IAGRIQTVVGDLATQGERLQSLLSWRDPRATALFVIFCLVAAIVLYVTPFQVVALLAGFY  364
             +AGRIQTVVGD+ATQGERLQ+LL+WRDPRAT L++ FCLVA+IVLYVTPFQV+ LL G Y
Sbjct  925   VAGRIQTVVGDVATQGERLQALLNWRDPRATTLYITFCLVASIVLYVTPFQVLVLLGGVY  984

Query  363   MLRHPRFRHKLPSVPLNFFRRLPARTDCML  274
             ++RHPRFR K+PS P+NFFRRLPARTD ML
Sbjct  985   LMRHPRFRGKMPSAPVNFFRRLPARTDSML  1014



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1287001441440