BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF007J18

Length=778
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAO51842.1|  UDP-glycosyltransferase 85A32                          256   4e-78   Ipomoea batatas [batate]
ref|XP_004237928.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    249   9e-76   Solanum lycopersicum
ref|XP_006363270.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       248   2e-75   Solanum tuberosum [potatoes]
ref|XP_004237929.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    247   6e-75   Solanum lycopersicum
ref|XP_004237927.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    245   6e-74   Solanum lycopersicum
ref|XP_006363269.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       238   4e-71   Solanum tuberosum [potatoes]
ref|XP_004237926.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    237   7e-71   Solanum lycopersicum
dbj|BAG80542.1|  glycosyltransferase                                    236   8e-71   Lycium barbarum [Duke of Argyll's teatree]
ref|XP_010676201.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    236   2e-70   Beta vulgaris subsp. vulgaris [field beet]
gb|KDP41397.1|  hypothetical protein JCGZ_15804                         235   2e-70   Jatropha curcas
ref|XP_010676160.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    234   7e-70   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002323757.2|  hypothetical protein POPTR_0017s07890g             229   8e-70   
gb|KDP41399.1|  hypothetical protein JCGZ_15806                         234   1e-69   Jatropha curcas
ref|XP_004299648.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    234   1e-69   Fragaria vesca subsp. vesca
ref|XP_009592743.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    233   2e-69   Nicotiana tomentosiformis
dbj|BAF75889.1|  glucosyltransferase                                    233   2e-69   Dianthus caryophyllus [carnation]
ref|XP_004299647.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    233   3e-69   Fragaria vesca subsp. vesca
gb|KCW66550.1|  hypothetical protein EUGRSUZ_F00348                     229   4e-69   Eucalyptus grandis [rose gum]
ref|XP_010676190.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    232   5e-69   Beta vulgaris subsp. vulgaris [field beet]
gb|KCW45703.1|  hypothetical protein EUGRSUZ_L005082                    226   6e-69   Eucalyptus grandis [rose gum]
ref|XP_010676178.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    231   1e-68   Beta vulgaris subsp. vulgaris [field beet]
gb|KCW45340.1|  hypothetical protein EUGRSUZ_L00994                     230   1e-68   Eucalyptus grandis [rose gum]
ref|XP_010064219.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    229   2e-68   Eucalyptus grandis [rose gum]
ref|XP_007222658.1|  hypothetical protein PRUPE_ppa004956mg             230   2e-68   Prunus persica
ref|XP_010035387.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    231   2e-68   Eucalyptus grandis [rose gum]
ref|XP_008219457.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       230   2e-68   Prunus mume [ume]
ref|XP_010040275.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    230   2e-68   
gb|KCW44219.1|  hypothetical protein EUGRSUZ_L023571                    222   2e-68   Eucalyptus grandis [rose gum]
ref|XP_010039907.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    230   3e-68   Eucalyptus grandis [rose gum]
ref|XP_008359320.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       230   4e-68   
ref|XP_002285779.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    229   5e-68   Vitis vinifera
ref|XP_007227474.1|  hypothetical protein PRUPE_ppa004968mg             229   6e-68   Prunus persica
sp|F8WKW1.1|UGT2_GARJA  RecName: Full=7-deoxyloganetin glucosyltr...    229   7e-68   Gardenia jasminoides
gb|ABV68925.1|  mandelonitrile glucosyltransferase UGT85A19             229   9e-68   Prunus dulcis [sweet almond]
ref|XP_008219316.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       229   1e-67   Prunus mume [ume]
ref|XP_002285778.2|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    229   1e-67   
ref|XP_008229739.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       229   1e-67   Prunus mume [ume]
ref|XP_010039828.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    228   1e-67   
ref|XP_010676225.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    228   1e-67   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008391482.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       223   2e-67   
ref|XP_010676253.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    228   2e-67   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004305885.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    228   2e-67   Fragaria vesca subsp. vesca
ref|XP_007224069.1|  hypothetical protein PRUPE_ppa015357mg             228   2e-67   Prunus persica
ref|XP_010098617.1|  UDP-glycosyltransferase 85A2                       227   3e-67   
ref|XP_008219460.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       219   3e-67   Prunus mume [ume]
emb|CDP01076.1|  unnamed protein product                                227   3e-67   Coffea canephora [robusta coffee]
ref|XP_011016634.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    227   3e-67   Populus euphratica
ref|XP_007222664.1|  hypothetical protein PRUPE_ppa004979mg             227   4e-67   Prunus persica
ref|XP_011009481.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    227   4e-67   Populus euphratica
ref|XP_008219456.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       227   4e-67   Prunus mume [ume]
ref|XP_009341754.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    227   4e-67   Pyrus x bretschneideri [bai li]
ref|XP_002323758.2|  hypothetical protein POPTR_0017s07930g             227   4e-67   
gb|EYU19973.1|  hypothetical protein MIMGU_mgv1a005383mg                227   5e-67   Erythranthe guttata [common monkey flower]
ref|XP_008229741.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       227   5e-67   Prunus mume [ume]
ref|XP_009341757.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    226   6e-67   Pyrus x bretschneideri [bai li]
ref|XP_009349617.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    226   7e-67   Pyrus x bretschneideri [bai li]
ref|XP_008229740.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       226   9e-67   Prunus mume [ume]
ref|XP_010060017.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    226   1e-66   Eucalyptus grandis [rose gum]
gb|KEH28097.1|  UDP-glucosyltransferase family protein                  226   1e-66   Medicago truncatula
ref|XP_008219459.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       226   1e-66   Prunus mume [ume]
ref|XP_006433960.1|  hypothetical protein CICLE_v10000925mg             226   2e-66   Citrus clementina [clementine]
ref|XP_006472584.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       226   2e-66   Citrus sinensis [apfelsine]
gb|AAB99950.1|  UDP-glucuronosyltransferase                             221   2e-66   Pisum sativum [garden pea]
ref|XP_010676237.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    226   2e-66   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002285770.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    225   2e-66   Vitis vinifera
dbj|BAO51844.1|  UDP-glycosyltransferase 85A28                          225   2e-66   Vitis vinifera
gb|KDP43116.1|  hypothetical protein JCGZ_26649                         216   2e-66   Jatropha curcas
ref|XP_010098615.1|  UDP-glycosyltransferase 85A1                       225   2e-66   Morus notabilis
ref|XP_006433964.1|  hypothetical protein CICLE_v10004031mg             227   3e-66   
ref|XP_007222427.1|  hypothetical protein PRUPE_ppa004909mg             225   3e-66   Prunus persica
ref|XP_008373152.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       224   3e-66   Malus domestica [apple tree]
ref|XP_002263158.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    224   3e-66   Vitis vinifera
ref|XP_008342285.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       219   4e-66   
gb|KCW45705.1|  hypothetical protein EUGRSUZ_L00511                     224   5e-66   Eucalyptus grandis [rose gum]
ref|XP_008219317.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       224   5e-66   Prunus mume [ume]
ref|XP_006373049.1|  hypothetical protein POPTR_0017s079101g            214   5e-66   
ref|XP_003615138.1|  Cytokinin-O-glucosyltransferase                    224   5e-66   Medicago truncatula
gb|KCW66544.1|  hypothetical protein EUGRSUZ_F00340                     223   6e-66   Eucalyptus grandis [rose gum]
gb|EYU19971.1|  hypothetical protein MIMGU_mgv1a024760mg                224   6e-66   Erythranthe guttata [common monkey flower]
ref|XP_010039829.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    224   6e-66   Eucalyptus grandis [rose gum]
ref|XP_008219404.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       221   7e-66   
ref|XP_006472583.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       224   1e-65   Citrus sinensis [apfelsine]
ref|XP_010248035.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    223   1e-65   Nelumbo nucifera [Indian lotus]
ref|XP_010060018.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    223   1e-65   Eucalyptus grandis [rose gum]
ref|XP_010030028.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    223   1e-65   Eucalyptus grandis [rose gum]
dbj|BAG80547.1|  glycosyltransferase                                    223   1e-65   Lycium barbarum [Duke of Argyll's teatree]
ref|XP_002308831.2|  hypothetical protein POPTR_0006s02390g             223   2e-65   Populus trichocarpa [western balsam poplar]
ref|XP_004172439.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       218   2e-65   
ref|XP_010060024.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    223   2e-65   Eucalyptus grandis [rose gum]
ref|XP_004173933.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       213   2e-65   
ref|XP_011467662.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    223   2e-65   Fragaria vesca subsp. vesca
ref|XP_010041627.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    223   2e-65   Eucalyptus grandis [rose gum]
ref|XP_006433963.1|  hypothetical protein CICLE_v10001630mg             219   2e-65   
ref|XP_008219319.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       223   2e-65   Prunus mume [ume]
ref|XP_007042920.1|  UDP-glucosyl transferase 85A2                      223   3e-65   
ref|XP_008219313.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       222   3e-65   Prunus mume [ume]
gb|KCW45338.1|  hypothetical protein EUGRSUZ_L009912                    217   3e-65   Eucalyptus grandis [rose gum]
ref|XP_008219315.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       222   3e-65   
ref|XP_002308829.1|  hypothetical protein POPTR_0006s02310g             222   4e-65   
gb|AFK33787.1|  unknown                                                 222   4e-65   Medicago truncatula
ref|XP_003546715.1|  PREDICTED: UDP-glycosyltransferase 85A3            221   4e-65   Glycine max [soybeans]
gb|KCW56974.1|  hypothetical protein EUGRSUZ_I02647                     221   4e-65   Eucalyptus grandis [rose gum]
ref|XP_010030926.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    228   4e-65   
ref|XP_008229793.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       222   5e-65   
gb|KHN13067.1|  UDP-glycosyltransferase 85A3                            221   5e-65   Glycine soja [wild soybean]
gb|KDP43115.1|  hypothetical protein JCGZ_26648                         221   5e-65   Jatropha curcas
ref|XP_010267412.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    222   5e-65   Nelumbo nucifera [Indian lotus]
ref|XP_007226586.1|  hypothetical protein PRUPE_ppa023851mg             221   6e-65   
ref|XP_008219318.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       221   6e-65   Prunus mume [ume]
ref|XP_009351417.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    212   6e-65   Pyrus x bretschneideri [bai li]
gb|ACJ84649.1|  unknown                                                 221   7e-65   Medicago truncatula
ref|XP_011069754.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    221   8e-65   
ref|XP_007042919.1|  UDP-glycosyltransferase 85A1                       221   8e-65   
ref|XP_011467660.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    221   8e-65   Fragaria vesca subsp. vesca
ref|XP_010030029.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    221   9e-65   Eucalyptus grandis [rose gum]
gb|KCW45699.1|  hypothetical protein EUGRSUZ_L00503                     219   1e-64   Eucalyptus grandis [rose gum]
ref|XP_008224048.1|  PREDICTED: UDP-glycosyltransferase 85A2-like...    221   1e-64   Prunus mume [ume]
ref|XP_008229792.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       221   1e-64   Prunus mume [ume]
ref|XP_002302305.1|  UDP-glucuronosyltransferase family protein         221   1e-64   Populus trichocarpa [western balsam poplar]
ref|XP_004303934.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    221   1e-64   Fragaria vesca subsp. vesca
ref|XP_009341756.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    221   1e-64   Pyrus x bretschneideri [bai li]
ref|XP_007222804.1|  hypothetical protein PRUPE_ppa005043mg             221   1e-64   Prunus persica
ref|XP_010273031.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    220   1e-64   Nelumbo nucifera [Indian lotus]
ref|XP_008229471.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       218   2e-64   Prunus mume [ume]
ref|XP_010039816.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    220   2e-64   Eucalyptus grandis [rose gum]
gb|KCW66540.1|  hypothetical protein EUGRSUZ_F00337                     219   2e-64   Eucalyptus grandis [rose gum]
ref|XP_006388792.1|  hypothetical protein POPTR_0098s002202g            216   2e-64   
dbj|BAF49299.1|  putative glycosyltransferase                           220   2e-64   Clitoria ternatea
ref|XP_004303931.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    220   2e-64   Fragaria vesca subsp. vesca
ref|XP_010060020.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    220   2e-64   Eucalyptus grandis [rose gum]
ref|XP_009377940.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    220   2e-64   
gb|KCW66542.1|  hypothetical protein EUGRSUZ_F00339                     219   2e-64   Eucalyptus grandis [rose gum]
gb|AFJ52992.1|  UDP-glycosyltransferase 1                               220   2e-64   Linum usitatissimum
gb|ABW96222.1|  glucosyltransferase                                     220   3e-64   Linum usitatissimum
ref|XP_008219322.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       219   3e-64   Prunus mume [ume]
gb|AIL51400.1|  glycosyltransferase                                     219   3e-64   Actinidia deliciosa [Chinese gooseberry]
ref|XP_010060016.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    219   3e-64   Eucalyptus grandis [rose gum]
ref|XP_007141198.1|  hypothetical protein PHAVU_008G175300g             219   3e-64   Phaseolus vulgaris [French bean]
ref|XP_007141200.1|  hypothetical protein PHAVU_008G175500g             219   3e-64   Phaseolus vulgaris [French bean]
ref|XP_009349618.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    219   3e-64   Pyrus x bretschneideri [bai li]
ref|XP_008245954.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       219   3e-64   Prunus mume [ume]
ref|XP_007042950.1|  UDP-glycosyltransferase 85A1                       219   4e-64   
ref|XP_009377941.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    219   4e-64   Pyrus x bretschneideri [bai li]
ref|XP_006433961.1|  hypothetical protein CICLE_v10000958mg             219   4e-64   Citrus clementina [clementine]
gb|KDP37429.1|  hypothetical protein JCGZ_07956                         219   4e-64   Jatropha curcas
ref|XP_010060023.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    219   5e-64   Eucalyptus grandis [rose gum]
ref|XP_011467653.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    218   5e-64   Fragaria vesca subsp. vesca
ref|XP_009349615.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    219   5e-64   Pyrus x bretschneideri [bai li]
ref|XP_009350671.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    219   5e-64   Pyrus x bretschneideri [bai li]
ref|XP_010064217.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    219   5e-64   Eucalyptus grandis [rose gum]
ref|XP_007141191.1|  hypothetical protein PHAVU_008G174700g             219   5e-64   Phaseolus vulgaris [French bean]
ref|XP_003618644.1|  Cytokinin-O-glucosyltransferase                    219   6e-64   Medicago truncatula
gb|KJB59011.1|  hypothetical protein B456_009G235700                    219   6e-64   Gossypium raimondii
gb|AFJ52993.1|  UDP-glycosyltransferase 1                               219   6e-64   Linum usitatissimum
ref|XP_011014886.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    219   7e-64   Populus euphratica
gb|KHN34757.1|  UDP-glycosyltransferase 85A2                            218   8e-64   Glycine soja [wild soybean]
gb|AFK37311.1|  unknown                                                 218   8e-64   Medicago truncatula
ref|XP_002525851.1|  UDP-glucuronosyltransferase, putative              218   8e-64   Ricinus communis
ref|XP_008229788.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       218   9e-64   
ref|XP_008229795.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       218   1e-63   Prunus mume [ume]
ref|XP_004303932.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    218   1e-63   Fragaria vesca subsp. vesca
gb|KCW66541.1|  hypothetical protein EUGRSUZ_F00338                     218   1e-63   Eucalyptus grandis [rose gum]
ref|XP_002447939.1|  hypothetical protein SORBIDRAFT_06g018460          218   1e-63   Sorghum bicolor [broomcorn]
ref|XP_011087901.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    218   1e-63   Sesamum indicum [beniseed]
ref|XP_004305879.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    219   1e-63   Fragaria vesca subsp. vesca
ref|XP_007225655.1|  hypothetical protein PRUPE_ppa004945mg             218   1e-63   Prunus persica
ref|XP_010056400.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    218   2e-63   Eucalyptus grandis [rose gum]
ref|XP_011100190.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    218   2e-63   Sesamum indicum [beniseed]
ref|XP_009349616.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    218   2e-63   Pyrus x bretschneideri [bai li]
ref|XP_002271368.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    218   2e-63   Vitis vinifera
gb|KCW45698.1|  hypothetical protein EUGRSUZ_L00502                     217   2e-63   Eucalyptus grandis [rose gum]
ref|XP_010040274.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    217   2e-63   Eucalyptus grandis [rose gum]
gb|AFJ52995.1|  UDP-glycosyltransferase 1                               217   2e-63   Linum usitatissimum
ref|XP_003542333.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       217   2e-63   Glycine max [soybeans]
ref|XP_008229743.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       218   2e-63   Prunus mume [ume]
ref|XP_011009478.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    217   3e-63   Populus euphratica
ref|XP_004299645.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    217   3e-63   Fragaria vesca subsp. vesca
ref|NP_001277168.1|  UDP-glycosyltransferase 85A2-like                  217   3e-63   Vitis vinifera
ref|XP_010094135.1|  UDP-glycosyltransferase 85A2                       214   3e-63   
gb|KCW73113.1|  hypothetical protein EUGRSUZ_E01564                     216   3e-63   Eucalyptus grandis [rose gum]
ref|XP_002323976.2|  hypothetical protein POPTR_0017s07920g             217   3e-63   
gb|EPS71307.1|  hypothetical protein M569_03453                         212   3e-63   Genlisea aurea
ref|XP_010056397.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    217   3e-63   Eucalyptus grandis [rose gum]
ref|XP_008373154.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       217   3e-63   
ref|XP_008378324.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       217   3e-63   
ref|XP_008779905.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       216   3e-63   Phoenix dactylifera
ref|XP_008229476.1|  PREDICTED: UDP-glycosyltransferase 85A5-like...    217   3e-63   
ref|XP_003618663.1|  Cytokinin-O-glucosyltransferase                    217   4e-63   Medicago truncatula
ref|XP_008229475.1|  PREDICTED: UDP-glycosyltransferase 85A5-like...    216   4e-63   Prunus mume [ume]
dbj|BAD93690.1|  glycosyltransferase                                    216   4e-63   Nicotiana tabacum [American tobacco]
emb|CDY21357.1|  BnaA09g30700D                                          211   4e-63   Brassica napus [oilseed rape]
ref|XP_002323978.2|  hypothetical protein POPTR_0017s07940g             216   5e-63   Populus trichocarpa [western balsam poplar]
emb|CAN60444.1|  hypothetical protein VITISV_032467                     216   5e-63   Vitis vinifera
ref|XP_008357979.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       216   5e-63   
ref|XP_008229473.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       216   6e-63   
ref|XP_010056398.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    216   6e-63   Eucalyptus grandis [rose gum]
ref|XP_008380092.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       214   6e-63   
ref|XP_004303929.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    217   7e-63   Fragaria vesca subsp. vesca
ref|XP_006366314.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       216   7e-63   Solanum tuberosum [potatoes]
ref|XP_002525852.1|  UDP-glucuronosyltransferase, putative              215   9e-63   
ref|XP_009377931.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    216   9e-63   Pyrus x bretschneideri [bai li]
ref|XP_004299646.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    216   9e-63   Fragaria vesca subsp. vesca
ref|XP_004303933.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    216   9e-63   Fragaria vesca subsp. vesca
ref|XP_002530115.1|  UDP-glucuronosyltransferase, putative              216   1e-62   Ricinus communis
ref|XP_009612691.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    216   1e-62   Nicotiana tomentosiformis
ref|XP_009377935.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    215   1e-62   Pyrus x bretschneideri [bai li]
ref|XP_008219468.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       218   1e-62   Prunus mume [ume]
ref|XP_002298702.2|  hypothetical protein POPTR_0001s32000g             215   1e-62   Populus trichocarpa [western balsam poplar]
ref|XP_002308830.2|  hypothetical protein POPTR_0006s02380g             215   1e-62   Populus trichocarpa [western balsam poplar]
ref|XP_002307922.1|  hypothetical protein POPTR_0006s02450g             215   1e-62   Populus trichocarpa [western balsam poplar]
ref|XP_004237925.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    215   1e-62   Solanum lycopersicum
ref|XP_007047908.1|  UDP-glucosyl transferase 85A2                      215   1e-62   
ref|XP_011008538.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    215   1e-62   Populus euphratica
gb|EYU18463.1|  hypothetical protein MIMGU_mgv1a005662mg                215   1e-62   Erythranthe guttata [common monkey flower]
ref|XP_009612740.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    215   2e-62   Nicotiana tomentosiformis
dbj|BAO51838.1|  UDP-glycosyltransferase 85A36                          215   2e-62   Humulus lupulus [common hop]
gb|AFJ52994.1|  UDP-glycosyltransferase 1                               214   2e-62   Linum usitatissimum
ref|XP_009590778.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    215   2e-62   Nicotiana tomentosiformis
gb|AFK38894.1|  unknown                                                 215   2e-62   Medicago truncatula
ref|XP_009791953.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    215   2e-62   Nicotiana sylvestris
gb|KCW66555.1|  hypothetical protein EUGRSUZ_F00353                     214   2e-62   Eucalyptus grandis [rose gum]
dbj|BAO51841.1|  UDP-glycosyltransferase 85A35                          215   2e-62   Humulus lupulus [common hop]
ref|XP_002323974.2|  hypothetical protein POPTR_0017s07880g             214   2e-62   Populus trichocarpa [western balsam poplar]
ref|XP_011010110.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    212   2e-62   Populus euphratica
ref|XP_008455179.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       214   2e-62   Cucumis melo [Oriental melon]
ref|XP_011008539.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    213   2e-62   Populus euphratica
ref|XP_002323977.2|  hypothetical protein POPTR_0017s07900g             214   2e-62   
emb|CDO97432.1|  unnamed protein product                                214   2e-62   Coffea canephora [robusta coffee]
ref|XP_002307921.2|  hypothetical protein POPTR_0006s02440g             213   3e-62   
gb|KEH17174.1|  UDP-glucosyltransferase family protein                  214   3e-62   Medicago truncatula
ref|XP_011045673.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    214   3e-62   Populus euphratica
ref|XP_002268162.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    214   3e-62   Vitis vinifera
ref|XP_006373648.1|  hypothetical protein POPTR_0016s021501g            209   4e-62   
ref|XP_011014888.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    214   4e-62   Populus euphratica
dbj|BAG80552.1|  UDP-glucose:glucosyltransferase                        214   4e-62   Lycium barbarum [Duke of Argyll's teatree]
ref|XP_004300654.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    214   5e-62   Fragaria vesca subsp. vesca
ref|XP_008466222.1|  PREDICTED: UDP-glycosyltransferase 85A2            214   5e-62   Cucumis melo [Oriental melon]
gb|KFK44331.1|  hypothetical protein AALP_AA1G244300                    214   5e-62   Arabis alpina [alpine rockcress]
ref|XP_004136879.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       214   5e-62   
emb|CDO97427.1|  unnamed protein product                                210   5e-62   Coffea canephora [robusta coffee]
ref|XP_009377942.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    213   6e-62   Pyrus x bretschneideri [bai li]
ref|XP_004136284.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       213   6e-62   Cucumis sativus [cucumbers]
ref|XP_011014887.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    213   6e-62   Populus euphratica
ref|XP_011045674.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    214   6e-62   Populus euphratica
ref|XP_006307366.1|  hypothetical protein CARUB_v10008992mg             213   6e-62   Capsella rubella
ref|XP_002454243.1|  hypothetical protein SORBIDRAFT_04g027420          213   6e-62   Sorghum bicolor [broomcorn]
ref|XP_002525850.1|  UDP-glucuronosyltransferase, putative              213   7e-62   
ref|XP_002308828.2|  hypothetical protein POPTR_0006s02330g             213   7e-62   Populus trichocarpa [western balsam poplar]
ref|XP_009341609.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    213   7e-62   Pyrus x bretschneideri [bai li]
ref|XP_009350108.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    213   7e-62   Pyrus x bretschneideri [bai li]
ref|XP_006363268.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       213   7e-62   
gb|KEH19454.1|  UDP-glucosyltransferase family protein                  213   7e-62   Medicago truncatula
dbj|BAO51839.1|  UDP-glycosyltransferase 85A34                          213   8e-62   Humulus lupulus [common hop]
ref|XP_008391275.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       213   9e-62   Malus domestica [apple tree]
ref|XP_011014733.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    213   9e-62   Populus euphratica
gb|EYU39132.1|  hypothetical protein MIMGU_mgv1a025300mg                208   9e-62   Erythranthe guttata [common monkey flower]
ref|XP_010320181.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    213   9e-62   Solanum lycopersicum
ref|XP_008229481.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       213   1e-61   Prunus mume [ume]
ref|XP_008789349.1|  PREDICTED: UDP-glycosyltransferase 85A2-like...    213   1e-61   
gb|KCW66548.1|  hypothetical protein EUGRSUZ_F003462                    208   1e-61   Eucalyptus grandis [rose gum]
gb|EAY87581.1|  hypothetical protein OsI_08991                          213   1e-61   Oryza sativa Indica Group [Indian rice]
ref|XP_009103241.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       213   1e-61   Brassica rapa
ref|XP_008789350.1|  PREDICTED: UDP-glycosyltransferase 85A2-like...    213   1e-61   Phoenix dactylifera
ref|XP_011008547.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    213   1e-61   Populus euphratica
ref|XP_006373650.1|  hypothetical protein POPTR_0016s021702g            202   1e-61   
ref|XP_009145352.1|  PREDICTED: UDP-glycosyltransferase 85A7 isof...    211   1e-61   Brassica rapa
ref|XP_008378325.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       213   2e-61   
gb|EYU18464.1|  hypothetical protein MIMGU_mgv1a005689mg                212   2e-61   Erythranthe guttata [common monkey flower]
gb|KJB79645.1|  hypothetical protein B456_013G060500                    212   2e-61   Gossypium raimondii
ref|XP_008224051.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       212   2e-61   Prunus mume [ume]
ref|XP_008789348.1|  PREDICTED: UDP-glycosyltransferase 85A2-like...    212   2e-61   Phoenix dactylifera
ref|XP_006388605.1|  hypothetical protein POPTR_0140s002101g            205   2e-61   
ref|XP_011009482.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    212   2e-61   Populus euphratica
gb|KCW45700.1|  hypothetical protein EUGRSUZ_L005042                    204   2e-61   Eucalyptus grandis [rose gum]
ref|NP_001048165.1|  Os02g0755900                                       212   2e-61   
ref|XP_006380939.1|  hypothetical protein POPTR_0006s02350g             212   2e-61   Populus trichocarpa [western balsam poplar]
ref|XP_002513937.1|  UDP-glucuronosyltransferase, putative              212   2e-61   Ricinus communis
gb|AAF87254.1|AC068562_1  Strong similarity to UDP-glucose glucos...    202   2e-61   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001148091.1|  cytokinin-O-glucosyltransferase 2                  212   3e-61   
ref|XP_008375649.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       212   3e-61   
ref|XP_004489448.1|  PREDICTED: UDP-glycosyltransferase 85A7-like...    212   3e-61   
ref|XP_008804762.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       211   3e-61   
emb|CDO97426.1|  unnamed protein product                                212   3e-61   
ref|XP_006360268.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       212   3e-61   
ref|XP_003635298.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    211   3e-61   
ref|XP_010025429.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    211   3e-61   
gb|KCW62086.1|  hypothetical protein EUGRSUZ_H04754                     211   3e-61   
ref|XP_009145349.1|  PREDICTED: UDP-glycosyltransferase 85A7 isof...    211   3e-61   
gb|KGN43734.1|  hypothetical protein Csa_7G063980                       212   3e-61   
ref|XP_010646820.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    211   3e-61   
ref|XP_004489451.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       211   3e-61   
gb|KFK44336.1|  hypothetical protein AALP_AA1G244800                    211   3e-61   
ref|XP_011016624.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    212   4e-61   
gb|KFK44335.1|  hypothetical protein AALP_AA1G244700                    211   4e-61   
ref|XP_002513939.1|  UDP-glucuronosyltransferase, putative              209   4e-61   
ref|XP_008372493.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       211   4e-61   
ref|XP_011462065.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    208   4e-61   
ref|XP_004953968.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       211   4e-61   
ref|XP_010459988.1|  PREDICTED: UDP-glycosyltransferase 85A2            211   4e-61   
gb|KDP40911.1|  hypothetical protein JCGZ_24910                         211   5e-61   
gb|KCW62091.1|  hypothetical protein EUGRSUZ_H04762                     209   5e-61   
ref|XP_008375675.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       211   5e-61   
ref|XP_008380053.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       211   6e-61   
ref|XP_008386293.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       216   6e-61   
gb|KDP41398.1|  hypothetical protein JCGZ_15805                         211   6e-61   
gb|KHN33534.1|  UDP-glycosyltransferase 85A2                            211   6e-61   
gb|EMS66061.1|  UDP-glycosyltransferase 85A2                            207   6e-61   
ref|XP_006366313.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       211   6e-61   
gb|AIS39470.1|  flavonoid UDP-glucosyltransferase 1                     206   7e-61   
ref|XP_011004477.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    210   7e-61   
ref|XP_011004479.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    211   7e-61   
ref|XP_010498706.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       211   7e-61   
ref|XP_011008546.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    210   8e-61   
ref|XP_004489450.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       211   8e-61   
gb|EMT19728.1|  Cytokinin-O-glucosyltransferase 2                       207   8e-61   
dbj|BAB86928.1|  glucosyltransferase-10                                 211   8e-61   
ref|XP_003545683.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       210   8e-61   
ref|XP_007148403.1|  hypothetical protein PHAVU_006G205600g             211   8e-61   
gb|ACU24374.1|  unknown                                                 210   9e-61   
ref|XP_002268637.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    210   9e-61   
ref|XP_004975806.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       211   9e-61   
tpg|DAA37525.1|  TPA: cytokinin-O-glucosyltransferase 2                 211   9e-61   
ref|XP_002322559.2|  hypothetical protein POPTR_0016s02220g             210   9e-61   
ref|XP_009380209.1|  PREDICTED: LOW QUALITY PROTEIN: 7-deoxylogan...    210   1e-60   
ref|XP_007227225.1|  hypothetical protein PRUPE_ppa018697mg             210   1e-60   
ref|XP_004252533.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    210   1e-60   
ref|XP_004305884.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    210   1e-60   
ref|XP_002323187.1|  hypothetical protein POPTR_0016s02180g             210   1e-60   
ref|XP_010025430.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    210   1e-60   
ref|XP_006388804.1|  hypothetical protein POPTR_0098s00310g             210   1e-60   
ref|XP_009377934.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    210   1e-60   
ref|XP_008229477.1|  PREDICTED: UDP-glycosyltransferase 85A5-like...    210   1e-60   
ref|XP_003579567.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    210   1e-60   
ref|XP_010027304.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    210   1e-60   
ref|XP_008386105.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       210   2e-60   
gb|KFK44329.1|  hypothetical protein AALP_AA1G244100                    210   2e-60   
emb|CDY62992.1|  BnaC07g48400D                                          210   2e-60   
gb|KJB79644.1|  hypothetical protein B456_013G060400                    209   2e-60   
gb|AFW64426.1|  hypothetical protein ZEAMMB73_179381                    209   2e-60   
gb|AFW64425.1|  cytokinin-O-glucosyltransferase 2                       209   2e-60   
ref|XP_007047907.1|  UDP-glucosyl transferase 85A2                      209   2e-60   
ref|XP_006853212.1|  hypothetical protein AMTR_s00038p00215430          201   2e-60   
gb|KDO58793.1|  hypothetical protein CISIN_1g022321mg                   204   2e-60   
ref|XP_008808008.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       209   2e-60   
ref|XP_004154178.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       203   2e-60   
ref|XP_010521179.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       209   2e-60   
ref|XP_010937418.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    209   2e-60   
ref|XP_008455196.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       209   2e-60   
ref|XP_009145346.1|  PREDICTED: UDP-glycosyltransferase 85A2 isof...    209   2e-60   
ref|XP_004489449.1|  PREDICTED: UDP-glycosyltransferase 85A7-like...    209   2e-60   
ref|XP_009145347.1|  PREDICTED: UDP-glycosyltransferase 85A2 isof...    209   2e-60   
ref|XP_002301060.1|  hypothetical protein POPTR_0002s09850g             210   2e-60   
ref|XP_008224047.1|  PREDICTED: UDP-glycosyltransferase 85A5-like...    209   2e-60   
gb|KDO60734.1|  hypothetical protein CISIN_1g022329mg                   204   2e-60   
ref|XP_009145345.1|  PREDICTED: UDP-glycosyltransferase 85A2 isof...    209   2e-60   
ref|XP_010025433.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    209   3e-60   
ref|XP_009350672.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    209   3e-60   
ref|NP_001149205.1|  cytokinin-O-glucosyltransferase 2                  208   4e-60   
ref|XP_010025434.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    209   4e-60   
gb|KCW62089.1|  hypothetical protein EUGRSUZ_H04760                     209   4e-60   
dbj|BAO51833.1|  UDP-glycosyltransferase 85K10                          209   4e-60   
gb|KDP33203.1|  hypothetical protein JCGZ_12725                         208   4e-60   
ref|XP_002529831.1|  UDP-glucuronosyltransferase, putative              209   4e-60   
ref|XP_010534080.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       209   4e-60   
ref|XP_009377948.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    209   4e-60   
ref|XP_009350114.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    211   4e-60   
ref|XP_006466242.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       204   4e-60   
ref|XP_010025432.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    208   5e-60   
ref|XP_011468603.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    204   5e-60   
ref|XP_010060021.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    209   5e-60   
ref|XP_010477495.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       208   5e-60   
ref|XP_003618655.1|  UDP-glucuronosyltransferase                        208   5e-60   
ref|XP_009391314.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    208   6e-60   
ref|NP_173655.2|  UDP-glucosyl transferase 85A3                         208   6e-60   
ref|NP_001052946.1|  Os04g0451200                                       208   6e-60   
gb|KEH17949.1|  UDP-glucosyltransferase family protein                  206   6e-60   
gb|KJB79650.1|  hypothetical protein B456_013G060700                    208   7e-60   
ref|XP_008811180.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       208   7e-60   
gb|AFJ53005.1|  UDP-glycosyltransferase 1                               208   7e-60   
ref|NP_001173869.1|  Os04g0326201                                       208   7e-60   
gb|ACF84905.1|  unknown                                                 202   7e-60   
ref|XP_006603934.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       208   8e-60   
ref|XP_010060022.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    208   8e-60   
ref|XP_002322563.2|  hypothetical protein POPTR_0016s02260g             207   8e-60   
ref|XP_009377951.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    208   8e-60   
gb|AHL38933.1|  glycosyltransferase                                     207   9e-60   
ref|XP_002322561.2|  hypothetical protein POPTR_0016s02260g             207   9e-60   
gb|EAY94339.1|  hypothetical protein OsI_16107                          208   1e-59   
ref|XP_008391265.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       207   1e-59   
ref|NP_173653.1|  UDP-glucosyl transferase 85A2                         207   1e-59   
gb|AAL32657.1|  UDP-glucose glucosyltransferase                         207   1e-59   
ref|XP_010910271.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    207   1e-59   
ref|XP_008353653.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       207   1e-59   
ref|XP_008342456.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       207   1e-59   
ref|XP_002322567.2|  hypothetical protein POPTR_0016s02230g             207   1e-59   
gb|KCW62094.1|  hypothetical protein EUGRSUZ_H04766                     207   1e-59   
ref|XP_008342288.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       207   1e-59   
ref|XP_008224046.1|  PREDICTED: UDP-glycosyltransferase 85A3-like...    207   1e-59   
ref|XP_002268845.1|  PREDICTED: 7-deoxyloganetin glucosyltransferase    207   1e-59   
ref|XP_008229791.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       202   1e-59   
gb|AES74874.2|  UDP-glucosyltransferase family protein                  202   1e-59   
ref|XP_002893224.1|  UDP-glucosyl transferase 85A1                      207   1e-59   
ref|XP_007208223.1|  hypothetical protein PRUPE_ppa018343mg             207   1e-59   
ref|XP_006367932.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       207   2e-59   
ref|XP_011467658.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    207   2e-59   
gb|ADG65641.1|  glycosyltransferase                                     207   2e-59   
ref|XP_009377947.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    206   2e-59   
gb|KFK44334.1|  hypothetical protein AALP_AA1G244600                    207   2e-59   
ref|XP_010027305.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    207   2e-59   
gb|KCW45706.1|  hypothetical protein EUGRSUZ_L00512                     206   2e-59   
gb|ACJ84676.1|  unknown                                                 197   2e-59   
ref|XP_006652346.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       207   2e-59   
ref|XP_007207648.1|  hypothetical protein PRUPE_ppa021414mg             206   2e-59   
gb|KDP45149.1|  hypothetical protein JCGZ_19349                         197   2e-59   
ref|XP_009775754.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    207   2e-59   
ref|XP_006853259.1|  hypothetical protein AMTR_s00038p00231120          206   3e-59   
ref|XP_008652961.1|  PREDICTED: UDP-glycosyltransferase 85A2-like...    206   3e-59   
gb|AFK34769.1|  unknown                                                 206   3e-59   
ref|XP_002893221.1|  UDP-glycosyltransferase                            206   3e-59   
ref|XP_003545681.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       206   3e-59   
ref|XP_006366316.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       206   3e-59   
gb|EYU18467.1|  hypothetical protein MIMGU_mgv1a005587mg                206   3e-59   
ref|XP_007151400.1|  hypothetical protein PHAVU_004G043400g             206   3e-59   
ref|XP_007047909.1|  UDP-glucosyl transferase 85A2                      206   3e-59   
ref|XP_006647925.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       206   3e-59   
ref|XP_008229744.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       206   4e-59   
ref|XP_002310425.2|  hypothetical protein POPTR_0007s01610g             205   4e-59   
ref|XP_006853218.1|  hypothetical protein AMTR_s00038p00217680          206   4e-59   
ref|XP_008234165.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       206   4e-59   
ref|XP_002893223.1|  transcription factor/ transferase, transferr...    206   4e-59   
ref|XP_004137056.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       210   5e-59   
gb|EMT00081.1|  Cytokinin-O-glucosyltransferase 2                       197   5e-59   
gb|ACF82011.1|  unknown                                                 202   5e-59   
ref|XP_007148404.1|  hypothetical protein PHAVU_006G205700g             206   5e-59   
ref|XP_002530114.1|  UDP-glucuronosyltransferase, putative              206   5e-59   
ref|XP_002530117.1|  UDP-glucuronosyltransferase, putative              204   6e-59   
emb|CDM82433.1|  unnamed protein product                                199   6e-59   
ref|XP_003526577.1|  PREDICTED: UDP-glycosyltransferase 85A3-like       206   6e-59   
ref|XP_007151403.1|  hypothetical protein PHAVU_004G043600g             204   6e-59   
ref|XP_008234175.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       205   7e-59   
gb|EYU43443.1|  hypothetical protein MIMGU_mgv1a018722mg                205   7e-59   
ref|XP_007148402.1|  hypothetical protein PHAVU_006G205500g             206   7e-59   
dbj|BAJ88498.1|  predicted protein                                      205   7e-59   
ref|XP_008224050.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       205   7e-59   
ref|XP_008652960.1|  PREDICTED: UDP-glycosyltransferase 85A2-like...    206   7e-59   
ref|XP_003555000.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       205   7e-59   
ref|NP_173656.1|  UDP-glycosyltransferase 85A1                          205   7e-59   
emb|CDP21742.1|  unnamed protein product                                200   7e-59   
gb|EMS50281.1|  UDP-glycosyltransferase 85A2                            204   7e-59   
ref|XP_007018744.1|  UDP-glucosyl transferase 85A2                      205   8e-59   
ref|XP_004235065.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    205   8e-59   
gb|EAY73885.1|  hypothetical protein OsI_01767                          205   8e-59   
ref|XP_002893220.1|  UDP-glucuronosyltransferase                        204   9e-59   
ref|XP_004252531.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    205   9e-59   
gb|KFK44619.1|  hypothetical protein AALP_AA1G282400                    202   9e-59   
ref|XP_006304665.1|  hypothetical protein CARUB_v10011877mg             205   1e-58   
ref|XP_010535401.1|  PREDICTED: UDP-glycosyltransferase 85A1-like...    205   1e-58   
ref|XP_002446588.1|  hypothetical protein SORBIDRAFT_06g018490          205   1e-58   
ref|XP_006416207.1|  hypothetical protein EUTSA_v100074990mg            200   1e-58   
ref|XP_002439975.1|  hypothetical protein SORBIDRAFT_09g023700          205   1e-58   
ref|XP_009334337.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    205   1e-58   
ref|XP_010040276.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    206   1e-58   
gb|ADV71371.1|  glycosyltransferase GT14M03                             205   1e-58   
gb|EPS66053.1|  hypothetical protein M569_08723                         205   1e-58   
ref|XP_003570608.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    205   1e-58   
ref|XP_009103240.1|  PREDICTED: UDP-glycosyltransferase 85A1-like       205   1e-58   
ref|XP_002513938.1|  UDP-glucuronosyltransferase, putative              205   1e-58   
ref|XP_011468341.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    204   1e-58   
ref|XP_003618649.1|  Cytokinin-O-glucosyltransferase                    204   1e-58   
emb|CDY38225.1|  BnaC05g17420D                                          204   1e-58   
gb|ACD03240.1|  UDP-glycosyltransferase                                 195   1e-58   
ref|XP_004155441.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    205   1e-58   
gb|EMS53235.1|  UDP-glycosyltransferase 85A2                            204   2e-58   
ref|XP_009351186.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    200   2e-58   
emb|CAH67108.1|  H0818E04.25                                            204   2e-58   
ref|XP_007151395.1|  hypothetical protein PHAVU_004G042900g             204   2e-58   
emb|CDJ26664.1|  unnamed protein product                                204   2e-58   
ref|XP_010066663.1|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    202   2e-58   
ref|XP_002891115.1|  predicted protein                                  204   2e-58   
ref|XP_003598165.1|  Cytokinin-O-glucosyltransferase                    204   2e-58   
ref|XP_010498707.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       204   2e-58   
ref|XP_008455195.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       204   2e-58   
ref|XP_007224375.1|  hypothetical protein PRUPE_ppa021058mg             204   2e-58   
ref|XP_007047910.1|  UDP-glucosyl transferase 85A2                      204   2e-58   
gb|AAR06913.1|  UDP-glycosyltransferase 85A8                            204   2e-58   
gb|KCW64634.1|  hypothetical protein EUGRSUZ_G02217                     204   2e-58   
ref|XP_004489447.1|  PREDICTED: UDP-glycosyltransferase 85A7-like       204   2e-58   
gb|KEH25028.1|  UDP-glucosyltransferase family protein                  204   2e-58   
ref|XP_006466245.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       204   2e-58   
ref|XP_008455233.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       204   2e-58   
ref|XP_009145344.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       204   2e-58   
emb|CDY21360.1|  BnaA09g30670D                                          204   2e-58   
ref|XP_008455190.1|  PREDICTED: UDP-glycosyltransferase 85A5-like...    204   2e-58   
ref|XP_006426368.1|  hypothetical protein CICLE_v10025476mg             204   3e-58   
ref|XP_006304973.1|  hypothetical protein CARUB_v10011467mg             204   3e-58   
ref|XP_004303930.2|  PREDICTED: 7-deoxyloganetin glucosyltransfer...    204   3e-58   
ref|XP_002452527.1|  hypothetical protein SORBIDRAFT_04g027460          204   3e-58   
ref|XP_010477496.1|  PREDICTED: UDP-glycosyltransferase 85A5-like       204   3e-58   
gb|KEH15137.1|  UDP-glucosyltransferase family protein                  195   3e-58   
ref|XP_008219458.1|  PREDICTED: UDP-glycosyltransferase 85A2-like       203   3e-58   



>dbj|BAO51842.1| UDP-glycosyltransferase 85A32 [Ipomoea batatas]
Length=485

 Score =   256 bits (653),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 151/168 (90%), Gaps = 2/168 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLANS+KPFLWIVRPD+VTGE A++PPEF+EETKDRGMLSSWC QEQVL H A+G
Sbjct  315  LEFAWGLANSKKPFLWIVRPDLVTGEAAIIPPEFLEETKDRGMLSSWCSQEQVLNHPAIG  374

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNSTLESIC+GVPMLCWPFFAEQQTNC Y+C+KWGIG EID+NV RDEVEK+V
Sbjct  375  GFLTHNGWNSTLESICSGVPMLCWPFFAEQQTNCHYACSKWGIGKEIDSNVKRDEVEKLV  434

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFIN-HLL  276
            RELME EKG EMK+KAME KKLA EAA T  IGSSH+NI+K IN HLL
Sbjct  435  RELMEGEKGGEMKKKAMEWKKLAEEAA-TSSIGSSHINIDKLINLHLL  481



>ref|XP_004237928.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Solanum 
lycopersicum]
Length=482

 Score =   249 bits (637),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 129/170 (76%), Positives = 149/170 (88%), Gaps = 1/170 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLANS+  FLWI+RPD+V+GE A+LPPEF+EETK+RGML+SWCPQEQVL H A+G
Sbjct  314  IEFAWGLANSEMEFLWIIRPDIVSGEEAILPPEFVEETKERGMLTSWCPQEQVLSHPAIG  373

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNSTLESI NGVPM+CWPFFAEQQTNCW+ CT+WGIGMEIDNNV RDEVE +V
Sbjct  374  GFLTHSGWNSTLESIGNGVPMICWPFFAEQQTNCWFKCTQWGIGMEIDNNVKRDEVESLV  433

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSH  267
            RELM  EKG++MK+KAME KKLA EAA   P GSS+VNI+K IN +LL H
Sbjct  434  RELMVGEKGKDMKKKAMEWKKLAEEAAAK-PAGSSYVNIDKLINEILLKH  482



>ref|XP_006363270.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Solanum tuberosum]
Length=482

 Score =   248 bits (634),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 129/170 (76%), Positives = 148/170 (87%), Gaps = 1/170 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEFAWGLANSQ  FLWI+RPD+V+GE A+LPPEF+EETK+RGML+SWCPQEQVL H A+G
Sbjct  314  VEFAWGLANSQIQFLWIIRPDIVSGEEAILPPEFVEETKERGMLTSWCPQEQVLSHPAIG  373

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNSTLESI NGVPM+CWPFFAEQQTNCW+ CT+WGIGMEIDNNV RDEVE +V
Sbjct  374  GFLTHSGWNSTLESIGNGVPMICWPFFAEQQTNCWFKCTQWGIGMEIDNNVKRDEVESLV  433

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSH  267
            REL+  EKG++MK+KAME KKL  EAA   P GSS+VNI+K IN +LL H
Sbjct  434  RELIVGEKGKDMKKKAMEWKKLTEEAAAK-PTGSSYVNIDKLINEILLKH  482



>ref|XP_004237929.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Solanum 
lycopersicum]
Length=482

 Score =   247 bits (631),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 128/170 (75%), Positives = 147/170 (86%), Gaps = 1/170 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLANSQ  FLWI+RPD+V+GE A+LPPEF+EETK+RGML+SWCPQEQVL H A+G
Sbjct  314  IEFAWGLANSQMEFLWIIRPDIVSGEEAILPPEFVEETKERGMLTSWCPQEQVLSHPAIG  373

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNSTLESI NGVPM+CWPFFAEQQTNCW+ CT+WGIGMEIDNNV RDEVE +V
Sbjct  374  GFLTHSGWNSTLESIGNGVPMICWPFFAEQQTNCWFKCTQWGIGMEIDNNVKRDEVESLV  433

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSH  267
            RELM  EKG++MK+KAME KK A EAA   P GSS+VNI+K IN +L  H
Sbjct  434  RELMVGEKGKDMKKKAMEWKKSAEEAA-AKPTGSSYVNIDKLINEILFKH  482



>ref|XP_004237927.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Solanum 
lycopersicum]
Length=488

 Score =   245 bits (625),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 126/171 (74%), Positives = 145/171 (85%), Gaps = 1/171 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
             EFAWGL NSQ  FLWI+RPD+V+GE A+LPPEF+EETK+RGML+SWCPQEQ+L H A+G
Sbjct  314  TEFAWGLVNSQMEFLWIIRPDIVSGEEAILPPEFVEETKERGMLTSWCPQEQILSHPAIG  373

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNSTLESI NGVPM+CWPFFAEQQTNCW+ CTKWGIGMEIDNNV R EVE +V
Sbjct  374  GFLTHSGWNSTLESIGNGVPMICWPFFAEQQTNCWFKCTKWGIGMEIDNNVKRAEVESLV  433

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHR  264
            RELM  EKG++MK+KAME KK A EAA     GSS+VNI+K IN +LLS +
Sbjct  434  RELMVGEKGKDMKKKAMEWKKSAEEAAAKT-TGSSYVNIDKLINEILLSSK  483



>ref|XP_006363269.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Solanum tuberosum]
Length=485

 Score =   238 bits (606),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 125/170 (74%), Positives = 142/170 (84%), Gaps = 1/170 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
             EFAWGLANSQ  FLWI+RPD V+GE A LP EFMEETK+RGML+SWC QEQVL H A+G
Sbjct  317  TEFAWGLANSQMDFLWIIRPDTVSGEKATLPSEFMEETKERGMLTSWCAQEQVLSHPAIG  376

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNSTLESI NGVPM+CWPFF EQQTNCW+ CT+W IGMEIDNNV RDEVE++V
Sbjct  377  GFLTHSGWNSTLESISNGVPMICWPFFTEQQTNCWFKCTQWRIGMEIDNNVKRDEVERLV  436

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSH  267
            R+LM  EKG++MK+KAME KKLA EAA     GSS+VNI+K IN +LL H
Sbjct  437  RDLMVGEKGKDMKKKAMEWKKLAEEAA-AKSTGSSYVNIDKLINEILLKH  485



>ref|XP_004237926.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Solanum 
lycopersicum]
Length=491

 Score =   237 bits (604),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 125/171 (73%), Positives = 144/171 (84%), Gaps = 1/171 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLANSQ  FLWI+RPD+V GE A+LPPEF+EETK+RGML+SWC QE+VL H A+G
Sbjct  317  IEFAWGLANSQLDFLWIIRPDVVLGEEAILPPEFLEETKERGMLASWCQQEKVLNHPAIG  376

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNSTLESI NGVPM+CWPFFAEQ TNCW+ CTK GIGMEI+NNV RDEVE +V
Sbjct  377  GFLTHSGWNSTLESISNGVPMICWPFFAEQPTNCWFCCTKLGIGMEINNNVKRDEVEALV  436

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHR  264
            RELM  EKG+EMK KA E KKLA EAA   P GSS+VNI+K IN +LL+ +
Sbjct  437  RELMTGEKGKEMKNKATEWKKLAEEAAAK-PAGSSYVNIDKLINEILLAPK  486



>dbj|BAG80542.1| glycosyltransferase [Lycium barbarum]
Length=484

 Score =   236 bits (603),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 121/171 (71%), Positives = 146/171 (85%), Gaps = 1/171 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLANSQ+ FLWI+RPD+V+G+ A+LPPEF+EETK RGML+SWC QE+VL H A+G
Sbjct  313  IEFAWGLANSQQDFLWIIRPDIVSGDEAILPPEFVEETKKRGMLASWCSQEEVLNHPAIG  372

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNSTLESI +GVPM+CWPFFAEQQTNCW+S TKWG+GMEIDNNV RDEVE +V
Sbjct  373  GFLTHSGWNSTLESISSGVPMICWPFFAEQQTNCWFSVTKWGVGMEIDNNVKRDEVESLV  432

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHR  264
            RELM  EKG++MK+K +E K LA E+A     GSS+VNIEK +N +LLS +
Sbjct  433  RELMVGEKGKQMKKKTIEWKNLAQESAKQ-STGSSYVNIEKVVNDILLSSK  482



>ref|XP_010676201.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=482

 Score =   236 bits (601),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 118/166 (71%), Positives = 139/166 (84%), Gaps = 1/166 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLANS +PFLWI RPD+V G+ ++LPPEF+E+TKDRG+++SWC QE+VL HQAVG
Sbjct  314  IEFAWGLANSNQPFLWITRPDLVAGDSSVLPPEFLEKTKDRGLIASWCNQEKVLAHQAVG  373

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNSTLESI NGVPM+CWPFFAEQ TNCW+ C KWGIGMEI+ NV R+EVE+ V
Sbjct  374  GFLTHSGWNSTLESISNGVPMICWPFFAEQHTNCWFCCNKWGIGMEINVNVKRNEVERQV  433

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHL  279
            RE+ME EKG+EMKRKAME K LA EAA T P GSS+ N+   I  L
Sbjct  434  REMMEGEKGKEMKRKAMEWKTLAHEAA-TSPCGSSYSNMNSLIKVL  478



>gb|KDP41397.1| hypothetical protein JCGZ_15804 [Jatropha curcas]
Length=487

 Score =   235 bits (600),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 141/169 (83%), Gaps = 1/169 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLANS K FLW++RPD+V G+ A+LPPEF+  TK+RG L+SWCPQEQVL H ++G
Sbjct  315  IEFAWGLANSNKTFLWVIRPDLVAGDTAVLPPEFVTLTKERGRLASWCPQEQVLSHSSIG  374

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNSTLE IC GVPM+CWPFFAEQQTNC YSC +WGIGMEI+++V  DEVE +V
Sbjct  375  GFLTHSGWNSTLEGICAGVPMICWPFFAEQQTNCRYSCVEWGIGMEINSDVKGDEVEILV  434

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLS  270
            RELME  KG+EMK+KAME KK+A EA  T P GSS  N++KFIN LLLS
Sbjct  435  RELMEGVKGKEMKKKAMEWKKMAEEAI-TCPKGSSFQNLDKFINLLLLS  482



>ref|XP_010676160.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=483

 Score =   234 bits (597),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 114/166 (69%), Positives = 140/166 (84%), Gaps = 1/166 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLANS +PFLWI RPD+V G+ A+LPP+F+EETK+RG+++SWC QE VL H A+G
Sbjct  315  IEFAWGLANSNQPFLWIARPDLVIGDSAVLPPDFLEETKNRGLITSWCDQEHVLAHPAIG  374

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTHCGWNST+E++ NGVP++CWPFFAEQQTNCWYSCTKWGIGMEID NV R EVE+ V
Sbjct  375  GFLTHCGWNSTIETLINGVPIVCWPFFAEQQTNCWYSCTKWGIGMEIDANVKRSEVERQV  434

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHL  279
            RELME E+G+EMKR AM+ KKLA EA   +  GSS+ N+++ I  L
Sbjct  435  RELMEGEQGKEMKRNAMKWKKLAYEAT-AVSTGSSYNNLDEVIKIL  479



>ref|XP_002323757.2| hypothetical protein POPTR_0017s07890g [Populus trichocarpa]
 gb|EEF03890.2| hypothetical protein POPTR_0017s07890g [Populus trichocarpa]
Length=330

 Score =   229 bits (585),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 118/166 (71%), Positives = 139/166 (84%), Gaps = 2/166 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLANS KPFLWI+RPD++ GE AMLPPEF+  TKDR +L SWCPQEQVL H ++G
Sbjct  161  IEFAWGLANSNKPFLWIIRPDLIVGEAAMLPPEFLSVTKDRSLLVSWCPQEQVLKHPSIG  220

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFL+H GWNSTLESIC GVPM+CWPFF EQQTNCW++CTKWGIGMEI+NNV RDEVEK+V
Sbjct  221  GFLSHMGWNSTLESICGGVPMVCWPFFGEQQTNCWFACTKWGIGMEIENNVKRDEVEKLV  280

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHL  279
            RELME EKG++MKRKAME K  A EAA T    +SH N+++ +  L
Sbjct  281  RELMEGEKGKDMKRKAMEWKTKAEEAAWT--GDASHRNLDRLVKVL  324



>gb|KDP41399.1| hypothetical protein JCGZ_15806 [Jatropha curcas]
Length=487

 Score =   234 bits (596),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 141/169 (83%), Gaps = 1/169 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLANS K FLW++RPD+V G+ A+LPPEF+  TK+RG L+SWCPQEQVL H ++G
Sbjct  315  IEFAWGLANSNKTFLWVIRPDLVAGDTAVLPPEFVTLTKERGRLASWCPQEQVLSHSSIG  374

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNSTLE IC GVPM+CWPFFAEQQTNC YSC +WGIGMEI+++V RDEVE +V
Sbjct  375  GFLTHSGWNSTLEGICAGVPMICWPFFAEQQTNCRYSCVEWGIGMEINSDVKRDEVEILV  434

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLS  270
            RELM   KG+EMK+KAME KK+A EA  T P GSS  N++KFINH LLS
Sbjct  435  RELMVGVKGQEMKKKAMEWKKMAEEAI-TCPNGSSFQNLDKFINHHLLS  482



>ref|XP_004299648.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=488

 Score =   234 bits (596),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 115/172 (67%), Positives = 145/172 (84%), Gaps = 1/172 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLANS+K FLW++RPD+V G  A++P EF+EET++R ML++WCPQE+VL H AVG
Sbjct  318  IEFAWGLANSKKTFLWVIRPDLVGGSSAVVPAEFVEETRERSMLATWCPQEEVLRHPAVG  377

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNSTLESIC GVPM+CWPFFAEQQTNC + C +WGIGMEI+ +  RD VE +V
Sbjct  378  GFLTHSGWNSTLESICGGVPMICWPFFAEQQTNCRFCCKEWGIGMEIEGDPKRDYVEGLV  437

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  261
            R+LME E+G+EMK+KA+E K+LAMEAA T P GSS VN++K +N +LL+ RK
Sbjct  438  RKLMEGEEGKEMKKKALEWKRLAMEAA-TGPKGSSFVNLDKMVNQVLLAPRK  488



>ref|XP_009592743.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=483

 Score =   233 bits (595),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 121/170 (71%), Positives = 140/170 (82%), Gaps = 1/170 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLANS+  FLWI+RPD+V GE A+LPPEF+EETKDR ML+SWCPQEQVL H A+G
Sbjct  315  IEFAWGLANSRMEFLWIIRPDIVLGEQAILPPEFVEETKDRAMLASWCPQEQVLSHPAIG  374

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH  WNS LESI  GVPM+CWPFFAEQ TNCW+ CTK GIGMEID+NV RDEV  +V
Sbjct  375  GFLTHGEWNSILESISCGVPMICWPFFAEQPTNCWFCCTKLGIGMEIDSNVKRDEVASLV  434

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSH  267
            RELM  +KG+EMK+KA+E KKLA EAA   P GSS+VNI+K IN + L H
Sbjct  435  RELMAGDKGKEMKKKALEWKKLAEEAAKK-PTGSSYVNIDKIINEISLKH  483



>dbj|BAF75889.1| glucosyltransferase [Dianthus caryophyllus]
Length=498

 Score =   233 bits (595),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/168 (65%), Positives = 142/168 (85%), Gaps = 0/168 (0%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEFAWG+ANS++ FLW++RPD+V+GE +++PPEF+ ET +RGM++SWC QEQVL H +VG
Sbjct  324  VEFAWGIANSKQYFLWVLRPDLVSGENSVIPPEFLSETAERGMITSWCEQEQVLRHASVG  383

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
             FLTHCGWNSTL+++C GVP+LCWPFFAEQQTNCW+ C KWGIGMEID++V RDEVEK V
Sbjct  384  AFLTHCGWNSTLDTVCGGVPVLCWPFFAEQQTNCWFGCRKWGIGMEIDSDVSRDEVEKQV  443

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  273
            RELME EKG EM++ AM+ +KLA +A D    GSS++N +KFI  +L+
Sbjct  444  RELMEGEKGVEMRKNAMQFRKLAEDAVDQTSCGSSYLNFDKFIKQILI  491



>ref|XP_004299647.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=483

 Score =   233 bits (593),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 112/171 (65%), Positives = 143/171 (84%), Gaps = 1/171 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLANS K FLW++RPD+V GE A++PPEF+EETK+R +L++WCPQEQVL H A+G
Sbjct  312  IEFAWGLANSSKTFLWVIRPDLVGGESAVVPPEFVEETKERSLLTTWCPQEQVLNHPAIG  371

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNSTLES+C GVPMLCWPFFAEQQTNC Y C +WGIGMEI+ +V R  +E++V
Sbjct  372  GFLTHSGWNSTLESVCAGVPMLCWPFFAEQQTNCRYCCKEWGIGMEIEGDVHRSNIEELV  431

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHR  264
             +LME E+G+EM++KAME KKLA EAA T P G S ++++K +N +LLS +
Sbjct  432  TKLMEGEEGKEMRKKAMEWKKLAKEAA-TGPNGLSFLDLDKMVNEVLLSKK  481



>gb|KCW66550.1| hypothetical protein EUGRSUZ_F00348 [Eucalyptus grandis]
Length=356

 Score =   229 bits (583),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 112/172 (65%), Positives = 144/172 (84%), Gaps = 2/172 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEFAWGLANS + FLW++RPD+V G+ AMLPP+F+  T++R +L+SWCPQE+VL H AVG
Sbjct  186  VEFAWGLANSGQAFLWVIRPDLVVGDAAMLPPDFLAATRERSLLASWCPQERVLSHSAVG  245

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNST+ESI  GVP++CWPFF +QQTNCWYSC +WGIGMEID+NV R+EVE+ V
Sbjct  246  GFLTHSGWNSTIESIAAGVPVVCWPFFGDQQTNCWYSCQEWGIGMEIDSNVKRNEVERQV  305

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  261
            +ELME EKG+ MKRKAM+ K++A EA  T P GSS +N+++ IN +LLS ++
Sbjct  306  KELMEGEKGKHMKRKAMKWKEMAREA--TRPSGSSFLNLDEVINKVLLSPKR  355



>ref|XP_010676190.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=482

 Score =   232 bits (591),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 139/166 (84%), Gaps = 1/166 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEFAWGLANS +PFLWI RPD+V G+ ++LPPEF+EETKDR +++SWC QE+VL HQA+G
Sbjct  314  VEFAWGLANSNQPFLWITRPDLVAGDSSVLPPEFLEETKDRRLIASWCNQEKVLAHQAIG  373

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
             FLTH GWNSTLESI NGVPM+CWPFFAEQQTNCW+ C KWGIG+EI+ NV R+EVE  V
Sbjct  374  VFLTHSGWNSTLESISNGVPMICWPFFAEQQTNCWFCCKKWGIGIEINVNVKRNEVETQV  433

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHL  279
            RELM+ EKG+EMKRKA+E KKLA EAA + P GSS+ N++  I  L
Sbjct  434  RELMQGEKGKEMKRKAIEWKKLAHEAAAS-PNGSSYSNLDNVIKVL  478



>gb|KCW45703.1| hypothetical protein EUGRSUZ_L005082, partial [Eucalyptus grandis]
Length=303

 Score =   226 bits (577),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 139/164 (85%), Gaps = 2/164 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLANSQKPFLWI+RPD+V  E A+LPPEFMEE   RGML+ WC QE+VL HQA+G
Sbjct  141  IEFAWGLANSQKPFLWIIRPDLVASESAVLPPEFMEEIAGRGMLARWCRQEEVLKHQAIG  200

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNSTLES+C+GVP++CWPFF +QQTNC YSCT+WGIGMEIDN+V RDEVE +V
Sbjct  201  GFLTHSGWNSTLESLCSGVPVICWPFFGDQQTNCLYSCTEWGIGMEIDNDVKRDEVEGLV  260

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFIN  285
            RELME EKG+EM++KAME K  A EA   +P G+S+ N++K I+
Sbjct  261  RELMEGEKGKEMRKKAMEWKAKAEEA--IMPSGTSYNNVDKLIS  302



>ref|XP_010676178.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=484

 Score =   231 bits (589),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 113/166 (68%), Positives = 138/166 (83%), Gaps = 1/166 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLANS +PFLWI+RPD+V G+ A+LPPEF+EETK+RG+++SWC Q+QVL H AVG
Sbjct  318  IEFAWGLANSNQPFLWIIRPDLVIGDSAVLPPEFIEETKNRGLIASWCNQDQVLAHPAVG  377

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTHCGWNS +E++ NG P++CWPFFAEQQTNCW+SC KWGIGMEID NV R EVE+ V
Sbjct  378  GFLTHCGWNSIIETLINGAPIICWPFFAEQQTNCWFSCNKWGIGMEIDVNVKRSEVERQV  437

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHL  279
            RELM+ EKG+EMKRK ME +KL  EA    P GSS+ N++K I  L
Sbjct  438  RELMDGEKGKEMKRKVMEWRKLGHEAT-AAPNGSSYKNLDKVIKVL  482



>gb|KCW45340.1| hypothetical protein EUGRSUZ_L00994 [Eucalyptus grandis]
Length=461

 Score =   230 bits (587),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 112/172 (65%), Positives = 144/172 (84%), Gaps = 2/172 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEFAWGLANS + FLW++RPD+V G+ AMLPP+F+  T++R +L+SWCPQE+VL H AVG
Sbjct  291  VEFAWGLANSGQAFLWVIRPDLVVGDAAMLPPDFLAATRERSLLASWCPQERVLSHSAVG  350

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNST+ESI  GVP++CWPFF +QQTNCWYSC +WGIGMEID++V R+EVE+ V
Sbjct  351  GFLTHSGWNSTIESIAAGVPVVCWPFFGDQQTNCWYSCQEWGIGMEIDSDVKRNEVERQV  410

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  261
            +ELME EKG+ MKRKAME K++A EA  T P GSS +N+++ IN +LLS ++
Sbjct  411  KELMEGEKGKHMKRKAMEWKEMAREA--TRPSGSSFLNLDEVINKVLLSPKR  460



>ref|XP_010064219.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=449

 Score =   229 bits (585),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 112/172 (65%), Positives = 144/172 (84%), Gaps = 2/172 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEFAWGLANS + FLW++RPD+V G+ AMLPP+F+  T++R +L+SWCPQE+VL H AVG
Sbjct  279  VEFAWGLANSGQAFLWVIRPDLVVGDAAMLPPDFLAATRERSLLASWCPQERVLSHSAVG  338

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNST+ESI  GVP++CWPFF +QQTNCWYSC +WGIGMEID+NV R+EVE+ V
Sbjct  339  GFLTHSGWNSTIESIAAGVPVVCWPFFGDQQTNCWYSCQEWGIGMEIDSNVKRNEVERQV  398

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  261
            +ELME EKG+ MKRKAM+ K++A EA  T P GSS +N+++ IN +LLS ++
Sbjct  399  KELMEGEKGKHMKRKAMKWKEMAREA--TRPSGSSFLNLDEVINKVLLSPKR  448



>ref|XP_007222658.1| hypothetical protein PRUPE_ppa004956mg [Prunus persica]
 gb|EMJ23857.1| hypothetical protein PRUPE_ppa004956mg [Prunus persica]
Length=483

 Score =   230 bits (587),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 114/172 (66%), Positives = 141/172 (82%), Gaps = 1/172 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLANS + F W+VRPD+V GE A++PPEFMEETK+RG+L+SWCPQEQVL H AVG
Sbjct  313  IEFAWGLANSNQTFFWVVRPDLVGGEAAVVPPEFMEETKERGLLASWCPQEQVLSHAAVG  372

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNSTLES+C GVPM+CWPFFAEQQTNC + C +WGIGMEI+ +V R+ VE +V
Sbjct  373  GFLTHSGWNSTLESLCGGVPMICWPFFAEQQTNCRFCCREWGIGMEIEGDVKRNYVEGLV  432

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  261
            R+LM  E+G+EM++KA+E KKLA EA  T P G S V ++K +N +LLS R 
Sbjct  433  RKLMAGEEGKEMRKKALEWKKLAKEAT-TGPNGFSFVGLDKLVNQMLLSTRN  483



>ref|XP_010035387.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
 gb|KCW84253.1| hypothetical protein EUGRSUZ_B01109 [Eucalyptus grandis]
Length=488

 Score =   231 bits (588),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 112/172 (65%), Positives = 143/172 (83%), Gaps = 2/172 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEFAWGLANS + FLW++RPD+V G+ AMLPP+F+  T++R +L SWCPQE+VLGH AVG
Sbjct  318  VEFAWGLANSGQAFLWVIRPDLVVGDAAMLPPDFLAATRERSLLVSWCPQERVLGHSAVG  377

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNST+ESI  GVP++CWPFF +QQTNCWYSC +W IGMEID++V R+EVE+ V
Sbjct  378  GFLTHSGWNSTIESIAAGVPVVCWPFFGDQQTNCWYSCQEWRIGMEIDSDVKRNEVERQV  437

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  261
            +ELME EKG++MKRKAME K++A EA  T P G S +N+++ IN +LLS R+
Sbjct  438  KELMEGEKGKQMKRKAMEWKEMAREA--TRPFGPSFLNLDEVINKVLLSPRR  487



>ref|XP_008219457.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=483

 Score =   230 bits (587),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 112/171 (65%), Positives = 144/171 (84%), Gaps = 2/171 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEF+WGLANS+KPFLWI+RP +V GE A++PPEF+EETK+RGML+SWCPQEQVL H A+G
Sbjct  314  VEFSWGLANSKKPFLWIIRPGLVAGETAVVPPEFLEETKERGMLASWCPQEQVLLHSAIG  373

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNSTLE++C GVP++CWPFFAEQQTN  YSCT+WGIG+EID  V RD ++ +V
Sbjct  374  GFLTHSGWNSTLEALCGGVPLICWPFFAEQQTNVRYSCTQWGIGIEIDGEVKRDYIDGLV  433

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHR  264
            R LM+ E+G++M++KA+E KKLA EA  T P GSS++ +E  ++ +LLS R
Sbjct  434  RTLMDGEEGKKMRKKALEWKKLAEEA--TAPKGSSYLALENVVSKVLLSPR  482



>ref|XP_010040275.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=486

 Score =   230 bits (587),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 112/172 (65%), Positives = 144/172 (84%), Gaps = 2/172 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEFAWGLANS + FLW++RPD+V G+ AMLPP+F+  T++R +L+SWCPQE+VL H AVG
Sbjct  316  VEFAWGLANSGQAFLWVIRPDLVVGDAAMLPPDFLAATRERSLLASWCPQERVLSHSAVG  375

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNST+ESI  GVP++CWPFF +QQTNCWYSC +WGIGMEID++V R+EVE+ V
Sbjct  376  GFLTHSGWNSTIESIAAGVPVVCWPFFGDQQTNCWYSCQEWGIGMEIDSDVKRNEVERQV  435

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  261
            +ELME EKG+ MKRKAME K++A EA  T P GSS +N+++ IN +LLS ++
Sbjct  436  KELMEGEKGKHMKRKAMEWKEMAREA--TRPSGSSFLNLDEVINKVLLSPKR  485



>gb|KCW44219.1| hypothetical protein EUGRSUZ_L023571, partial [Eucalyptus grandis]
Length=214

 Score =   222 bits (565),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 140/169 (83%), Gaps = 2/169 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
             EFAWGLANSQKPFLWI+RPD+V  E A+LPPEF+EE   RGML SWC QE+VL H+A+G
Sbjct  46   TEFAWGLANSQKPFLWIIRPDLVASESAVLPPEFVEEIAGRGMLVSWCQQEEVLKHRAIG  105

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNSTLES+C GVP++CWPFFAEQQTNC YSCT+WGIGMEIDN+V RDEVE +V
Sbjct  106  GFLTHSGWNSTLESLCGGVPVICWPFFAEQQTNCRYSCTEWGIGMEIDNDVKRDEVEGLV  165

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLS  270
            RELME EKG+EM++KAME K  A EA   +  G+S+ N++K I+ +L S
Sbjct  166  RELMEGEKGKEMRKKAMEWKAKAEEA--IMLGGTSYNNVDKLISEVLSS  212



>ref|XP_010039907.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
 gb|KCW45644.1| hypothetical protein EUGRSUZ_L00599 [Eucalyptus grandis]
Length=487

 Score =   230 bits (586),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 115/171 (67%), Positives = 143/171 (84%), Gaps = 2/171 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEFAWGLANS + FLW++RPD+V G+ AMLPP+F+  T++R +L SWCPQE+VL H AVG
Sbjct  317  VEFAWGLANSGQAFLWVIRPDLVVGDAAMLPPDFLAATRERSLLVSWCPQERVLSHSAVG  376

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNST+ESI  GVP++CWPFF +QQTNCWYSC +WGIGMEIDNNV R+EVE+ V
Sbjct  377  GFLTHNGWNSTIESIAAGVPVVCWPFFGDQQTNCWYSCQEWGIGMEIDNNVKRNEVERQV  436

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHR  264
            +ELME EKG++MKRKAME K++A EA  T P GSS +N+++ IN +LLS R
Sbjct  437  KELMEGEKGKQMKRKAMEWKEMAREA--TRPSGSSFLNLDEVINKVLLSTR  485



>ref|XP_008359320.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Malus domestica]
Length=484

 Score =   230 bits (586),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 109/172 (63%), Positives = 144/172 (84%), Gaps = 2/172 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLAN +K FLW++RPD+V G+ A++PP+F+EETKDR +L+SWCPQEQVL H A+G
Sbjct  313  IEFAWGLANCKKTFLWVIRPDLVGGDSAVVPPKFLEETKDRSLLASWCPQEQVLSHPAIG  372

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNSTLES+C GVPM+CWPFFAEQQTNC  SC +WGIG+EI+ +V R  VE +V
Sbjct  373  GFLTHSGWNSTLESVCGGVPMICWPFFAEQQTNCRVSCKEWGIGLEIEGDVKRKYVEGLV  432

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  261
            R+LM+ E+G+EM++KA+E KK A EA  + PIG S+V+++K +N +LL+ RK
Sbjct  433  RKLMDGEEGKEMRKKALEWKKSAKEA--SCPIGLSYVDLDKMVNQVLLTPRK  482



>ref|XP_002285779.1| PREDICTED: 7-deoxyloganetin glucosyltransferase isoform X2 [Vitis 
vinifera]
Length=474

 Score =   229 bits (584),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 117/168 (70%), Positives = 140/168 (83%), Gaps = 1/168 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGL+NS++ FLWI+RPD+V+G  A+LPPEF+ ETKDRG+L+SWC QEQVLGH AVG
Sbjct  308  IEFAWGLSNSKQKFLWIIRPDLVSGASAILPPEFLTETKDRGLLASWCSQEQVLGHPAVG  367

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNS LES+C GV M+CWPFFAEQQTNC Y CT+WGIGMEID +V RD+VE++V
Sbjct  368  GFLTHNGWNSILESVCCGVAMICWPFFAEQQTNCRYCCTEWGIGMEIDGDVKRDDVERLV  427

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  273
            RELME EKG EMK+K ME KK+A EA  T P GSS  N+++ I  LLL
Sbjct  428  RELMEGEKGEEMKKKTMEWKKIAHEAT-TAPSGSSFFNLDRMIKQLLL  474



>ref|XP_007227474.1| hypothetical protein PRUPE_ppa004968mg [Prunus persica]
 gb|EMJ28673.1| hypothetical protein PRUPE_ppa004968mg [Prunus persica]
Length=483

 Score =   229 bits (584),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 111/171 (65%), Positives = 144/171 (84%), Gaps = 2/171 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEF+WGLANS+KPFLWI+RP +V GE A++PPEF+EETK+RGML+SWCPQEQVL H A+G
Sbjct  314  VEFSWGLANSKKPFLWIIRPGLVAGETAVVPPEFLEETKERGMLASWCPQEQVLLHSAIG  373

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNSTLE++C GVP++CWPFFAEQQTN  YSCT+WGIG+EID  V RD ++ +V
Sbjct  374  GFLTHSGWNSTLEALCGGVPLICWPFFAEQQTNVRYSCTQWGIGIEIDGEVKRDYIDGLV  433

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHR  264
            R LM+ E+G++M++KA+E KKLA +A  T P GSS++ +E  ++ +LLS R
Sbjct  434  RTLMDGEEGKKMRKKALEWKKLAEDA--TAPKGSSYLALENVVSKVLLSPR  482



>sp|F8WKW1.1|UGT2_GARJA RecName: Full=7-deoxyloganetin glucosyltransferase; AltName: 
Full=Genipin glucosyltransferase; AltName: Full=UDP-glucose 
glucosyltransferase 2; Short=GjUGT2; AltName: Full=UDP-glycosyltransferase 
85A24 [Gardenia jasminoides]
 dbj|BAK55737.1| UDP-glucose glucosyltransferase [Gardenia jasminoides]
Length=481

 Score =   229 bits (583),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 141/167 (84%), Gaps = 1/167 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEFAWGLANS++ FLWI+RPD+V+G+ A+LPPEF+EETKDRG+L+SWCPQEQVL H A+G
Sbjct  314  VEFAWGLANSKQTFLWIIRPDLVSGDSAILPPEFLEETKDRGLLASWCPQEQVLSHPAIG  373

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNSTLESIC+GVPM+CWPFFAEQQTNCW+ CTKW  G+EIDNNV RDEVE +V
Sbjct  374  GFLTHSGWNSTLESICSGVPMICWPFFAEQQTNCWFCCTKWYNGLEIDNNVKRDEVESLV  433

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLL  276
             ELM  EKG +MK+KA+E K  A EAA +   GSS+ N+EK +  LL
Sbjct  434  TELMVGEKGMDMKKKALEWKNKAEEAAKSSG-GSSYSNLEKVVQVLL  479



>gb|ABV68925.1| mandelonitrile glucosyltransferase UGT85A19 [Prunus dulcis]
Length=483

 Score =   229 bits (583),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 111/171 (65%), Positives = 144/171 (84%), Gaps = 2/171 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEF+WGLANS+KPFLWI+RP +V GE A++PPEF+EETK+RGML+SWCPQEQVL H A+G
Sbjct  314  VEFSWGLANSKKPFLWIIRPGLVAGETAVVPPEFLEETKERGMLASWCPQEQVLLHSAIG  373

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNSTLE++C GVP++CWPFFAEQQTN  YSCT+WGIG+EID  V RD ++ +V
Sbjct  374  GFLTHSGWNSTLEALCGGVPLICWPFFAEQQTNVRYSCTQWGIGIEIDGEVKRDYIDGLV  433

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHR  264
            R LM+ E+G++M++KA+E KKLA +A  T P GSS++ +E  ++ +LLS R
Sbjct  434  RTLMDGEEGKKMRKKALEWKKLAEDA--TSPKGSSYLALENVVSKVLLSPR  482



>ref|XP_008219316.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=483

 Score =   229 bits (583),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 110/172 (64%), Positives = 140/172 (81%), Gaps = 1/172 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLANS + F W++RPD+V GE A++PPEFM+ET +RG+L+SWCPQEQVL H AVG
Sbjct  313  IEFAWGLANSNQTFFWVIRPDLVGGEAAVVPPEFMQETNERGLLASWCPQEQVLSHPAVG  372

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNSTLES+C GVPM+CWPFFAEQQ NC + C +WGIGMEI+ +V R+ +E +V
Sbjct  373  GFLTHSGWNSTLESLCGGVPMICWPFFAEQQINCRFCCKEWGIGMEIEGDVKRNYIEGLV  432

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  261
            R+LME E+G+EM++KA+E KKLA EA    P GSS V ++K +N +LLS R 
Sbjct  433  RKLMEGEEGKEMRKKALEWKKLAKEATSG-PNGSSFVGLDKLVNQMLLSRRN  483



>ref|XP_002285778.2| PREDICTED: 7-deoxyloganetin glucosyltransferase isoform X1 [Vitis 
vinifera]
Length=492

 Score =   229 bits (583),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 117/168 (70%), Positives = 140/168 (83%), Gaps = 1/168 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGL+NS++ FLWI+RPD+V+G  A+LPPEF+ ETKDRG+L+SWC QEQVLGH AVG
Sbjct  326  IEFAWGLSNSKQKFLWIIRPDLVSGASAILPPEFLTETKDRGLLASWCSQEQVLGHPAVG  385

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNS LES+C GV M+CWPFFAEQQTNC Y CT+WGIGMEID +V RD+VE++V
Sbjct  386  GFLTHNGWNSILESVCCGVAMICWPFFAEQQTNCRYCCTEWGIGMEIDGDVKRDDVERLV  445

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  273
            RELME EKG EMK+K ME KK+A EA  T P GSS  N+++ I  LLL
Sbjct  446  RELMEGEKGEEMKKKTMEWKKIAHEAT-TAPSGSSFFNLDRMIKQLLL  492



>ref|XP_008229739.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Prunus mume]
Length=490

 Score =   229 bits (583),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 116/168 (69%), Positives = 140/168 (83%), Gaps = 2/168 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEF WGLANS+ PF W++RPD+V GE A+LPPEF+ ETK+RG+L+SWCPQEQVL H +VG
Sbjct  322  VEFGWGLANSKLPFFWVIRPDLVVGESAILPPEFVAETKERGLLASWCPQEQVLNHASVG  381

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNSTLES+  GVPMLCWPFFA+QQT+C+Y+C +WGIGMEIDN+V RDEVEK+V
Sbjct  382  GFLTHSGWNSTLESLTAGVPMLCWPFFADQQTDCYYTCNEWGIGMEIDNDVKRDEVEKLV  441

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  273
            +ELME EKG++MK KAME KKLA EA  T P GSS    +  +N +LL
Sbjct  442  KELMEGEKGKKMKNKAMEWKKLAEEA--TGPHGSSSTGFDNLVNQVLL  487



>ref|XP_010039828.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=490

 Score =   228 bits (582),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 141/167 (84%), Gaps = 2/167 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLANSQKPFLWI+RPD+V  E A+LPPEFMEE   RGML+ WC QE+VL HQA+G
Sbjct  322  IEFAWGLANSQKPFLWIIRPDLVASESAVLPPEFMEEIAGRGMLARWCRQEEVLKHQAIG  381

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNSTLES+C+GVP++CWPFF +QQTNC YSCT+WGIGMEIDN+V RDEVE +V
Sbjct  382  GFLTHSGWNSTLESLCSGVPVICWPFFGDQQTNCLYSCTEWGIGMEIDNDVKRDEVEGLV  441

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLL  276
            RELME EKG+EM++KAME K  A EA   +P G+S+ N++K I+ +L
Sbjct  442  RELMEGEKGKEMRKKAMEWKAKAEEA--IMPSGTSYNNVDKLISEVL  486



>ref|XP_010676225.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=490

 Score =   228 bits (582),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/168 (66%), Positives = 140/168 (83%), Gaps = 2/168 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEFAWGLANS +PFLWIVRPD+VTG+ A+LPP+F+ +TKDRGML+SWC QE+VL H+A  
Sbjct  321  VEFAWGLANSNRPFLWIVRPDIVTGDLAVLPPDFLTKTKDRGMLASWCDQEKVLNHEATA  380

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
             FLTHCGWNS+L++IC G P+LCWPFFAEQQTNCWY C KWG GMEI+ +V RDEVE+ V
Sbjct  381  AFLTHCGWNSSLDTICGGKPVLCWPFFAEQQTNCWYFCNKWGTGMEINKDVKRDEVERQV  440

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  273
            RELME EKG +M+R A++LK+LA +A  T P GSS+ N+E+ ++ + L
Sbjct  441  RELMEGEKGEDMRRNAIKLKRLAEKA--TRPTGSSYNNMEQLMSQVFL  486



>ref|XP_008391482.1| PREDICTED: UDP-glycosyltransferase 85A1-like, partial [Malus 
domestica]
Length=317

 Score =   223 bits (568),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/171 (63%), Positives = 141/171 (82%), Gaps = 1/171 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLAN +K FLW++RPD+V G+  ++PPEF+EETKDR +L+SWCPQEQVL H A+G
Sbjct  147  IEFAWGLANCRKTFLWVIRPDLVGGDSDVVPPEFVEETKDRSLLASWCPQEQVLSHPAIG  206

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFL H GWNSTLES+C GVP++CWPFFAEQQTNC +SC  WGIG+EI+ +V R  VE++V
Sbjct  207  GFLMHSGWNSTLESVCCGVPVICWPFFAEQQTNCRFSCKDWGIGLEIEGDVKRKYVEELV  266

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHR  264
            R+LM+ E+G++M++KA+E KKLA +A  + P GSS VN +K +N +LLS R
Sbjct  267  RKLMDGEEGKQMRKKALEWKKLAKQAI-SGPDGSSFVNFDKMVNQVLLSPR  316



>ref|XP_010676253.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=497

 Score =   228 bits (582),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 139/168 (83%), Gaps = 1/168 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLANS+ PFLWI+RPD+V+G+ A++PPEF+ ETKDRG+++SWC QE VL H ++G
Sbjct  320  IEFAWGLANSKHPFLWILRPDIVSGDSAVIPPEFLAETKDRGLITSWCDQETVLDHASIG  379

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
             FLTHCGWNS L++IC+GVP++CWPFFAEQQTNCW+   KWGIGMEIDNNV R EVEK V
Sbjct  380  AFLTHCGWNSILDTICSGVPVICWPFFAEQQTNCWFISEKWGIGMEIDNNVRRSEVEKQV  439

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  273
            RELME EKG EM RKAME KKLA EAA T P GSS  N +  +N ++L
Sbjct  440  RELMEEEKGGEMTRKAMEWKKLAEEAAAT-PSGSSCSNFDNLVNQVIL  486



>ref|XP_004305885.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=478

 Score =   228 bits (580),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 118/168 (70%), Positives = 139/168 (83%), Gaps = 2/168 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEF WGLANS+ PFLW++RPD+V GE A+LPPEF+ ETK RG+++SWCPQE+VL H +VG
Sbjct  310  VEFGWGLANSKHPFLWVIRPDLVVGESAILPPEFVAETKGRGIIASWCPQEEVLNHPSVG  369

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNST+ES+  GVPMLCWPFFAEQQTNCWY C   GIGMEIDNNV RDEVEK+V
Sbjct  370  GFLTHNGWNSTIESVTAGVPMLCWPFFAEQQTNCWYVCNGLGIGMEIDNNVKRDEVEKLV  429

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  273
            RELME + G EM+ KA  LKKLA EAAD  P GSS+ N++K +N +LL
Sbjct  430  RELMEGQNGEEMRNKANVLKKLAEEAAD--PQGSSYKNLDKVVNQVLL  475



>ref|XP_007224069.1| hypothetical protein PRUPE_ppa015357mg [Prunus persica]
 gb|EMJ25268.1| hypothetical protein PRUPE_ppa015357mg [Prunus persica]
Length=482

 Score =   228 bits (580),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 143/172 (83%), Gaps = 2/172 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLANS + F W++RPD+V G+ A++PPEF+EETK+R +L+ WCPQEQVL H AVG
Sbjct  313  IEFAWGLANSNQTFFWVIRPDLVGGDSAVVPPEFVEETKERSLLAHWCPQEQVLSHPAVG  372

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNST+ES+C GVPM+CWPFFAEQQTNC YS  +WGIGMEI+N+V R+ VE +V
Sbjct  373  GFLTHSGWNSTIESVCAGVPMICWPFFAEQQTNCRYSEKEWGIGMEIENDVKRNYVEGLV  432

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  261
            R+LME E+G++M++KA+E KKLAMEA  T P GSS V ++K IN +LLS R 
Sbjct  433  RKLMEGEEGKDMRKKALEWKKLAMEA--TSPNGSSFVALDKMINQVLLSPRN  482



>ref|XP_010098617.1| UDP-glycosyltransferase 85A2 [Morus notabilis]
 gb|EXB75356.1| UDP-glycosyltransferase 85A2 [Morus notabilis]
Length=471

 Score =   227 bits (579),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEFAWGLANS+K FLW++RPD+V GE A+LPPEF EET +RG L+SWCPQE+VLGH AVG
Sbjct  289  VEFAWGLANSKKEFLWVLRPDLVAGESAVLPPEFSEETSERGFLTSWCPQEKVLGHPAVG  348

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTHCGWNST+ESIC+GVPMLCWPFFAEQQTNCWYSC +WGIGMEID +  R+E+E++V
Sbjct  349  GFLTHCGWNSTIESICSGVPMLCWPFFAEQQTNCWYSCGEWGIGMEIDGDAKREEIERIV  408

Query  416  RELMESEKGREMKRKAMELKKLAME  342
            RELM+ EKGREMKR+  + K+LA E
Sbjct  409  RELMDGEKGREMKRRVEKWKRLAEE  433



>ref|XP_008219460.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Prunus mume]
Length=210

 Score =   219 bits (557),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 106/168 (63%), Positives = 137/168 (82%), Gaps = 1/168 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLANS + F W++RPD+V GE A++PPEFM+ET +RG+L+SWCPQEQVL H AVG
Sbjct  7    IEFAWGLANSNQTFFWVIRPDLVGGEAAVVPPEFMQETNERGLLASWCPQEQVLSHPAVG  66

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNSTLES+C GVPM+CWPFFAEQQ NC + C +WGIGMEI+ +V R+ +E +V
Sbjct  67   GFLTHSGWNSTLESLCGGVPMICWPFFAEQQINCRFCCKEWGIGMEIEGDVKRNYIEGLV  126

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  273
            R+LME E+G+EM++KA+E KKLA EA  T P G S V ++K +N + +
Sbjct  127  RKLMEGEEGKEMRKKALEWKKLAKEAT-TGPNGLSFVGLDKLVNQVCI  173



>emb|CDP01076.1| unnamed protein product [Coffea canephora]
Length=481

 Score =   227 bits (579),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 114/167 (68%), Positives = 139/167 (83%), Gaps = 1/167 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEFAWGL NS++ FLWI+RPD+V+G+ A+LPPEF+EE KDRG+L+SWCPQEQVL H A+G
Sbjct  314  VEFAWGLVNSKQTFLWIIRPDLVSGDSAILPPEFLEEIKDRGLLASWCPQEQVLSHPAIG  373

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNSTLESIC+GVPM+CWPFFAEQQTNCW+ CTKWG G+EIDNNV R+ VE +V
Sbjct  374  GFLTHSGWNSTLESICSGVPMICWPFFAEQQTNCWFCCTKWGNGLEIDNNVKREGVESLV  433

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLL  276
             ELM   KG++MK+KA+E K  A EAA +   GSS+ N+EK +  LL
Sbjct  434  TELMVRGKGKDMKKKALEWKNKAEEAAKSSG-GSSYANLEKVVQVLL  479



>ref|XP_011016634.1| PREDICTED: 7-deoxyloganetin glucosyltransferase [Populus euphratica]
Length=483

 Score =   227 bits (579),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 138/172 (80%), Gaps = 2/172 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
             EFAWGLANS + FLW++RPD+V G+ AMLPPEF+  TK+RG+ SSWC QEQVL H ++G
Sbjct  314  TEFAWGLANSDQTFLWVIRPDLVAGDSAMLPPEFVSATKERGLFSSWCSQEQVLSHPSIG  373

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNST+ESIC GVPM+CWPFFAEQQTNC Y CT+WGIGMEI+++V R EVE +V
Sbjct  374  GFLTHSGWNSTIESICGGVPMICWPFFAEQQTNCRYCCTEWGIGMEINSDVKRGEVESLV  433

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  261
            RELM  +KGREMK+K  ELKK+A EA  +   GSS +N++  IN +LLS R 
Sbjct  434  RELMGGDKGREMKKKTRELKKMAEEAITS--TGSSCMNLDDMINKVLLSPRD  483



>ref|XP_007222664.1| hypothetical protein PRUPE_ppa004979mg [Prunus persica]
 gb|EMJ23863.1| hypothetical protein PRUPE_ppa004979mg [Prunus persica]
Length=483

 Score =   227 bits (579),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 111/172 (65%), Positives = 141/172 (82%), Gaps = 1/172 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EF+WGLANS + F W++RPD+V GE A++PPEFM+ETK+RG+L+SWCPQEQVL H A+G
Sbjct  313  IEFSWGLANSNQTFFWVIRPDLVGGEAAVVPPEFMQETKERGLLASWCPQEQVLSHPAIG  372

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNSTLES+C GVPM+CWPFFAEQ  NC + C +WGIGMEI+ +V R+ VE++V
Sbjct  373  GFLTHSGWNSTLESLCGGVPMICWPFFAEQHANCRFCCKEWGIGMEIEGDVKRNYVEELV  432

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  261
            R+LME E+G+EM+RKA+E KKLA EA  T P G S V +EK +N +LLS R 
Sbjct  433  RKLMEGEEGKEMRRKALEWKKLAKEAT-TGPNGLSFVGLEKLVNQVLLSPRN  483



>ref|XP_011009481.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Populus 
euphratica]
Length=482

 Score =   227 bits (578),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 139/166 (84%), Gaps = 2/166 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLANS KPFLWI+RPD++ GE AMLPPEF+  TKDR +L SWCPQEQ+L H ++G
Sbjct  313  IEFAWGLANSNKPFLWIIRPDLIGGEAAMLPPEFLSATKDRSLLVSWCPQEQILKHPSIG  372

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFL+H GWNSTLESIC GVPM+CWPFF EQQTNCW++CTKWGIGMEI+NNV RDEVEK+V
Sbjct  373  GFLSHMGWNSTLESICGGVPMVCWPFFGEQQTNCWFACTKWGIGMEIENNVKRDEVEKLV  432

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHL  279
            RELME EKG++MKRKAME K  A EAA T    +S+ N+++ +  L
Sbjct  433  RELMEGEKGKDMKRKAMEWKTKAEEAAWT--GDASYRNLDRLVKVL  476



>ref|XP_008219456.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=486

 Score =   227 bits (578),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 111/172 (65%), Positives = 140/172 (81%), Gaps = 1/172 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EF WGLANS K FLW++RPD+V GE A++PPEF+EETK+RG+ +SWCPQEQVL H AVG
Sbjct  314  IEFVWGLANSNKAFLWVIRPDLVCGESAVVPPEFLEETKERGLFASWCPQEQVLSHPAVG  373

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNS+LES+C GVPM+CWPFFAEQQTNC + C +WG+G+EI+ +V R+ +E +V
Sbjct  374  GFLTHSGWNSSLESLCGGVPMICWPFFAEQQTNCRFCCREWGVGIEIEGDVKRNYIEDLV  433

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  261
            R LME EKG+EM++KAME KKLA EAA T P G S + ++  IN +LLS R 
Sbjct  434  RTLMEGEKGKEMRKKAMEWKKLAEEAA-TGPNGLSFLALDNMINRVLLSPRN  484



>ref|XP_009341754.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Pyrus x 
bretschneideri]
Length=485

 Score =   227 bits (578),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 108/172 (63%), Positives = 143/172 (83%), Gaps = 1/172 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLAN +K FLW++RPD+V G+ A++PPEF+EETKDR +L+SWCPQEQVL H A+G
Sbjct  313  IEFAWGLANCKKTFLWVIRPDLVGGDSAVVPPEFVEETKDRSLLASWCPQEQVLSHPAIG  372

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNSTLES+C GVPM+CWPFFAEQQTNC +SC +WGIG+EI+ +V R  VE +V
Sbjct  373  GFLTHSGWNSTLESVCGGVPMICWPFFAEQQTNCRFSCKEWGIGLEIEGDVKRKYVEGLV  432

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  261
            R+LM+ E+G+EM++K++E KK A EA+   P G S V+++K +N +LL+ RK
Sbjct  433  RKLMDGEEGKEMRKKSLEWKKSAKEASSG-PNGLSFVDLDKMVNQVLLTPRK  483



>ref|XP_002323758.2| hypothetical protein POPTR_0017s07930g [Populus trichocarpa]
 gb|EEF03891.2| hypothetical protein POPTR_0017s07930g [Populus trichocarpa]
Length=482

 Score =   227 bits (578),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 138/166 (83%), Gaps = 2/166 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EF+WGLANS KPFLWI+RPD++ GE AMLPPEF+  TKDR +L SWCPQEQVL H ++G
Sbjct  313  IEFSWGLANSNKPFLWIIRPDLIVGEAAMLPPEFLSVTKDRSLLVSWCPQEQVLKHPSIG  372

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GF+ H GWNSTLESIC GVPM+CWPFF EQQTNCW++CTKWGIGMEI+NNV RDEVEK+V
Sbjct  373  GFVNHMGWNSTLESICGGVPMICWPFFGEQQTNCWFACTKWGIGMEIENNVKRDEVEKLV  432

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHL  279
            RELME EKG++MKRKAME K  A EAA T    +SH N+++ +  L
Sbjct  433  RELMEGEKGKDMKRKAMEWKTKAEEAAWT--GDASHRNLDRLVKVL  476



>gb|EYU19973.1| hypothetical protein MIMGU_mgv1a005383mg [Erythranthe guttata]
Length=486

 Score =   227 bits (578),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 109/168 (65%), Positives = 142/168 (85%), Gaps = 4/168 (2%)
 Frame = -3

Query  773  EFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVGG  594
            EFAWGLANS +PFLWI+RP++V+GE A+LP  F++ TK+RGML++WCPQE+VL H +VGG
Sbjct  321  EFAWGLANSMQPFLWIIRPNLVSGEKAVLPDGFLDATKERGMLANWCPQEKVLSHSSVGG  380

Query  593  FLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvvR  414
            FLTH GWNSTLESIC+GVPM+CWPFFAEQQTNCWY CTKWG+GMEID++V R+ VE +V 
Sbjct  381  FLTHSGWNSTLESICSGVPMICWPFFAEQQTNCWYCCTKWGVGMEIDSDVKRNGVETLVT  440

Query  413  ELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLS  270
            +LM  E+GR+M+ KA+E K LA ++A+    GSS+ N++K I+ +LLS
Sbjct  441  KLMVGEEGRQMRNKAVEWKNLARDSAE----GSSYRNLKKLIDQVLLS  484



>ref|XP_008229741.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=485

 Score =   227 bits (578),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 111/168 (66%), Positives = 140/168 (83%), Gaps = 2/168 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEF WGLANS+ PF W++RPD+V GE A+LPPEF+ ETK+RG+++SWCPQEQVL   +VG
Sbjct  318  VEFGWGLANSKLPFFWVIRPDLVVGESAILPPEFVAETKERGLIASWCPQEQVLNDPSVG  377

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNST+ES+C GVPMLCWPFFA+QQTNC+Y C +WGIG+EI+N+V RD+VEK+V
Sbjct  378  GFLTHGGWNSTIESLCAGVPMLCWPFFADQQTNCYYVCNEWGIGLEINNDVKRDQVEKLV  437

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  273
            +ELME EKG++MK K ME KKLA EA  T P GSS  N++  +N ++L
Sbjct  438  KELMEGEKGKKMKNKVMEWKKLAEEA--TSPHGSSSTNLDNLVNQVIL  483



>ref|XP_009341757.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Pyrus x 
bretschneideri]
Length=483

 Score =   226 bits (577),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 108/172 (63%), Positives = 143/172 (83%), Gaps = 1/172 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLAN +K FLW++RPD+V G+ A++PPEF+EETKDR +L+SWCPQEQVL + A+G
Sbjct  313  IEFAWGLANCKKTFLWVIRPDLVGGDSAVIPPEFLEETKDRSLLASWCPQEQVLNNPAIG  372

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNSTLES+C GVP++CWPFFAEQQTNC +SC +WGIG+EI+ +V R  VE +V
Sbjct  373  GFLTHSGWNSTLESVCGGVPIICWPFFAEQQTNCRFSCKEWGIGLEIEGDVKRKYVEGLV  432

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  261
            R+LM+ E+G+EM++KA+E KKLA EA+   P G S V+ +K +N +LLS +K
Sbjct  433  RKLMDGEEGKEMRKKALEWKKLAKEASGG-PNGLSFVDFDKMVNQVLLSQKK  483



>ref|XP_009349617.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Pyrus x 
bretschneideri]
Length=486

 Score =   226 bits (577),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 110/170 (65%), Positives = 140/170 (82%), Gaps = 2/170 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEF WGLANS+ PF W++RPD+V GE  +L P+F  ETK++G+++SWCPQEQVL H +VG
Sbjct  318  VEFGWGLANSKLPFFWVIRPDLVIGESGILSPDFFAETKEKGLIASWCPQEQVLNHPSVG  377

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNST+ES+  GVPMLCWPFFA+QQTNC+Y+C KWGIGMEIDN+V RD V+K++
Sbjct  378  GFLTHSGWNSTMESLTAGVPMLCWPFFADQQTNCYYTCNKWGIGMEIDNDVKRDGVQKLI  437

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSH  267
            +ELME EKG++MK KAME KKLA EA  T P+GSS  N +  +N++LL +
Sbjct  438  KELMEGEKGKKMKNKAMEWKKLAEEA--TGPLGSSSTNFDNLVNNVLLRN  485



>ref|XP_008229740.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=486

 Score =   226 bits (576),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 111/168 (66%), Positives = 139/168 (83%), Gaps = 2/168 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEF WGLANS+ PF W++RPD+V GE A+LPPEF+ ETK+RG+++SWCPQEQVL   +VG
Sbjct  318  VEFGWGLANSKLPFFWVIRPDLVVGESAILPPEFVAETKERGLIASWCPQEQVLNDPSVG  377

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNST+ES+C GVPMLCWPFFA+QQTNC+Y C  WGIG+EI+N+V RD+VEK+V
Sbjct  378  GFLTHGGWNSTIESLCAGVPMLCWPFFADQQTNCYYVCNDWGIGLEINNDVKRDQVEKLV  437

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  273
            +ELME EKG++MK K ME KK+A EA  T P GSS  N++  +N +LL
Sbjct  438  KELMEGEKGKKMKNKVMEWKKIAEEA--TSPHGSSSRNLDNLVNQVLL  483



>ref|XP_010060017.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=486

 Score =   226 bits (576),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 114/172 (66%), Positives = 142/172 (83%), Gaps = 2/172 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEFAWGLA+S + FLW++RPD+V G+ A+LPPEF   T++R +L+SWCPQE+VL H AVG
Sbjct  316  VEFAWGLADSGQTFLWVIRPDLVVGDTAILPPEFSSSTRERSLLASWCPQERVLSHSAVG  375

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNST+ESI  GVPM+CWPFF EQQTNC YSC +WGIGMEID+NV RDEV + V
Sbjct  376  GFLTHSGWNSTIESIAAGVPMVCWPFFGEQQTNCRYSCQEWGIGMEIDSNVKRDEVSRQV  435

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  261
            RELME E+G+EMKRKAME K++A EA  T P GSS +N+++ I+ +LLS R+
Sbjct  436  RELMEGERGKEMKRKAMEWKEMAREA--TRPSGSSCLNLDEVIDKVLLSPRR  485



>gb|KEH28097.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=483

 Score =   226 bits (575),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 110/168 (65%), Positives = 141/168 (84%), Gaps = 2/168 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEFAWGLANS+K FLW++RPD+V+G+ A+LP EF+EETK+RG+LSSWCPQE+VLGH ++G
Sbjct  316  VEFAWGLANSKKTFLWVIRPDLVSGKNAVLPQEFLEETKNRGLLSSWCPQEEVLGHSSIG  375

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNSTLES+C GVPM+CWPFFAEQQTNC + C +WGIG+EI  +  RD++E +V
Sbjct  376  GFLTHSGWNSTLESVCGGVPMICWPFFAEQQTNCRFCCNEWGIGLEI-EDAKRDKIEILV  434

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  273
            +ELME EKG+EMK KA+ LK+LA + A     GSS VN++  I+H+LL
Sbjct  435  KELMEGEKGKEMKEKALRLKELAHDNAYG-AFGSSLVNLDNMIHHVLL  481



>ref|XP_008219459.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=483

 Score =   226 bits (575),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 111/172 (65%), Positives = 140/172 (81%), Gaps = 1/172 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLANS + F W++RPD+V GE A++PPEFM+ETK+RG+L+SWCPQEQVL H AVG
Sbjct  313  IEFAWGLANSNQTFFWVIRPDLVGGEAAVVPPEFMQETKERGLLASWCPQEQVLSHPAVG  372

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNSTLES+C GVPM+CWPFFAEQ  NC + C +WGIGMEI+ +V R+ VE +V
Sbjct  373  GFLTHSGWNSTLESLCGGVPMICWPFFAEQHANCRFCCKEWGIGMEIEGDVKRNYVEGLV  432

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  261
            R+LME E+G+EM++KA+E KKLA EA  T P G S V ++K +N +LLS R 
Sbjct  433  RKLMEGEEGKEMRKKALEWKKLAKEAT-TGPNGLSFVCLDKLVNQVLLSPRN  483



>ref|XP_006433960.1| hypothetical protein CICLE_v10000925mg [Citrus clementina]
 gb|ESR47200.1| hypothetical protein CICLE_v10000925mg [Citrus clementina]
Length=504

 Score =   226 bits (576),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 111/170 (65%), Positives = 139/170 (82%), Gaps = 1/170 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEFAWGLANS++PFLW++RPD+V    A++  EF+EETKDRGML+SWCPQEQ+L H AVG
Sbjct  322  VEFAWGLANSKRPFLWVIRPDIVNEATAVITQEFVEETKDRGMLASWCPQEQILSHPAVG  381

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTHCGWNST+ES+C+GV MLCWPFFAEQQTNCW+  TKWG+G+E++    R E+EK V
Sbjct  382  GFLTHCGWNSTVESLCSGVAMLCWPFFAEQQTNCWFCQTKWGVGIEVNPRGDRVEIEKRV  441

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSH  267
            RELME E G+ MK KA+E K LA +AA   P GSS+VN++  IN +LL++
Sbjct  442  RELMEGESGKLMKEKALEWKLLAEKAAAG-PNGSSYVNLDNLINDVLLTY  490



>ref|XP_006472584.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Citrus sinensis]
Length=503

 Score =   226 bits (576),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 109/170 (64%), Positives = 140/170 (82%), Gaps = 1/170 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEFAWGLANS++PFLW++RPD++    A++  EF+EETKDRGML+SWCPQEQ+L H +VG
Sbjct  322  VEFAWGLANSKRPFLWVIRPDIINEATAVITQEFVEETKDRGMLASWCPQEQILRHPSVG  381

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTHCGWNST+ES+C+GV MLCWPFFAEQQTNCW+  TKWG+G+E++    R ++EK V
Sbjct  382  GFLTHCGWNSTVESLCSGVAMLCWPFFAEQQTNCWFCQTKWGVGIEVNPRADRVDIEKRV  441

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSH  267
            RELME E G+ MK KA+E K LA +AA   P GSS+VN++K IN +LL++
Sbjct  442  RELMEGESGKLMKEKALEWKLLAEKAAAG-PNGSSYVNLDKLINDVLLTY  490



>gb|AAB99950.1| UDP-glucuronosyltransferase [Pisum sativum]
Length=347

 Score =   221 bits (564),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 110/168 (65%), Positives = 138/168 (82%), Gaps = 2/168 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLANS+ PFLW++RPD+V GE ++LP EF+EETK+RGMLSSWCPQE+VL H A+G
Sbjct  182  IEFAWGLANSKIPFLWVIRPDLVAGENSVLPQEFLEETKNRGMLSSWCPQEEVLDHSAIG  241

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNSTLES+C GVPM+CWPFFAEQQTNC + C +WGIG+EI  +  RD++E +V
Sbjct  242  GFLTHSGWNSTLESVCGGVPMICWPFFAEQQTNCRFCCHEWGIGLEI-EDAKRDKIESLV  300

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  273
            +E++E EKG+EMK KA+E KKLA  AA   P GSS +N+EK    +LL
Sbjct  301  KEMVEGEKGKEMKEKALEWKKLAPNAASG-PNGSSFMNLEKMFRDVLL  347



>ref|XP_010676237.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=495

 Score =   226 bits (575),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 138/168 (82%), Gaps = 2/168 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEFAWGLANS  PFLWIVRPD+VTG+ A+LPP+F+ +TKDRGML+SWC QE+VL H+A  
Sbjct  321  VEFAWGLANSNCPFLWIVRPDIVTGDLAVLPPDFLAKTKDRGMLASWCDQEKVLKHEATA  380

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
             FLTHCGWNS+L++IC G P+LCWPFFAEQQTNCWY C KWG GMEI+ +V RDEVE+ V
Sbjct  381  AFLTHCGWNSSLDTICGGKPVLCWPFFAEQQTNCWYFCNKWGTGMEINKDVKRDEVERQV  440

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  273
            RELME EKG +M+R A++LK+LA EAA T P GSS+ N+E   N + L
Sbjct  441  RELMEGEKGADMRRNAVKLKRLA-EAA-TRPTGSSYKNMEHLTNQVFL  486



>ref|XP_002285770.1| PREDICTED: 7-deoxyloganetin glucosyltransferase [Vitis vinifera]
Length=473

 Score =   225 bits (573),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 139/168 (83%), Gaps = 1/168 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLANS + FLWI+RPD+V+GE A+LPPEF+ ET+DRG+L+ WCPQEQVL HQA+G
Sbjct  307  IEFAWGLANSNQSFLWILRPDLVSGESAILPPEFVAETEDRGLLAGWCPQEQVLTHQAIG  366

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNST+E +C GVPM+CWPFFAEQQTNC Y CT+WG+GMEID++V RDEV K+V
Sbjct  367  GFLTHNGWNSTIEGLCAGVPMICWPFFAEQQTNCRYCCTEWGVGMEIDSDVKRDEVAKLV  426

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  273
            RELM  EKG+ MK+K ME K  A E A T P GSS++N+EK    +LL
Sbjct  427  RELMVGEKGKVMKKKTMEWKHRA-EVATTGPDGSSYLNLEKIFEQVLL  473



>dbj|BAO51844.1| UDP-glycosyltransferase 85A28 [Vitis vinifera]
Length=473

 Score =   225 bits (573),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 139/168 (83%), Gaps = 1/168 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLANS + FLWI+RPD+V+GE A+LPPEF+ ET+DRG+L+ WCPQEQVL HQA+G
Sbjct  307  IEFAWGLANSNQSFLWILRPDLVSGESAILPPEFVAETEDRGLLAGWCPQEQVLTHQAIG  366

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNST+E +C GVPM+CWPFFAEQQTNC Y CT+WG+GMEID++V RDEV K+V
Sbjct  367  GFLTHNGWNSTIEGLCAGVPMICWPFFAEQQTNCRYCCTEWGVGMEIDSDVKRDEVAKLV  426

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  273
            RELM  EKG+ MK+K ME K  A E A T P GSS++N+EK    +LL
Sbjct  427  RELMVGEKGKVMKKKTMEWKHRA-EVATTGPDGSSYLNLEKIFEQVLL  473



>gb|KDP43116.1| hypothetical protein JCGZ_26649 [Jatropha curcas]
Length=175

 Score =   216 bits (549),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/169 (63%), Positives = 143/169 (85%), Gaps = 2/169 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EF  GLANS+ PFLWI+RPD+V G+  +LPPEF+E TK+RG+++SWCPQE+VL H ++G
Sbjct  7    IEFGMGLANSKHPFLWIIRPDLVIGDSGILPPEFVEYTKERGLIASWCPQEEVLNHFSIG  66

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTHCGW ST+ES+  GVPMLCWPFFA+Q TNC Y+C +WG+GMEID+NV RDE+EK+V
Sbjct  67   GFLTHCGWGSTIESLSAGVPMLCWPFFADQPTNCRYTCCEWGVGMEIDSNVKRDEIEKLV  126

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLS  270
            RELME EK ++++ +AME +KLA+EA  T P GSS +N++K ++H+LLS
Sbjct  127  RELMEGEKCKKLRNRAMEWRKLAIEA--TSPTGSSSLNLDKLVSHVLLS  173



>ref|XP_010098615.1| UDP-glycosyltransferase 85A1 [Morus notabilis]
 gb|EXB75354.1| UDP-glycosyltransferase 85A1 [Morus notabilis]
Length=481

 Score =   225 bits (573),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 111/171 (65%), Positives = 138/171 (81%), Gaps = 6/171 (4%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEFAWGLANSQK FLWI+RPD+V G+ A++PPEF+ ETKDRG++ SWCPQEQVLGH A+G
Sbjct  315  VEFAWGLANSQKTFLWIIRPDLVVGDAAIVPPEFVSETKDRGLMPSWCPQEQVLGHPAIG  374

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTHCGWNST+ESI  GVP++CWPFFAEQQTNC Y C  WGIGMEI  NV R  +E++V
Sbjct  375  GFLTHCGWNSTIESISCGVPVICWPFFAEQQTNCRYCCRAWGIGMEI-ENVERGNIERLV  433

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHR  264
            R+LM+ EKG+EMK++AME KK   ++     I SS +N++K I  +LL+ R
Sbjct  434  RKLMDGEKGKEMKKRAMEWKKSTEDS-----IASSQLNLDKMIEQVLLAPR  479



>ref|XP_006433964.1| hypothetical protein CICLE_v10004031mg [Citrus clementina]
 gb|ESR47204.1| hypothetical protein CICLE_v10004031mg [Citrus clementina]
Length=561

 Score =   227 bits (578),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 111/170 (65%), Positives = 140/170 (82%), Gaps = 1/170 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEFAWGLANS++PFLW++RPD+V    A++  EF+EETKDRGML+SWCPQEQ+L H AVG
Sbjct  379  VEFAWGLANSKRPFLWVIRPDIVNEATAVITQEFVEETKDRGMLASWCPQEQILRHPAVG  438

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTHCGWNST+ES+C+GV MLCWPFFAEQQTNCW+  TKWG+G+E++    R E+EK V
Sbjct  439  GFLTHCGWNSTVESLCSGVAMLCWPFFAEQQTNCWFCQTKWGVGIEVNPRADRVEIEKRV  498

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSH  267
            RELME + G+ MK KA+E K LA +AA   P GSS+VN++K IN +LL++
Sbjct  499  RELMEGDSGKLMKEKALEWKLLAEKAAAG-PNGSSYVNLDKLINDVLLTY  547



>ref|XP_007222427.1| hypothetical protein PRUPE_ppa004909mg [Prunus persica]
 gb|EMJ23626.1| hypothetical protein PRUPE_ppa004909mg [Prunus persica]
Length=486

 Score =   225 bits (573),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 110/172 (64%), Positives = 139/172 (81%), Gaps = 1/172 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EF WGLANS K FLW++RPD+V GE A++PPEF+EET++RG+ SSWCPQEQVL H AVG
Sbjct  314  IEFVWGLANSNKAFLWVIRPDLVLGESAVVPPEFLEETEERGLFSSWCPQEQVLSHPAVG  373

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNS+LES+C GVPM+CWPFFAEQQTNC + C +WG+G+EI+ +V R+ +E +V
Sbjct  374  GFLTHSGWNSSLESLCGGVPMICWPFFAEQQTNCRFCCKEWGVGIEIEGDVKRNYIEDLV  433

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  261
            R LME EKG+EM++KA E KKLA EAA T P G S + ++  IN +LLS R 
Sbjct  434  RTLMEGEKGKEMRKKATEWKKLAEEAA-TGPNGLSFLALDNMINRVLLSPRN  484



>ref|XP_008373152.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Malus domestica]
 ref|XP_008373153.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Malus domestica]
Length=478

 Score =   224 bits (572),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 116/171 (68%), Positives = 139/171 (81%), Gaps = 2/171 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EF WGLANS+ PFLW +RPD+V GE A+ PPEF  ETK+RG+L+SWCPQEQVL H +VG
Sbjct  310  LEFGWGLANSKLPFLWAIRPDLVIGESAIFPPEFEFETKERGLLASWCPQEQVLNHPSVG  369

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNST+ES+  GVPMLCWPFFA+Q TNC+Y+C +WGIGMEIDN+V RDEVEK+V
Sbjct  370  GFLTHSGWNSTIESLSAGVPMLCWPFFADQTTNCYYTCNEWGIGMEIDNDVKRDEVEKLV  429

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHR  264
            RELME EKG++MK K ME KKLA EA  T P GSS  N++  +N +LL  R
Sbjct  430  RELMEGEKGKKMKNKVMEWKKLAEEA--TSPQGSSTRNLDNLVNQVLLRKR  478



>ref|XP_002263158.1| PREDICTED: 7-deoxyloganetin glucosyltransferase [Vitis vinifera]
Length=475

 Score =   224 bits (571),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 114/167 (68%), Positives = 140/167 (84%), Gaps = 2/167 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEFAWGLANS KPFLWI+RPD+V G+  +LPPEF+ ET  RG+++ WCPQE+VL H +VG
Sbjct  308  VEFAWGLANSHKPFLWIIRPDLVVGDSVILPPEFVNETIQRGLMAGWCPQEKVLNHPSVG  367

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNST+ESIC GVPM+CWPFFAEQQTNC Y+CT+WG+GMEIDNNV RDEVEK+V
Sbjct  368  GFLTHSGWNSTIESICAGVPMICWPFFAEQQTNCRYACTEWGVGMEIDNNVERDEVEKLV  427

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLL  276
            +ELME EKG+ MK+ AME +  A EA  T P GSS++N++K ++ LL
Sbjct  428  KELMEGEKGKSMKKAAMEWRTKAEEA--TAPCGSSYLNLDKLVDILL  472



>ref|XP_008342285.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Malus domestica]
Length=317

 Score =   219 bits (559),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 109/167 (65%), Positives = 138/167 (83%), Gaps = 2/167 (1%)
 Frame = -3

Query  773  EFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVGG  594
            EF WGLANS+ PF W++RPD+V GE A+LPPEF+ ETK+R +++SWCPQEQVL H +VGG
Sbjct  150  EFGWGLANSKMPFFWVIRPDLVIGESAILPPEFVAETKERSLIASWCPQEQVLNHPSVGG  209

Query  593  FLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvvR  414
            FLTH GWNST+ES+ +GVPMLCWPFFA+QQ +C Y+C +WG+GMEI N+V RDEVEK++R
Sbjct  210  FLTHSGWNSTVESLTSGVPMLCWPFFADQQMDCRYTCKEWGVGMEISNDVKRDEVEKLIR  269

Query  413  ELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  273
            ELM+ EKG++MK KAME KKLA EA  T P GSS  N++  +N +LL
Sbjct  270  ELMDGEKGKKMKNKAMEWKKLAEEA--TSPHGSSSKNLDNLVNQVLL  314



>gb|KCW45705.1| hypothetical protein EUGRSUZ_L00511 [Eucalyptus grandis]
Length=462

 Score =   224 bits (570),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 142/168 (85%), Gaps = 2/168 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EF+WGLANSQKPFLWI+RPD+V G+  +LP EF+ ETKDRGML+ WCPQE+VL H +VG
Sbjct  292  IEFSWGLANSQKPFLWIIRPDLVAGDTVVLPSEFLAETKDRGMLAGWCPQERVLRHPSVG  351

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTHCGWNS LESIC GVP+LCWPFFAEQQTNC+YS  +WGIGMEIDN+V R+EVEK+V
Sbjct  352  GFLTHCGWNSMLESICGGVPVLCWPFFAEQQTNCFYSKNEWGIGMEIDNSVRREEVEKLV  411

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  273
            RELM+ EKG+ MK+KA+E K+ A EA +    GSS+ N+E  ++H+L+
Sbjct  412  RELMDGEKGKAMKKKAVEWKRKAEEATEL--GGSSYENLETLLSHVLV  457



>ref|XP_008219317.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=482

 Score =   224 bits (571),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 110/172 (64%), Positives = 141/172 (82%), Gaps = 2/172 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLANS + F W++RPD+V G+ A++PPEF+EETK+R +L+ WCPQEQVL H AVG
Sbjct  313  IEFAWGLANSNQTFFWVIRPDLVGGDSAVVPPEFVEETKERSLLAHWCPQEQVLSHPAVG  372

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNST+ES+C GVPM+CWPFFAEQQTNC Y+  +WGIGMEI ++V R+ VE +V
Sbjct  373  GFLTHSGWNSTIESVCAGVPMICWPFFAEQQTNCRYTEKEWGIGMEIKSDVKRNYVEGLV  432

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  261
            R+LME E+G++M++KA+E KKLA EA  T P GSS V ++K IN +LLS R 
Sbjct  433  RKLMEGEEGKDMRKKALEWKKLAKEA--TSPNGSSFVPLDKMINQVLLSPRN  482



>ref|XP_006373049.1| hypothetical protein POPTR_0017s079101g, partial [Populus trichocarpa]
 gb|ERP50846.1| hypothetical protein POPTR_0017s079101g, partial [Populus trichocarpa]
Length=162

 Score =   214 bits (545),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 133/164 (81%), Gaps = 2/164 (1%)
 Frame = -3

Query  752  NSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVGGFLTHCGW  573
            NS KPFLWI+RPD++ GE AMLPPEF+  TKDR +L SWCPQEQVL H ++GGFL+H GW
Sbjct  1    NSNKPFLWIIRPDLIVGEAAMLPPEFLSVTKDRSLLVSWCPQEQVLKHPSIGGFLSHMGW  60

Query  572  NSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvvRELMESEK  393
            NSTLESIC GVPM+CWPFF EQQTNCW++CTKWGIGMEI++NV RDEVEK+VRELME EK
Sbjct  61   NSTLESICGGVPMVCWPFFGEQQTNCWFACTKWGIGMEIESNVKRDEVEKLVRELMEGEK  120

Query  392  GREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  261
            G++MKRKAME K  A EAA T    +SH N+++ +  L    R+
Sbjct  121  GKDMKRKAMEWKTKAEEAAWT--GDASHRNLDRLVKVLASEQRR  162



>ref|XP_003615138.1| Cytokinin-O-glucosyltransferase [Medicago truncatula]
 gb|AES98096.1| UDP-glucosyltransferase family protein [Medicago truncatula]
 gb|KEH28099.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=480

 Score =   224 bits (571),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 110/168 (65%), Positives = 140/168 (83%), Gaps = 2/168 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGL+NS+ PFLW++RPD+V GE A+LP EF+EETK+RG+LSSWCPQE+VLGH ++G
Sbjct  314  IEFAWGLSNSKMPFLWVIRPDLVAGENAVLPLEFLEETKNRGLLSSWCPQEEVLGHSSIG  373

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNSTLES+C GVPM+CWPFFAEQQTNC + C +WGIG+EI  +  RD++E +V
Sbjct  374  GFLTHNGWNSTLESVCGGVPMICWPFFAEQQTNCRFCCNEWGIGLEI-EDAKRDKIEILV  432

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  273
            +ELME EKG+EMK KA++ KKLA  AA   P GSS +N+E  I+ +LL
Sbjct  433  KELMEGEKGKEMKEKALQWKKLAHNAASG-PHGSSFMNLENLIHDVLL  479



>gb|KCW66544.1| hypothetical protein EUGRSUZ_F00340 [Eucalyptus grandis]
Length=460

 Score =   223 bits (569),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 112/172 (65%), Positives = 141/172 (82%), Gaps = 2/172 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEFAWGLANS + FLW++RPD+V G  A+LPP+F+  T++R +L SWCPQE+VL H AVG
Sbjct  290  VEFAWGLANSGQVFLWVIRPDLVKGNTAILPPDFLAATRERSLLVSWCPQERVLSHSAVG  349

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTHCGWNS +ESI   VP+ CWPFFA+QQTNC YSC +WGIGMEID++V RDEVE+ V
Sbjct  350  GFLTHCGWNSIIESIAASVPVACWPFFADQQTNCRYSCQEWGIGMEIDSDVRRDEVERQV  409

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  261
            RELME E+G+EMKRKAME K++A EA  T P GSS +N+++ I+ +LLS R+
Sbjct  410  RELMEGERGKEMKRKAMEWKEMAREA--TCPSGSSFLNLDEVIDKVLLSSRR  459



>gb|EYU19971.1| hypothetical protein MIMGU_mgv1a024760mg [Erythranthe guttata]
Length=483

 Score =   224 bits (571),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 141/167 (84%), Gaps = 4/167 (2%)
 Frame = -3

Query  773  EFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVGG  594
            EFAWGLANS++PFLWI+RP++V+GE A+LP  F++ TK+RGML++WCPQE+VL H +VGG
Sbjct  318  EFAWGLANSKQPFLWIIRPNLVSGEKAVLPDGFLDATKERGMLANWCPQEKVLSHSSVGG  377

Query  593  FLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvvR  414
            FLTH GWNSTLESIC+GVPM+CWPFFAEQQTNCWY CTKWG+GMEID++V R+ VE +V 
Sbjct  378  FLTHSGWNSTLESICSGVPMICWPFFAEQQTNCWYCCTKWGVGMEIDSDVKRNGVETLVT  437

Query  413  ELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  273
            +LM  E+GR+M+ KA+E K LA ++A+    GSS+ N++  I+ +LL
Sbjct  438  KLMVGEEGRQMRNKAVEWKNLARDSAE----GSSYRNLKNLIDQVLL  480



>ref|XP_010039829.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=487

 Score =   224 bits (571),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 142/168 (85%), Gaps = 2/168 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EF+WGLANSQKPFLWI+RPD+V G+  +LP EF+ ETKDRGML+ WCPQE+VL H +VG
Sbjct  317  IEFSWGLANSQKPFLWIIRPDLVAGDTVVLPSEFLAETKDRGMLAGWCPQERVLRHPSVG  376

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTHCGWNS LESIC GVP+LCWPFFAEQQTNC+YS  +WGIGMEIDN+V R+EVEK+V
Sbjct  377  GFLTHCGWNSMLESICGGVPVLCWPFFAEQQTNCFYSKNEWGIGMEIDNSVRREEVEKLV  436

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  273
            RELM+ EKG+ MK+KA+E K+ A EA +    GSS+ N+E  ++H+L+
Sbjct  437  RELMDGEKGKAMKKKAVEWKRKAEEATEL--GGSSYENLETLLSHVLV  482



>ref|XP_008219404.1| PREDICTED: UDP-glycosyltransferase 85A2-like, partial [Prunus 
mume]
Length=385

 Score =   221 bits (563),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 107/172 (62%), Positives = 139/172 (81%), Gaps = 1/172 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLANS + F W++RPD+V G+ A++PPEF+EETK+R +L+ WCPQEQVL H AVG
Sbjct  215  IEFAWGLANSNQTFFWVIRPDLVGGDSAVVPPEFVEETKERSLLAHWCPQEQVLSHPAVG  274

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNST+ES+C GVPM+CWPFFAEQQ NC + C +WGIGMEI+ +V R+ +E +V
Sbjct  275  GFLTHSGWNSTIESVCAGVPMICWPFFAEQQINCRFCCKEWGIGMEIEGDVKRNYIEGLV  334

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  261
            R+LME E+G+EM++KA+E KKLA EA  T P G S V ++K +N +LLS R 
Sbjct  335  RKLMEGEEGKEMRKKALEWKKLAKEAT-TGPNGLSFVGLDKLVNQVLLSPRN  385



>ref|XP_006472583.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Citrus sinensis]
Length=503

 Score =   224 bits (570),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 111/170 (65%), Positives = 139/170 (82%), Gaps = 1/170 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEFAWGLANS++PFLW++RPD+V    A++  EF+EETKDRGML+SWCPQEQ+L H AVG
Sbjct  322  VEFAWGLANSKRPFLWVIRPDIVNEATAVITQEFVEETKDRGMLASWCPQEQILRHPAVG  381

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTHCGWNST+ES+C+GV MLCWPFFAEQQTNCW+  TKWG+G+E++    R E+EK V
Sbjct  382  GFLTHCGWNSTVESLCSGVAMLCWPFFAEQQTNCWFCQTKWGVGIEVNPRADRVEIEKRV  441

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSH  267
            RELME E G+ MK KA E K LA +AA   P GSS+VN++K +N +LL++
Sbjct  442  RELMEGESGKLMKEKAWEWKLLAEKAAAG-PNGSSYVNLDKLMNDVLLTY  490



>ref|XP_010248035.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Nelumbo 
nucifera]
Length=488

 Score =   223 bits (569),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 114/171 (67%), Positives = 142/171 (83%), Gaps = 5/171 (3%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEFAWGLANS + FLW++RPD+V G+ A+LPPEF+ +TK+R +L+SWCPQ+QVL H +VG
Sbjct  316  VEFAWGLANSNQTFLWVIRPDLVVGDSALLPPEFIRDTKERSLLASWCPQKQVLNHPSVG  375

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNST+ESIC+GVPM+CWPFFA+QQT C Y+CT+WG+GMEID+NV RDEVE ++
Sbjct  376  GFLTHNGWNSTVESICSGVPMICWPFFADQQTICRYACTEWGVGMEIDSNVKRDEVESLI  435

Query  416  RELMESEKGREMKRKAMELKKLAMEAA--DTIPIGSSHVNIEKFINHLLLS  270
            RELME EKG+EMK KAME K+ A EAA     P   SH N++K IN +LLS
Sbjct  436  RELMEGEKGKEMKYKAMEWKRRAEEAAYQGGXP---SHTNLDKMINEVLLS  483



>ref|XP_010060018.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=485

 Score =   223 bits (569),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 112/172 (65%), Positives = 141/172 (82%), Gaps = 2/172 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEFAWGLANS + FLW++RPD+V G  A+LPP+F+  T++R +L SWCPQE+VL H AVG
Sbjct  315  VEFAWGLANSGQVFLWVIRPDLVKGNTAILPPDFLAATRERSLLVSWCPQERVLSHSAVG  374

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTHCGWNS +ESI   VP+ CWPFFA+QQTNC YSC +WGIGMEID++V RDEVE+ V
Sbjct  375  GFLTHCGWNSIIESIAASVPVACWPFFADQQTNCRYSCQEWGIGMEIDSDVRRDEVERQV  434

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  261
            RELME E+G+EMKRKAME K++A EA  T P GSS +N+++ I+ +LLS R+
Sbjct  435  RELMEGERGKEMKRKAMEWKEMAREA--TCPSGSSFLNLDEVIDKVLLSSRR  484



>ref|XP_010030028.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=483

 Score =   223 bits (569),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 115/167 (69%), Positives = 139/167 (83%), Gaps = 2/167 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
             EFAWGLANSQKPFLWI+RPD+V  E A+LPPEF+EE   RGML+ WC QE+VL H+A+G
Sbjct  315  TEFAWGLANSQKPFLWIIRPDLVATESAVLPPEFVEEIAGRGMLAHWCRQEEVLKHRAIG  374

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNSTLES+C GVP++CWPFF +QQTNC YSCT+WGIGMEIDN+V RDEVE +V
Sbjct  375  GFLTHSGWNSTLESLCGGVPVICWPFFGDQQTNCRYSCTEWGIGMEIDNDVKRDEVEGLV  434

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLL  276
            RELME EKG+EM++KAME K  A EA   +P G+S+ N+EK I+ +L
Sbjct  435  RELMEGEKGKEMRKKAMEWKAKAEEA--IMPGGTSYNNVEKLISEVL  479



>dbj|BAG80547.1| glycosyltransferase [Lycium barbarum]
Length=490

 Score =   223 bits (569),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 124/171 (73%), Positives = 146/171 (85%), Gaps = 1/171 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLANSQ  FLWI+RPD+V+G  A+LPPEF+EETK+RGML+SWC Q+QVL H AVG
Sbjct  316  IEFAWGLANSQVDFLWIIRPDIVSGNKAVLPPEFLEETKERGMLASWCQQQQVLSHVAVG  375

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNSTLESI +GVPM+CWPFFAEQQTNCW+ CT+W IGMEIDNNV RDEV+ +V
Sbjct  376  GFLTHSGWNSTLESISSGVPMICWPFFAEQQTNCWFCCTQWEIGMEIDNNVKRDEVKSLV  435

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHR  264
            REL+  EKG EMK+KA+E KKLA EAA   P GSS+VNI+K IN +LLS +
Sbjct  436  RELLTWEKGNEMKKKALEWKKLAKEAA-KKPGGSSYVNIDKLINEILLSSK  485



>ref|XP_002308831.2| hypothetical protein POPTR_0006s02390g [Populus trichocarpa]
 gb|EEE92354.2| hypothetical protein POPTR_0006s02390g [Populus trichocarpa]
Length=480

 Score =   223 bits (567),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 140/169 (83%), Gaps = 2/169 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEF  GLA S  PFLWI+RPDMVTG+ A+LPPEF EETK+R  + SWCPQE+VL H ++G
Sbjct  314  VEFGMGLAKSGHPFLWIIRPDMVTGDSAILPPEFTEETKERSFICSWCPQEEVLNHPSIG  373

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GW ST+ESI +GVPMLCWPFFA+QQTNC Y+C++WGIGMEIDNNV RD+VEK+V
Sbjct  374  GFLTHSGWGSTIESISSGVPMLCWPFFADQQTNCRYTCSEWGIGMEIDNNVKRDKVEKLV  433

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLS  270
            RELME EKG+ MK+KAME KKLA EA+   P GSS +N++K +  +LLS
Sbjct  434  RELMEGEKGKSMKKKAMEWKKLAEEASG--PSGSSSMNLDKLVKEVLLS  480



>ref|XP_004172439.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Cucumis sativus]
Length=312

 Score =   218 bits (555),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 112/172 (65%), Positives = 138/172 (80%), Gaps = 2/172 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEFAWGLA+S KPFLWI RPD++ G+ A++P EF+ +TKDR ++SSWC QEQVL H ++G
Sbjct  141  VEFAWGLADSGKPFLWITRPDLIVGDSAIMPQEFVTQTKDRSLISSWCSQEQVLNHPSIG  200

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNSTLESIC GVPM+ WPFFAEQQTNC Y CT+WGIGMEIDNNV R+EVE++V
Sbjct  201  GFLTHSGWNSTLESICAGVPMISWPFFAEQQTNCRYCCTEWGIGMEIDNNVKRNEVEELV  260

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  261
            RELM+ EKG++MK   M LK  A EA    P GS++  ++K IN +LLS+ K
Sbjct  261  RELMDGEKGKKMKENVMYLKSKAEEAYK--PGGSAYKQLDKLINEVLLSNIK  310



>ref|XP_010060024.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=485

 Score =   223 bits (567),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 114/172 (66%), Positives = 142/172 (83%), Gaps = 2/172 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEFAWGLANS + FLW++RPD+V G+ A+LPPEF   T++R +L+SWCPQ QVL HQA+G
Sbjct  315  VEFAWGLANSGQTFLWVIRPDLVVGDTAILPPEFSAMTRERSLLASWCPQVQVLRHQAIG  374

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNST+ESI  GVP++CWPFFAEQQ NC YSC +WGIGMEID +V RDEVE+ V
Sbjct  375  GFLTHSGWNSTIESITAGVPVVCWPFFAEQQMNCRYSCQEWGIGMEIDGDVKRDEVERQV  434

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  261
            RELME E+G+EMKRKAME K++A EA  T P GSS +N+++ I+ +LLS R+
Sbjct  435  RELMEGERGKEMKRKAMEWKEMAREA--TRPSGSSCLNLDEVIDKVLLSPRR  484



>ref|XP_004173933.1| PREDICTED: UDP-glycosyltransferase 85A3-like, partial [Cucumis 
sativus]
Length=187

 Score =   213 bits (543),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 108/172 (63%), Positives = 138/172 (80%), Gaps = 2/172 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLA+S KPFLWI RPD++ G+ A++  EF+ +TKDR +++SWC QEQVL H ++G
Sbjct  16   IEFAWGLADSAKPFLWITRPDLIVGDSAIMSQEFVTQTKDRSLIASWCSQEQVLSHPSIG  75

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GF+TH GWNSTLESIC GVPM+CWPFF+EQQTNC Y CT+WGIGMEIDNNV+R EVE++V
Sbjct  76   GFVTHSGWNSTLESICAGVPMICWPFFSEQQTNCRYCCTEWGIGMEIDNNVIRSEVEELV  135

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  261
            RELM+ EKG++MK   M LK  A EA    P GS++  ++K IN +LLS+ K
Sbjct  136  RELMDGEKGKKMKENVMYLKSKAEEAYK--PGGSAYKQLDKLINEVLLSNIK  185



>ref|XP_011467662.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=489

 Score =   223 bits (567),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 111/166 (67%), Positives = 137/166 (83%), Gaps = 2/166 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEF WGLA ++ PFLW++RPD+V GE A+LPPEF+ ETK+RG+++SWCPQEQVL H +VG
Sbjct  322  VEFGWGLAKTKLPFLWVIRPDLVVGESAVLPPEFVAETKERGLIASWCPQEQVLNHPSVG  381

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNST+ES+C GVPML  PFFAEQQTNC+Y+C KWGIGMEI+N+V RDEV+K+V
Sbjct  382  GFLTHSGWNSTIESLCAGVPMLSLPFFAEQQTNCYYTCRKWGIGMEINNDVKRDEVQKLV  441

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHL  279
            +ELME EKG+EM+ K ME  KLA EA  T P GSS  N++K +  L
Sbjct  442  KELMEREKGKEMRNKVMEWNKLAEEA--TAPHGSSSKNLDKLVKRL  485



>ref|XP_010041627.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=489

 Score =   223 bits (567),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 140/169 (83%), Gaps = 2/169 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
             EFAWGLANSQKPFLWI+RPD+V  E A+LPPEF+EE   RGML SWC QE+VL H+A+G
Sbjct  321  TEFAWGLANSQKPFLWIIRPDLVASESAVLPPEFVEEIAGRGMLVSWCQQEEVLKHRAIG  380

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNSTLES+C GVP++CWPFFAEQQTNC YSCT+WGIGMEIDN+V RDEVE +V
Sbjct  381  GFLTHSGWNSTLESLCGGVPVICWPFFAEQQTNCRYSCTEWGIGMEIDNDVKRDEVEGLV  440

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLS  270
            RELME EKG+EM++KAME K  A EA   +  G+S+ N++K I+ +L S
Sbjct  441  RELMEGEKGKEMRKKAMEWKAKAEEA--IMLGGTSYNNVDKLISEVLSS  487



>ref|XP_006433963.1| hypothetical protein CICLE_v10001630mg [Citrus clementina]
 gb|ESR47203.1| hypothetical protein CICLE_v10001630mg [Citrus clementina]
Length=358

 Score =   219 bits (558),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 147/169 (87%), Gaps = 1/169 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLANS++ F+W++RPD+V G+ A+LPPEF+ ETK+R +L+SWCPQEQVL H A+G
Sbjct  188  IEFAWGLANSKQTFMWVIRPDLVVGDSAILPPEFVTETKERSLLASWCPQEQVLNHPAIG  247

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNSTLESIC GVP++CWPFFAEQQTNC YSC +WGIGMEID+NV R+EVE +V
Sbjct  248  GFLTHSGWNSTLESICGGVPLICWPFFAEQQTNCRYSCREWGIGMEIDSNVKREEVEVLV  307

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLS  270
            R+LM  EKG+EMK KA+ELKK A EAA T P+GSS+VN+EK I H+LLS
Sbjct  308  RDLMVGEKGQEMKLKALELKKKAKEAA-TGPVGSSYVNLEKLITHVLLS  355



>ref|XP_008219319.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=490

 Score =   223 bits (567),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 108/169 (64%), Positives = 140/169 (83%), Gaps = 2/169 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLANS + F W++RPD+V G+ A++PPEF+EETK+R +L++WCPQEQVL H AVG
Sbjct  313  IEFAWGLANSNQTFFWVIRPDLVGGDSAVVPPEFVEETKERSLLANWCPQEQVLSHSAVG  372

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNSTLES+C GVPM+CWPFFAEQQTN  YS  +WGIGMEI+ +V R+ +E +V
Sbjct  373  GFLTHSGWNSTLESVCAGVPMICWPFFAEQQTNSRYSEKEWGIGMEIERDVKRNYIEGLV  432

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLS  270
            R+LME ++G+EM++KA+E KKLA EA  T P GSS V ++K +N +LLS
Sbjct  433  RKLMEGDEGKEMRKKALEWKKLATEA--TSPNGSSFVGLDKMVNQVLLS  479



>ref|XP_007042920.1| UDP-glucosyl transferase 85A2 [Theobroma cacao]
 gb|EOX98751.1| UDP-glucosyl transferase 85A2 [Theobroma cacao]
Length=519

 Score =   223 bits (568),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 114/171 (67%), Positives = 143/171 (84%), Gaps = 2/171 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEFAWGLANS+  FLWI+RPD+V G+ ++LPPEF+EET++RG+++SWCPQEQVL H A+ 
Sbjct  311  VEFAWGLANSKHTFLWIIRPDLVRGDSSILPPEFLEETEERGLMASWCPQEQVLNHPAIA  370

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNST+ESI  GVPM+ WPFFAEQQTNC ++CT+WG+GMEIDNNV R+EVE++V
Sbjct  371  GFLTHSGWNSTVESIGYGVPMISWPFFAEQQTNCRFACTEWGVGMEIDNNVKREEVERLV  430

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHR  264
            RELME EKG+ M+ KAME KK A +AA   P GSS +N+EK I  +LL H+
Sbjct  431  RELMEGEKGKGMRNKAMEWKKKAEQAAS--PNGSSFLNLEKLIKDVLLKHQ  479



>ref|XP_008219313.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=482

 Score =   222 bits (566),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 108/172 (63%), Positives = 141/172 (82%), Gaps = 2/172 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLA+S + F W++RPD+V G+ A++PPEF+EETK+R +L+ WCPQEQVL H AVG
Sbjct  313  IEFAWGLASSNQTFFWVIRPDLVGGDSAVVPPEFVEETKERSLLAHWCPQEQVLSHPAVG  372

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNST+ES+C GVPM+CWPFFAEQQTNC Y+  +WGIGMEI ++V R+ +E +V
Sbjct  373  GFLTHSGWNSTIESVCAGVPMICWPFFAEQQTNCRYTEKEWGIGMEIKSDVKRNYIEGLV  432

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  261
            R+LME E+G++M++KA+E KKLA EA  T P GSS V ++K IN +LLS R 
Sbjct  433  RKLMEGEEGKDMRKKALEWKKLAKEA--TSPNGSSFVPLDKMINQVLLSPRN  482



>gb|KCW45338.1| hypothetical protein EUGRSUZ_L009912, partial [Eucalyptus grandis]
Length=311

 Score =   217 bits (553),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 110/172 (64%), Positives = 141/172 (82%), Gaps = 2/172 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEFAWGLANS + FLW++RPD+V G+ A+LP EF   T++R +L+SWCPQE+VL H AVG
Sbjct  141  VEFAWGLANSCQTFLWVIRPDLVVGDMAILPSEFSATTRERSLLASWCPQERVLNHPAVG  200

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNST+ESI  GVP+LCWPFFAEQQTNC YSC +WGIGMEID +V RD+VE+ V
Sbjct  201  GFLTHSGWNSTIESITAGVPVLCWPFFAEQQTNCRYSCEEWGIGMEIDGDVKRDKVERQV  260

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  261
            RELME E+G+EMKRKAME +++A EA    P GSS++N+++ ++ +LL  R+
Sbjct  261  RELMEGERGKEMKRKAMEWQQMAREAMR--PSGSSYLNLDEVMDKVLLLPRR  310



>ref|XP_008219315.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=482

 Score =   222 bits (565),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 108/172 (63%), Positives = 141/172 (82%), Gaps = 2/172 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLA+S + F W++RPD+V G+ A++PPEF+EETK+R +L+ WCPQEQVL H AVG
Sbjct  313  IEFAWGLASSNQTFFWVIRPDLVGGDSAVVPPEFVEETKERSLLAHWCPQEQVLSHPAVG  372

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNST+ES+C GVPM+CWPFFAEQQTNC Y+  +WGIGMEI ++V R+ +E +V
Sbjct  373  GFLTHSGWNSTIESVCAGVPMICWPFFAEQQTNCRYTEKEWGIGMEIKSDVKRNYIEGLV  432

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  261
            R+LME E+G++M++KA+E KKLA EA  T P GSS V ++K IN +LLS R 
Sbjct  433  RKLMEGEEGKDMRKKALEWKKLAKEA--TSPNGSSFVPLDKMINQVLLSPRN  482



>ref|XP_002308829.1| hypothetical protein POPTR_0006s02310g [Populus trichocarpa]
 gb|EEE92352.1| hypothetical protein POPTR_0006s02310g [Populus trichocarpa]
Length=480

 Score =   222 bits (565),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 138/168 (82%), Gaps = 2/168 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +E   GLA S  PFLWI+RPDMVTG+ A+LPPEF +ETKDRG +S+WCPQE+VL H ++G
Sbjct  314  IELGMGLAKSGHPFLWIIRPDMVTGDSAILPPEFTDETKDRGFISNWCPQEEVLNHPSIG  373

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNST ESI +GVPMLCWPFFA+QQTNC Y+C +WGIGMEID+N  RD+VEK+V
Sbjct  374  GFLTHSGWNSTAESISSGVPMLCWPFFADQQTNCRYTCNEWGIGMEIDSNAERDKVEKLV  433

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  273
            RELME EKGRE+K+K ME +KLA EAA   P GSS +N+++ +  +LL
Sbjct  434  RELMEGEKGREVKKKVMEWRKLAEEAAG--PSGSSSMNLDEMVKAVLL  479



>gb|AFK33787.1| unknown [Medicago truncatula]
Length=480

 Score =   222 bits (565),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 109/168 (65%), Positives = 139/168 (83%), Gaps = 2/168 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGL+NS+ PFLW++RPD+V GE A+LP EF+EETK+RG+LSSWCPQE+VLGH ++G
Sbjct  314  IEFAWGLSNSKMPFLWVIRPDLVAGENAVLPLEFLEETKNRGLLSSWCPQEEVLGHSSIG  373

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH  WNSTLES+C GVPM+CWPFFAEQQTNC + C +WGIG+EI  +  RD++E +V
Sbjct  374  GFLTHNDWNSTLESVCGGVPMICWPFFAEQQTNCRFCCNEWGIGLEI-EDAKRDKIEILV  432

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  273
            +ELME EKG+EMK KA++ KKLA  AA   P GSS +N+E  I+ +LL
Sbjct  433  KELMEGEKGKEMKEKALQWKKLAHNAASG-PHGSSFMNLENLIHDVLL  479



>ref|XP_003546715.1| PREDICTED: UDP-glycosyltransferase 85A3 [Glycine max]
Length=478

 Score =   221 bits (564),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 113/170 (66%), Positives = 138/170 (81%), Gaps = 3/170 (2%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGE-GAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAV  600
             E AWGLANS K FLW++RPD+V GE    LP EF++ETKDRGML+SWCPQE+VL H AV
Sbjct  306  TELAWGLANSNKNFLWVIRPDLVAGEINCALPNEFVKETKDRGMLASWCPQEEVLAHPAV  365

Query  599  GGFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekv  420
            GGFLTHCGWNSTLES+C GVPMLCWPFFAEQQTNC + C +WGIG+EI  +V R++VE +
Sbjct  366  GGFLTHCGWNSTLESVCEGVPMLCWPFFAEQQTNCRFCCKEWGIGLEI-EDVKREKVEAL  424

Query  419  vRELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLS  270
            VRELME EKG+EMK +A+E KKLA EAA + P GSS VN++  +  +L++
Sbjct  425  VRELMEGEKGKEMKERALEWKKLAHEAASS-PHGSSFVNMDNVVRQVLMN  473



>gb|KCW56974.1| hypothetical protein EUGRSUZ_I02647 [Eucalyptus grandis]
Length=464

 Score =   221 bits (563),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 141/168 (84%), Gaps = 2/168 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EF+WGLANSQKPFLWI+RPD+V G+  +LP EF+ ETKDRGML+ WCPQE+VL H +VG
Sbjct  294  IEFSWGLANSQKPFLWIIRPDLVAGDKVVLPSEFLAETKDRGMLAGWCPQERVLRHPSVG  353

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTHCGWNS LESIC GVP+LCWPFFAEQQTNC+YS  +WGIGMEIDN+V R+EVEK+V
Sbjct  354  GFLTHCGWNSMLESICGGVPVLCWPFFAEQQTNCFYSKNEWGIGMEIDNSVRREEVEKLV  413

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  273
            RELM+ EKG+ MK+KA+E K+ A EA +    GSS+ N+E  ++ +L+
Sbjct  414  RELMDGEKGKAMKKKAVEWKRKAEEATEL--GGSSYENLETLLSQVLV  459



>ref|XP_010030926.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=865

 Score =   228 bits (581),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 118/169 (70%), Positives = 141/169 (83%), Gaps = 2/169 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
             EFAWGLANSQKPFLWI+RPD+V  E A+LPPEF+EE   RGML SWC QE+VL H+A+G
Sbjct  697  TEFAWGLANSQKPFLWIIRPDLVASESAVLPPEFVEEIAGRGMLVSWCQQEEVLKHRAIG  756

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNSTLES+C GVP++CWPFFAEQQTNC YSCT+WGIGMEIDN+V RDEVE +V
Sbjct  757  GFLTHSGWNSTLESLCGGVPVICWPFFAEQQTNCRYSCTEWGIGMEIDNDVKRDEVEGLV  816

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLS  270
            RELME EKG+EM++KAME K  A EA   +P G+S+ N++K I+ +L S
Sbjct  817  RELMEGEKGKEMRKKAMEWKAKAEEA--IMPGGTSYNNVDKLISEVLSS  863


 Score =   132 bits (332),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 94/146 (64%), Gaps = 37/146 (25%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +E +WGLANSQKPFLWI+RPD+V G+  +LP EF+ ETKDRGML                
Sbjct  272  IEVSWGLANSQKPFLWIIRPDLVAGDTVVLPSEFLAETKDRGML----------------  315

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
                                 +CWPFFAEQQTNC YS T+WGIGMEIDN+V RDEVE +V
Sbjct  316  ---------------------VCWPFFAEQQTNCQYSYTEWGIGMEIDNDVKRDEVEGLV  354

Query  416  RELMESEKGREMKRKAMELKKLAMEA  339
            RELME EKG+EM++KAME K  A EA
Sbjct  355  RELMEGEKGKEMRKKAMEWKVKAKEA  380



>ref|XP_008229793.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=493

 Score =   222 bits (565),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 139/168 (83%), Gaps = 2/168 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEF WGLANS+ PFLW++RPD++ GE A+LPPEF  ETKDRG+++SWCPQEQVL H +VG
Sbjct  326  VEFGWGLANSKVPFLWVIRPDLIVGESAILPPEFEFETKDRGLIASWCPQEQVLNHPSVG  385

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNST+ES+  GVPMLCWP FAEQ TNC+Y+C +WG G+EIDNNV RDEVEK+V
Sbjct  386  GFLTHSGWNSTIESLTAGVPMLCWPVFAEQHTNCYYTCNEWGSGLEIDNNVKRDEVEKLV  445

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  273
            REL E EKG++MK KAME +KLA EA  T P GSS +N++  +N +LL
Sbjct  446  RELTEGEKGKKMKIKAMEWRKLAEEA--TGPHGSSSINMDNLVNQVLL  491



>gb|KHN13067.1| UDP-glycosyltransferase 85A3 [Glycine soja]
Length=478

 Score =   221 bits (564),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 113/170 (66%), Positives = 138/170 (81%), Gaps = 3/170 (2%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGE-GAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAV  600
             E AWGLANS K FLW++RPD+V GE    LP EF++ETKDRGML+SWCPQE+VL H AV
Sbjct  306  TELAWGLANSNKNFLWVIRPDLVAGEINCALPNEFVKETKDRGMLASWCPQEEVLAHPAV  365

Query  599  GGFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekv  420
            GGFLTHCGWNSTLES+C GVPMLCWPFFAEQQTNC + C +WGIG+EI  +V R++VE +
Sbjct  366  GGFLTHCGWNSTLESVCEGVPMLCWPFFAEQQTNCRFCCKEWGIGLEI-EDVKREKVEAL  424

Query  419  vRELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLS  270
            VRELME EKG+EMK +A+E KKLA EAA + P GSS VN++  +  +L++
Sbjct  425  VRELMEGEKGKEMKERALEWKKLAHEAASS-PHGSSFVNMDNVVRQVLMN  473



>gb|KDP43115.1| hypothetical protein JCGZ_26648 [Jatropha curcas]
Length=481

 Score =   221 bits (564),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 107/169 (63%), Positives = 144/169 (85%), Gaps = 2/169 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EF  GLANS+ PFLWI+RPD+V G+  +LPPEF+E TK+RG++++WCPQE+VL H ++G
Sbjct  313  IEFGMGLANSKHPFLWIIRPDLVIGDSGILPPEFVEYTKERGLIANWCPQEEVLNHSSIG  372

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTHCGW ST+ES+  GVPMLCWPFFA+Q TNC Y+C +WG+GMEID+NV RDE+EK+V
Sbjct  373  GFLTHCGWGSTIESLSAGVPMLCWPFFADQPTNCRYTCCEWGVGMEIDSNVKRDEIEKLV  432

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLS  270
            RELME EK +++K++AME +KLA+EA  T P GSS +N++K ++H+LLS
Sbjct  433  RELMEGEKCKKLKKRAMEWRKLAIEA--TSPTGSSSLNLDKLVSHVLLS  479



>ref|XP_010267412.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Nelumbo 
nucifera]
Length=492

 Score =   222 bits (565),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 111/172 (65%), Positives = 142/172 (83%), Gaps = 4/172 (2%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEFAWGLANS + FLW++RPD+V G+ A+LPPEF++ TK+RG+L++WCPQEQ+L H ++G
Sbjct  317  VEFAWGLANSNQTFLWVIRPDLVKGDSALLPPEFVQHTKERGLLANWCPQEQILNHPSIG  376

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCT--KWGIGMEIdnnvvrdevek  423
             FLTHCGWNSTLESICNGVPMLCWPFFAEQQTNC Y+CT  +WGIGMEI+N+V RD+VE 
Sbjct  377  VFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCRYTCTESEWGIGMEINNDVKRDDVES  436

Query  422  vvRELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSH  267
            +VR+L+  +KG+E+K K ME KK A EA      GSS +N +K I+ +LLS+
Sbjct  437  LVRQLINGDKGKELKNKVMEWKKKAQEA--ICLGGSSRLNFDKMIDQVLLSN  486



>ref|XP_007226586.1| hypothetical protein PRUPE_ppa023851mg [Prunus persica]
 gb|EMJ27785.1| hypothetical protein PRUPE_ppa023851mg [Prunus persica]
Length=474

 Score =   221 bits (563),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 108/169 (64%), Positives = 141/169 (83%), Gaps = 2/169 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLANS + F W++RPD+V G+ A++PPEF+EETK+R +L++WCPQEQVL H AVG
Sbjct  307  IEFAWGLANSNQTFFWVIRPDLVGGDSAVVPPEFVEETKERSLLANWCPQEQVLSHPAVG  366

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNST+ES+C GVPM+CWPFFAEQQTNC YS  +WGI MEI+++V R+ VE +V
Sbjct  367  GFLTHSGWNSTIESVCAGVPMICWPFFAEQQTNCRYSEKEWGIDMEIESDVKRNHVEGLV  426

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLS  270
            R+LME ++G+EM++KA+E KKLA EA  T P GSS V ++K +N +LLS
Sbjct  427  RKLMEGDEGKEMRKKALEWKKLATEA--TSPNGSSFVGLDKMVNEVLLS  473



>ref|XP_008219318.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=480

 Score =   221 bits (563),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 107/169 (63%), Positives = 143/169 (85%), Gaps = 2/169 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLANS + F W++RPD+V G+ A++PPEF+E+TK+R +L++WCPQEQVL H AVG
Sbjct  313  IEFAWGLANSNQTFFWVIRPDLVGGDSAVVPPEFVEDTKERSLLANWCPQEQVLKHPAVG  372

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNST+ES+C+GVPM+CWPFFAEQQTNC YS  +WGIGMEI+++V R+ VE +V
Sbjct  373  GFLTHSGWNSTIESVCSGVPMICWPFFAEQQTNCRYSEKEWGIGMEIESDVKRNYVEGLV  432

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLS  270
            R+LME ++G+EM++KA+E KKLA EA  T P GSS + ++K +N +LLS
Sbjct  433  RKLMEGDEGKEMRKKALEWKKLATEA--TSPNGSSFLCLDKMVNQVLLS  479



>ref|XP_009351417.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Pyrus x 
bretschneideri]
Length=179

 Score =   212 bits (539),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 136/175 (78%), Gaps = 2/175 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEF WGLANS+ PF W++RPD+V G+ A+ PPEF+ ETK+R +++ WCPQEQVL H +VG
Sbjct  7    VEFGWGLANSKVPFFWVIRPDLVIGQSALSPPEFLAETKERSLIAGWCPQEQVLNHPSVG  66

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTHCGWNST+ES+  GVPMLCWPF  +QQ +C YSC +WGIGMEI N+V RDEVE++V
Sbjct  67   GFLTHCGWNSTMESLTAGVPMLCWPFCGDQQMDCRYSCNEWGIGMEISNDVKRDEVERLV  126

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK*HP  252
            RELM+ EKG++MK K M  KKLA EA  T P GSS  N+E  +N +LL   + HP
Sbjct  127  RELMDGEKGKKMKNKVMVWKKLAEEA--TGPHGSSSKNLEMLVNQVLLRKTRRHP  179



>gb|ACJ84649.1| unknown [Medicago truncatula]
Length=480

 Score =   221 bits (563),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 108/168 (64%), Positives = 139/168 (83%), Gaps = 2/168 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGL+NS+ PFLW++RPD+V GE A+LP EF+EET++RG+LSSWCPQE+VLGH ++G
Sbjct  314  IEFAWGLSNSKMPFLWVIRPDLVAGENAVLPLEFLEETQNRGLLSSWCPQEEVLGHSSIG  373

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNSTLES+C GVPM+CWPFF EQQTNC + C +WGIG+EI  +  RD++E +V
Sbjct  374  GFLTHNGWNSTLESVCGGVPMICWPFFTEQQTNCRFCCNEWGIGLEI-EDAKRDKIEILV  432

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  273
            +ELME EKG+EMK KA++ KKLA  AA   P GSS +N+E  I+ +LL
Sbjct  433  KELMEGEKGKEMKEKALQWKKLAHNAASG-PHGSSFMNLENLIHDVLL  479



>ref|XP_011069754.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Sesamum 
indicum]
Length=485

 Score =   221 bits (563),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 118/172 (69%), Positives = 146/172 (85%), Gaps = 4/172 (2%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLANS  PFLWI+RPD+V+G+ A+LPPEF+E TK+RG+L++WCPQE+VL H +VG
Sbjct  315  LEFAWGLANSNLPFLWIIRPDLVSGDKAVLPPEFLEATKERGLLANWCPQERVLRHPSVG  374

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNSTLESIC+GVPM+CWPFFAEQQTNCWY CTKW IGMEID+NV RDEVE +V
Sbjct  375  GFLTHSGWNSTLESICSGVPMICWPFFAEQQTNCWYCCTKWNIGMEIDSNVKRDEVEILV  434

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  261
            R+LM  E+G+EMKR+AME KKLA+ +A +    SS  N+EK I+ +LL+  K
Sbjct  435  RKLMIGEEGQEMKRRAMEWKKLAVASAQS----SSSENLEKVISRVLLAPSK  482



>ref|XP_007042919.1| UDP-glycosyltransferase 85A1 [Theobroma cacao]
 gb|EOX98750.1| UDP-glycosyltransferase 85A1 [Theobroma cacao]
Length=488

 Score =   221 bits (563),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 114/171 (67%), Positives = 139/171 (81%), Gaps = 2/171 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLANSQ+ FLWI+RPD+V GE A+LPP+F+ ETKDRGML+SWCPQEQVL H ++G
Sbjct  317  IEFAWGLANSQRQFLWIIRPDLVAGETAILPPDFVSETKDRGMLASWCPQEQVLKHPSIG  376

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFL+H GWNSTLES+C GVPM+CWPFFAEQQ NC ++C  WGIGMEID NV R++VEK+V
Sbjct  377  GFLSHMGWNSTLESLCCGVPMVCWPFFAEQQLNCRFACRNWGIGMEIDTNVKREDVEKLV  436

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHR  264
            REL+E EKG EMK KAME K+ A EA    P GSS  N+EK +  +L + +
Sbjct  437  RELLEGEKGMEMKTKAMEWKREAEEAIR--PGGSSFQNLEKLVAEVLQTDK  485



>ref|XP_011467660.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=479

 Score =   221 bits (562),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 111/174 (64%), Positives = 142/174 (82%), Gaps = 2/174 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEF WGLANS+  F+W++RPD+V GE A+LPPEF+ ETK+RG++++WCPQEQVL H +VG
Sbjct  307  VEFGWGLANSKVCFIWVIRPDLVVGESAILPPEFVAETKERGLIANWCPQEQVLNHPSVG  366

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTHCGWNS +ES+C GVPMLCWPFFA+QQTNCW +C +WGIGMEI+N+V RDEVEK+V
Sbjct  367  GFLTHCGWNSMIESLCAGVPMLCWPFFADQQTNCWSACNEWGIGMEINNDVKRDEVEKLV  426

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK*H  255
            R++M  EKG +M+ KA+E KKLA EA  T P GSS  N+E  +N ++L   + H
Sbjct  427  RQMMGGEKGEKMRSKALEWKKLAEEA--TAPHGSSSQNLENLVNEVMLRQTEGH  478



>ref|XP_010030029.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=489

 Score =   221 bits (563),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 141/168 (84%), Gaps = 2/168 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EF+WGLANSQKPFLWI+RPD+V G+  +LP EF+ ETKDRGML+ WCPQE+VL H +VG
Sbjct  319  IEFSWGLANSQKPFLWIIRPDLVAGDKVVLPSEFLAETKDRGMLAGWCPQERVLRHPSVG  378

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTHCGWNS LESIC GVP+LCWPFFAEQQTNC+YS  +WGIGMEIDN+V R+EVEK+V
Sbjct  379  GFLTHCGWNSMLESICGGVPVLCWPFFAEQQTNCFYSKNEWGIGMEIDNSVRREEVEKLV  438

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  273
            RELM+ EKG+ MK+KA+E K+ A EA +    GSS+ N+E  ++ +L+
Sbjct  439  RELMDGEKGKAMKKKAVEWKRKAEEATEL--GGSSYENLETLLSQVLV  484



>gb|KCW45699.1| hypothetical protein EUGRSUZ_L00503, partial [Eucalyptus grandis]
Length=443

 Score =   219 bits (559),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 136/164 (83%), Gaps = 2/164 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
             +FAWGLANSQKPFLWI+RPD+V  E A+LPPEF+EE   RGML SWC QE+VL H A+G
Sbjct  281  TKFAWGLANSQKPFLWIIRPDLVASESAVLPPEFVEEIAGRGMLVSWCQQEEVLKHGAIG  340

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNSTLES+C GVP++CWPFFAEQQTNC YSCT+WGIGMEIDN+V RDEVE +V
Sbjct  341  GFLTHSGWNSTLESLCGGVPVICWPFFAEQQTNCRYSCTEWGIGMEIDNDVKRDEVEGLV  400

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFIN  285
            RELME EKG+EM++KAME K  A   A  +P G+S+ N++K I+
Sbjct  401  RELMEGEKGKEMRKKAMEWK--AKAEAAIMPGGTSYNNVDKLIS  442



>ref|XP_008224048.1| PREDICTED: UDP-glycosyltransferase 85A2-like isoform X1 [Prunus 
mume]
Length=483

 Score =   221 bits (562),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 106/168 (63%), Positives = 136/168 (81%), Gaps = 2/168 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEF WGLANS+ PF W++RPD+V GE A+LPPEF++ETK+RG+++SWCPQEQVL H +VG
Sbjct  315  VEFGWGLANSKLPFFWVIRPDLVVGESAILPPEFVDETKERGLIASWCPQEQVLKHSSVG  374

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GW+ST+ES+C GVPMLCWP   +Q TNC+Y+C +W IGMEI   V R +VEK+V
Sbjct  375  GFLTHSGWSSTIESLCAGVPMLCWPCSTDQPTNCYYACNEWDIGMEIGKEVKRAQVEKLV  434

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  273
            +ELME EKG++MK K M+ KKLA EA  T P GSS +N++ F+N +LL
Sbjct  435  KELMEGEKGKQMKNKVMQWKKLAEEA--TSPHGSSSLNLDNFVNQVLL  480



>ref|XP_008229792.1| PREDICTED: UDP-glycosyltransferase 85A7-like [Prunus mume]
Length=484

 Score =   221 bits (562),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 111/171 (65%), Positives = 137/171 (80%), Gaps = 2/171 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEF WGLANS+ PFLWI+RPD+V G  A+LPPEF+ ETK+R +++SWCPQEQVL H ++G
Sbjct  316  VEFGWGLANSKNPFLWIIRPDLVVGASAILPPEFVAETKERALIASWCPQEQVLNHPSIG  375

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNST+ES+  GVPM+CWP FA+Q  NCWY+C +WG GMEID NV R+EVEK+V
Sbjct  376  GFLTHSGWNSTIESLSAGVPMVCWPLFADQPINCWYTCNEWGCGMEIDKNVKREEVEKLV  435

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHR  264
            RELME EKG++MK KAME KKLA EA  T P GSS  N++  +N +LL + 
Sbjct  436  RELMEGEKGKKMKNKAMEWKKLAEEA--TGPHGSSSTNLDNLVNQVLLKNN  484



>ref|XP_002302305.1| UDP-glucuronosyltransferase family protein [Populus trichocarpa]
 gb|EEE81578.1| UDP-glucuronosyltransferase family protein [Populus trichocarpa]
Length=483

 Score =   221 bits (562),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 111/172 (65%), Positives = 136/172 (79%), Gaps = 2/172 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
             EFAWGLANS + FLW++RPD+V G+ AMLPPEF+  TK+RG+ +SWC QEQVL H ++G
Sbjct  314  TEFAWGLANSDQTFLWVIRPDLVAGDSAMLPPEFVSATKERGLFASWCSQEQVLSHPSIG  373

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNST+ESIC GVPM+CWPFFAEQQTNC Y CT+WGIGMEI+++V R EVE +V
Sbjct  374  GFLTHNGWNSTIESICGGVPMICWPFFAEQQTNCRYCCTEWGIGMEINSDVKRGEVESLV  433

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  261
            RELM  EKG EMK+K  E KK+A EA  +   GSS +N++  IN +LLS R 
Sbjct  434  RELMGGEKGSEMKKKTREWKKMAEEAITS--TGSSCMNLDDMINKVLLSPRD  483



>ref|XP_004303934.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=478

 Score =   221 bits (562),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 107/168 (64%), Positives = 134/168 (80%), Gaps = 2/168 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEF WGL NSQ PFLW++RPD+V GE A+LPPEF+  TKDRG++S WCPQE+VL H +VG
Sbjct  313  VEFGWGLVNSQLPFLWVIRPDLVVGESAILPPEFVANTKDRGLVSRWCPQEEVLNHPSVG  372

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNST+ES+  GVPMLCWP F +QQTNC+Y+C +WGIGME+ ++V RDEVE++V
Sbjct  373  GFLTHSGWNSTIESVAAGVPMLCWPLFGDQQTNCYYTCNEWGIGMEMSSDVKRDEVERLV  432

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  273
            +E ME EKG +M+ KAME KK A EA  T P GSS  N++  +N +LL
Sbjct  433  KEFMEGEKGEKMRHKAMEWKKHAEEA--TAPNGSSSKNLDDLVNQVLL  478



>ref|XP_009341756.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Pyrus x 
bretschneideri]
Length=485

 Score =   221 bits (562),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 106/172 (62%), Positives = 140/172 (81%), Gaps = 1/172 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
             EFAWGLAN +K FLW++RPD+V G+ A++P EF+EETKDR +++SWCPQEQVL H A+G
Sbjct  313  TEFAWGLANCKKTFLWVIRPDLVGGDSAVVPQEFVEETKDRSLMASWCPQEQVLSHPAIG  372

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTHCGWNSTLES+C GVPM+CWPFFAEQQTNC +SC + GIG+EI+ +V R  VE +V
Sbjct  373  GFLTHCGWNSTLESVCGGVPMVCWPFFAEQQTNCRFSCKELGIGLEIEGDVKRKYVEGLV  432

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  261
            R+LM+ ++G+EM++KA+E KKLA EA+   P G S V+ +  +N +LLS +K
Sbjct  433  RKLMDGKEGKEMRKKALEWKKLAKEASSG-PNGLSFVDFDTMVNQVLLSQKK  483



>ref|XP_007222804.1| hypothetical protein PRUPE_ppa005043mg [Prunus persica]
 gb|EMJ24003.1| hypothetical protein PRUPE_ppa005043mg [Prunus persica]
Length=480

 Score =   221 bits (562),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 107/169 (63%), Positives = 140/169 (83%), Gaps = 2/169 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLANS + F W++RPD+V G+ A++PPEF+EETK+R +L++WCPQEQVL H AVG
Sbjct  313  IEFAWGLANSNQTFFWVIRPDLVGGDSAVVPPEFVEETKERSLLANWCPQEQVLSHPAVG  372

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNST+ES+C GVPM+CWPFFAEQQTNC YS  +W IGMEI+++V R+ VE +V
Sbjct  373  GFLTHSGWNSTIESVCAGVPMICWPFFAEQQTNCRYSEKEWAIGMEIESDVKRNYVEGLV  432

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLS  270
            R+LME ++G+EM++KA+E KKLA EA    P GSS V ++K +N +LLS
Sbjct  433  RKLMEGDEGKEMRKKALEWKKLATEAIS--PNGSSFVGLDKMVNQVLLS  479



>ref|XP_010273031.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Nelumbo 
nucifera]
Length=483

 Score =   220 bits (561),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 109/169 (64%), Positives = 140/169 (83%), Gaps = 2/169 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEFAWGLANS   FLW++RPD+V G+ A+LPP+F+ +T++RG+L+SWCPQEQVL H ++G
Sbjct  316  VEFAWGLANSNXTFLWVIRPDLVVGDSALLPPKFITDTRERGLLASWCPQEQVLNHPSIG  375

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
             FLTH GWNST+ESIC GVPM+CWPFFAEQQTNC Y CT+WG+GMEID+NV RDEVE +V
Sbjct  376  AFLTHNGWNSTIESICGGVPMICWPFFAEQQTNCRYVCTEWGMGMEIDSNVKRDEVESLV  435

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLS  270
            +++ME EKG+EMK++ +E KK A EA  T   GSS+ N++K I  +LLS
Sbjct  436  KQIMEGEKGKEMKKRTLEWKKKAEEA--TYQDGSSYSNLDKMIKEVLLS  482



>ref|XP_008229471.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Prunus mume]
Length=386

 Score =   218 bits (554),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/168 (65%), Positives = 135/168 (80%), Gaps = 2/168 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEF WGLANS+ PF W++RPD+V GE A+LPPEF+ ETK+R +++ WCPQEQVL H +VG
Sbjct  218  VEFGWGLANSRLPFFWVIRPDLVIGESAILPPEFVAETKERSLIAGWCPQEQVLNHPSVG  277

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNST+ES+  GVPMLCWPFF +QQ +C Y+C +WGIGMEI N+V RDEVEK+V
Sbjct  278  GFLTHSGWNSTVESLTAGVPMLCWPFFGDQQMDCRYTCNEWGIGMEISNDVKRDEVEKLV  337

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  273
            +ELME EKG++MK K ME KKLA EA  T P GSS  N++  +N +LL
Sbjct  338  KELMEGEKGKKMKNKVMEWKKLAEEA--TGPHGSSSTNLDNLVNQVLL  383



>ref|XP_010039816.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=487

 Score =   220 bits (560),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 141/168 (84%), Gaps = 2/168 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EF+WGLANSQKPFLWI+RPD+V G+  +LP EF+ ETKDRGML+ WCPQE+VL H +VG
Sbjct  317  IEFSWGLANSQKPFLWIIRPDLVAGDKVVLPSEFLAETKDRGMLAGWCPQERVLRHPSVG  376

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTHCGWNS LESIC GVP+LCWPFFAEQQTNC+Y+  +WGIGMEIDN+V R+EVEK+V
Sbjct  377  GFLTHCGWNSMLESICGGVPVLCWPFFAEQQTNCFYTKNEWGIGMEIDNSVRREEVEKLV  436

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  273
            RELM+ EKG+ MK+KA+E K+ A EA +    GSS+ N+E  ++ +L+
Sbjct  437  RELMDGEKGKAMKKKAVEWKRKAEEATEL--GGSSYENLETLLSQVLV  482



>gb|KCW66540.1| hypothetical protein EUGRSUZ_F00337 [Eucalyptus grandis]
Length=460

 Score =   219 bits (558),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 111/172 (65%), Positives = 139/172 (81%), Gaps = 2/172 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEFAWGLANS + FLW++RPD++ G  A+LPP+F+  T++R +L+SWCPQE+VL H AVG
Sbjct  290  VEFAWGLANSGQVFLWVIRPDLIIGNTAILPPDFLAATRERSLLASWCPQERVLSHSAVG  349

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTHC WNST+ESI   VP+ CWPFF +QQTNC YSC +WGIGMEID++V RDEVE+ V
Sbjct  350  GFLTHCRWNSTIESIAASVPVACWPFFGDQQTNCRYSCQEWGIGMEIDSDVRRDEVERQV  409

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  261
            RELME E+G+EMKRKAME ++ A EA  T P GSS +N+E  IN +LLS R+
Sbjct  410  RELMEGERGKEMKRKAMEWQETAREA--TRPSGSSFLNLEGVINEVLLSPRR  459



>ref|XP_006388792.1| hypothetical protein POPTR_0098s002202g, partial [Populus trichocarpa]
 gb|ERP47706.1| hypothetical protein POPTR_0098s002202g, partial [Populus trichocarpa]
Length=332

 Score =   216 bits (549),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/174 (63%), Positives = 138/174 (79%), Gaps = 2/174 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEF  GL+ S  PFLWI+RPDM+T + A+LPPEF EETK+RG + SWCPQE+VL H ++G
Sbjct  141  VEFGMGLSKSGHPFLWIIRPDMITDDSAILPPEFTEETKERGFICSWCPQEEVLNHPSIG  200

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTHCGW ST+ESI +GV MLCWP F +QQTNC Y+C +W IGMEID+NV R+ VEK V
Sbjct  201  GFLTHCGWGSTIESISSGVTMLCWPSFGDQQTNCRYTCNEWAIGMEIDSNVTRENVEKQV  260

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK*H  255
            RELME E+G++MK+KAME K+LA+EA  T P GSS +N++K +  +LLS  + H
Sbjct  261  RELMEGEQGKKMKKKAMEWKRLALEA--TRPSGSSSMNLDKLVTEVLLSRNQTH  312



>dbj|BAF49299.1| putative glycosyltransferase [Clitoria ternatea]
Length=482

 Score =   220 bits (560),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 133/168 (79%), Gaps = 2/168 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLANS++PFLWI+RPD+V G   +L  EF+ ET DRG+++SWCPQEQVL H +VG
Sbjct  311  LEFAWGLANSKRPFLWIIRPDLVIGGSVILSSEFVNETSDRGLIASWCPQEQVLNHPSVG  370

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTHCGWNST+ESIC GVPMLCWPFFA+Q TNC   C +W IGME+D NV R+EVEK+V
Sbjct  371  GFLTHCGWNSTIESICAGVPMLCWPFFADQPTNCRSICNEWNIGMELDTNVKREEVEKLV  430

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  273
             ELME EKG +MK K MELKK A E  DT P G SH N++K  N +LL
Sbjct  431  NELMEGEKGNKMKEKVMELKKKAEE--DTRPGGLSHTNLDKVTNEMLL  476



>ref|XP_004303931.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=488

 Score =   220 bits (560),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/167 (65%), Positives = 137/167 (82%), Gaps = 2/167 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEF WGLANS   F+W++RPD+V GE A+LPPEF+ ETK+RG+++SWCPQEQVL H +VG
Sbjct  320  VEFGWGLANSNVSFIWVIRPDLVLGESAILPPEFVAETKERGLIASWCPQEQVLNHPSVG  379

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTHCGWNS +ES+C GVPMLCWPFFA+QQTNCWY+C +WGIGMEI N+V RDEVEK+V
Sbjct  380  GFLTHCGWNSMIESLCAGVPMLCWPFFADQQTNCWYACNEWGIGMEISNDVKRDEVEKLV  439

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLL  276
            +ELM+ E G +M+ KA+E KKLA +A  T P  SS  N++  +N +L
Sbjct  440  KELMKGEMGVKMRNKALEWKKLAEDA--TAPHASSSKNLDNVVNLML  484



>ref|XP_010060020.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=486

 Score =   220 bits (560),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 114/172 (66%), Positives = 141/172 (82%), Gaps = 2/172 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEFAWGLANS + FLW++RPD+V G+ A+LP EF   T++R +L+SWCPQE+VL H AVG
Sbjct  316  VEFAWGLANSGQMFLWVIRPDLVVGDTAILPSEFSATTRERSLLASWCPQERVLNHPAVG  375

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNST+ESI  GVPMLCWPFFAEQQTNC YSC +WGIGMEID +V RD+VEK V
Sbjct  376  GFLTHSGWNSTIESITAGVPMLCWPFFAEQQTNCRYSCEEWGIGMEIDGDVKRDKVEKQV  435

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  261
            RELME E G+EMKRKAME +++A EA  T P GSS +N+++ ++ +LLS R+
Sbjct  436  RELMEGETGKEMKRKAMEWQEMAREA--TRPSGSSCLNLDEVMDKVLLSPRR  485



>ref|XP_009377940.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Pyrus x 
bretschneideri]
Length=491

 Score =   220 bits (560),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 112/170 (66%), Positives = 139/170 (82%), Gaps = 2/170 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEF WGLANS+ PF W++RPD+V GE  +L P+F  ETK++G+++SWCPQEQVL H +VG
Sbjct  318  VEFGWGLANSKLPFFWVIRPDLVIGESGILSPDFFAETKEKGLIASWCPQEQVLNHPSVG  377

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNST+ES+  GVPMLCWPFF++QQTNC+Y+C KWGIGMEIDN+V RDEVEK+V
Sbjct  378  GFLTHSGWNSTMESLTAGVPMLCWPFFSDQQTNCYYTCNKWGIGMEIDNDVKRDEVEKLV  437

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSH  267
            RELME EKG +MK KA+E KKLA EA  T P GSS  N++  +  LLL++
Sbjct  438  RELMEGEKGNKMKNKAIEWKKLAEEA--TGPHGSSSKNLDNLVKQLLLNN  485



>gb|KCW66542.1| hypothetical protein EUGRSUZ_F00339 [Eucalyptus grandis]
Length=460

 Score =   219 bits (558),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 112/172 (65%), Positives = 141/172 (82%), Gaps = 2/172 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEFAWGLANS + FLW++RPD+V G  A+LPP+F+  T++R +L+SWCPQE+VL H AVG
Sbjct  290  VEFAWGLANSGQVFLWVIRPDLVIGNTAILPPDFLAATRERSLLASWCPQERVLSHSAVG  349

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTHCGWNS +ESI   VP++CWPFFA+QQTNC YSC +WGIGMEIDN+V RDEVE+ V
Sbjct  350  GFLTHCGWNSIIESIEASVPVVCWPFFADQQTNCRYSCQEWGIGMEIDNDVRRDEVERQV  409

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  261
            RELME  +G+EMKRK ME K++A EA  T P GSS +N+++ IN +LLS R+
Sbjct  410  RELMEGGRGKEMKRKVMEWKEMAREA--THPSGSSFLNLDEVINKVLLSPRR  459



>gb|AFJ52992.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=491

 Score =   220 bits (560),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 108/172 (63%), Positives = 139/172 (81%), Gaps = 1/172 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEFAWGLANS+K FLW++RPD+V GE A+LPPEF+ +T+DRG+L+SWCPQEQVL H++V 
Sbjct  320  VEFAWGLANSKKDFLWVIRPDLVAGETAVLPPEFVAKTRDRGLLASWCPQEQVLNHESVA  379

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNSTLES+  GVPM+CWPFFAEQQTNCW++C +WG+GMEI+++V RDEVE  V
Sbjct  380  GFLTHNGWNSTLESVSAGVPMICWPFFAEQQTNCWFACNEWGVGMEINSDVKRDEVEAQV  439

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  261
            REL++  KG EM++KA E K++A EA  T   GSS   ++  I  +LLS  +
Sbjct  440  RELVDGRKGGEMRKKAAEWKRIAAEAV-TGGGGSSFAGLDSLIERVLLSSSR  490



>gb|ABW96222.1| glucosyltransferase [Linum usitatissimum]
Length=491

 Score =   220 bits (560),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 108/172 (63%), Positives = 139/172 (81%), Gaps = 1/172 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEFAWGLANS+K FLW++RPD+V GE A+LPPEF+ +T+DRG+L+SWCPQEQVL H++V 
Sbjct  320  VEFAWGLANSKKDFLWVIRPDLVAGETAVLPPEFVAKTRDRGLLASWCPQEQVLNHESVA  379

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNSTLES+  GVPM+CWPFFAEQQTNCW++C +WG+GMEI+++V RDEVE  V
Sbjct  380  GFLTHNGWNSTLESVSAGVPMICWPFFAEQQTNCWFACNEWGVGMEINSDVKRDEVEAQV  439

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  261
            REL++  KG EM++KA E K++A EA  T   GSS   ++  I  +LLS  +
Sbjct  440  RELVDGRKGGEMRKKAAEWKRIAAEAV-TGGGGSSFAGLDSLIERVLLSSSR  490



>ref|XP_008219322.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=483

 Score =   219 bits (559),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/172 (63%), Positives = 140/172 (81%), Gaps = 1/172 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLANS   FLW +RPD+V GE A++P EF++ETK+R +L++WCPQEQVL H A+G
Sbjct  313  IEFAWGLANSMHTFLWAIRPDLVGGESAVVPKEFVDETKERSLLANWCPQEQVLSHPAIG  372

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNSTLES+C GVPM+CWPFFAEQQTNC +SC +WGIG+EID +V RD VE +V
Sbjct  373  GFLTHSGWNSTLESVCGGVPMICWPFFAEQQTNCRFSCREWGIGLEIDPDVKRDYVEGLV  432

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  261
            R+LME E+G+EM++K +E KKLA EA  T P G S V+ EK ++ ++L+ RK
Sbjct  433  RKLMEGEEGKEMRKKTLEWKKLAKEAT-TGPSGLSFVDFEKVVSQVILAQRK  483



>gb|AIL51400.1| glycosyltransferase [Actinidia deliciosa]
Length=484

 Score =   219 bits (559),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 113/171 (66%), Positives = 141/171 (82%), Gaps = 1/171 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEFAWGLANS + FLWI+RPD+V GE A+LPPEF+  TK+RGML+SW PQE+VL H +VG
Sbjct  314  VEFAWGLANSNQSFLWIIRPDLVVGESAVLPPEFVAVTKERGMLASWAPQEEVLAHSSVG  373

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTHCGWNSTLESI +GV ++CWPFFAEQQTNCWY C + GIGMEID++V R+EVE++V
Sbjct  374  GFLTHCGWNSTLESISSGVAVVCWPFFAEQQTNCWYCCGELGIGMEIDSDVKREEVERLV  433

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHR  264
            RELM  EKG+EMK +AM  K+LA EA  +   GSS +N++K ++ +LLS R
Sbjct  434  RELMVGEKGKEMKERAMGWKRLAEEATQS-SSGSSFLNLDKLVHQVLLSPR  483



>ref|XP_010060016.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=480

 Score =   219 bits (559),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 111/172 (65%), Positives = 139/172 (81%), Gaps = 2/172 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEFAWGLANS + FLW++RPD++ G  A+LPP+F+  T++R +L+SWCPQE+VL H AVG
Sbjct  310  VEFAWGLANSGQVFLWVIRPDLIIGNTAILPPDFLAATRERSLLASWCPQERVLSHSAVG  369

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTHC WNST+ESI   VP+ CWPFF +QQTNC YSC +WGIGMEID++V RDEVE+ V
Sbjct  370  GFLTHCRWNSTIESIAASVPVACWPFFGDQQTNCRYSCQEWGIGMEIDSDVRRDEVERQV  429

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  261
            RELME E+G+EMKRKAME ++ A EA  T P GSS +N+E  IN +LLS R+
Sbjct  430  RELMEGERGKEMKRKAMEWQETAREA--TRPSGSSFLNLEGVINEVLLSPRR  479



>ref|XP_007141198.1| hypothetical protein PHAVU_008G175300g [Phaseolus vulgaris]
 gb|ESW13192.1| hypothetical protein PHAVU_008G175300g [Phaseolus vulgaris]
Length=484

 Score =   219 bits (559),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 107/168 (64%), Positives = 137/168 (82%), Gaps = 2/168 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEFAWGL NS K FLW++RPD+V GE  +LPPEF+E+TK+RG+LSSWC QEQVL H A+G
Sbjct  311  VEFAWGLGNSNKTFLWVIRPDLVAGENVVLPPEFVEQTKNRGLLSSWCSQEQVLNHPAIG  370

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNSTLES+C GVPM+CWPFFAEQQTNC + C +WGIGMEI  +V RD++E +V
Sbjct  371  GFLTHSGWNSTLESVCAGVPMICWPFFAEQQTNCRFCCKEWGIGMEI-EDVKRDKIESLV  429

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  273
            +ELM+ EKG++MK KA++ KKLA  AA   P G+S +N++  ++ +LL
Sbjct  430  KELMDGEKGKQMKEKALQWKKLAKSAASG-PYGTSFLNLDNMVHEVLL  476



>ref|XP_007141200.1| hypothetical protein PHAVU_008G175500g [Phaseolus vulgaris]
 gb|ESW13194.1| hypothetical protein PHAVU_008G175500g [Phaseolus vulgaris]
Length=484

 Score =   219 bits (558),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 107/168 (64%), Positives = 138/168 (82%), Gaps = 2/168 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEFAWGL NS K FLW++RPD+V GE A+LPPEF+++TK+RG+LSSWC QEQVL H A+G
Sbjct  311  VEFAWGLGNSNKSFLWVIRPDLVAGENAILPPEFVKQTKNRGLLSSWCSQEQVLNHPAIG  370

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNSTLES+C GVPM+CWPFFAEQQTNC + C +WGIGMEI  +V RD++E +V
Sbjct  371  GFLTHSGWNSTLESVCAGVPMICWPFFAEQQTNCRFCCKEWGIGMEI-EDVKRDKIESLV  429

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  273
            +ELM+ EKG++MK KA++ KKLA  AA   P G+S +N++  ++ +LL
Sbjct  430  KELMDGEKGKQMKEKALQWKKLAKTAASG-PYGTSFLNLDNMVHEVLL  476



>ref|XP_009349618.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Pyrus x 
bretschneideri]
Length=485

 Score =   219 bits (559),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/168 (65%), Positives = 138/168 (82%), Gaps = 2/168 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEF WGLANS+ PF W++RPD+V GE A+LPPEF+ ETK+R +++SWCPQEQVL H +VG
Sbjct  317  VEFGWGLANSKLPFFWVIRPDLVIGESAILPPEFVAETKERSLVASWCPQEQVLNHPSVG  376

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNST+ES+ +GVPMLCWPFFA+QQ +C Y+C +W +GMEI N+V RDEVEK+V
Sbjct  377  GFLTHSGWNSTVESLTSGVPMLCWPFFADQQMDCRYTCKEWDVGMEIGNDVKRDEVEKLV  436

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  273
            RELM+ EKG++MK +AME KKLA EA  T P GSS  N++  +N +LL
Sbjct  437  RELMDGEKGKKMKNRAMEWKKLAEEA--TSPYGSSSKNLDNLVNQVLL  482



>ref|XP_008245954.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Prunus mume]
Length=485

 Score =   219 bits (559),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 111/168 (66%), Positives = 135/168 (80%), Gaps = 2/168 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEF WGLANS+ PF W++RPD+V GE A+LPPEF+ ETK R +++ WCPQEQVL H +VG
Sbjct  317  VEFGWGLANSKLPFFWVIRPDLVIGESAILPPEFVAETKGRSLIAGWCPQEQVLNHPSVG  376

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNST+ESI  GVPMLCWPFFA+QQ +C Y+C +WGIGMEI N+V RDEVEK+V
Sbjct  377  GFLTHSGWNSTVESITAGVPMLCWPFFADQQMDCRYTCNEWGIGMEISNDVKRDEVEKLV  436

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  273
            +ELME EKG++MK K ME KKLA EA  T P GSS  N++  +N +LL
Sbjct  437  KELMEGEKGKKMKNKVMEWKKLAEEA--TGPHGSSSTNLDNLVNQVLL  482



>ref|XP_007042950.1| UDP-glycosyltransferase 85A1 [Theobroma cacao]
 gb|EOX98781.1| UDP-glycosyltransferase 85A1 [Theobroma cacao]
Length=496

 Score =   219 bits (559),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 116/171 (68%), Positives = 139/171 (81%), Gaps = 2/171 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEFAWGLANS+K FLWI+RPD+V GE A+LPPEF+ ETKDRGML+SWCPQEQVL H ++G
Sbjct  316  VEFAWGLANSKKQFLWIMRPDLVAGEAAILPPEFVSETKDRGMLASWCPQEQVLKHPSIG  375

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFL+H GWNST+ESI  GVPMLC P  A+QQTNC  +CT+WGIGMEIDNNV RD+VE +V
Sbjct  376  GFLSHMGWNSTIESISAGVPMLCLPVLADQQTNCRLACTEWGIGMEIDNNVKRDQVEMLV  435

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHR  264
            RELME +KG EMK  A+E KK A EA+   P G S  N++K +NH+LLS +
Sbjct  436  RELMEGDKGVEMKANALEWKKKAAEASR--PGGGSFENLDKLLNHVLLSDK  484



>ref|XP_009377941.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Pyrus x 
bretschneideri]
Length=485

 Score =   219 bits (558),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 109/168 (65%), Positives = 138/168 (82%), Gaps = 2/168 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEF WGLANS+ PF W++RPD+V GE  +LPPEF+ ETK+R +++SWCPQEQVL H +VG
Sbjct  317  VEFGWGLANSKLPFFWVIRPDLVIGESMILPPEFVAETKERSLVASWCPQEQVLNHPSVG  376

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNST+ES+ +GVPMLCWPFFA+QQ +C Y+C +WG+GMEI N+V RDEVEK+V
Sbjct  377  GFLTHSGWNSTVESLTSGVPMLCWPFFADQQMDCRYTCKEWGVGMEIGNDVKRDEVEKLV  436

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  273
            RELM+ EKG++MK +AME KKLA EA  T P GSS  N++  +N +LL
Sbjct  437  RELMDGEKGKKMKNRAMEWKKLAEEA--TSPYGSSSKNLDNLVNQVLL  482



>ref|XP_006433961.1| hypothetical protein CICLE_v10000958mg [Citrus clementina]
 gb|ESR47201.1| hypothetical protein CICLE_v10000958mg [Citrus clementina]
Length=489

 Score =   219 bits (559),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 147/169 (87%), Gaps = 1/169 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLANS++ F+W++RPD+V G+ A+LPPEF+ ETK+R +L+SWCPQEQVL H A+G
Sbjct  316  IEFAWGLANSKQTFMWVIRPDLVVGDSAILPPEFVTETKERSLLASWCPQEQVLNHPAIG  375

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNSTLESIC GVP++CWPFFAEQQTNC YSC +WGIGMEID+NV R+EVE +V
Sbjct  376  GFLTHSGWNSTLESICGGVPLICWPFFAEQQTNCRYSCREWGIGMEIDSNVKREEVEVLV  435

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLS  270
            R+LM  EKG+EMK KA+ELKK A EAA T P+GSS+VN+EK I H+LLS
Sbjct  436  RDLMVGEKGQEMKLKALELKKKAKEAA-TGPVGSSYVNLEKLITHVLLS  483



>gb|KDP37429.1| hypothetical protein JCGZ_07956 [Jatropha curcas]
Length=497

 Score =   219 bits (559),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 106/169 (63%), Positives = 142/169 (84%), Gaps = 2/169 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EF  GL NS+ PFLWI+RPD+V G+  +LPPEF+E TK+RG+++SWCPQE+VL H ++G
Sbjct  329  IEFGMGLTNSKHPFLWIIRPDLVIGDSGILPPEFVEYTKERGLIASWCPQEEVLNHSSIG  388

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTHCGW ST+ES+  GVPMLCWPFFA+Q TNC Y+C +WG+GMEID+NV RDE+EK+V
Sbjct  389  GFLTHCGWGSTIESLSAGVPMLCWPFFADQPTNCRYTCCEWGVGMEIDSNVKRDEIEKLV  448

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLS  270
            RELME EK ++++ +AME +KLA+EA  T P GSS +N++K ++H+LLS
Sbjct  449  RELMEGEKCKKLRNRAMEWRKLAIEA--TSPTGSSSLNLDKLVSHVLLS  495



>ref|XP_010060023.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
 gb|KCW66547.1| hypothetical protein EUGRSUZ_F00343 [Eucalyptus grandis]
Length=486

 Score =   219 bits (558),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 111/172 (65%), Positives = 142/172 (83%), Gaps = 2/172 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEFAWGLANS + FLW++RPD+V G+ A+LP EF   T++R +L+SWCPQE+VL H AVG
Sbjct  316  VEFAWGLANSCQTFLWVIRPDLVVGDMAILPSEFSATTRERSLLASWCPQERVLNHPAVG  375

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNST+ESI  GVP+LCWPFFAEQQTNC YSC +WGIGMEID +V RD+VE+ V
Sbjct  376  GFLTHSGWNSTIESITAGVPVLCWPFFAEQQTNCRYSCEEWGIGMEIDGDVKRDKVERQV  435

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  261
            RELME E+G+EMKRKAME +++A EA  T P GSS++N+++ ++ +LL  R+
Sbjct  436  RELMEGERGKEMKRKAMEWQQMAREA--TRPSGSSYLNLDEVMDKVLLLPRR  485



>ref|XP_011467653.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like isoform 
X2 [Fragaria vesca subsp. vesca]
Length=462

 Score =   218 bits (556),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 104/172 (60%), Positives = 137/172 (80%), Gaps = 2/172 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLANS+ PFLW++RPD++ GE A+LPPEF+ ETK+RG+++SWCPQEQVL H  VG
Sbjct  290  MEFAWGLANSKLPFLWVIRPDLIAGESAILPPEFVAETKERGLIASWCPQEQVLNHPTVG  349

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNST+ESI  GVPMLCWP   +Q+ NC Y+C +WGIGMEI N+V RD+V+K+V
Sbjct  350  GFLTHSGWNSTMESISAGVPMLCWPLLGDQRINCRYTCYEWGIGMEISNDVKRDKVKKLV  409

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  261
             ELM+ EKG+E+K K M  KKLA +A+   P+GSSH+ ++  +N +LL   +
Sbjct  410  EELMKGEKGKELKNKVMIWKKLAEDASS--PLGSSHIALDNLVNQVLLRKAR  459



>ref|XP_009349615.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Pyrus x 
bretschneideri]
Length=485

 Score =   219 bits (558),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 110/168 (65%), Positives = 138/168 (82%), Gaps = 2/168 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEF WGLANS+ PF W++RPD+V GE A+LPPEF+ ETK+R +++SWCPQEQVL H +VG
Sbjct  317  VEFGWGLANSKLPFFWVIRPDLVIGESAILPPEFVAETKERSLIASWCPQEQVLNHPSVG  376

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNST+ES+ +GVPMLCWPFFA+QQ +C Y+C +WG+GMEI N+V RDEVEK+V
Sbjct  377  GFLTHSGWNSTVESLTSGVPMLCWPFFADQQMDCHYTCKEWGVGMEISNDVKRDEVEKLV  436

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  273
            RELM  EKG++MK KAME KKLA EA  T P GSS  N++  ++ +LL
Sbjct  437  RELMAGEKGKKMKNKAMEWKKLAEEA--TSPHGSSSKNLDNLVHQVLL  482



>ref|XP_009350671.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Pyrus x 
bretschneideri]
Length=489

 Score =   219 bits (558),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 110/170 (65%), Positives = 137/170 (81%), Gaps = 2/170 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEFAWGLANS+ PF W++RPD+V GE A+L  EF+ ETKDRG+++SWCPQEQVL H +VG
Sbjct  319  VEFAWGLANSKLPFFWVIRPDLVVGESAILSAEFVAETKDRGLIASWCPQEQVLSHPSVG  378

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNS +ES+C GVPMLCWPFFA+QQTN W +C +W IGMEI N+V R EVEK+V
Sbjct  379  GFLTHSGWNSVVESLCAGVPMLCWPFFADQQTNTWCACNEWDIGMEISNDVKRVEVEKLV  438

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSH  267
            RELME EKG++MK K M+ KKLA E+  T P GSS  N++  +N++LL +
Sbjct  439  RELMEGEKGKKMKIKVMQWKKLAEES--TSPNGSSSTNLDNLVNNVLLRN  486



>ref|XP_010064217.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=485

 Score =   219 bits (558),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 112/172 (65%), Positives = 141/172 (82%), Gaps = 2/172 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEFAWGLANS + FLW++RPD+V G  A+LPP+F+  T++R +L+SWCPQE+VL H AVG
Sbjct  315  VEFAWGLANSGQVFLWVIRPDLVIGNTAILPPDFLAATRERSLLASWCPQERVLSHSAVG  374

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTHCGWNS +ESI   VP++CWPFFA+QQTNC YSC +WGIGMEIDN+V RDEVE+ V
Sbjct  375  GFLTHCGWNSIIESIEASVPVVCWPFFADQQTNCRYSCQEWGIGMEIDNDVRRDEVERQV  434

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  261
            RELME  +G+EMKRK ME K++A EA  T P GSS +N+++ IN +LLS R+
Sbjct  435  RELMEGGRGKEMKRKVMEWKEMAREA--THPSGSSFLNLDEVINKVLLSPRR  484



>ref|XP_007141191.1| hypothetical protein PHAVU_008G174700g [Phaseolus vulgaris]
 gb|ESW13185.1| hypothetical protein PHAVU_008G174700g [Phaseolus vulgaris]
Length=491

 Score =   219 bits (558),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 110/167 (66%), Positives = 136/167 (81%), Gaps = 2/167 (1%)
 Frame = -3

Query  773  EFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVGG  594
            EFAWGLANS K FLW++RPD+V GE  +LPPEF+E+TKDRG LSSWCPQEQVL H A+GG
Sbjct  321  EFAWGLANSNKSFLWVIRPDVVGGENVVLPPEFVEQTKDRGFLSSWCPQEQVLAHPAIGG  380

Query  593  FLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvvR  414
            FLTH GWNSTLES+C GVPM+CWPFFAEQQTNC + C +WGIG+EI  +V RD++E++VR
Sbjct  381  FLTHSGWNSTLESVCGGVPMICWPFFAEQQTNCRFCCKEWGIGLEI-EDVKRDKIERLVR  439

Query  413  ELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  273
            ELM+ EKG+EMK KA++ K LA+ A    P GSS +N+E  I  +L+
Sbjct  440  ELMDGEKGKEMKEKAIQWKDLAVSATYG-PHGSSFLNLENMIREVLV  485



>ref|XP_003618644.1| Cytokinin-O-glucosyltransferase [Medicago truncatula]
 gb|AES74862.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=485

 Score =   219 bits (557),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 111/171 (65%), Positives = 136/171 (80%), Gaps = 2/171 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLANS+KPFLWI+RPD+V G   +L  +F+ ET DRG+++SWCPQE+VL H +VG
Sbjct  317  LEFAWGLANSKKPFLWIIRPDLVIGGSVILSSDFVNETSDRGVIASWCPQEKVLNHPSVG  376

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTHCGWNST+ESIC GVPMLCWPFFAEQ TNC Y C +W IG EID NV R+EVEK++
Sbjct  377  GFLTHCGWNSTMESICAGVPMLCWPFFAEQPTNCRYICNEWEIGAEIDTNVKREEVEKLI  436

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHR  264
             ELM  +KG++M++KAMELKK A E  DT P G S+VN+EK I  +LL   
Sbjct  437  NELMVGDKGKKMRQKAMELKKKAEE--DTRPGGCSYVNLEKVIKEVLLKQN  485



>gb|KJB59011.1| hypothetical protein B456_009G235700 [Gossypium raimondii]
Length=483

 Score =   219 bits (557),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 113/165 (68%), Positives = 138/165 (84%), Gaps = 1/165 (1%)
 Frame = -3

Query  773  EFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVGG  594
            EFAWGLANS++PFLW++RPD+V  E A++P EF+ ETKDRGML++WCPQEQVL H +VGG
Sbjct  315  EFAWGLANSKQPFLWVIRPDLVGDESAVVPAEFVAETKDRGMLATWCPQEQVLNHPSVGG  374

Query  593  FLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvvR  414
            FLTH GWNST+ESI  GVPM CWPFFAEQQTNCWYSCTKWGIG EIDNNV RDEVE +VR
Sbjct  375  FLTHSGWNSTIESISGGVPMTCWPFFAEQQTNCWYSCTKWGIGEEIDNNVKRDEVESLVR  434

Query  413  ELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHL  279
            EL++ EKG++MK+KA+E ++ A +AA     GSS+ N++K I  L
Sbjct  435  ELIKGEKGKDMKKKAVEWERKA-KAATVNSDGSSYRNLDKIIQLL  478



>gb|AFJ52993.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=501

 Score =   219 bits (558),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 114/166 (69%), Positives = 136/166 (82%), Gaps = 2/166 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEFAWGLANS+K FLWI+RPD+V GE A+LP EF  ET+DRGML+SWCPQE+VL H A+G
Sbjct  326  VEFAWGLANSKKTFLWIIRPDLVRGESALLPEEFAAETRDRGMLASWCPQEEVLKHPAIG  385

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFL+H GWNSTL+S+CNGVPM+CWPFFAEQQTNCW++C  WGIGMEID+NV R EVE++V
Sbjct  386  GFLSHMGWNSTLDSLCNGVPMVCWPFFAEQQTNCWFACGVWGIGMEIDSNVKRGEVEELV  445

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHL  279
            RELME  KG+EMK KA E KKLA  AA   P GSS  + ++ +  L
Sbjct  446  RELMEGGKGKEMKLKAEEWKKLAAAAAQ--PGGSSRRSFDELVELL  489



>ref|XP_011014886.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like isoform 
X1 [Populus euphratica]
Length=488

 Score =   219 bits (557),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 112/172 (65%), Positives = 136/172 (79%), Gaps = 2/172 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EF  GL  S  PFLWI+RPDM+ G+ A+LPPEF EETKDR  +SSWCPQE+VL H +VG
Sbjct  315  IEFGMGLVKSGHPFLWIIRPDMIAGDCAILPPEFTEETKDRCFISSWCPQEEVLDHPSVG  374

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTHCGW ST+ESI +GVPMLC PF  +QQTNC Y+CTKWGIGMEID+NV  D VEK+V
Sbjct  375  GFLTHCGWGSTIESISSGVPMLCLPFAGDQQTNCRYTCTKWGIGMEIDSNVKSDNVEKLV  434

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  261
            RELME ++G++MK KA E KKLA EA+   P GSS +N++K +  +LLS RK
Sbjct  435  RELMEGDRGKKMKDKATEWKKLAEEASG--PTGSSTMNLDKLVKEVLLSRRK  484



>gb|KHN34757.1| UDP-glycosyltransferase 85A2 [Glycine soja]
Length=459

 Score =   218 bits (554),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 107/168 (64%), Positives = 137/168 (82%), Gaps = 2/168 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLANS K FLW++RPD+V GE A+LP EF+++T+ RG+LSSWC QEQVL H A+G
Sbjct  286  IEFAWGLANSNKTFLWVIRPDLVAGENALLPSEFVKQTEKRGLLSSWCSQEQVLTHPAIG  345

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNSTLES+C GVPM+CWPFFAEQQTNCW+ C +WGIG+EI  +V RD++E +V
Sbjct  346  GFLTHSGWNSTLESVCGGVPMICWPFFAEQQTNCWFCCKEWGIGLEI-EDVERDKIESLV  404

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  273
            RELM+ EKG+EMK KA++ K+LA  AA   P+GSS  N++  +  +LL
Sbjct  405  RELMDGEKGKEMKEKALQWKELAKSAAFG-PVGSSFANLDNMVRDVLL  451



>gb|AFK37311.1| unknown [Medicago truncatula]
Length=480

 Score =   218 bits (556),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 107/168 (64%), Positives = 137/168 (82%), Gaps = 2/168 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGL+NS+ PFLW++RPD+V GE A+LP EF+EET++RG+LSSWCPQE+VLGH ++G
Sbjct  314  IEFAWGLSNSKMPFLWVIRPDLVAGENAVLPLEFLEETQNRGLLSSWCPQEEVLGHSSIG  373

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNSTLES+C GVPM+CWPFF EQQTNC + C +WGIG+EI  +  RD++E  V
Sbjct  374  GFLTHNGWNSTLESVCGGVPMICWPFFTEQQTNCRFCCNEWGIGLEI-EDAKRDKIEIFV  432

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  273
            +ELME EKG+EMK KA++ KKLA  AA   P GSS +N+E  I+ + L
Sbjct  433  KELMEGEKGKEMKEKALQWKKLAHNAAFG-PHGSSFMNLENLIHDVFL  479



>ref|XP_002525851.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
 gb|EEF36545.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
Length=482

 Score =   218 bits (556),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 138/166 (83%), Gaps = 2/166 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLA+S+KPFLWI+RPD+V GE AMLP EF+ ETKDRGML+SW PQEQ+L H AVG
Sbjct  314  IEFAWGLASSKKPFLWIIRPDLVIGENAMLPAEFVSETKDRGMLASWGPQEQILKHPAVG  373

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFL+H GWNSTL+S+  GVPM+CWPFFAEQQTNC ++CT+WG+GMEIDNNV RDEV+K+V
Sbjct  374  GFLSHMGWNSTLDSMSGGVPMVCWPFFAEQQTNCRFACTEWGVGMEIDNNVKRDEVKKLV  433

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHL  279
              LM+ +KG+EMK KAME K  A EAA   P GSSH N+++ +  +
Sbjct  434  EVLMDGKKGKEMKSKAMEWKTKAEEAAK--PGGSSHNNLDRLVKFI  477



>ref|XP_008229788.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Prunus mume]
Length=485

 Score =   218 bits (556),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 109/168 (65%), Positives = 135/168 (80%), Gaps = 2/168 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEF WGLANS+ PF W++RPD+V GE A+LPPEF+ ET++R +++ WCPQEQVL H +VG
Sbjct  317  VEFGWGLANSKLPFFWVIRPDLVIGESAILPPEFVAETRERSLIAGWCPQEQVLNHPSVG  376

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNST+ESI  GVPMLCWPFF +QQ +C Y+C +WGIGMEI N+V RDEVEK+V
Sbjct  377  GFLTHSGWNSTVESITAGVPMLCWPFFGDQQMDCRYTCNEWGIGMEISNDVKRDEVEKLV  436

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  273
            +ELME EKG++MK K ME KKLA EA  T P GSS  N++  +N +LL
Sbjct  437  KELMEGEKGKKMKNKVMEWKKLAEEA--TGPHGSSSTNLDNLVNQVLL  482



>ref|XP_008229795.1| PREDICTED: UDP-glycosyltransferase 85A1-like [Prunus mume]
Length=486

 Score =   218 bits (556),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 138/168 (82%), Gaps = 2/168 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EF WGLANS+ PF W+VRPD++ GE A+LPPEF+ ETK RG+++SWCPQEQVL H ++G
Sbjct  318  IEFCWGLANSKLPFFWVVRPDLLVGESAILPPEFVAETKGRGLVASWCPQEQVLSHPSIG  377

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNST+ES+  GVPMLCWPFFAEQ+ NC Y+C +WGIG+EI+N+  RD+VEK++
Sbjct  378  GFLTHSGWNSTIESLSAGVPMLCWPFFAEQRINCVYTCNEWGIGLEINNDAKRDQVEKLI  437

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  273
            +EL+E EKG++M+ KAME KKLA +A    P GSS+ N++  +N +LL
Sbjct  438  KELVEGEKGKKMRTKAMEWKKLAEKAIS--PDGSSYANLDNLVNQVLL  483



>ref|XP_004303932.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=479

 Score =   218 bits (555),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 108/168 (64%), Positives = 136/168 (81%), Gaps = 2/168 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEF WGLANS+ PF W++RPD+V GE A+LPPEF+ E KDRG+L+ WCPQEQVL H +VG
Sbjct  309  VEFGWGLANSKFPFFWVIRPDLVVGESAILPPEFVAEIKDRGLLAHWCPQEQVLNHPSVG  368

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNST+ES+  GVPMLCWPFF +QQT+C +SC +WG+GMEI N+V RDEVEK+V
Sbjct  369  GFLTHSGWNSTIESLTAGVPMLCWPFFGDQQTDCHFSCKEWGVGMEISNDVKRDEVEKLV  428

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  273
            +ELME EKG++MK KA+  K+LA EA  T P G+S  N++  +N +LL
Sbjct  429  KELMEGEKGKKMKNKALNWKELAQEA--TAPHGTSSRNLDTLVNQVLL  474



>gb|KCW66541.1| hypothetical protein EUGRSUZ_F00338, partial [Eucalyptus grandis]
Length=478

 Score =   218 bits (555),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 136/164 (83%), Gaps = 2/164 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEFAWGLA+S + FLW++RPD+V G+ A+LPPEF   T++R +L+SWCPQE+VL H AVG
Sbjct  316  VEFAWGLADSGQTFLWVIRPDLVVGDTAILPPEFSSSTRERSLLASWCPQERVLSHSAVG  375

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNST+ESI  GVPM+CWPFF EQQTNC YSC +WGIGMEID+NV RDEV + V
Sbjct  376  GFLTHSGWNSTIESIAAGVPMVCWPFFGEQQTNCRYSCQEWGIGMEIDSNVKRDEVSRQV  435

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFIN  285
            RELME E+G+EMKRKAME K++A EA  T P GSS +N+++ I+
Sbjct  436  RELMEGERGKEMKRKAMEWKEMAREA--TRPSGSSCLNLDEVID  477



>ref|XP_002447939.1| hypothetical protein SORBIDRAFT_06g018460 [Sorghum bicolor]
 gb|EES12267.1| hypothetical protein SORBIDRAFT_06g018460 [Sorghum bicolor]
Length=501

 Score =   218 bits (556),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 105/169 (62%), Positives = 135/169 (80%), Gaps = 2/169 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEFAWGLANS   FLWI+RPD+V+G+ A+LPPEF E TK RG+L+SWCPQ+ VL H+AVG
Sbjct  328  VEFAWGLANSGHDFLWIIRPDLVSGDAAVLPPEFREATKGRGLLASWCPQDAVLRHEAVG  387

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
             FLTH GWNSTLES+C GVPMLCWPFFAEQQTNC Y CT+WG+G+EI ++V R+ VE  +
Sbjct  388  VFLTHSGWNSTLESLCAGVPMLCWPFFAEQQTNCRYKCTEWGVGVEIGHDVRREAVEAKI  447

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLS  270
            RE M+ E+G+EM+R+A+E +  A+ A  T P G S+ N++K +  +LLS
Sbjct  448  REAMDGEEGKEMRRRALEWRDTAVRA--TQPGGRSYANLQKLVTDVLLS  494



>ref|XP_011087901.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Sesamum 
indicum]
Length=473

 Score =   218 bits (554),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 139/170 (82%), Gaps = 2/170 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEFAWGL++S + FLWI+RPD++ G+G++LP  F+EETK RG++  WCPQEQVLGH+AVG
Sbjct  305  VEFAWGLSSSNQNFLWIIRPDLINGKGSVLPEGFLEETKGRGLMVGWCPQEQVLGHRAVG  364

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTHCGWNST+E+I +GVPM+CWPFFAEQQTNC Y+C KWG+G+EI+ +V R +VEK+V
Sbjct  365  GFLTHCGWNSTIETISSGVPMVCWPFFAEQQTNCRYACAKWGVGVEIEGDVTRGKVEKMV  424

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSH  267
            R +ME EKG+EM++KA+E K  A  AA   P GSS  N+E  IN  LL++
Sbjct  425  RVMMEGEKGKEMRKKALEWKDKARVAAK--PGGSSFTNLETLINATLLNN  472



>ref|XP_004305879.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like isoform 
X1 [Fragaria vesca subsp. vesca]
 ref|XP_011467652.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like isoform 
X1 [Fragaria vesca subsp. vesca]
Length=533

 Score =   219 bits (557),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/172 (60%), Positives = 137/172 (80%), Gaps = 2/172 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLANS+ PFLW++RPD++ GE A+LPPEF+ ETK+RG+++SWCPQEQVL H  VG
Sbjct  361  MEFAWGLANSKLPFLWVIRPDLIAGESAILPPEFVAETKERGLIASWCPQEQVLNHPTVG  420

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNST+ESI  GVPMLCWP   +Q+ NC Y+C +WGIGMEI N+V RD+V+K+V
Sbjct  421  GFLTHSGWNSTMESISAGVPMLCWPLLGDQRINCRYTCYEWGIGMEISNDVKRDKVKKLV  480

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  261
             ELM+ EKG+E+K K M  KKLA +A+   P+GSSH+ ++  +N +LL   +
Sbjct  481  EELMKGEKGKELKNKVMIWKKLAEDASS--PLGSSHIALDNLVNQVLLRKAR  530



>ref|XP_007225655.1| hypothetical protein PRUPE_ppa004945mg [Prunus persica]
 gb|EMJ26854.1| hypothetical protein PRUPE_ppa004945mg [Prunus persica]
Length=484

 Score =   218 bits (554),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 105/172 (61%), Positives = 141/172 (82%), Gaps = 1/172 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLANS+K FLW++RPD+V GE A++P EF+EETKDR +L+ WCPQEQVL H AVG
Sbjct  314  IEFAWGLANSKKKFLWVIRPDLVRGESAVVPAEFLEETKDRSLLAHWCPQEQVLSHPAVG  373

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNSTLES+C GVP++CW F  EQ TNC YSC +WG+G+E+ ++V R+ VE++V
Sbjct  374  GFLTHSGWNSTLESLCGGVPLICWSFCGEQPTNCRYSCREWGVGLEVGDDVKRNYVEELV  433

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  261
            R+LME E+G++M++KA+E KKLA EA  T P GSS +++E+ +N +LLS + 
Sbjct  434  RKLMEGEEGKKMRKKALEWKKLAEEAT-TGPYGSSFLDLEQMVNKVLLSSKN  484



>ref|XP_010056400.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=485

 Score =   218 bits (554),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 137/167 (82%), Gaps = 2/167 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEFAWGLANS + FLWI+RPD+V G+ A+LPPEF   T++R +L+SWCPQEQVLGHQAVG
Sbjct  315  VEFAWGLANSGQTFLWIIRPDLVAGDTAVLPPEFSAATRERSLLASWCPQEQVLGHQAVG  374

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNST+ESI  GVP++CWPFFAEQ  NC YS  +WGIGMEID++V RDEVE+ V
Sbjct  375  GFLTHSGWNSTIESIVAGVPVVCWPFFAEQPMNCRYSREEWGIGMEIDSDVKRDEVERQV  434

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLL  276
            RELME E+G+EMKRK ME K++A EA  T P G S +N+++ IN +L
Sbjct  435  RELMEGERGKEMKRKVMEWKEMAREA--TCPSGPSFLNLDELINSVL  479



>ref|XP_011100190.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Sesamum 
indicum]
Length=481

 Score =   218 bits (554),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 133/162 (82%), Gaps = 2/162 (1%)
 Frame = -3

Query  773  EFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVGG  594
            EFAWGLA SQ+PFLW+VRPD+V GE A LP EF+EE+K RG+L SWC Q+QVL H+AVG 
Sbjct  314  EFAWGLAKSQQPFLWVVRPDVVRGESAALPEEFLEESKARGLLVSWCAQDQVLAHKAVGA  373

Query  593  FLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvvR  414
            FLTHCGWNS +ES+C GVP++CWPFFA+QQTNC YSCTKWGIGMEI+++V RDEV ++V+
Sbjct  374  FLTHCGWNSMMESVCRGVPVICWPFFADQQTNCHYSCTKWGIGMEINHDVKRDEVAELVK  433

Query  413  ELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFI  288
            E+ME EKG+ M+ KA E KK+A  A D    G S++N +KFI
Sbjct  434  EMMEGEKGKRMRMKAQEWKKIAEAATDA--GGMSYLNFDKFI  473



>ref|XP_009349616.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Pyrus x 
bretschneideri]
Length=486

 Score =   218 bits (554),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 108/170 (64%), Positives = 139/170 (82%), Gaps = 2/170 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EF WGLANS+ PFLWI+RPD+V GE A+LPP+F+ +TK+RGM+ SWCPQE+VL H +VG
Sbjct  313  IEFGWGLANSKHPFLWIIRPDLVAGETAILPPDFVADTKERGMIVSWCPQEKVLNHPSVG  372

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNST+ES+  GVPMLCWP F +QQTNC+++C +WG GMEI++ V RDEVEK+V
Sbjct  373  GFLTHSGWNSTIESLSAGVPMLCWPLFGDQQTNCYFTCNEWGSGMEINSKVKRDEVEKLV  432

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSH  267
            RELME EKG++MK KA+E KKLA EA  T P GSS  N++  +  +LL++
Sbjct  433  RELMEGEKGKKMKNKAIEWKKLAEEA--TGPHGSSSKNLDNLVKQVLLNN  480



>ref|XP_002271368.1| PREDICTED: 7-deoxyloganetin glucosyltransferase [Vitis vinifera]
Length=483

 Score =   218 bits (554),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 113/171 (66%), Positives = 137/171 (80%), Gaps = 2/171 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
             E AWGLANS KPFLWI+RPD+V G+ A LPPEF+ ET+DRG+L+SWCPQEQVL H AVG
Sbjct  315  TELAWGLANSNKPFLWIIRPDLVPGDSAPLPPEFVTETRDRGLLASWCPQEQVLKHPAVG  374

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GF+TH GWNST E IC GVP++C PF AEQ TNC Y C++WGIGMEID NV RD+VEK+V
Sbjct  375  GFVTHSGWNSTSEGICGGVPLICMPFRAEQPTNCRYCCSEWGIGMEIDGNVKRDKVEKLV  434

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHR  264
            RELM+ E G++MK+KAME KKLA EA   +P GSS+ N  K ++ +LLS +
Sbjct  435  RELMDGENGKKMKKKAMEWKKLAEEA--IMPGGSSYNNFNKLLSDVLLSKK  483



>gb|KCW45698.1| hypothetical protein EUGRSUZ_L00502, partial [Eucalyptus grandis]
Length=479

 Score =   217 bits (553),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 138/165 (84%), Gaps = 2/165 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EF+WGLANSQKPFLWI+RPD+V G+  +LP EF+ ETKDRGML+ WCPQE+VL H +VG
Sbjct  317  IEFSWGLANSQKPFLWIIRPDLVAGDKVVLPSEFLAETKDRGMLAGWCPQERVLRHPSVG  376

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTHCGWNS LESIC GVP+LCWPFFAEQQTNC+Y+  +WGIGMEIDN+V R+EVEK+V
Sbjct  377  GFLTHCGWNSMLESICGGVPVLCWPFFAEQQTNCFYTKNEWGIGMEIDNSVRREEVEKLV  436

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINH  282
            RELM+ EKG+ MK+KA+E K+ A EA +    GSS+ N+E  ++ 
Sbjct  437  RELMDGEKGKAMKKKAVEWKRKAEEATEL--GGSSYENLETLLSQ  479



>ref|XP_010040274.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=486

 Score =   217 bits (553),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 110/172 (64%), Positives = 141/172 (82%), Gaps = 2/172 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEFAWGLANS + FLW++RPD+V G+ A+LP EF   T++R +L+SWCPQE+VL H AVG
Sbjct  316  VEFAWGLANSCQTFLWVIRPDLVVGDMAILPSEFSATTRERSLLASWCPQERVLNHPAVG  375

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNST+ESI  GVP+LCWPFFAEQQTNC YSC +WGIGMEID +V RD+VE+ V
Sbjct  376  GFLTHSGWNSTIESITAGVPVLCWPFFAEQQTNCRYSCEEWGIGMEIDGDVKRDKVERQV  435

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  261
            RELME E+G+EMKRKAME +++A EA    P GSS++N+++ ++ +LL  R+
Sbjct  436  RELMEGERGKEMKRKAMEWQQMAREAMR--PSGSSYLNLDEVMDKVLLLPRR  485



>gb|AFJ52995.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=489

 Score =   217 bits (553),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 109/172 (63%), Positives = 141/172 (82%), Gaps = 1/172 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEFAWGLA+S KPFLW++R D+V GE A+LP EF EE K+RG+L SWCPQE+VL H ++G
Sbjct  317  VEFAWGLAHSGKPFLWVIRSDLVKGESAILPREFSEEIKERGLLVSWCPQEKVLKHASIG  376

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTHCGWNSTLES+ NGVPM+CWPFFAEQ TNCW+ C K G+G+EIDN++ R+E++++V
Sbjct  377  GFLTHCGWNSTLESLTNGVPMICWPFFAEQHTNCWFVCEKLGVGLEIDNDIKREEIDELV  436

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  261
            RELM+ EKG+EMKR+AME KK A E A     G +++N+E  IN++LL + K
Sbjct  437  RELMDGEKGKEMKRRAMEWKKSA-EDATLGESGLAYLNLEDMINNILLHNVK  487



>ref|XP_003542333.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Glycine max]
Length=485

 Score =   217 bits (553),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 107/168 (64%), Positives = 137/168 (82%), Gaps = 2/168 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLANS K FLW++RPD+V GE A+LP EF+++T+ RG+LSSWC QEQVL H A+G
Sbjct  312  IEFAWGLANSNKTFLWVIRPDLVAGENALLPSEFVKQTEKRGLLSSWCSQEQVLTHPAIG  371

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNSTLES+C GVPM+CWPFFAEQQTNCW+ C +WGIG+EI  +V RD++E +V
Sbjct  372  GFLTHSGWNSTLESVCGGVPMICWPFFAEQQTNCWFCCKEWGIGLEI-EDVERDKIESLV  430

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  273
            RELM+ EKG+EMK KA++ K+LA  AA   P+GSS  N++  +  +LL
Sbjct  431  RELMDGEKGKEMKEKALQWKELAKSAAFG-PVGSSFANLDNMVRDVLL  477



>ref|XP_008229743.1| PREDICTED: UDP-glycosyltransferase 85A1-like [Prunus mume]
Length=495

 Score =   218 bits (554),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/172 (60%), Positives = 138/172 (80%), Gaps = 2/172 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EF WGLANS+ PF W+VRPD++ GE A+LPPEF+ ETK RG+++SWCPQEQVL H ++G
Sbjct  318  IEFCWGLANSKLPFFWVVRPDLLVGESAILPPEFVAETKGRGLVASWCPQEQVLSHPSIG  377

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNST+ES+  GVPMLCWPFFAEQ+ NC Y+C +WGIG+EI+N+  R +VEK++
Sbjct  378  GFLTHSGWNSTIESLSAGVPMLCWPFFAEQRINCVYTCNEWGIGLEINNDAKRHQVEKLI  437

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  261
            +EL+E EKG++M+ KAME KKLA +A    P GSS+ N++  +N +LL   +
Sbjct  438  KELVEGEKGKKMRTKAMEWKKLAEKAIS--PDGSSYSNLDNLVNQVLLRKAR  487



>ref|XP_011009478.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Populus 
euphratica]
 ref|XP_011009479.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Populus 
euphratica]
 ref|XP_011009480.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Populus 
euphratica]
Length=482

 Score =   217 bits (552),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 138/167 (83%), Gaps = 2/167 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEF+WGLANS K FLWI+RPD+V G+ A+LPPEF+EET++RG+ +SWC QE+VL H ++G
Sbjct  313  VEFSWGLANSMKNFLWIIRPDLVRGDSAVLPPEFLEETRERGLTASWCAQEKVLKHSSIG  372

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFL+H GWNST+ES+ NGVPMLCWPFF+EQQTNC ++CT W +GMEI+++  RDEVEK+V
Sbjct  373  GFLSHMGWNSTIESLSNGVPMLCWPFFSEQQTNCKFACTDWDVGMEIESDANRDEVEKLV  432

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLL  276
             ELM+ EKG+EMKRKAME K  A EA   I  GSS +N++K +N LL
Sbjct  433  IELMDGEKGKEMKRKAMEWKSKA-EATTGIN-GSSSMNLDKLVNDLL  477



>ref|XP_004299645.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=482

 Score =   217 bits (552),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/172 (59%), Positives = 138/172 (80%), Gaps = 1/172 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLANS   FLW++RPD+V G  A++PPEF+EETK R  L+SWCPQEQVL H A+G
Sbjct  312  IEFAWGLANSNMTFLWVIRPDLVAGNSAVVPPEFVEETKGRSWLASWCPQEQVLNHPAIG  371

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTHCGWNST+ES+C GVPM+CWPFFA+QQ NC + C +WG+ M+I+ +V R+ +E +V
Sbjct  372  GFLTHCGWNSTVESLCGGVPMICWPFFADQQINCRFCCKEWGVAMQIEGDVRRNYIEVLV  431

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  261
            R+LME ++G++M++K++E KKLA EA  T P GSS +N+ K +N +LLS + 
Sbjct  432  RKLMEGQEGKQMRKKSLEWKKLAEEAV-TAPNGSSFLNLNKMVNQVLLSPKN  482



>ref|NP_001277168.1| UDP-glycosyltransferase 85A2-like [Vitis vinifera]
 dbj|BAO51843.1| UDP-glycosyltransferase 85A33 [Vitis vinifera]
Length=482

 Score =   217 bits (552),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 141/167 (84%), Gaps = 2/167 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
             EFAWGLANS KPFLWI+RPD+V G+ A+LPPEF+ ETKDRGML+SWCPQEQVL H A+G
Sbjct  315  TEFAWGLANSNKPFLWIIRPDLVVGDSALLPPEFVTETKDRGMLASWCPQEQVLKHPAIG  374

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNST ESIC GVP++CWPFFAEQQTNC YSC++WGIGMEIDNNV R EVEK+V
Sbjct  375  GFLTHSGWNSTSESICGGVPLICWPFFAEQQTNCRYSCSEWGIGMEIDNNVKRVEVEKLV  434

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLL  276
            RELM+ EKG+EMK+K ME KKLA EA  T P GSS+ N  K + ++L
Sbjct  435  RELMDGEKGKEMKKKVMEWKKLAEEA--TRPGGSSYDNFNKLLRNVL  479



>ref|XP_010094135.1| UDP-glycosyltransferase 85A2 [Morus notabilis]
 gb|EXB55268.1| UDP-glycosyltransferase 85A2 [Morus notabilis]
Length=360

 Score =   214 bits (544),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 105/175 (60%), Positives = 140/175 (80%), Gaps = 2/175 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGL+NS+KPF+WI+RPD+V  +  +LPPEF+EET++RG+L+ WCPQE +L H +VG
Sbjct  187  IEFAWGLSNSKKPFVWIIRPDLVADDSGILPPEFVEETRERGVLAGWCPQETMLRHPSVG  246

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTHCGWNST+ES+  GVP++CWPFFAEQQTNC +SC +W +GMEID++V R++VEK+V
Sbjct  247  GFLTHCGWNSTIESLTTGVPIVCWPFFAEQQTNCRFSCGEWSVGMEIDSDVKREKVEKLV  306

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK*HP  252
            RELM+ EKG+EM+R A+E K+ A EA +    GSS  N EK I  +LL   +  P
Sbjct  307  RELMDGEKGKEMRRNALEWKRKAEEATEA--GGSSLTNFEKLIEEVLLFKNQLQP  359



>gb|KCW73113.1| hypothetical protein EUGRSUZ_E01564, partial [Eucalyptus grandis]
Length=433

 Score =   216 bits (549),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 136/164 (83%), Gaps = 2/164 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEFAWGLANS + FLWI+RPD+V G+ A+LPPEF   T +R +L+SWCPQE+VLGHQAVG
Sbjct  271  VEFAWGLANSGQTFLWIIRPDLVAGDTAVLPPEFSAATGERSLLASWCPQERVLGHQAVG  330

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNST+ESI  GVP++CWPFFAEQ TNC YS  +WGIGMEID++V RDEVE+ V
Sbjct  331  GFLTHSGWNSTIESIVAGVPVVCWPFFAEQPTNCRYSREEWGIGMEIDSDVKRDEVERQV  390

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFIN  285
            RELME EKG+EMKRKAME K++A EAA   P G S +N+++ IN
Sbjct  391  RELMEGEKGKEMKRKAMEWKEMAREAA--CPSGPSFLNLDELIN  432



>ref|XP_002323976.2| hypothetical protein POPTR_0017s07920g [Populus trichocarpa]
 gb|EEF04109.2| hypothetical protein POPTR_0017s07920g [Populus trichocarpa]
Length=482

 Score =   217 bits (552),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 138/167 (83%), Gaps = 2/167 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEF+ GLANS+K FLWI+RPD+V G+ A+LPPEF+EET+DRG+++SWC QE+VL H ++G
Sbjct  313  VEFSLGLANSKKNFLWIIRPDLVRGDSAVLPPEFLEETRDRGLMASWCAQEKVLKHSSIG  372

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFL+H GWNST+ES+ NGVPMLCWPFF+EQQTNC ++C  WG+GMEI+++  RDEVEK+V
Sbjct  373  GFLSHMGWNSTIESLSNGVPMLCWPFFSEQQTNCKFACVDWGVGMEIESDANRDEVEKLV  432

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLL  276
             ELM+ EKG+EMKRKAME K  A EA   I  GSS +N +K +N +L
Sbjct  433  IELMDGEKGKEMKRKAMEWKSKA-EATTGIN-GSSSMNFDKLVNDVL  477



>gb|EPS71307.1| hypothetical protein M569_03453, partial [Genlisea aurea]
Length=300

 Score =   212 bits (539),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 109/162 (67%), Positives = 130/162 (80%), Gaps = 2/162 (1%)
 Frame = -3

Query  773  EFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVGG  594
            EFAWGLANS  PFLW+VRPDMVTG+ AML  EF+ ETK+RG+L SWCPQE+VLGH + GG
Sbjct  140  EFAWGLANSGSPFLWVVRPDMVTGDSAMLDEEFLNETKERGLLISWCPQEKVLGHPSTGG  199

Query  593  FLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvvR  414
            FL H GWNST+ESI +GVPMLCWPFFA+Q TNC +SC +WGI MEIDNNV R++VE  VR
Sbjct  200  FLNHSGWNSTIESISSGVPMLCWPFFADQPTNCRFSCVEWGIAMEIDNNVRREQVEAAVR  259

Query  413  ELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFI  288
            ELME EKG++M+ K  ELK+ A   A+  P G S VN++KFI
Sbjct  260  ELMEGEKGKKMREKVRELKRKA--EAEAAPGGLSDVNLDKFI  299



>ref|XP_010056397.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=485

 Score =   217 bits (552),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 138/167 (83%), Gaps = 2/167 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEFAWGLANS + FLWI+RPD+V G+ A+LPPEF   T++R +L+SWCPQE+VLGHQAVG
Sbjct  315  VEFAWGLANSGQTFLWIIRPDLVAGDTAVLPPEFSAATRERSLLASWCPQERVLGHQAVG  374

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNST+ESI  GVP++CWPFFAEQ  NC YS  +WGIGMEID++V RDEVE+ V
Sbjct  375  GFLTHSGWNSTIESIVAGVPVVCWPFFAEQPMNCRYSREEWGIGMEIDSDVKRDEVERQV  434

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLL  276
            RELME E+G+EMKRKAME K++A EAA   P G S +N+++ IN +L
Sbjct  435  RELMEGERGKEMKRKAMEWKEMAREAA--CPSGPSFLNLDELINSVL  479



>ref|XP_008373154.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Malus domestica]
Length=486

 Score =   217 bits (552),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 109/170 (64%), Positives = 138/170 (81%), Gaps = 2/170 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EF WGLANS  PFLWI+RPD+V GE A+LPP+F+ +TK+RGM+ SWCPQE+VL H +VG
Sbjct  313  IEFGWGLANSNHPFLWIIRPDLVAGETAILPPDFVADTKERGMIVSWCPQEKVLNHPSVG  372

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNST+ES+  GVPMLCWP F +QQTNC+++C +WG GMEID+ V RDEVEK+V
Sbjct  373  GFLTHSGWNSTIESLSAGVPMLCWPLFGDQQTNCYFTCNEWGSGMEIDSKVKRDEVEKLV  432

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSH  267
            RELME EKG++MK KA+E KKLA EA  T P GSS  N++  +  +LL++
Sbjct  433  RELMEGEKGKKMKNKAIEWKKLAEEA--TGPHGSSSKNLDNLVKQVLLNN  480



>ref|XP_008378324.1| PREDICTED: UDP-glycosyltransferase 85A3-like [Malus domestica]
Length=488

 Score =   217 bits (552),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 136/170 (80%), Gaps = 2/170 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEFAWGLANS+ PF W++RPD+  GE A+L PEF+ ETK+RG+++SWCPQEQVL H +VG
Sbjct  319  VEFAWGLANSKLPFFWVIRPDLXVGESAILSPEFVAETKERGLIASWCPQEQVLSHPSVG  378

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNS  ES+C GVPMLCWPFFA+QQTN W +C +W IGMEI N+V R EV+++V
Sbjct  379  GFLTHSGWNSXXESLCAGVPMLCWPFFADQQTNTWCACNEWDIGMEISNDVKRVEVQELV  438

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSH  267
            RELME EKG++MK K M+ KKLA E+  T P GSS  N++  +N++LL +
Sbjct  439  RELMEGEKGKKMKIKVMQWKKLAEES--TSPNGSSSTNLDNLVNNVLLRN  486



>ref|XP_008779905.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Phoenix dactylifera]
Length=477

 Score =   216 bits (551),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 109/168 (65%), Positives = 138/168 (82%), Gaps = 2/168 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLANS+  FLW++RPD+V G+  +LP EF+ ETK+RG+L+SWCPQE VL H ++G
Sbjct  312  IEFAWGLANSKHDFLWVIRPDLVKGDSTVLPQEFLSETKERGLLASWCPQEAVLSHPSIG  371

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNSTLESIC+GVP + WPFFAEQQTNC Y+CT+WGIGMEID+NV R+EVE++V
Sbjct  372  GFLTHSGWNSTLESICSGVPTISWPFFAEQQTNCRYACTEWGIGMEIDSNVKREEVERLV  431

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  273
            RELME EKG+EM+R+A+E K  A+ A  T P GSS  N ++ +N  LL
Sbjct  432  RELMEGEKGKEMRRRAVEWKGSAISA--TQPGGSSFQNFDRLVNEALL  477



>ref|XP_008229476.1| PREDICTED: UDP-glycosyltransferase 85A5-like isoform X2 [Prunus 
mume]
Length=485

 Score =   217 bits (552),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 108/168 (64%), Positives = 135/168 (80%), Gaps = 2/168 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEF WGLAN++ PF W++RPD+V GE A+LPPEF+ ETK+R +++ WCPQEQVL H +VG
Sbjct  317  VEFGWGLANTKLPFFWVIRPDLVIGESAILPPEFVAETKERSLIAGWCPQEQVLNHPSVG  376

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNST+ES+  GVPMLCWPFF +QQ +C Y+C +WGIGMEI N+V RDEVEK+V
Sbjct  377  GFLTHSGWNSTVESLTAGVPMLCWPFFGDQQMDCRYTCNEWGIGMEISNDVKRDEVEKLV  436

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  273
            +ELME EKG++MK K ME KKLA EA  T P GSS  N++  +N +LL
Sbjct  437  KELMEGEKGKKMKNKVMEWKKLAEEA--TGPHGSSSTNLDNLVNQVLL  482



>ref|XP_003618663.1| Cytokinin-O-glucosyltransferase [Medicago truncatula]
 gb|AES74881.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=485

 Score =   217 bits (552),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 110/172 (64%), Positives = 136/172 (79%), Gaps = 2/172 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLANS++PFLWI+RPD+V G   +L  EF+ E  DRG+++SWCPQEQVL H ++G
Sbjct  315  LEFAWGLANSKQPFLWIIRPDLVIGGSVVLSSEFVNEISDRGLIASWCPQEQVLNHPSIG  374

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTHCGWNST ESIC GVPMLCWPFFA+Q  NC Y C +W IGMEID NV RDEVEK+V
Sbjct  375  GFLTHCGWNSTTESICAGVPMLCWPFFADQPANCRYICNEWEIGMEIDTNVKRDEVEKLV  434

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  261
             ELM  EKG++M++KA+ELKK A E  DT P G S++N++K IN +LL   +
Sbjct  435  NELMVGEKGKKMRQKAIELKKKAEE--DTRPGGCSYMNLDKVINEVLLKQNQ  484



>ref|XP_008229475.1| PREDICTED: UDP-glycosyltransferase 85A5-like isoform X1 [Prunus 
mume]
Length=485

 Score =   216 bits (551),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 108/168 (64%), Positives = 135/168 (80%), Gaps = 2/168 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEF WGLAN++ PF W++RPD+V GE A+LPPEF+ ETK+R +++ WCPQEQVL H +VG
Sbjct  317  VEFGWGLANTKLPFFWVIRPDLVIGESAILPPEFVAETKERSLIAGWCPQEQVLNHPSVG  376

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNST+ES+  GVPMLCWPFF +QQ +C Y+C +WGIGMEI N+V RDEVEK+V
Sbjct  377  GFLTHSGWNSTVESLTAGVPMLCWPFFGDQQMDCRYTCNEWGIGMEISNDVKRDEVEKLV  436

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  273
            +ELME EKG++MK K ME KKLA EA  T P GSS  N++  +N +LL
Sbjct  437  KELMEGEKGKKMKNKVMEWKKLAEEA--TGPHGSSSTNLDNLVNQVLL  482



>dbj|BAD93690.1| glycosyltransferase [Nicotiana tabacum]
Length=485

 Score =   216 bits (551),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 118/171 (69%), Positives = 145/171 (85%), Gaps = 1/171 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLANSQ+ FLWI+RPD+V+G+ ++LPPEF+EETK RGML+SWC QE+VL H A+G
Sbjct  315  IEFAWGLANSQQSFLWIIRPDIVSGDASILPPEFVEETKKRGMLASWCSQEEVLSHPAIG  374

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNSTLESI +GVPM+CWPFFAEQQTNCW+S TKW +GMEID +V RDEVE +V
Sbjct  375  GFLTHSGWNSTLESISSGVPMICWPFFAEQQTNCWFSVTKWDVGMEIDCDVKRDEVESLV  434

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHR  264
            RELM   KG++MK+KAME K+LA EA+     GSS+VNIEK +N +LLS +
Sbjct  435  RELMVGGKGKKMKKKAMEWKELA-EASAKEHSGSSYVNIEKVVNDILLSSK  484



>emb|CDY21357.1| BnaA09g30700D [Brassica napus]
Length=290

 Score =   211 bits (537),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 103/166 (62%), Positives = 134/166 (81%), Gaps = 1/166 (1%)
 Frame = -3

Query  773  EFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVGG  594
            EFAWGLA S K FLW++RPD+V GE A +PPEF+ ET+DRGM++SWCPQE+VL H A+GG
Sbjct  126  EFAWGLAGSGKEFLWVIRPDLVAGEAAAVPPEFIRETEDRGMMASWCPQEKVLSHPAIGG  185

Query  593  FLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvvR  414
            FLTHCGWNSTLES+  GVPM+CWPFFAEQ TNC + C +WG+GMEI  +V R+EVE V+R
Sbjct  186  FLTHCGWNSTLESLSGGVPMICWPFFAEQPTNCKFCCDEWGVGMEIGGDVKREEVEAVIR  245

Query  413  ELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLL  276
            ELM+ EKG++++ KA + ++LA EA +  P GSS+V+ E  +N +L
Sbjct  246  ELMDGEKGKKLREKAEKWQRLAKEATE-YPSGSSNVSFETLVNKVL  290



>ref|XP_002323978.2| hypothetical protein POPTR_0017s07940g [Populus trichocarpa]
 gb|EEF04111.2| hypothetical protein POPTR_0017s07940g [Populus trichocarpa]
Length=482

 Score =   216 bits (551),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 139/167 (83%), Gaps = 2/167 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EF+WGLANS+K FLWI+RPD+V GE A+LPPEF+EET++RG+++SWC QE+VL H ++G
Sbjct  313  LEFSWGLANSKKNFLWIIRPDLVRGESAVLPPEFLEETRERGLMASWCAQEKVLKHSSIG  372

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFL+H GWNST+ES+ NGVPMLCWPFF+EQQTNC ++C  WG+GMEI+++  RDEVEK+V
Sbjct  373  GFLSHMGWNSTIESMSNGVPMLCWPFFSEQQTNCKFACVDWGVGMEIESDANRDEVEKLV  432

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLL  276
             EL++ EKG+EMKRKAME K  A EA   I  GSS +N +K +N +L
Sbjct  433  IELIDGEKGKEMKRKAMEWKSKA-EATTGIN-GSSSMNFDKLVNDVL  477



>emb|CAN60444.1| hypothetical protein VITISV_032467 [Vitis vinifera]
Length=468

 Score =   216 bits (550),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 141/167 (84%), Gaps = 2/167 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
             EFAWGLANS KPFLWI+RPD+V G+ A+LPPEF+ ETKDRGML+SWCPQEQVL H A+G
Sbjct  301  TEFAWGLANSNKPFLWIIRPDLVVGDSALLPPEFVTETKDRGMLASWCPQEQVLKHPAIG  360

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNST ESIC GVP++CWPFFAEQQTNC YSC++WGIGMEIDNNV R EVEK+V
Sbjct  361  GFLTHSGWNSTSESICGGVPLICWPFFAEQQTNCRYSCSEWGIGMEIDNNVKRVEVEKLV  420

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLL  276
            RELM+ EKG+EMK+K ME +KLA EA  T P GSS+ N  K + ++L
Sbjct  421  RELMDGEKGKEMKKKVMEWRKLAEEA--TRPGGSSYDNFNKLLRNVL  465



>ref|XP_008357979.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Malus domestica]
Length=478

 Score =   216 bits (550),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 109/168 (65%), Positives = 133/168 (79%), Gaps = 2/168 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EF WGLANS+ PFLW +RPD+V GE A+LPPEF  ETK+R ++ SWCPQEQ+L H AVG
Sbjct  310  LEFGWGLANSKLPFLWAIRPDLVLGESAILPPEFEFETKERSLIPSWCPQEQILNHPAVG  369

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNST+ES+C GVPMLCWP FAEQ TNC+Y+C  WG G+EI+ +V RD+VEK+V
Sbjct  370  GFLTHSGWNSTIESLCAGVPMLCWPIFAEQTTNCYYTCNDWGCGLEIEXDVKRDDVEKLV  429

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  273
            RELME EKG+EMK KA E KKLA EA+   P GSS   ++  +N +LL
Sbjct  430  RELMEGEKGKEMKNKAXEWKKLAEEASS--PHGSSSRTLDNLVNQVLL  475



>ref|XP_008229473.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Prunus mume]
 ref|XP_008229474.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Prunus mume]
Length=486

 Score =   216 bits (550),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 108/168 (64%), Positives = 134/168 (80%), Gaps = 2/168 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEF WGLANS+ PF W++RPD+V GE A+ PPEF+ ETK+R +++ WCPQEQVL H +VG
Sbjct  318  VEFGWGLANSKLPFFWVIRPDLVIGESAIFPPEFVAETKERSLIAGWCPQEQVLNHPSVG  377

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNST+ES+  GVPMLCWPFF +QQ +C Y+C +WGIGMEI N+V RDEVEK+V
Sbjct  378  GFLTHSGWNSTVESLTAGVPMLCWPFFGDQQMDCRYTCNEWGIGMEISNDVKRDEVEKLV  437

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  273
            +ELME EKG++MK K ME KKLA EA  T P GSS  N++  +N +LL
Sbjct  438  KELMEGEKGKKMKNKVMEWKKLAEEA--TGPHGSSSTNLDNLVNQVLL  483



>ref|XP_010056398.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Eucalyptus 
grandis]
Length=485

 Score =   216 bits (550),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 112/172 (65%), Positives = 140/172 (81%), Gaps = 2/172 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEFAWGLANS + FLWI+RPD+V G+ A+LPPEF   T +R +L+SWCPQE+VLGHQAVG
Sbjct  315  VEFAWGLANSGQTFLWIIRPDLVAGDTAVLPPEFSAATGERSLLASWCPQERVLGHQAVG  374

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNST+ESI  GVP++CWPFFAEQ TNC YS  +WG+GMEID++V RDEVE+ V
Sbjct  375  GFLTHSGWNSTIESIVAGVPVVCWPFFAEQPTNCRYSREEWGMGMEIDSDVKRDEVERQV  434

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  261
            RELME ++G+EMKRKAME K++A EAA   P G S +N+++ IN +L   R+
Sbjct  435  RELMEGKRGKEMKRKAMEWKEMAREAA--CPSGPSFLNLDELINSVLRLPRR  484



>ref|XP_008380092.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Malus domestica]
Length=434

 Score =   214 bits (546),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 109/168 (65%), Positives = 133/168 (79%), Gaps = 2/168 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EF WGLANS+ PFLW +RPD+V GE A+LPPEF  ETK+R ++ SWCPQEQ+L H AVG
Sbjct  266  LEFGWGLANSKLPFLWAIRPDLVLGESAILPPEFEFETKERXLIPSWCPQEQILNHPAVG  325

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNST+ES+C GVPMLCWP FAEQ TNC+Y+C  WG G+EI+ +V RD+VEK+V
Sbjct  326  GFLTHSGWNSTIESLCAGVPMLCWPIFAEQTTNCYYTCNDWGCGLEIEXDVKRDDVEKLV  385

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  273
            RELME EKG+EMK KA E KKLA EA+   P GSS   ++  +N +LL
Sbjct  386  RELMEGEKGKEMKNKAXEWKKLAEEASS--PHGSSSRTLDNLVNQVLL  431



>ref|XP_004303929.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=539

 Score =   217 bits (553),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 106/172 (62%), Positives = 137/172 (80%), Gaps = 2/172 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLANS+ PFLW++RPD+V GE A+LPPEF+ ETK+RG++++WCPQEQVL H +VG
Sbjct  369  IEFAWGLANSKLPFLWVIRPDLVAGECAILPPEFVAETKERGLIANWCPQEQVLNHPSVG  428

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNST+ESI  GVPMLCWP   +Q+ NC Y+C +W IGMEI N+V RDEV+K+V
Sbjct  429  GFLTHSGWNSTMESISAGVPMLCWPLIGDQRINCRYTCYQWDIGMEISNDVKRDEVKKLV  488

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  261
             ELME EKG+E+K K M  KKLA EA+   P+GSS++ +   +N +LLS  +
Sbjct  489  EELMEGEKGKELKNKVMMWKKLAEEASS--PLGSSNITLNNLVNQVLLSKYR  538



>ref|XP_006366314.1| PREDICTED: UDP-glycosyltransferase 85A7-like [Solanum tuberosum]
Length=475

 Score =   216 bits (549),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 103/169 (61%), Positives = 136/169 (80%), Gaps = 2/169 (1%)
 Frame = -3

Query  773  EFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVGG  594
            EFAWGLANS+ PFLWIVRPD+V G+ A+LP EF+EE KDRG+L+SWCPQ+QVL H ++G 
Sbjct  308  EFAWGLANSKHPFLWIVRPDIVMGDSAVLPDEFLEEIKDRGLLASWCPQDQVLSHPSIGV  367

Query  593  FLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvvR  414
            FLTHCGWNST+ESI +GVP++CWPFFAEQQTNC Y+C +WGIG+E++ +V R E+E ++ 
Sbjct  368  FLTHCGWNSTIESISSGVPLICWPFFAEQQTNCRYACVEWGIGVEVNKDVKRQEIEAIIN  427

Query  413  ELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSH  267
            +++E EKG+++K KA+E KK A EA D    GSS  + + F+  LLLS 
Sbjct  428  DMLEGEKGKDLKDKALEWKKKAAEATDI--GGSSWKHFDTFLEKLLLSR  474



>ref|XP_002525852.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
 gb|EEF36546.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
Length=474

 Score =   215 bits (548),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 107/172 (62%), Positives = 140/172 (81%), Gaps = 2/172 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VE AWGL NS++ FLWI+R D+V GE  +LP EF++ETK+RG+ +SWCPQE+VL H ++G
Sbjct  305  VELAWGLGNSKQTFLWIIRTDIVKGESTILPEEFVDETKERGLRTSWCPQERVLKHPSIG  364

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFL+H GWNST+ES+ NGVP++CWPF  EQQTNCW++C KWGIGMEI+N V RDEVEK+V
Sbjct  365  GFLSHMGWNSTIESLSNGVPVICWPFGGEQQTNCWFACNKWGIGMEIENEVKRDEVEKLV  424

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  261
            REL+E EKG+EM++KAME K+ A EA D  P G S +N+++ +N +LLS  K
Sbjct  425  RELIEGEKGKEMRKKAMEWKRKAEEATD--PNGKSSMNLDRLVNEVLLSQHK  474



>ref|XP_009377931.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Pyrus x 
bretschneideri]
Length=487

 Score =   216 bits (549),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 135/168 (80%), Gaps = 2/168 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EF WGLANS+ PFLW++RPD+V GE A+ P EF+ ET +RG+++SWCPQEQVL H +VG
Sbjct  319  IEFGWGLANSKLPFLWVIRPDLVAGESAIFPHEFVAETMERGLITSWCPQEQVLNHPSVG  378

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNST+ES+  GVPMLC P F EQQTNC+Y+C++WGIGMEI  +  RD+VEK+V
Sbjct  379  GFLTHSGWNSTIESLSAGVPMLCCPLFGEQQTNCFYTCSEWGIGMEISKDAKRDDVEKIV  438

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  273
            +E++  EKG++MK KAMELKKLA +A D  P GSS  N++  +N +LL
Sbjct  439  KEMLVGEKGKKMKNKAMELKKLAEKATD--PHGSSWTNLDNLVNQVLL  484



>ref|XP_004299646.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=486

 Score =   216 bits (549),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 105/172 (61%), Positives = 139/172 (81%), Gaps = 1/172 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLA+S K F W++RPD+V GE  +LPPEF+E+TK+RG+L+SWC QEQVL H A+G
Sbjct  316  IEFAWGLADSSKTFFWVIRPDLVGGESPVLPPEFIEQTKERGLLASWCCQEQVLSHPAIG  375

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNST+ES+C GVPM+CWPF  EQQTNC Y C +WGIG+E++ +V R+ +E VV
Sbjct  376  GFLTHSGWNSTIESVCGGVPMICWPFNGEQQTNCRYCCKEWGIGIEMEGDVKRNYIESVV  435

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  261
            R+LME E+G+EM++K+ME KKLA E A T P GSS ++++  +N +LLS R 
Sbjct  436  RKLMEGEEGKEMRKKSMEWKKLA-EKATTGPHGSSFLDLDNMVNQVLLSPRD  486



>ref|XP_004303933.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=483

 Score =   216 bits (549),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 137/168 (82%), Gaps = 3/168 (2%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLAN++ PF W++RPD+V GE A+LPPEF+ ETK+RG+++SWCPQEQVL H AVG
Sbjct  317  IEFAWGLANTKLPFFWVIRPDLVAGESAILPPEFVAETKERGLIASWCPQEQVLNHPAVG  376

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrde-vekv  420
            GFLTH GWNS +ES+  GVPM+CWPFF++QQTN W +C KWGIG+EI +N V+ + +EK+
Sbjct  377  GFLTHSGWNSVIESVNAGVPMICWPFFSDQQTNTWSACNKWGIGVEIMSNDVKRDEIEKL  436

Query  419  vRELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLL  276
            V+E+ME EKG++++ KAME KKLA EA  T P GSS  N++  +N LL
Sbjct  437  VKEVMEGEKGKKLRNKAMEWKKLAEEA--TGPHGSSATNLDNLVNQLL  482



>ref|XP_002530115.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
 gb|EEF32259.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
Length=483

 Score =   216 bits (549),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 138/168 (82%), Gaps = 2/168 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EF  GLANS+ PFLWI+R D+V GE A+LPP+F +ETK+R +++ WCPQE+VL H ++G
Sbjct  315  LEFGMGLANSKHPFLWIIRRDLVIGESAILPPDFFQETKERSLIAHWCPQEEVLNHPSIG  374

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GW ST+ES+  GVPMLCWPFFA+Q TNC YSC +WG+GMEIDNNV RDEVEK+V
Sbjct  375  GFLTHSGWGSTMESLSAGVPMLCWPFFADQPTNCRYSCNEWGVGMEIDNNVKRDEVEKLV  434

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  273
            RELME EKG+EM+  AME KKLA EA  T P GSS +N+EKF+N +LL
Sbjct  435  RELMEGEKGKEMRNNAMEWKKLAEEA--TAPNGSSSMNLEKFMNEVLL  480



>ref|XP_009612691.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Nicotiana 
tomentosiformis]
 dbj|BAD93689.1| glycosyltransferase [Nicotiana tabacum]
Length=485

 Score =   216 bits (549),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 117/171 (68%), Positives = 146/171 (85%), Gaps = 1/171 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLANSQ+ FLWI+RPD+V+G+ ++LPPEF+EETK+RGML+SWC QE+VL H A+ 
Sbjct  315  IEFAWGLANSQQTFLWIIRPDIVSGDASILPPEFVEETKNRGMLASWCSQEEVLSHPAIV  374

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNSTLESI +GVPM+CWPFFAEQQTNCW+S TKW +GMEID++V RDEVE +V
Sbjct  375  GFLTHSGWNSTLESISSGVPMICWPFFAEQQTNCWFSVTKWDVGMEIDSDVKRDEVESLV  434

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHR  264
            RELM   KG++MK+KAME K+LA EA+     GSS+VNIEK +N +LLS +
Sbjct  435  RELMVGGKGKKMKKKAMEWKELA-EASAKEHSGSSYVNIEKLVNDILLSSK  484



>ref|XP_009377935.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Pyrus x 
bretschneideri]
 ref|XP_009377936.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Pyrus x 
bretschneideri]
Length=478

 Score =   215 bits (548),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 135/168 (80%), Gaps = 2/168 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EF WGLANS+ PFLW +RPD+V GE A+ PPEF  ETK+RG+L SWCPQEQVL H +VG
Sbjct  310  LEFGWGLANSELPFLWAIRPDLVIGESAIFPPEFEFETKERGLLVSWCPQEQVLNHPSVG  369

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNS +ES+  GVPMLCWPFFA+Q TNC+Y+C +WGIGMEIDN+V RDEVEK+V
Sbjct  370  GFLTHSGWNSNIESLSAGVPMLCWPFFADQTTNCYYTCNEWGIGMEIDNDVKRDEVEKLV  429

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  273
            R LME EKG++MK K ME KKLA EA  T P GSS  N++  +N +LL
Sbjct  430  RGLMEGEKGKKMKNKVMEWKKLAEEA--TGPQGSSTRNLDNLVNQVLL  475



>ref|XP_008219468.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Prunus mume]
Length=577

 Score =   218 bits (554),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 112/174 (64%), Positives = 141/174 (81%), Gaps = 4/174 (2%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMV-TGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAV  600
             EFAWGLANS+K F W++RPD+V  G+  ++ PEF+EETK+RG+L+SWCPQEQVL H AV
Sbjct  406  TEFAWGLANSKKAFFWVIRPDLVGEGKSVVVAPEFVEETKERGLLASWCPQEQVLSHPAV  465

Query  599  GGFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekv  420
            GGFLTH GWNSTLES+C GVPM+CWPFFAEQQTNC + C +WGIGMEI+ +V R+ VE +
Sbjct  466  GGFLTHSGWNSTLESLCGGVPMICWPFFAEQQTNCRFCCKEWGIGMEIEGDVKRNYVEGL  525

Query  419  vRELMESEKGREMKRKAMELKKLAMEAADTI-PIGSSHVNIEKFINHLLLSHRK  261
            VR+LME E+G+EM++KA+E KKLA EA  TI P G S V ++K +N +LLS R 
Sbjct  526  VRKLMEGEEGKEMRKKALEWKKLAKEA--TIGPNGLSFVGLDKLVNQVLLSPRN  577


 Score = 94.4 bits (233),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLG  612
            +EFAWGLANS + F W++RPD+V GE A++PPEFMEETK+RG+L+SWCPQEQ +G
Sbjct  313  IEFAWGLANSNQTFFWVIRPDLVGGEAAVVPPEFMEETKERGLLASWCPQEQSIG  367



>ref|XP_002298702.2| hypothetical protein POPTR_0001s32000g [Populus trichocarpa]
 gb|EEE83507.2| hypothetical protein POPTR_0001s32000g [Populus trichocarpa]
Length=474

 Score =   215 bits (548),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 114/166 (69%), Positives = 136/166 (82%), Gaps = 2/166 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLANS KPFLWI+RPD+V GE AMLP EF+ ETK RGML++WCPQE VL H ++G
Sbjct  305  MEFAWGLANSNKPFLWIIRPDLVEGESAMLPSEFVSETKKRGMLANWCPQELVLKHPSIG  364

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFL H GWNST++SIC GVP++CWPFFA+QQTNC ++CT+WGIGM+IDNNV RDEVEK+V
Sbjct  365  GFLCHMGWNSTMDSICAGVPLICWPFFADQQTNCMFACTEWGIGMQIDNNVKRDEVEKLV  424

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHL  279
            RELME EKG++MKRKAME K  A E   T P GSS  N+E  +  L
Sbjct  425  RELMEGEKGKDMKRKAMEWKTKAEEV--TRPGGSSFENLEALVKVL  468



>ref|XP_002308830.2| hypothetical protein POPTR_0006s02380g [Populus trichocarpa]
 gb|EEE92353.2| hypothetical protein POPTR_0006s02380g [Populus trichocarpa]
Length=480

 Score =   215 bits (548),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 110/168 (65%), Positives = 135/168 (80%), Gaps = 2/168 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +E   GLA S  PFLWI+RPDMV G+ A+LPPEF +ETKDRG +SSWCPQE+VL H ++G
Sbjct  314  IELGMGLAKSGHPFLWILRPDMVIGDSAILPPEFTDETKDRGFISSWCPQEEVLNHPSIG  373

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNST ESI +GVPMLC PFF +QQTNC Y+C +WGIGMEID+N  RD+VEK+V
Sbjct  374  GFLTHSGWNSTAESISSGVPMLCLPFFGDQQTNCRYTCNEWGIGMEIDSNAERDKVEKLV  433

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  273
            RELME EKGRE+K+K ME +KLA EAA   P GSS +N+++ +  +LL
Sbjct  434  RELMEGEKGREVKKKVMEWRKLAEEAAG--PSGSSSMNLDELVKAVLL  479



>ref|XP_002307922.1| hypothetical protein POPTR_0006s02450g [Populus trichocarpa]
 gb|EEE91445.1| hypothetical protein POPTR_0006s02450g [Populus trichocarpa]
Length=474

 Score =   215 bits (547),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 110/170 (65%), Positives = 138/170 (81%), Gaps = 2/170 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEFA GLA+S+ PFLWI+RPD+V G+ A LP EF  ET++R  ++SWCPQE+VL H +VG
Sbjct  307  VEFAMGLADSKHPFLWIIRPDLVVGDAATLPAEFAAETQNRSFIASWCPQEEVLNHPSVG  366

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNST ES+  GVPM+CWPFF +QQ NC YSC +WG+GMEIDNNV R+EVEK+V
Sbjct  367  GFLTHSGWNSTTESLSAGVPMICWPFFGDQQMNCRYSCNEWGVGMEIDNNVRREEVEKLV  426

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSH  267
            RELME EKG++M+ KAM+ K+LA EA  T P GSS +N+EK ++ LLLS+
Sbjct  427  RELMEGEKGKKMREKAMDWKRLAEEA--TEPTGSSSINLEKLVSELLLSN  474



>ref|XP_004237925.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Solanum 
lycopersicum]
Length=482

 Score =   215 bits (548),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 138/170 (81%), Gaps = 1/170 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
             EFAWGLAN+Q  FLWIVR D+V G+ A+LP EF+ ETK+RG+L  WCPQEQVL H ++G
Sbjct  314  TEFAWGLANTQMDFLWIVRSDLVMGDSAILPHEFLAETKERGLLVGWCPQEQVLSHPSIG  373

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTHCGWNSTLESI  GVPMLCWPFFA+QQTN W++C +W +GMEID+NV R+ +E+VV
Sbjct  374  GFLTHCGWNSTLESISYGVPMLCWPFFADQQTNSWFNCNRWDVGMEIDSNVKREVIEEVV  433

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSH  267
            RELM  EKG++MK  A++ KKLA +A D+   GSS++N +K ++H+LL +
Sbjct  434  RELMIGEKGKKMKENALKWKKLAEKAIDSSD-GSSYMNFDKLVSHVLLRN  482



>ref|XP_007047908.1| UDP-glucosyl transferase 85A2 [Theobroma cacao]
 gb|EOX92065.1| UDP-glucosyl transferase 85A2 [Theobroma cacao]
Length=484

 Score =   215 bits (548),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 135/166 (81%), Gaps = 2/166 (1%)
 Frame = -3

Query  773  EFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVGG  594
            EFAWGLANS+ PFLWI+RPD+V GE A+LP EF EE KDRG+++SWCPQ++VL H +VG 
Sbjct  312  EFAWGLANSKHPFLWIIRPDVVMGESAILPEEFFEEIKDRGLITSWCPQDEVLCHPSVGV  371

Query  593  FLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvvR  414
            FLTHCGWNSTLESI  GVP++CWPFFAEQQTNC Y+CTKWGIGME++ +V RD+V+ +V+
Sbjct  372  FLTHCGWNSTLESISGGVPVICWPFFAEQQTNCRYACTKWGIGMEVNPDVKRDDVKALVK  431

Query  413  ELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLL  276
            E+ME + G++M++KA+E +  A  A D    GSS+ N ++FIN  L
Sbjct  432  EMMEGDNGKQMRQKALEWRSKAEVATDI--GGSSYNNFDRFINEAL  475



>ref|XP_011008538.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Populus 
euphratica]
Length=488

 Score =   215 bits (548),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 109/172 (63%), Positives = 135/172 (78%), Gaps = 2/172 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +E   GL+ S  PFLWI+RPDM+ G+ A+LPPEF EETK+RG + SWCPQE VL H ++G
Sbjct  315  IELGMGLSKSGHPFLWIIRPDMIAGDSAILPPEFTEETKERGFICSWCPQEVVLNHPSIG  374

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTHCGW ST+ESI +GVPMLC PF  +QQTNC Y+CTKWGIGMEID+NV  D VEK+V
Sbjct  375  GFLTHCGWGSTIESISSGVPMLCLPFAGDQQTNCRYTCTKWGIGMEIDSNVKSDNVEKLV  434

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  261
            RELME ++G++MK KA E KKLA EA+   P GSS +N++K +  +LLS RK
Sbjct  435  RELMEGDRGKKMKEKATEWKKLAEEASG--PTGSSTMNLDKLVKEVLLSRRK  484



>gb|EYU18463.1| hypothetical protein MIMGU_mgv1a005662mg [Erythranthe guttata]
Length=475

 Score =   215 bits (547),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 107/169 (63%), Positives = 131/169 (78%), Gaps = 3/169 (2%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
             EFAWGLA+S+KPFLW VRPD+V G GA LPPEF  E +DRGM+  W PQE+VL H + G
Sbjct  308  AEFAWGLADSRKPFLWCVRPDVVVGGGAALPPEFTAEVRDRGMVVGWAPQERVLKHPSTG  367

Query  596  GFLTHCGWNSTLESICN-GVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekv  420
            GFLTHCGWNST+ESI N G+P++ WPFFAEQQTNC YSC +WGIG EID +V R +V   
Sbjct  368  GFLTHCGWNSTIESIANGGLPLIGWPFFAEQQTNCRYSCVEWGIGFEIDTDVKRADVAAA  427

Query  419  vRELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  273
            V ELM+ +KG++MK KA+ELK+ A EA  T P GSS +N++K IN +LL
Sbjct  428  VIELMDGDKGKKMKEKALELKRKAGEA--TAPGGSSFMNLDKLINDVLL  474



>ref|XP_009612740.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=484

 Score =   215 bits (547),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 144/170 (85%), Gaps = 1/170 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLANSQ  FLWI+RPD+VTGE A+LP EF+E+TK+RGML+SWCPQEQVL H A+G
Sbjct  316  IEFAWGLANSQMEFLWIIRPDIVTGEQAILPSEFVEQTKERGMLASWCPQEQVLSHSAIG  375

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNSTLESI +GVPM+CWPFFAEQQTNCW+  T+WGIGMEIDNNV RDEV+ +V
Sbjct  376  GFLTHSGWNSTLESIGSGVPMICWPFFAEQQTNCWFKGTQWGIGMEIDNNVKRDEVKSLV  435

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSH  267
            RELM  EKG+EMK+K+ME KKLA EA    P GSS V I+K IN +LL H
Sbjct  436  RELMAGEKGKEMKKKSMEWKKLAEEATQK-PEGSSFVAIDKLINEILLKH  484



>dbj|BAO51838.1| UDP-glycosyltransferase 85A36 [Humulus lupulus]
Length=487

 Score =   215 bits (547),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 109/172 (63%), Positives = 138/172 (80%), Gaps = 2/172 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLANS+KPF+WI+RPD+V G+ A+LP EF+EET++R ++SSWCPQE+VL H A+G
Sbjct  317  IEFAWGLANSKKPFVWIIRPDLVDGDSAILPSEFVEETRERSLISSWCPQEEVLSHPAIG  376

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTHCGWNSTLES+  GVPM+CWPFFAEQQTNC + C  WG GMEI+ NV RD+VEK+V
Sbjct  377  GFLTHCGWNSTLESLSAGVPMICWPFFAEQQTNCKFLCNYWGSGMEINPNVKRDDVEKLV  436

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  261
            RELM+ EKG +M+ KAME K  A EA +    GSS VN++  I+ +L+   K
Sbjct  437  RELMDGEKGNDMRNKAMEWKHKAHEATEL--GGSSLVNLDNIISKVLVPSSK  486



>gb|AFJ52994.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=457

 Score =   214 bits (545),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/169 (62%), Positives = 140/169 (83%), Gaps = 1/169 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEFAWGLA S+K FLW++RPD+V G  A+LP EF +E K+RG+L SWCPQ++VL H ++G
Sbjct  288  VEFAWGLAKSKKTFLWVIRPDLVQGASAILPGEFSDEVKERGLLVSWCPQDRVLKHPSIG  347

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTHCGWNSTLES+ +GVPM+CWPFFAEQQTNCW+ C KW +G+EID++V RDE++++V
Sbjct  348  GFLTHCGWNSTLESLTSGVPMICWPFFAEQQTNCWFVCNKWRVGVEIDSDVKRDEIDELV  407

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLS  270
            +EL++  KG+EMK  AME K+LA EAA    IG +++N+E  IN++LL+
Sbjct  408  KELIDGVKGKEMKETAMEWKRLAEEAAQC-EIGHAYLNLESVINNVLLN  455



>ref|XP_009590778.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Nicotiana 
tomentosiformis]
Length=485

 Score =   215 bits (547),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 117/171 (68%), Positives = 144/171 (84%), Gaps = 1/171 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLANSQ+ FLWI+RPD+V+G+ ++LPPEF+EETK RGML+SWC QE+VL H A+G
Sbjct  315  IEFAWGLANSQQSFLWIIRPDIVSGDASILPPEFVEETKKRGMLASWCSQEEVLSHPAIG  374

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNSTLESI +GVPM+CWPFFAEQQTNCW+S TKW +GMEID +V RDEVE +V
Sbjct  375  GFLTHSGWNSTLESISSGVPMICWPFFAEQQTNCWFSVTKWDVGMEIDCDVKRDEVESLV  434

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHR  264
            RELM   KG++MK+K ME K+LA EA+     GSS+VNIEK +N +LLS +
Sbjct  435  RELMVGGKGKKMKKKTMEWKELA-EASAKEHSGSSYVNIEKVVNDILLSSK  484



>gb|AFK38894.1| unknown [Medicago truncatula]
Length=485

 Score =   215 bits (547),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 109/172 (63%), Positives = 135/172 (78%), Gaps = 2/172 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLANS++PFLWI+RPD+V G   +L  EF+ E  DRG+++SWCPQEQVL H ++G
Sbjct  315  LEFAWGLANSKQPFLWIIRPDLVIGGSVVLSSEFVNEISDRGLIASWCPQEQVLNHPSIG  374

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTHCGWNST ES C GVPMLCWPFFA+Q  NC Y C +W IGMEID NV RDEVEK+V
Sbjct  375  GFLTHCGWNSTTESTCAGVPMLCWPFFADQPANCRYICNEWEIGMEIDTNVKRDEVEKLV  434

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  261
             ELM  EKG++M++KA+ELKK A E  DT P G S++N++K IN +LL   +
Sbjct  435  NELMVGEKGKKMRQKAIELKKKAEE--DTRPGGCSYMNLDKVINEVLLKQNQ  484



>ref|XP_009791953.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Nicotiana 
sylvestris]
Length=484

 Score =   215 bits (547),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 126/170 (74%), Positives = 144/170 (85%), Gaps = 1/170 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLANSQ  FLWI+RPD+V+GE A+LPPEF+ ETK+RGML+SWCPQEQVL H A+G
Sbjct  316  IEFAWGLANSQMEFLWIIRPDIVSGEQAILPPEFVGETKERGMLASWCPQEQVLSHPAIG  375

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNSTLESI +GVPM+CWPFFAEQQTNCW+  T+WGIGMEIDNNV RDEVE +V
Sbjct  376  GFLTHSGWNSTLESIGSGVPMICWPFFAEQQTNCWFKGTQWGIGMEIDNNVKRDEVESLV  435

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSH  267
            RELM  EKG+EMK+KAME KKLA EA    P GSS V I+K IN +LL H
Sbjct  436  RELMAGEKGKEMKKKAMEWKKLAEEATQK-PEGSSFVAIDKLINEILLKH  484



>gb|KCW66555.1| hypothetical protein EUGRSUZ_F00353, partial [Eucalyptus grandis]
Length=477

 Score =   214 bits (546),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 136/164 (83%), Gaps = 2/164 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEFAWGLANS + FLW++RPD+V G+ A+LPPEF   T++R +L+SWCPQ QVL HQA+G
Sbjct  315  VEFAWGLANSGQTFLWVIRPDLVVGDTAILPPEFSAMTRERSLLASWCPQVQVLRHQAIG  374

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNST+ESI  GVP++CWPFFAEQQ NC YSC +WGIGMEID +V RDEVE+ V
Sbjct  375  GFLTHSGWNSTIESITAGVPVVCWPFFAEQQMNCRYSCQEWGIGMEIDGDVKRDEVERQV  434

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFIN  285
            RELME E+G+EMKRKAME K++A EA  T P GSS +N+++ I+
Sbjct  435  RELMEGERGKEMKRKAMEWKEMAREA--TRPSGSSCLNLDEVID  476



>dbj|BAO51841.1| UDP-glycosyltransferase 85A35 [Humulus lupulus]
Length=487

 Score =   215 bits (547),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 109/172 (63%), Positives = 138/172 (80%), Gaps = 2/172 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLANS+KPF+WI+RPD+V G+ A+LP EF+EET++R ++SSWCPQE+VL H A+G
Sbjct  317  IEFAWGLANSKKPFVWIIRPDLVDGDSAILPSEFVEETRERSLISSWCPQEEVLSHPAIG  376

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTHCGWNSTLES+  GVPM+CWPFFAEQQTNC + C  WG GMEI+ NV RD+VEK+V
Sbjct  377  GFLTHCGWNSTLESLSAGVPMICWPFFAEQQTNCKFLCDYWGSGMEINPNVKRDDVEKLV  436

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  261
            RELM+ EKG +M+ KAME K  A EA +    GSS VN++  I+ +L+   K
Sbjct  437  RELMDGEKGNDMRNKAMEWKHKAHEATEL--GGSSLVNLDNIISKVLVPSSK  486



>ref|XP_002323974.2| hypothetical protein POPTR_0017s07880g [Populus trichocarpa]
 gb|EEF04107.2| hypothetical protein POPTR_0017s07880g [Populus trichocarpa]
Length=482

 Score =   214 bits (546),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 138/167 (83%), Gaps = 2/167 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEF+WGLANS+K FLWI+RPD+V GE A+LPPEF+EET++RG+++SWC QE+VL H ++G
Sbjct  313  VEFSWGLANSKKNFLWIIRPDLVRGESAVLPPEFLEETRERGLMASWCAQEKVLKHSSIG  372

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFL+H GWNST+ES+ NGV MLCWPFF+EQQTNC ++C  WG+GMEI+++  RD+VEK+V
Sbjct  373  GFLSHMGWNSTIESLSNGVAMLCWPFFSEQQTNCKFACVDWGVGMEIESDANRDDVEKLV  432

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLL  276
             EL++ EKG+EMKRKAME K  A EA   I  GSS +N +K +N +L
Sbjct  433  IELIDGEKGKEMKRKAMEWKSKA-EATTGIN-GSSSMNFDKLVNDVL  477



>ref|XP_011010110.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Populus 
euphratica]
Length=388

 Score =   212 bits (540),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 136/171 (80%), Gaps = 2/171 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEFA GL NS  PFLWI+RPD+V GE A+LP EF EET+ RG ++SWCPQE+VL H AVG
Sbjct  220  VEFAMGLVNSNIPFLWIIRPDLVIGESAVLPAEFAEETERRGFITSWCPQEEVLNHPAVG  279

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GW ST+ES+C GVPM+CWPFFA+Q  NC YSC +WG+GMEIDNNV R+EVE +V
Sbjct  280  GFLTHSGWGSTIESLCAGVPMVCWPFFADQAMNCRYSCNEWGVGMEIDNNVKREEVEMLV  339

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHR  264
            +ELME EKG +M+ KAME K+LA EA    P G+S +N++KFI+ ++ S+ 
Sbjct  340  KELMEGEKGEKMRGKAMEWKRLAEEAVG--PEGTSSINLDKFIHEIISSNN  388



>ref|XP_008455179.1| PREDICTED: UDP-glycosyltransferase 85A5-like [Cucumis melo]
Length=488

 Score =   214 bits (546),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 110/172 (64%), Positives = 138/172 (80%), Gaps = 2/172 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLA+S KPFLWI RPD++ G+ A+LP EF+ +TKDR ++++WC QEQVL H ++G
Sbjct  317  IEFAWGLADSGKPFLWITRPDLIVGDSAILPHEFVTQTKDRSLIANWCCQEQVLNHPSIG  376

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNSTLESIC GVPM+ WPFFAEQQTNC Y CT+WGIGMEIDNNV R+EVE++V
Sbjct  377  GFLTHSGWNSTLESICAGVPMISWPFFAEQQTNCRYCCTEWGIGMEIDNNVKRNEVEELV  436

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  261
            RELM+ EKG++MK   M LK  A EA    P GS++  ++K IN +LLS+ K
Sbjct  437  RELMDGEKGKKMKENVMYLKSKAEEAYK--PDGSAYKQLDKLINEVLLSNIK  486



>ref|XP_011008539.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Populus 
euphratica]
Length=418

 Score =   213 bits (542),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 110/169 (65%), Positives = 133/169 (79%), Gaps = 2/169 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EF  GL  S  PFLWI+RPDM+ G+ A+LPPEF EETKDRG + SWCPQE+VL H +VG
Sbjct  252  IEFGMGLVKSGHPFLWIIRPDMIAGDCAILPPEFTEETKDRGFICSWCPQEEVLNHPSVG  311

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
             FLTHCGW S +ESI +GVPMLCWPF  +QQTNC Y+CT+WGIGMEID+NV RD+VE +V
Sbjct  312  AFLTHCGWTSIIESISSGVPMLCWPFAGDQQTNCRYTCTEWGIGMEIDSNVTRDKVENIV  371

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLS  270
            RE  E EKG+EMK+KAME KKLA EA  T   GSS +N++K +  +LLS
Sbjct  372  REFREREKGKEMKKKAMEWKKLAEEA--TGAGGSSSMNLDKLVTEVLLS  418



>ref|XP_002323977.2| hypothetical protein POPTR_0017s07900g [Populus trichocarpa]
 gb|EEF04110.2| hypothetical protein POPTR_0017s07900g [Populus trichocarpa]
Length=482

 Score =   214 bits (546),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 138/167 (83%), Gaps = 2/167 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEF+WGLANS+K FLWI+RPD+V GE A+LPPEF+EET++RG+++SWC QE+VL H ++G
Sbjct  313  VEFSWGLANSKKNFLWIIRPDLVRGESAVLPPEFLEETRERGLMTSWCAQEKVLKHSSIG  372

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFL+H GWNST+ES+ NGV MLCWPFF+EQQTNC ++C  WG+GMEI+++  RD+VEK+V
Sbjct  373  GFLSHMGWNSTIESLSNGVAMLCWPFFSEQQTNCKFACVDWGVGMEIESDANRDDVEKLV  432

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLL  276
             EL++ EKG+EMKRKAME K  A EA   I  GSS +N +K +N +L
Sbjct  433  IELIDGEKGKEMKRKAMEWKSKA-EATTGIN-GSSSMNFDKLVNDVL  477



>emb|CDO97432.1| unnamed protein product [Coffea canephora]
Length=477

 Score =   214 bits (545),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 107/174 (61%), Positives = 138/174 (79%), Gaps = 2/174 (1%)
 Frame = -3

Query  773  EFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVGG  594
            EFAWGLA+S++ FLWI+RPD+V+GE A+LP EF+EETKDRG+L+ WCPQE+VL H +VG 
Sbjct  306  EFAWGLADSKQNFLWIIRPDLVSGESAILPAEFLEETKDRGILAGWCPQERVLAHPSVGV  365

Query  593  FLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvvR  414
            FLTHCGWNST+ESI  GVPM+CWPFFAEQQTNC Y+C+ W  G+EID+N  R++V + V+
Sbjct  366  FLTHCGWNSTIESISCGVPMICWPFFAEQQTNCRYACSTWENGVEIDSNATREKVAESVK  425

Query  413  ELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK*HP  252
            E+ME EKGR M+ KA+E K+ A  A  T P GSS+ N+EK I + LL +   +P
Sbjct  426  EMMEGEKGRNMRAKALEWKEKARLA--TKPGGSSYQNLEKLIRNTLLENGTNYP  477



>ref|XP_002307921.2| hypothetical protein POPTR_0006s02440g [Populus trichocarpa]
 gb|EEE91444.2| hypothetical protein POPTR_0006s02440g [Populus trichocarpa]
Length=453

 Score =   213 bits (543),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 111/169 (66%), Positives = 137/169 (81%), Gaps = 2/169 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEFA GLANS+  FLWI+RPD+V G+ A+LP EF  ET+ RG ++SWCPQE+VL H ++G
Sbjct  283  VEFAMGLANSKISFLWIIRPDLVIGDSAILPAEFAVETQKRGFIASWCPQEEVLNHPSIG  342

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNST+ES+C GVPM+CWPFFA+Q  NC YS ++WG+GMEIDN V R+EVEK+V
Sbjct  343  GFLTHSGWNSTVESLCAGVPMICWPFFADQAINCSYSGSEWGVGMEIDNKVKREEVEKLV  402

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLS  270
            RELME EKG +M+ KAME KKLA EAA   P GSS +N++KFIN +L S
Sbjct  403  RELMEGEKGEKMRGKAMEWKKLAEEAA--APHGSSSINLDKFINEILQS  449



>gb|KEH17174.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=479

 Score =   214 bits (545),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 106/168 (63%), Positives = 135/168 (80%), Gaps = 2/168 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGL+NS+KPFLW++RPD+V GE A+LP EF+EETKDRG+LSSWC Q +VL H A+G
Sbjct  314  IEFAWGLSNSKKPFLWVIRPDLVAGENAVLPLEFLEETKDRGLLSSWCLQGEVLAHSAIG  373

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNSTLES+C GVPM+CWPFFAEQQTNC + C +W IG+EI  +  RD++E +V
Sbjct  374  GFLTHSGWNSTLESVCAGVPMICWPFFAEQQTNCRFCCNEWEIGLEI-EDAKRDKIESLV  432

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  273
            +EL++ EKG+EMK KA++ KKLA  AA   P GSS +N+E     +LL
Sbjct  433  KELLDGEKGKEMKAKALQWKKLAHNAASG-PHGSSFMNLENLFRDVLL  479



>ref|XP_011045673.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Populus 
euphratica]
Length=474

 Score =   214 bits (544),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 136/166 (82%), Gaps = 2/166 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLANS  PFLWI+RPD+V GE +MLP EF+ ETK RGML++WCPQE VL H ++G
Sbjct  305  MEFAWGLANSNTPFLWIIRPDLVEGESSMLPSEFVSETKKRGMLANWCPQELVLKHPSIG  364

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFL+H GWNST++SIC GVP++CWPFFA+QQTNC ++CTKWGIGM+IDNNV RDEVEK+V
Sbjct  365  GFLSHTGWNSTMDSICAGVPLICWPFFADQQTNCMFACTKWGIGMQIDNNVKRDEVEKLV  424

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHL  279
            RELM+ EKG++MKRKAME K  A E   T P GSS  N+E  +  L
Sbjct  425  RELMKGEKGKDMKRKAMEWKTKAEEV--TRPGGSSFENLEALVKVL  468



>ref|XP_002268162.1| PREDICTED: 7-deoxyloganetin glucosyltransferase [Vitis vinifera]
Length=480

 Score =   214 bits (545),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 134/166 (81%), Gaps = 2/166 (1%)
 Frame = -3

Query  773  EFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVGG  594
            EFAWGLANSQ  FLWI+RPD+V G+ A+LP EF EETKDRG+L+SWCPQEQVL H +V  
Sbjct  313  EFAWGLANSQYSFLWIIRPDVVMGDSAVLPEEFREETKDRGLLASWCPQEQVLSHPSVAV  372

Query  593  FLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvvR  414
            FLTH GWNSTLE++C GVP++CWPFFAEQQTNC Y+CT+WGIGME++++V R ++E +V+
Sbjct  373  FLTHSGWNSTLETVCAGVPVICWPFFAEQQTNCRYACTEWGIGMEVNHDVKRHDIEALVK  432

Query  413  ELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLL  276
            E+ME EKG++MK+ AME KK A EA      GSS+ N ++ +  +L
Sbjct  433  EMMEGEKGKQMKKTAMEWKKKAEEATGV--GGSSYNNFDRLVKEVL  476



>ref|XP_006373648.1| hypothetical protein POPTR_0016s021501g, partial [Populus trichocarpa]
 gb|ERP51445.1| hypothetical protein POPTR_0016s021501g, partial [Populus trichocarpa]
Length=308

 Score =   209 bits (532),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 102/171 (60%), Positives = 137/171 (80%), Gaps = 2/171 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EF  GL+ S   F+WI+RPDMV G+ A+ P EFMEETK+RG +++WCPQE+VL H ++G
Sbjct  140  IEFGMGLSESNHSFVWIIRPDMVIGQSAIFPAEFMEETKERGFIANWCPQEEVLNHPSIG  199

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GF+THCGW ST+ESI +GVPMLC PFF +Q TNC Y+C +WGIGMEIDN++ R+ V+ +V
Sbjct  200  GFITHCGWGSTIESISSGVPMLCCPFFGDQLTNCRYTCNEWGIGMEIDNDINRENVKTLV  259

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHR  264
            RELME +KG++MK++AME KKLA+EA  T P G+S +N++K IN +LLS  
Sbjct  260  RELMEGDKGKKMKKQAMEWKKLAVEA--TAPNGTSSMNLDKLINEVLLSRN  308



>ref|XP_011014888.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like isoform 
X3 [Populus euphratica]
Length=487

 Score =   214 bits (544),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 110/172 (64%), Positives = 135/172 (78%), Gaps = 2/172 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEF  GL+ S   FLWI+RPDM+ G+ A+LPPEF EETK+RG + SWCPQE VL H ++G
Sbjct  314  VEFGMGLSKSGHLFLWIIRPDMIAGDSAILPPEFTEETKERGFICSWCPQEVVLNHPSIG  373

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTHCGW ST+ESI +GVPMLC PF  +QQTNC Y+CTKWGIGMEID+NV  D VEK+V
Sbjct  374  GFLTHCGWGSTIESISSGVPMLCLPFAGDQQTNCRYTCTKWGIGMEIDSNVKSDNVEKLV  433

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  261
            RELME ++G++MK KA E KKLA EA+   P GSS +N++K +  +LLS RK
Sbjct  434  RELMEGDRGKKMKDKATEWKKLAEEASG--PTGSSTMNLDKLVKEVLLSRRK  483



>dbj|BAG80552.1| UDP-glucose:glucosyltransferase [Lycium barbarum]
Length=490

 Score =   214 bits (545),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 108/170 (64%), Positives = 136/170 (80%), Gaps = 1/170 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLAN +  FLWI R D+V G+ A+LP EF+ ETK+RG+L  WCPQEQVL H ++G
Sbjct  319  IEFAWGLANIKMNFLWITRSDLVMGDSAILPHEFLAETKERGLLGGWCPQEQVLSHPSIG  378

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GF+THCGWNSTLESI  GVPMLCWPFFA+QQTNCW+ C +WG+GMEID+NV R+ +EK+V
Sbjct  379  GFITHCGWNSTLESISFGVPMLCWPFFADQQTNCWFICNRWGVGMEIDSNVKREVIEKLV  438

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSH  267
            RELM  EKG+EMK  A++ KKLA E   T   GSS++N EK ++H+LL +
Sbjct  439  RELMIGEKGKEMKENALKWKKLAEETI-TSSNGSSYMNFEKLVSHVLLRN  487



>ref|XP_004300654.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Fragaria 
vesca subsp. vesca]
 ref|XP_011465520.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=482

 Score =   214 bits (544),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 101/172 (59%), Positives = 138/172 (80%), Gaps = 1/172 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLANS   FLW++RPD+V G+ A++PPEF+EETK R  L+SWCPQEQVL H A+G
Sbjct  312  IEFAWGLANSSMTFLWVIRPDLVAGKSAVVPPEFVEETKGRSWLASWCPQEQVLNHPAIG  371

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTHCGWNS +ES+C GVPM+CWPFFA+QQTNC + C +WG+ M+I+ +V R+ +E +V
Sbjct  372  GFLTHCGWNSMVESLCGGVPMICWPFFADQQTNCRFCCKEWGVAMQIEGDVKRNYIEDLV  431

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  261
            R+LM  ++G++M++K++E KKLA EA  T P GSS +N+ K +N +LLS + 
Sbjct  432  RKLMGGQEGKQMRKKSLEWKKLAEEAI-TAPNGSSFLNLNKMVNQVLLSPKN  482



>ref|XP_008466222.1| PREDICTED: UDP-glycosyltransferase 85A2 [Cucumis melo]
Length=487

 Score =   214 bits (544),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 137/167 (82%), Gaps = 1/167 (1%)
 Frame = -3

Query  773  EFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVGG  594
            EFAWGLANS + FLWI+RPD+V G+ A+LPPEF++ TK+RGML++WCPQE+VL H A+GG
Sbjct  319  EFAWGLANSGQTFLWIIRPDLVAGDTAVLPPEFIDMTKERGMLTNWCPQEEVLQHPAIGG  378

Query  593  FLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvvR  414
            FLTH GWNST ESI  GVPM+CWPFFAEQQTNC Y CT+WGIGMEID++V R+E+EK VR
Sbjct  379  FLTHNGWNSTFESIVAGVPMICWPFFAEQQTNCRYCCTEWGIGMEIDSDVKREEIEKQVR  438

Query  413  ELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  273
            ELME +KG+EM+++A E KKL  +AA+    GSS  N+   ++ +LL
Sbjct  439  ELMEGDKGKEMRKRAQEWKKLMADAAEPHS-GSSFRNLNHLVHKVLL  484



>gb|KFK44331.1| hypothetical protein AALP_AA1G244300 [Arabis alpina]
Length=483

 Score =   214 bits (544),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 107/168 (64%), Positives = 133/168 (79%), Gaps = 1/168 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEFAWGLA S K FLW++RPD+V G+ A++PPEF+ ET+DR ML+SWCPQE+VL H A+G
Sbjct  316  VEFAWGLAASGKDFLWVIRPDLVAGDAAVIPPEFLAETEDRRMLASWCPQEKVLSHPAIG  375

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTHCGWNSTLES+C GVPM+CWPFFAEQ TNC + C +WG+GMEI  NV R+E+E VV
Sbjct  376  GFLTHCGWNSTLESLCGGVPMICWPFFAEQPTNCKFCCDEWGVGMEIGGNVKREELETVV  435

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  273
            RELM+ EKG++M+ KA E + LA EA     +GSS VN    +N +LL
Sbjct  436  RELMDGEKGKKMREKAEEWRHLAEEATKD-KLGSSVVNFNTLVNKVLL  482



>ref|XP_004136879.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Cucumis sativus]
Length=488

 Score =   214 bits (544),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 109/172 (63%), Positives = 137/172 (80%), Gaps = 2/172 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLA+S KPFLWI RPD++ G+ A++  EF+ +TKDR M++SWC QEQVL H ++G
Sbjct  317  IEFAWGLADSGKPFLWITRPDLIVGDSAIMSQEFVTQTKDRSMIASWCSQEQVLNHPSIG  376

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GF+TH GWNSTLESIC GVPM+ WPFFAEQQTNC Y CT+WGIGMEIDNNV+R EVE++V
Sbjct  377  GFVTHSGWNSTLESICAGVPMISWPFFAEQQTNCRYCCTEWGIGMEIDNNVIRSEVEELV  436

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  261
             ELM+ EKG++MK  AM LK  A EA    P GS++  ++K IN +LLS+ K
Sbjct  437  GELMDGEKGKKMKENAMFLKSKAEEAYK--PGGSAYKQLDKLINEVLLSNIK  486



>emb|CDO97427.1| unnamed protein product [Coffea canephora]
Length=361

 Score =   210 bits (535),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 110/172 (64%), Positives = 134/172 (78%), Gaps = 2/172 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEFAWGLANS K FLWI+RPD+V G+ A+LPPEF EETK+RGM++ WC QEQVL H + G
Sbjct  186  VEFAWGLANSNKSFLWILRPDLVVGDSAILPPEFAEETKERGMITGWCAQEQVLKHSSTG  245

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNS LES+C GVP++CWPFFA+Q  NC YSC +WGIGMEID NV R+EVEK+V
Sbjct  246  GFLTHSGWNSILESLCCGVPVICWPFFADQLINCRYSCQEWGIGMEIDTNVKRNEVEKIV  305

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  261
            REL+E +KGREMKRKA + K  A EA  T    SS++N  + +  ++LS  K
Sbjct  306  RELIEGDKGREMKRKATDWKLKAEEA--TGLDSSSYLNFNRLVKEVILSKAK  355



>ref|XP_009377942.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Pyrus x 
bretschneideri]
Length=473

 Score =   213 bits (543),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 108/168 (64%), Positives = 135/168 (80%), Gaps = 2/168 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VE+ WGLAN++  F W++RPD++ GE A+LPP+F++ETK R +++ WCPQEQVL H +VG
Sbjct  305  VEYGWGLANTKLTFFWVIRPDLIIGESAILPPKFVDETKGRSLIAGWCPQEQVLNHPSVG  364

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWN T+ES+  GVPMLCWPFFA+QQTNC YSC +WGIGMEIDN V RDE+EK+V
Sbjct  365  GFLTHSGWNLTIESVSAGVPMLCWPFFADQQTNCHYSCKEWGIGMEIDNKVKRDELEKLV  424

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  273
            RELME EKG++MK KA+E K LA EA  T P GSS  N+EK +N + L
Sbjct  425  RELMEGEKGKKMKNKAIEWKTLAEEA--TGPHGSSSTNLEKLVNQMQL  470



>ref|XP_004136284.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Cucumis sativus]
 ref|XP_004167272.1| PREDICTED: UDP-glycosyltransferase 85A2-like [Cucumis sativus]
 gb|KGN60220.1| hypothetical protein Csa_3G889760 [Cucumis sativus]
Length=486

 Score =   213 bits (543),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 136/167 (81%), Gaps = 1/167 (1%)
 Frame = -3

Query  773  EFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVGG  594
            EFAWGLANS + FLWI+RPD+V G+ A+LPPEF++ TK+RGML++WCPQE+VL H A+GG
Sbjct  318  EFAWGLANSGQTFLWIIRPDLVAGDTAVLPPEFIDVTKERGMLTNWCPQEEVLQHPAIGG  377

Query  593  FLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvvR  414
            FLTH GWNST ESI  GVPM+CWPFFAEQQTNC Y CT+WGIGME+D++V R+E+EK V+
Sbjct  378  FLTHNGWNSTFESIVAGVPMICWPFFAEQQTNCRYCCTEWGIGMEVDSDVKREEIEKQVK  437

Query  413  ELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  273
            ELME EKG+EM+ +A E KKL  +AA T   GSS  N+   ++ +LL
Sbjct  438  ELMEGEKGKEMRNRAEEWKKLVGDAA-TPHSGSSSRNLNDLVHKVLL  483



>ref|XP_011014887.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like isoform 
X2 [Populus euphratica]
Length=488

 Score =   213 bits (543),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 110/172 (64%), Positives = 135/172 (78%), Gaps = 2/172 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEF  GL+ S   FLWI+RPDM+ G+ A+LPPEF EETK+RG + SWCPQE VL H ++G
Sbjct  315  VEFGMGLSKSGHLFLWIIRPDMIAGDSAILPPEFTEETKERGFICSWCPQEVVLNHPSIG  374

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTHCGW ST+ESI +GVPMLC PF  +QQTNC Y+CTKWGIGMEID+NV  D VEK+V
Sbjct  375  GFLTHCGWGSTIESISSGVPMLCLPFAGDQQTNCRYTCTKWGIGMEIDSNVKSDNVEKLV  434

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  261
            RELME ++G++MK KA E KKLA EA+   P GSS +N++K +  +LLS RK
Sbjct  435  RELMEGDRGKKMKDKATEWKKLAEEASG--PTGSSTMNLDKLVKEVLLSRRK  484



>ref|XP_011045674.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Populus 
euphratica]
Length=503

 Score =   214 bits (544),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 136/166 (82%), Gaps = 2/166 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +EFAWGLANS  PFLWI+RPD+V GE +MLP EF+ ETK RGML++WCPQE VL H ++G
Sbjct  334  MEFAWGLANSNTPFLWIIRPDLVEGESSMLPSEFVSETKKRGMLANWCPQELVLKHPSIG  393

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFL+H GWNST++SIC GVP++CWPFFA+QQTNC ++CTKWGIGM+IDNNV RDEVEK+V
Sbjct  394  GFLSHTGWNSTMDSICAGVPLICWPFFADQQTNCMFACTKWGIGMQIDNNVKRDEVEKLV  453

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHL  279
            RELM+ EKG++MKRKAME K  A E   T P GSS  N+E  +  L
Sbjct  454  RELMKGEKGKDMKRKAMEWKTKAEEV--TRPGGSSFENLEALVKVL  497



>ref|XP_006307366.1| hypothetical protein CARUB_v10008992mg [Capsella rubella]
 gb|EOA40264.1| hypothetical protein CARUB_v10008992mg [Capsella rubella]
Length=484

 Score =   213 bits (543),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 134/167 (80%), Gaps = 1/167 (1%)
 Frame = -3

Query  773  EFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVGG  594
            EFAWGLA + K FLW++RPD+V G+ AM+P EF+ ET+DR ML+SWCPQEQVL H A+GG
Sbjct  317  EFAWGLAATGKEFLWVIRPDLVAGDDAMVPQEFLTETEDRRMLASWCPQEQVLSHPAIGG  376

Query  593  FLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvvR  414
            FLTHCGWNSTLES+C GVPM+CWPFFAEQQTNC +SC +W +G+E   +V R+EVE VVR
Sbjct  377  FLTHCGWNSTLESLCGGVPMVCWPFFAEQQTNCKFSCDEWEVGIETGGDVNREEVEAVVR  436

Query  413  ELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  273
            ELM+ EKG++M+ KA E ++LA EA D   +GSS VN+E  +  +LL
Sbjct  437  ELMDGEKGKKMREKAEEWRRLAKEATDH-KLGSSIVNLETVVRKILL  482



>ref|XP_002454243.1| hypothetical protein SORBIDRAFT_04g027420 [Sorghum bicolor]
 gb|EES07219.1| hypothetical protein SORBIDRAFT_04g027420 [Sorghum bicolor]
Length=487

 Score =   213 bits (543),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 99/168 (59%), Positives = 132/168 (79%), Gaps = 2/168 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEFAWGLANS +PFLWI+R D+V G+ A+LPPEF+  T DRG+++SWCPQ+ VL H AV 
Sbjct  319  VEFAWGLANSGRPFLWIIRRDLVKGDTAVLPPEFLAATADRGLMASWCPQQAVLDHPAVA  378

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
             FLTH GWNSTLE++C GVP++ WPFFA+QQTNC Y C +WG+GMEID+NV RD V  ++
Sbjct  379  AFLTHSGWNSTLEAMCGGVPVISWPFFADQQTNCRYQCNEWGVGMEIDSNVRRDAVASLI  438

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  273
             ELM+ E+G+EM+RKA+E + +A+E A   P G+SH N +  + ++LL
Sbjct  439  TELMDGERGKEMRRKALEWRDIAVEVAK--PGGTSHRNFDDLVRNVLL  484



>ref|XP_002525850.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
 gb|EEF36544.1| UDP-glucuronosyltransferase, putative [Ricinus communis]
Length=480

 Score =   213 bits (543),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 106/172 (62%), Positives = 139/172 (81%), Gaps = 2/172 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VE AWGL NS++ FLWI+R D+V GE  +LP EF++ETK+RG+ +SWCPQE+VL H ++G
Sbjct  311  VELAWGLGNSKQTFLWIIRTDIVKGESTILPEEFVDETKERGLRTSWCPQERVLKHPSIG  370

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFL+H GWNST+ES+ NGVP++CWPF  EQQ NCW++C KWGIGMEI+N V RDEVEK+V
Sbjct  371  GFLSHMGWNSTIESLSNGVPVICWPFGGEQQINCWFACNKWGIGMEIENEVKRDEVEKLV  430

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLLSHRK  261
            REL+E EKG+EM++KAME K+ A EA D  P G S +N+++ +N +LLS  K
Sbjct  431  RELIEGEKGKEMRKKAMEWKRKAEEATD--PNGKSSMNLDRLVNEVLLSQHK  480



>ref|XP_002308828.2| hypothetical protein POPTR_0006s02330g [Populus trichocarpa]
 gb|EEE92351.2| hypothetical protein POPTR_0006s02330g [Populus trichocarpa]
Length=482

 Score =   213 bits (543),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 107/168 (64%), Positives = 135/168 (80%), Gaps = 2/168 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            +E   GLA S  PFLWI+RPDMVTG+ A+LPPEF +ETKDRG +S+WCPQE+VL H ++G
Sbjct  314  IELGMGLAKSGHPFLWIIRPDMVTGDSAILPPEFTDETKDRGFISNWCPQEEVLNHPSIG  373

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNST ESI +GVPMLC PFF +QQTNC Y+C +WG+GMEID++  RD+VEK+V
Sbjct  374  GFLTHSGWNSTAESISSGVPMLCLPFFGDQQTNCRYTCNEWGVGMEIDSSAERDKVEKLV  433

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  273
            RELME EKGRE+K+K M+ K LA EAA   P GSS +N+++ +  +LL
Sbjct  434  RELMEGEKGREVKKKVMQWKILAEEAAG--PSGSSSMNLDELVKGVLL  479



>ref|XP_009341609.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Pyrus x 
bretschneideri]
Length=484

 Score =   213 bits (543),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 108/168 (64%), Positives = 133/168 (79%), Gaps = 2/168 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEF WGLANS+ PF W++RPD+V  E A+  PEF+ ETK+RG+++SWCPQEQVL H +VG
Sbjct  316  VEFGWGLANSKVPFFWVIRPDLVVRESAIFQPEFVAETKERGLIASWCPQEQVLEHSSVG  375

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNST+ES+C GVPMLC P F++QQTNC+  C KWGIGMEI  +V RDEVEK+V
Sbjct  376  GFLTHSGWNSTIESLCAGVPMLCLPCFSDQQTNCYCVCKKWGIGMEISYDVKRDEVEKLV  435

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  273
             ELME EKG++MK K ME K+LA EA  T P GSS  N++ F+N +LL
Sbjct  436  IELMEGEKGKQMKSKVMEWKQLAEEA--TAPHGSSSTNLDNFVNQVLL  481



>ref|XP_009350108.1| PREDICTED: 7-deoxyloganetin glucosyltransferase-like [Pyrus x 
bretschneideri]
Length=484

 Score =   213 bits (543),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 109/168 (65%), Positives = 134/168 (80%), Gaps = 2/168 (1%)
 Frame = -3

Query  776  VEFAWGLANSQKPFLWIVRPDMVTGEGAMLPPEFMEETKDRGMLSSWCPQEQVLGHQAVG  597
            VEF WGLANS+ PF W++RPD+V  E A+  PEF+ ETK+RG+++SWCPQEQVL H +VG
Sbjct  316  VEFGWGLANSKVPFFWVIRPDLVVRESAIFQPEFVAETKERGLIASWCPQEQVLEHSSVG  375

Query  596  GFLTHCGWNSTLESICNGVPMLCWPFFAEQQTNCWYSCTKWGIGMEIdnnvvrdevekvv  417
            GFLTH GWNST+ES+C GVPMLC P F++QQTNC+  C KWGIGMEI N+V RDEVEK+V
Sbjct  376  GFLTHSGWNSTIESLCAGVPMLCLPCFSDQQTNCYCVCKKWGIGMEISNDVKRDEVEKLV  435

Query  416  RELMESEKGREMKRKAMELKKLAMEAADTIPIGSSHVNIEKFINHLLL  273
             ELME EKG++MK K ME K+LA EA  T P GSS  N++ F+N +LL
Sbjct  436  IELMEGEKGKQMKNKVMEWKQLAEEA--TAPHGSSSTNLDNFVNQVLL  481



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1507754616730