BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF007J14

Length=699
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|NP_001183608.1|  uncharacterized protein LOC100502202               283   3e-93   
gb|AAM91528.1|  putative casein kinase                                  288   3e-93   Arabidopsis thaliana [mouse-ear cress]
gb|EPS68531.1|  hypothetical protein M569_06230                         298   1e-92   Genlisea aurea
ref|XP_011075041.1|  PREDICTED: uncharacterized protein LOC105159627    298   1e-92   Sesamum indicum [beniseed]
emb|CDP14324.1|  unnamed protein product                                298   1e-92   Coffea canephora [robusta coffee]
gb|KDO55049.1|  hypothetical protein CISIN_1g005214mg                   293   2e-92   Citrus sinensis [apfelsine]
ref|XP_009788026.1|  PREDICTED: uncharacterized protein LOC104235895    296   6e-92   Nicotiana sylvestris
ref|XP_009771625.1|  PREDICTED: uncharacterized protein LOC104222130    296   7e-92   Nicotiana sylvestris
ref|XP_009615719.1|  PREDICTED: uncharacterized protein LOC104108400    296   8e-92   Nicotiana tomentosiformis
ref|XP_009621585.1|  PREDICTED: uncharacterized protein LOC104113184    296   8e-92   Nicotiana tomentosiformis
ref|XP_002525432.1|  casein kinase, putative                            295   1e-91   Ricinus communis
gb|AAO41895.1|  putative casein kinase                                  283   3e-91   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008441978.1|  PREDICTED: uncharacterized protein LOC103485979    295   3e-91   Cucumis melo [Oriental melon]
ref|XP_004147533.1|  PREDICTED: uncharacterized protein LOC101221479    295   3e-91   Cucumis sativus [cucumbers]
ref|XP_006443418.1|  hypothetical protein CICLE_v10019090mg             295   3e-91   Citrus clementina [clementine]
ref|XP_006479104.1|  PREDICTED: uncharacterized protein LOC102619...    294   4e-91   Citrus sinensis [apfelsine]
ref|XP_004249304.1|  PREDICTED: uncharacterized protein LOC101268442    294   5e-91   Solanum lycopersicum
ref|XP_011078778.1|  PREDICTED: uncharacterized protein LOC105162459    294   5e-91   Sesamum indicum [beniseed]
ref|XP_011021493.1|  PREDICTED: uncharacterized protein LOC105123555    294   6e-91   Populus euphratica
gb|EYU20664.1|  hypothetical protein MIMGU_mgv1a002165mg                293   7e-91   Erythranthe guttata [common monkey flower]
ref|XP_004157014.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    295   7e-91   
ref|XP_002325416.1|  kinase family protein                              294   8e-91   
ref|XP_010088042.1|  Casein kinase I isoform delta                      293   1e-90   
ref|XP_006351365.1|  PREDICTED: uncharacterized protein LOC102603072    293   1e-90   Solanum tuberosum [potatoes]
gb|KDP39706.1|  hypothetical protein JCGZ_02726                         292   2e-90   Jatropha curcas
ref|XP_007204249.1|  hypothetical protein PRUPE_ppa002161mg             292   3e-90   Prunus persica
ref|XP_009366444.1|  PREDICTED: uncharacterized protein LOC103956210    291   4e-90   Pyrus x bretschneideri [bai li]
ref|XP_007030718.1|  Kinase family protein                              291   5e-90   Theobroma cacao [chocolate]
emb|CBI29940.3|  unnamed protein product                                288   5e-90   Vitis vinifera
gb|AAF00624.1|AC009540_1  unknown protein, 5' partial                   285   6e-90   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010036218.1|  PREDICTED: uncharacterized protein LOC104425268    291   7e-90   Eucalyptus grandis [rose gum]
ref|XP_004288418.1|  PREDICTED: uncharacterized protein LOC101290807    290   7e-90   Fragaria vesca subsp. vesca
ref|XP_003548750.1|  PREDICTED: uncharacterized protein LOC100801...    291   9e-90   Glycine max [soybeans]
ref|XP_008240478.1|  PREDICTED: uncharacterized protein LOC103338977    290   1e-89   Prunus mume [ume]
gb|KJB45108.1|  hypothetical protein B456_007G289500                    290   2e-89   Gossypium raimondii
ref|XP_002281952.1|  PREDICTED: uncharacterized protein LOC100267624    289   3e-89   Vitis vinifera
ref|XP_004493152.1|  PREDICTED: uncharacterized protein LOC101504...    289   3e-89   Cicer arietinum [garbanzo]
ref|XP_003624626.1|  Casein kinase I isoform alpha                      288   6e-89   Medicago truncatula
ref|XP_010558719.1|  PREDICTED: uncharacterized protein LOC104827...    288   6e-89   Tarenaya hassleriana [spider flower]
emb|CDY29971.1|  BnaC01g40370D                                          288   6e-89   Brassica napus [oilseed rape]
gb|ADE75678.1|  unknown                                                 275   6e-89   Picea sitchensis
ref|XP_010558720.1|  PREDICTED: uncharacterized protein LOC104827...    288   6e-89   
ref|XP_007161937.1|  hypothetical protein PHAVU_001G110300g             288   7e-89   Phaseolus vulgaris [French bean]
ref|NP_187044.1|  protein kinase family protein                         288   9e-89   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006408240.1|  hypothetical protein EUTSA_v10020173mg             288   1e-88   Eutrema salsugineum [saltwater cress]
ref|XP_006297091.1|  hypothetical protein CARUB_v10013094mg             288   1e-88   Capsella rubella
gb|KHG27523.1|  hypothetical protein F383_15264                         288   1e-88   Gossypium arboreum [tree cotton]
ref|XP_002884421.1|  kinase family protein                              288   1e-88   Arabidopsis lyrata subsp. lyrata
gb|KHG17118.1|  Casein kinase I isoform delta                           287   1e-88   Gossypium arboreum [tree cotton]
emb|CDY21155.1|  BnaA01g33860D                                          287   2e-88   Brassica napus [oilseed rape]
ref|XP_010276388.1|  PREDICTED: uncharacterized protein LOC104611151    288   2e-88   
gb|KJB82583.1|  hypothetical protein B456_013G203000                    287   2e-88   Gossypium raimondii
gb|KJB82579.1|  hypothetical protein B456_013G203000                    287   2e-88   Gossypium raimondii
ref|XP_010485760.1|  PREDICTED: uncharacterized protein LOC104764...    287   2e-88   Camelina sativa [gold-of-pleasure]
ref|XP_010463863.1|  PREDICTED: uncharacterized protein LOC104744499    286   3e-88   Camelina sativa [gold-of-pleasure]
gb|KHG04306.1|  Casein kinase I-like protein                            287   3e-88   Gossypium arboreum [tree cotton]
ref|XP_010516062.1|  PREDICTED: uncharacterized protein LOC104791...    286   3e-88   Camelina sativa [gold-of-pleasure]
emb|CDY42890.1|  BnaC05g47610D                                          286   3e-88   Brassica napus [oilseed rape]
gb|ABR25333.1|  protein kinase family protein                           269   4e-88   Oryza sativa Indica Group [Indian rice]
gb|KJB80963.1|  hypothetical protein B456_013G123300                    286   4e-88   Gossypium raimondii
gb|KJB80965.1|  hypothetical protein B456_013G123300                    286   4e-88   Gossypium raimondii
ref|XP_009102089.1|  PREDICTED: uncharacterized protein LOC103828226    286   6e-88   Brassica rapa
ref|XP_010672054.1|  PREDICTED: uncharacterized protein LOC104888...    286   6e-88   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009413883.1|  PREDICTED: uncharacterized protein LOC103995100    286   7e-88   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009130401.1|  PREDICTED: uncharacterized protein LOC103855200    285   8e-88   Brassica rapa
ref|XP_010908708.1|  PREDICTED: uncharacterized protein LOC105035016    285   2e-87   Elaeis guineensis
gb|EEC71557.1|  hypothetical protein OsI_03913                          282   3e-87   Oryza sativa Indica Group [Indian rice]
ref|XP_008805378.1|  PREDICTED: uncharacterized protein LOC103718369    284   4e-87   Phoenix dactylifera
ref|XP_010257690.1|  PREDICTED: uncharacterized protein LOC104597684    283   6e-87   Nelumbo nucifera [Indian lotus]
gb|ABF99312.1|  protein kinase family protein, putative, expressed      278   6e-87   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001044393.1|  Os01g0772600                                       283   7e-87   
ref|XP_009418951.1|  PREDICTED: uncharacterized protein LOC103999...    283   7e-87   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006400366.1|  hypothetical protein EUTSA_v10012841mg             283   8e-87   Eutrema salsugineum [saltwater cress]
dbj|BAJ90552.1|  predicted protein                                      283   8e-87   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003569928.1|  PREDICTED: uncharacterized protein LOC100845295    282   1e-86   Brachypodium distachyon [annual false brome]
ref|NP_197320.1|  protein kinase                                        282   1e-86   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009418950.1|  PREDICTED: uncharacterized protein LOC103999...    283   1e-86   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006644782.1|  PREDICTED: uncharacterized protein LOC102714869    282   2e-86   Oryza brachyantha
ref|XP_010492820.1|  PREDICTED: uncharacterized protein LOC104770147    281   2e-86   Camelina sativa [gold-of-pleasure]
emb|CDY38493.1|  BnaA10g16650D                                          281   2e-86   Brassica napus [oilseed rape]
emb|CDY25451.1|  BnaC09g39660D                                          281   2e-86   Brassica napus [oilseed rape]
ref|XP_010424160.1|  PREDICTED: uncharacterized protein LOC104709208    280   2e-86   Camelina sativa [gold-of-pleasure]
ref|XP_004970128.1|  PREDICTED: uncharacterized protein LOC101772174    281   3e-86   Setaria italica
ref|XP_009121003.1|  PREDICTED: uncharacterized protein LOC103845859    281   5e-86   Brassica rapa
ref|XP_006287189.1|  hypothetical protein CARUB_v10000361mg             280   5e-86   Capsella rubella
ref|XP_010454044.1|  PREDICTED: uncharacterized protein LOC104735873    280   5e-86   Camelina sativa [gold-of-pleasure]
ref|NP_001058996.1|  Os07g0171300                                       280   7e-86   
ref|XP_010485763.1|  PREDICTED: uncharacterized protein LOC104764...    280   7e-86   Camelina sativa [gold-of-pleasure]
ref|XP_008655390.1|  PREDICTED: uncharacterized protein LOC100502...    283   7e-86   
ref|XP_010516137.1|  PREDICTED: uncharacterized protein LOC104791...    280   8e-86   Camelina sativa [gold-of-pleasure]
dbj|BAN15568.1|  heading date 16                                        280   9e-86   Oryza sativa Japonica Group [Japonica rice]
gb|KHF98002.1|  hypothetical protein F383_12939                         279   9e-86   Gossypium arboreum [tree cotton]
ref|NP_001051531.1|  Os03g0793500                                       280   9e-86   
gb|EAY92152.1|  hypothetical protein OsI_13865                          280   1e-85   Oryza sativa Indica Group [Indian rice]
ref|XP_006657490.1|  PREDICTED: uncharacterized protein LOC102719500    280   1e-85   Oryza brachyantha
emb|CDY50866.1|  BnaA05g37270D                                          281   1e-85   Brassica napus [oilseed rape]
ref|XP_002873876.1|  kinase family protein                              279   2e-85   
ref|XP_010228600.1|  PREDICTED: uncharacterized protein LOC100829940    279   2e-85   
dbj|BAJ93086.1|  predicted protein                                      279   3e-85   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB46016.1|  hypothetical protein B456_007G343500                    278   4e-85   Gossypium raimondii
ref|XP_009132256.1|  PREDICTED: uncharacterized protein LOC103856881    278   5e-85   Brassica rapa
emb|CDY51243.1|  BnaA03g06950D                                          278   5e-85   Brassica napus [oilseed rape]
emb|CDX70801.1|  BnaC03g08850D                                          278   5e-85   
gb|ADE77861.1|  unknown                                                 262   1e-84   Picea sitchensis
ref|XP_010672056.1|  PREDICTED: uncharacterized protein LOC104888...    277   1e-84   
ref|XP_003557523.1|  PREDICTED: uncharacterized protein LOC100821235    276   2e-84   Brachypodium distachyon [annual false brome]
ref|XP_004955583.1|  PREDICTED: uncharacterized protein LOC101773...    276   4e-84   Setaria italica
ref|NP_001152463.1|  ATP binding protein                                275   5e-84   Zea mays [maize]
ref|XP_008651588.1|  PREDICTED: ATP binding protein isoform X1          275   5e-84   Zea mays [maize]
ref|XP_004955580.1|  PREDICTED: uncharacterized protein LOC101773...    276   6e-84   Setaria italica
emb|CDY02641.1|  BnaC02g07940D                                          274   1e-83   
gb|ACN36158.1|  unknown                                                 275   1e-83   Zea mays [maize]
ref|NP_001152101.1|  LOC100285738                                       275   1e-83   Zea mays [maize]
ref|XP_002466312.1|  hypothetical protein SORBIDRAFT_01g005460          274   2e-83   Sorghum bicolor [broomcorn]
ref|XP_004981469.1|  PREDICTED: uncharacterized protein LOC101783...    274   2e-83   
ref|XP_009126244.1|  PREDICTED: uncharacterized protein LOC103851164    273   2e-83   Brassica rapa
emb|CDY53253.1|  BnaA02g04010D                                          275   4e-83   Brassica napus [oilseed rape]
ref|XP_006842223.1|  hypothetical protein AMTR_s00078p00181940          273   7e-83   
gb|EMS51431.1|  Casein kinase I isoform beta                            272   1e-82   Triticum urartu
ref|XP_010552201.1|  PREDICTED: serine/threonine-protein kinase s...    271   2e-82   Tarenaya hassleriana [spider flower]
ref|XP_010936996.1|  PREDICTED: casein kinase I isoform gamma-1-l...    268   3e-82   
ref|XP_010936995.1|  PREDICTED: casein kinase I isoform gamma-1-l...    268   3e-82   
ref|XP_010500967.1|  PREDICTED: uncharacterized protein LOC104778...    263   3e-82   Camelina sativa [gold-of-pleasure]
gb|EYU39997.1|  hypothetical protein MIMGU_mgv1a002328mg                270   4e-82   Erythranthe guttata [common monkey flower]
ref|XP_010472589.1|  PREDICTED: uncharacterized protein LOC104752210    257   6e-82   Camelina sativa [gold-of-pleasure]
gb|AAC42254.1|  unknown protein                                         257   1e-81   Arabidopsis thaliana [mouse-ear cress]
gb|KHN37292.1|  Casein kinase I                                         266   1e-81   Glycine soja [wild soybean]
ref|XP_006651899.1|  PREDICTED: uncharacterized protein LOC102717146    269   2e-81   Oryza brachyantha
ref|XP_010534909.1|  PREDICTED: serine/threonine-protein kinase S...    268   3e-81   Tarenaya hassleriana [spider flower]
ref|XP_010542444.1|  PREDICTED: serine/threonine-protein kinase S...    268   3e-81   Tarenaya hassleriana [spider flower]
gb|KHN27094.1|  Casein kinase I                                         267   4e-81   Glycine soja [wild soybean]
ref|XP_003536792.1|  PREDICTED: uncharacterized protein LOC100783819    267   4e-81   Glycine max [soybeans]
ref|XP_003556554.1|  PREDICTED: uncharacterized protein LOC100807373    266   6e-81   Glycine max [soybeans]
ref|XP_008797915.1|  PREDICTED: uncharacterized protein LOC103712...    268   7e-81   Phoenix dactylifera
gb|KDP33655.1|  hypothetical protein JCGZ_07226                         266   7e-81   Jatropha curcas
ref|XP_008797930.1|  PREDICTED: uncharacterized protein LOC103712...    268   7e-81   Phoenix dactylifera
ref|XP_008797922.1|  PREDICTED: uncharacterized protein LOC103712...    268   8e-81   Phoenix dactylifera
ref|XP_008797939.1|  PREDICTED: uncharacterized protein LOC103712...    268   8e-81   Phoenix dactylifera
ref|XP_009382978.1|  PREDICTED: uncharacterized protein LOC103970784    267   1e-80   Musa acuminata subsp. malaccensis [pisang utan]
tpg|DAA54811.1|  TPA: hypothetical protein ZEAMMB73_098757              251   1e-80   
gb|EMT21659.1|  Casein kinase I-RAG8-like protein                       265   1e-80   
ref|XP_001770883.1|  predicted protein                                  264   2e-80   
ref|XP_001764211.1|  predicted protein                                  264   2e-80   
emb|CDP13154.1|  unnamed protein product                                264   2e-80   Coffea canephora [robusta coffee]
emb|CDY23629.1|  BnaC05g39650D                                          261   2e-80   Brassica napus [oilseed rape]
ref|XP_006445886.1|  hypothetical protein CICLE_v10014444mg             266   3e-80   Citrus clementina [clementine]
ref|XP_008367866.1|  PREDICTED: casein kinase I                         261   3e-80   
ref|XP_002960894.1|  hypothetical protein SELMODRAFT_139482             263   3e-80   
ref|XP_002967119.1|  hypothetical protein SELMODRAFT_144765             263   3e-80   
emb|CBI28086.3|  unnamed protein product                                264   4e-80   Vitis vinifera
ref|XP_006407187.1|  hypothetical protein EUTSA_v10020172mg             265   4e-80   Eutrema salsugineum [saltwater cress]
ref|XP_006849555.1|  hypothetical protein AMTR_s00024p00176520          265   5e-80   Amborella trichopoda
ref|XP_007024284.1|  Casein kinase I protein isoform 1                  265   6e-80   
ref|XP_009413490.1|  PREDICTED: uncharacterized protein LOC103994778    265   6e-80   
ref|XP_008351086.1|  PREDICTED: uncharacterized protein LOC103414488    259   6e-80   
ref|XP_003552750.1|  PREDICTED: serine/threonine-protein kinase V...    264   6e-80   Glycine max [soybeans]
ref|XP_003532324.1|  PREDICTED: serine/threonine-protein kinase V...    264   6e-80   Glycine max [soybeans]
gb|KHN24964.1|  Casein kinase I isoform alpha                           265   6e-80   Glycine soja [wild soybean]
ref|XP_008787870.1|  PREDICTED: uncharacterized protein LOC103705792    265   7e-80   Phoenix dactylifera
ref|XP_009404157.1|  PREDICTED: uncharacterized protein LOC103987553    265   7e-80   Musa acuminata subsp. malaccensis [pisang utan]
emb|CBI16476.3|  unnamed protein product                                262   8e-80   Vitis vinifera
gb|ADE76410.1|  unknown                                                 258   8e-80   Picea sitchensis
ref|XP_010939945.1|  PREDICTED: uncharacterized protein LOC105058...    265   9e-80   
emb|CDY55141.1|  BnaC01g44810D                                          263   9e-80   Brassica napus [oilseed rape]
ref|XP_010939947.1|  PREDICTED: uncharacterized protein LOC105058...    265   1e-79   Elaeis guineensis
ref|XP_002882838.1|  kinase family protein                              264   1e-79   Arabidopsis lyrata subsp. lyrata
ref|XP_010656334.1|  PREDICTED: uncharacterized protein LOC100254414    264   1e-79   Vitis vinifera
ref|XP_003621013.1|  Casein kinase I isoform alpha                      262   1e-79   Medicago truncatula
gb|KFK38714.1|  hypothetical protein AALP_AA3G150500                    264   1e-79   Arabis alpina [alpine rockcress]
ref|XP_007139114.1|  hypothetical protein PHAVU_008G002500g             263   1e-79   Phaseolus vulgaris [French bean]
ref|XP_006297084.1|  hypothetical protein CARUB_v10013087mg             264   1e-79   Capsella rubella
emb|CDY51730.1|  BnaA01g37130D                                          263   1e-79   Brassica napus [oilseed rape]
ref|XP_010500960.1|  PREDICTED: uncharacterized protein LOC104778...    264   2e-79   Camelina sativa [gold-of-pleasure]
ref|XP_010465212.1|  PREDICTED: uncharacterized protein LOC104745616    264   2e-79   Camelina sativa [gold-of-pleasure]
emb|CDX75726.1|  BnaC03g38090D                                          262   2e-79   
ref|XP_010487127.1|  PREDICTED: serine/threonine-protein kinase S...    264   2e-79   
emb|CDX97505.1|  BnaA05g25740D                                          262   2e-79   
gb|KDP44321.1|  hypothetical protein JCGZ_19188                         263   3e-79   Jatropha curcas
emb|CAN69523.1|  hypothetical protein VITISV_040873                     262   3e-79   Vitis vinifera
gb|KHN18151.1|  Casein kinase I like 2                                  258   3e-79   Glycine soja [wild soybean]
ref|XP_008352012.1|  PREDICTED: uncharacterized protein LOC103415457    262   3e-79   
ref|XP_009146466.1|  PREDICTED: uncharacterized protein LOC103870106    263   3e-79   Brassica rapa
ref|XP_010257513.1|  PREDICTED: uncharacterized protein LOC104597586    263   3e-79   Nelumbo nucifera [Indian lotus]
ref|XP_004142151.1|  PREDICTED: uncharacterized protein LOC101213194    263   3e-79   Cucumis sativus [cucumbers]
ref|XP_007013209.1|  Kinase family protein isoform 5                    257   3e-79   
gb|KDO79864.1|  hypothetical protein CISIN_1g005420mg                   258   3e-79   Citrus sinensis [apfelsine]
ref|XP_004162011.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    263   3e-79   
ref|XP_008338530.1|  PREDICTED: casein kinase I homolog 2-like          259   4e-79   
dbj|BAJ99119.1|  predicted protein                                      257   4e-79   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS55588.1|  Casein kinase I-like protein 2                          260   4e-79   Triticum urartu
ref|NP_187977.1|  protein kinase family protein                         263   4e-79   Arabidopsis thaliana [mouse-ear cress]
gb|KJB56821.1|  hypothetical protein B456_009G137100                    263   4e-79   Gossypium raimondii
ref|XP_002283346.1|  PREDICTED: uncharacterized protein LOC100263956    263   4e-79   Vitis vinifera
emb|CBI36074.3|  unnamed protein product                                260   4e-79   Vitis vinifera
tpg|DAA54810.1|  TPA: hypothetical protein ZEAMMB73_098757              252   4e-79   
ref|XP_010915404.1|  PREDICTED: uncharacterized protein LOC105040538    262   4e-79   Elaeis guineensis
ref|XP_008228435.1|  PREDICTED: uncharacterized protein LOC103327845    262   5e-79   Prunus mume [ume]
ref|XP_009406168.1|  PREDICTED: uncharacterized protein LOC103989128    262   6e-79   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB21848.1|  hypothetical protein B456_004G018000                    262   6e-79   Gossypium raimondii
ref|XP_004491691.1|  PREDICTED: serine/threonine-protein kinase V...    261   6e-79   Cicer arietinum [garbanzo]
ref|XP_008655737.1|  PREDICTED: uncharacterized protein LOC103634938    252   6e-79   
ref|XP_009117581.1|  PREDICTED: uncharacterized protein LOC103842673    261   6e-79   Brassica rapa
emb|CDX82524.1|  BnaA03g32970D                                          261   7e-79   
ref|XP_009395056.1|  PREDICTED: uncharacterized protein LOC103980...    261   7e-79   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK32550.1|  hypothetical protein AALP_AA6G257400                    261   8e-79   Arabis alpina [alpine rockcress]
ref|XP_009135319.1|  PREDICTED: uncharacterized protein LOC103859531    261   8e-79   Brassica rapa
ref|XP_009395055.1|  PREDICTED: uncharacterized protein LOC103980...    261   9e-79   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG14825.1|  hypothetical protein F383_08945                         262   9e-79   Gossypium arboreum [tree cotton]
ref|XP_002531638.1|  casein kinase, putative                            261   9e-79   Ricinus communis
tpg|DAA54809.1|  TPA: hypothetical protein ZEAMMB73_098757              252   9e-79   
ref|XP_010249522.1|  PREDICTED: uncharacterized protein LOC104592...    261   1e-78   Nelumbo nucifera [Indian lotus]
ref|XP_010249521.1|  PREDICTED: uncharacterized protein LOC104592...    261   1e-78   Nelumbo nucifera [Indian lotus]
ref|XP_002283957.2|  PREDICTED: uncharacterized protein LOC100253221    261   1e-78   Vitis vinifera
emb|CAN77676.1|  hypothetical protein VITISV_013722                     261   1e-78   Vitis vinifera
ref|XP_007014775.1|  Kinase family protein isoform 2                    261   1e-78   
ref|XP_007024285.1|  Kinase family protein isoform 2                    256   1e-78   
ref|XP_010267169.1|  PREDICTED: uncharacterized protein LOC104604...    261   2e-78   Nelumbo nucifera [Indian lotus]
ref|XP_010267167.1|  PREDICTED: uncharacterized protein LOC104604...    261   2e-78   
gb|AAT44311.1|  putative casein kinase                                  259   2e-78   Oryza sativa Japonica Group [Japonica rice]
gb|ACO87665.1|  protein kinase                                          259   2e-78   Brachypodium sylvaticum
ref|XP_010526089.1|  PREDICTED: casein kinase I-like                    258   2e-78   Tarenaya hassleriana [spider flower]
gb|EEC78673.1|  hypothetical protein OsI_18806                          259   2e-78   Oryza sativa Indica Group [Indian rice]
dbj|BAG92829.1|  unnamed protein product                                259   2e-78   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002516524.1|  casein kinase, putative                            260   2e-78   
ref|XP_008378069.1|  PREDICTED: uncharacterized protein LOC103441148    260   2e-78   
emb|CDY21505.1|  BnaC03g26920D                                          258   2e-78   Brassica napus [oilseed rape]
ref|XP_010047289.1|  PREDICTED: uncharacterized protein LOC104436263    258   3e-78   Eucalyptus grandis [rose gum]
ref|XP_010033842.1|  PREDICTED: uncharacterized protein LOC104423081    261   3e-78   
gb|EMT06030.1|  Casein kinase I-2-like protein                          258   3e-78   
ref|XP_008791563.1|  PREDICTED: uncharacterized protein LOC103708420    260   3e-78   Phoenix dactylifera
ref|XP_010546534.1|  PREDICTED: uncharacterized protein LOC104818596    260   3e-78   Tarenaya hassleriana [spider flower]
ref|XP_006853659.1|  hypothetical protein AMTR_s00056p00104010          260   3e-78   Amborella trichopoda
ref|XP_007217013.1|  hypothetical protein PRUPE_ppa002136mg             260   3e-78   Prunus persica
gb|KJB07481.1|  hypothetical protein B456_001G026300                    255   3e-78   Gossypium raimondii
ref|XP_007208054.1|  hypothetical protein PRUPE_ppa002206mg             260   3e-78   Prunus persica
ref|XP_009375296.1|  PREDICTED: uncharacterized protein LOC103964127    260   3e-78   
ref|XP_008338507.1|  PREDICTED: uncharacterized protein LOC103401...    260   4e-78   
ref|XP_008390151.1|  PREDICTED: uncharacterized protein LOC103452441    260   4e-78   
ref|XP_008338505.1|  PREDICTED: uncharacterized protein LOC103401...    260   4e-78   
gb|KHN39248.1|  Casein kinase I isoform delta-like                      259   4e-78   Glycine soja [wild soybean]
ref|XP_009364099.1|  PREDICTED: uncharacterized protein LOC103954016    260   4e-78   Pyrus x bretschneideri [bai li]
gb|KHN10182.1|  Casein kinase I like 2                                  258   4e-78   Glycine soja [wild soybean]
ref|XP_011019588.1|  PREDICTED: uncharacterized protein LOC105122...    254   5e-78   Populus euphratica
ref|XP_004294964.1|  PREDICTED: uncharacterized protein LOC101294343    260   5e-78   Fragaria vesca subsp. vesca
emb|CDY11509.1|  BnaA09g40750D                                          256   5e-78   Brassica napus [oilseed rape]
ref|NP_001054881.2|  Os05g0200500                                       258   5e-78   
ref|XP_008445007.1|  PREDICTED: uncharacterized protein LOC103488176    259   5e-78   Cucumis melo [Oriental melon]
ref|XP_006408871.1|  hypothetical protein EUTSA_v10001925mg             259   6e-78   Eutrema salsugineum [saltwater cress]
ref|XP_009367436.1|  PREDICTED: uncharacterized protein LOC103957076    259   6e-78   Pyrus x bretschneideri [bai li]
ref|XP_011006418.1|  PREDICTED: uncharacterized protein LOC105112417    259   6e-78   Populus euphratica
ref|XP_010243375.1|  PREDICTED: uncharacterized protein LOC104587456    260   6e-78   Nelumbo nucifera [Indian lotus]
ref|XP_003592802.1|  Casein kinase-like protein                         259   6e-78   Medicago truncatula
ref|XP_004963353.1|  PREDICTED: probable casein kinase I homolog ...    257   6e-78   Setaria italica
emb|CBI20566.3|  unnamed protein product                                257   7e-78   Vitis vinifera
ref|XP_009388687.1|  PREDICTED: casein kinase I isoform delta-like      257   7e-78   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008804603.1|  PREDICTED: negative regulator of sexual conj...    255   7e-78   
gb|KJB21850.1|  hypothetical protein B456_004G018100                    259   7e-78   Gossypium raimondii
ref|XP_010093160.1|  Casein kinase I                                    261   7e-78   
ref|XP_003577056.1|  PREDICTED: uncharacterized protein LOC100836999    258   7e-78   Brachypodium distachyon [annual false brome]
ref|XP_009117039.1|  PREDICTED: casein kinase I                         257   7e-78   Brassica rapa
dbj|BAD73224.1|  putative serine/threonine protein kinase               249   8e-78   Oryza sativa Japonica Group [Japonica rice]
emb|CDX76739.1|  BnaC08g33250D                                          257   8e-78   
ref|XP_006583050.1|  PREDICTED: uncharacterized protein LOC100800869    259   8e-78   Glycine max [soybeans]
ref|XP_006476018.1|  PREDICTED: uncharacterized protein LOC102627...    259   9e-78   Citrus sinensis [apfelsine]
ref|XP_006450715.1|  hypothetical protein CICLE_v10007635mg             259   9e-78   
gb|KDO79859.1|  hypothetical protein CISIN_1g005420mg                   259   9e-78   Citrus sinensis [apfelsine]
ref|XP_003523750.1|  PREDICTED: uncharacterized protein LOC100778...    258   1e-77   Glycine max [soybeans]
emb|CDO97984.1|  unnamed protein product                                256   1e-77   Coffea canephora [robusta coffee]
ref|XP_004517304.1|  PREDICTED: uncharacterized protein LOC101495334    256   1e-77   
ref|XP_011081763.1|  PREDICTED: uncharacterized protein LOC105164726    256   1e-77   Sesamum indicum [beniseed]
ref|XP_007014774.1|  Casein kinase I protein isoform 1                  262   1e-77   
ref|XP_010249770.1|  PREDICTED: uncharacterized protein LOC104592236    259   1e-77   Nelumbo nucifera [Indian lotus]
gb|KGN45587.1|  hypothetical protein Csa_7G452910                       259   1e-77   Cucumis sativus [cucumbers]
ref|XP_004141661.1|  PREDICTED: uncharacterized protein LOC101213589    259   1e-77   Cucumis sativus [cucumbers]
ref|XP_004155952.1|  PREDICTED: uncharacterized protein LOC101230855    259   1e-77   
ref|XP_010102418.1|  Casein kinase I-2-like protein                     259   1e-77   
gb|KGN62809.1|  hypothetical protein Csa_2G373520                       258   1e-77   Cucumis sativus [cucumbers]
ref|XP_003523751.1|  PREDICTED: uncharacterized protein LOC100779...    259   1e-77   Glycine max [soybeans]
ref|XP_004148393.1|  PREDICTED: uncharacterized protein LOC101218249    258   1e-77   
ref|XP_006644695.1|  PREDICTED: casein kinase I homolog 1-like          256   1e-77   
ref|XP_003565003.1|  PREDICTED: uncharacterized protein LOC100839189    256   2e-77   
ref|XP_003526502.1|  PREDICTED: uncharacterized protein LOC100800...    256   2e-77   
ref|XP_003531651.1|  PREDICTED: uncharacterized protein LOC100799630    258   2e-77   
ref|XP_002324211.2|  hypothetical protein POPTR_0018s08230g             258   2e-77   
ref|XP_002880706.1|  kinase family protein                              258   2e-77   
ref|XP_006293796.1|  hypothetical protein CARUB_v10022778mg             258   2e-77   
ref|XP_007013205.1|  Kinase family protein isoform 1                    257   2e-77   
ref|XP_002515975.1|  casein kinase, putative                            258   2e-77   
ref|XP_008220112.1|  PREDICTED: uncharacterized protein LOC103320244    258   2e-77   
ref|XP_010925551.1|  PREDICTED: uncharacterized protein LOC105048062    258   2e-77   
gb|KJB07483.1|  hypothetical protein B456_001G026300                    256   2e-77   
ref|XP_008462429.1|  PREDICTED: uncharacterized protein LOC103500783    258   2e-77   
ref|XP_002272679.2|  PREDICTED: serine/threonine-protein kinase S...    258   2e-77   
dbj|BAD87518.1|  putative serine/threonine protein kinase               256   2e-77   
ref|XP_010472590.1|  PREDICTED: uncharacterized protein LOC104752211    257   2e-77   
ref|XP_010924661.1|  PREDICTED: uncharacterized protein LOC105047...    258   2e-77   
ref|XP_010924659.1|  PREDICTED: uncharacterized protein LOC105047...    258   2e-77   
ref|XP_002309535.1|  kinase family protein                              256   2e-77   
ref|XP_010044967.1|  PREDICTED: uncharacterized protein LOC104433...    258   3e-77   
ref|NP_180147.2|  protein kinase family protein                         257   3e-77   
ref|XP_008392669.1|  PREDICTED: uncharacterized protein LOC103454855    258   3e-77   
ref|XP_011037977.1|  PREDICTED: uncharacterized protein LOC105135003    258   3e-77   
ref|XP_002297651.2|  hypothetical protein POPTR_0001s04710g             258   3e-77   
gb|KDP34168.1|  hypothetical protein JCGZ_07739                         257   3e-77   
ref|NP_973532.1|  protein kinase family protein                         257   3e-77   
ref|XP_007225173.1|  hypothetical protein PRUPE_ppa002269mg             257   3e-77   
ref|XP_010044966.1|  PREDICTED: uncharacterized protein LOC104433...    258   3e-77   
ref|XP_009416478.1|  PREDICTED: uncharacterized protein LOC103997068    257   3e-77   
ref|NP_001141429.1|  uncharacterized protein LOC100273539               252   3e-77   
ref|XP_009349729.1|  PREDICTED: uncharacterized protein LOC103941...    257   3e-77   
ref|XP_007135639.1|  hypothetical protein PHAVU_010G145900g             258   4e-77   
ref|XP_009349728.1|  PREDICTED: uncharacterized protein LOC103941...    258   4e-77   
ref|XP_011072424.1|  PREDICTED: serine/threonine-protein kinase S...    257   4e-77   
ref|XP_011025189.1|  PREDICTED: uncharacterized protein LOC105126132    257   4e-77   
emb|CDM82151.1|  unnamed protein product                                255   4e-77   
ref|XP_010915579.1|  PREDICTED: uncharacterized protein LOC105040...    257   4e-77   
dbj|BAJ94407.1|  predicted protein                                      255   4e-77   
ref|XP_010915613.1|  PREDICTED: uncharacterized protein LOC105040...    257   4e-77   
gb|ADI78885.1|  casein kinase I                                         257   5e-77   
ref|XP_002979683.1|  hypothetical protein SELMODRAFT_177864             254   5e-77   
ref|XP_004960930.1|  PREDICTED: uncharacterized protein LOC101765228    255   5e-77   
ref|XP_011072423.1|  PREDICTED: serine/threonine-protein kinase S...    257   5e-77   
ref|XP_002304015.1|  kinase family protein                              257   5e-77   
ref|XP_010668618.1|  PREDICTED: uncharacterized protein LOC104885660    258   5e-77   
gb|KHG18897.1|  Casein kinase I                                         257   5e-77   
gb|AES58679.2|  casein kinase I-like protein                            256   6e-77   
ref|XP_011019579.1|  PREDICTED: casein kinase I homolog 1-like is...    254   6e-77   
gb|EEE55368.1|  hypothetical protein OsJ_03423                          255   6e-77   
ref|XP_010429582.1|  PREDICTED: uncharacterized protein LOC104714043    256   6e-77   
ref|XP_010417347.1|  PREDICTED: uncharacterized protein LOC104703...    256   6e-77   
gb|KDP40868.1|  hypothetical protein JCGZ_24867                         257   7e-77   
gb|KJB07478.1|  hypothetical protein B456_001G026300                    255   7e-77   
ref|XP_010417348.1|  PREDICTED: uncharacterized protein LOC104703...    256   7e-77   
gb|KJB70401.1|  hypothetical protein B456_011G072100                    257   7e-77   
ref|XP_008810649.1|  PREDICTED: uncharacterized protein LOC103722...    256   8e-77   
ref|XP_002985391.1|  hypothetical protein SELMODRAFT_269002             254   8e-77   
ref|XP_006426889.1|  hypothetical protein CICLE_v10025028mg             256   8e-77   
ref|XP_010673525.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    257   8e-77   
ref|XP_008810650.1|  PREDICTED: uncharacterized protein LOC103722...    256   8e-77   
ref|XP_009787105.1|  PREDICTED: uncharacterized protein LOC104235125    256   8e-77   
ref|XP_006465683.1|  PREDICTED: uncharacterized protein LOC102607770    256   9e-77   
ref|XP_011003700.1|  PREDICTED: uncharacterized protein LOC105110375    256   9e-77   
ref|NP_001044224.1|  Os01g0744300                                       256   9e-77   
gb|EEC71464.1|  hypothetical protein OsI_03705                          256   1e-76   
ref|XP_008804602.1|  PREDICTED: uncharacterized protein LOC103717...    256   1e-76   
gb|KHG27580.1|  Casein kinase I                                         256   1e-76   
gb|KJB54778.1|  hypothetical protein B456_009G048800                    253   1e-76   
ref|XP_008804601.1|  PREDICTED: uncharacterized protein LOC103717...    256   1e-76   
emb|CDP08183.1|  unnamed protein product                                256   1e-76   
gb|KHG03332.1|  hypothetical protein F383_28165                         256   1e-76   
ref|XP_002440770.1|  hypothetical protein SORBIDRAFT_09g006270          254   1e-76   
gb|KJB54779.1|  hypothetical protein B456_009G048800                    253   1e-76   
ref|XP_011458971.1|  PREDICTED: uncharacterized protein LOC101301711    255   1e-76   
ref|XP_004497365.1|  PREDICTED: casein kinase I isoform delta-like      255   1e-76   
ref|XP_002303307.2|  hypothetical protein POPTR_0003s04820g             250   2e-76   
tpg|DAA52911.1|  TPA: hypothetical protein ZEAMMB73_402791              250   2e-76   
gb|KHG22911.1|  Casein kinase I                                         253   2e-76   
ref|XP_004291170.1|  PREDICTED: uncharacterized protein LOC101299149    254   2e-76   
ref|NP_001169571.1|  hypothetical protein                               253   2e-76   
ref|XP_004968538.1|  PREDICTED: casein kinase I-like                    253   2e-76   
gb|EMT25395.1|  Casein kinase I-2-like protein                          253   2e-76   
ref|XP_009592153.1|  PREDICTED: uncharacterized protein LOC104089043    255   2e-76   
ref|XP_004969923.1|  PREDICTED: uncharacterized protein LOC101760429    254   2e-76   
dbj|BAJ99167.1|  predicted protein                                      254   2e-76   
ref|XP_009596024.1|  PREDICTED: uncharacterized protein LOC104092197    255   3e-76   
ref|XP_004510300.1|  PREDICTED: uncharacterized protein LOC101511720    255   3e-76   
ref|XP_009587685.1|  PREDICTED: uncharacterized protein LOC104085378    255   3e-76   
gb|EPS63371.1|  hypothetical protein M569_11412                         243   5e-76   
ref|XP_010062521.1|  PREDICTED: uncharacterized protein LOC104449912    254   5e-76   
gb|EYU29288.1|  hypothetical protein MIMGU_mgv1a002190mg                254   5e-76   
ref|XP_009776610.1|  PREDICTED: uncharacterized protein LOC104226336    254   6e-76   
ref|XP_002298239.1|  hypothetical protein POPTR_0001s18990g             254   6e-76   
ref|XP_003568762.1|  PREDICTED: uncharacterized protein LOC100825718    252   6e-76   
ref|XP_002455001.1|  hypothetical protein SORBIDRAFT_03g002790          252   7e-76   
ref|XP_009801165.1|  PREDICTED: uncharacterized protein LOC104246947    254   7e-76   
ref|XP_008226475.1|  PREDICTED: protein kinase 3                        254   7e-76   
emb|CDM84047.1|  unnamed protein product                                253   7e-76   
gb|KDO50862.1|  hypothetical protein CISIN_1g005947mg                   253   8e-76   
ref|XP_008672449.1|  PREDICTED: uncharacterized protein LOC100273...    251   8e-76   
ref|XP_004253105.1|  PREDICTED: uncharacterized protein LOC101244359    254   8e-76   
gb|EMS66552.1|  Casein kinase I-like protein 2                          251   9e-76   
dbj|BAK02283.1|  predicted protein                                      251   9e-76   
ref|XP_007137240.1|  hypothetical protein PHAVU_009G111300g             254   1e-75   
ref|XP_002882289.1|  hypothetical protein ARALYDRAFT_340491             241   1e-75   
ref|XP_009336928.1|  PREDICTED: uncharacterized protein LOC103929445    253   1e-75   
ref|XP_006451129.1|  hypothetical protein CICLE_v10007666mg             253   1e-75   
ref|XP_006342517.1|  PREDICTED: uncharacterized protein LOC102599332    253   1e-75   
ref|XP_008386593.1|  PREDICTED: uncharacterized protein LOC103449090    253   1e-75   
ref|XP_011013369.1|  PREDICTED: uncharacterized protein LOC105117...    248   2e-75   
ref|XP_008673564.1|  PREDICTED: casein kinase I isoform X2              250   2e-75   
ref|XP_011013372.1|  PREDICTED: uncharacterized protein LOC105117...    248   2e-75   
ref|XP_007012164.1|  Casein kinase I protein                            253   2e-75   
ref|XP_008242613.1|  PREDICTED: uncharacterized protein LOC103340922    252   2e-75   
ref|XP_004302863.1|  PREDICTED: uncharacterized protein LOC101305860    253   2e-75   
ref|XP_003057011.1|  Serine/Threonine protein kinase                    252   3e-75   
ref|XP_011092199.1|  PREDICTED: uncharacterized protein LOC105172435    252   3e-75   
ref|XP_008673563.1|  PREDICTED: uncharacterized protein LOC103649...    250   3e-75   
ref|XP_003569789.1|  PREDICTED: serine/threonine-protein kinase VRK1    251   4e-75   
ref|XP_005850218.1|  hypothetical protein CHLNCDRAFT_34546              250   4e-75   
ref|XP_008794114.1|  PREDICTED: uncharacterized protein LOC103710237    251   4e-75   
ref|XP_008380865.1|  PREDICTED: uncharacterized protein LOC103443751    252   4e-75   
ref|XP_002884419.1|  hypothetical protein ARALYDRAFT_340552             241   4e-75   
ref|XP_010098134.1|  Casein kinase I-2-like protein                     252   5e-75   
ref|XP_006643875.1|  PREDICTED: casein kinase I homolog 2-like          250   5e-75   
ref|XP_002954481.1|  hypothetical protein VOLCADRAFT_76324              249   6e-75   
gb|KJB82881.1|  hypothetical protein B456_013G219500                    249   6e-75   
ref|XP_007203777.1|  hypothetical protein PRUPE_ppa002378mg             251   6e-75   
ref|XP_001701465.1|  MUT9-related serine/threonine protein kinase       249   7e-75   
ref|XP_006340257.1|  PREDICTED: uncharacterized protein LOC102583902    251   8e-75   
ref|XP_004251171.2|  PREDICTED: uncharacterized protein LOC101245026    251   8e-75   
ref|XP_009353558.1|  PREDICTED: uncharacterized protein LOC103944824    251   8e-75   
ref|NP_001042306.1|  Os01g0198200                                       249   9e-75   
dbj|BAD73223.1|  putative serine/threonine protein kinase               249   9e-75   
gb|EMT27276.1|  Casein kinase I-2-like protein                          250   1e-74   
gb|EEC70115.1|  hypothetical protein OsI_00774                          249   1e-74   
ref|XP_007161527.1|  hypothetical protein PHAVU_001G076900g             250   1e-74   
ref|XP_004228598.1|  PREDICTED: casein kinase I isoform gamma-3         250   2e-74   
gb|EEE54054.1|  hypothetical protein OsJ_00747                          249   2e-74   
ref|XP_006354169.1|  PREDICTED: casein kinase I isoform gamma-3-like    250   2e-74   
gb|KEH36077.1|  casein kinase I-like protein                            249   2e-74   
gb|KJB27133.1|  hypothetical protein B456_004G279600                    249   2e-74   
ref|XP_004252842.1|  PREDICTED: casein kinase I-like                    248   3e-74   
gb|EYU21509.1|  hypothetical protein MIMGU_mgv1a002137mg                250   3e-74   
gb|KJB82582.1|  hypothetical protein B456_013G203000                    249   4e-74   
ref|XP_002502422.1|  predicted protein                                  247   4e-74   
ref|XP_009347165.1|  PREDICTED: uncharacterized protein LOC103938...    248   7e-74   
ref|XP_009347166.1|  PREDICTED: uncharacterized protein LOC103938...    248   7e-74   
ref|XP_005649643.1|  MUT9-related serine/threonine protein kinase       246   1e-73   
ref|XP_011013373.1|  PREDICTED: uncharacterized protein LOC105117...    248   2e-73   
ref|XP_011013374.1|  PREDICTED: uncharacterized protein LOC105117...    248   2e-73   
ref|NP_187043.1|  protein kinase-related protein                        236   2e-73   
ref|XP_002514324.1|  casein kinase, putative                            245   6e-73   
emb|CEG01140.1|  Serine/threonine-protein kinase, active site           244   9e-73   
ref|XP_008337442.1|  PREDICTED: uncharacterized protein LOC103400...    245   9e-73   
ref|XP_008337441.1|  PREDICTED: uncharacterized protein LOC103400...    245   1e-72   
ref|XP_003075213.1|  protein kinase family protein (ISS)                244   2e-72   
ref|XP_001416335.1|  predicted protein                                  242   4e-72   
gb|EMT06466.1|  Casein kinase I isoform alpha                           243   1e-71   
gb|EMS55265.1|  Casein kinase I isoform alpha                           243   1e-71   
ref|XP_005850945.1|  hypothetical protein CHLNCDRAFT_140695             234   5e-71   
ref|XP_008655344.1|  PREDICTED: hypothetical protein isoform X2         241   5e-71   
ref|XP_008655345.1|  PREDICTED: hypothetical protein isoform X3         240   6e-71   
ref|XP_007514232.1|  predicted protein                                  238   1e-70   
gb|EMS54400.1|  Casein kinase I-like protein 2                          240   4e-70   
gb|KHG22741.1|  Casein kinase I isoform delta                           236   6e-70   
ref|XP_003588428.1|  Casein kinase I isoform alpha                      238   9e-70   
gb|KJB54170.1|  hypothetical protein B456_009G024100                    236   1e-69   
ref|XP_009781261.1|  PREDICTED: casein kinase I isoform gamma-3         236   2e-69   
ref|XP_009625624.1|  PREDICTED: casein kinase I isoform gamma-3-like    236   2e-69   
ref|XP_010690200.1|  PREDICTED: casein kinase I isoform gamma-2-like    235   2e-69   
gb|KJB54173.1|  hypothetical protein B456_009G024100                    234   2e-68   
ref|XP_006299519.1|  hypothetical protein CARUB_v10015691mg             223   3e-68   
gb|KDD72198.1|  hypothetical protein H632_c3713p0                       219   6e-67   
gb|KDD76924.1|  hypothetical protein H632_c65p1                         228   8e-67   
ref|XP_008655343.1|  PREDICTED: hypothetical protein isoform X1         229   1e-66   
ref|XP_004309533.2|  PREDICTED: casein kinase I isoform delta-A-like    227   2e-66   
ref|XP_011396021.1|  Casein kinase I isoform delta-like protein         226   2e-66   
ref|XP_010088832.1|  Casein kinase I isoform alpha                      228   3e-66   
ref|XP_007014776.1|  Kinase family protein isoform 3                    227   1e-65   
ref|XP_004963352.1|  PREDICTED: probable casein kinase I homolog ...    223   1e-64   
gb|AET01488.2|  casein kinase I-like protein                            223   2e-64   
gb|KJB46017.1|  hypothetical protein B456_007G343500                    224   2e-64   
ref|XP_010915572.1|  PREDICTED: uncharacterized protein LOC105040...    222   8e-64   
ref|XP_010915562.1|  PREDICTED: uncharacterized protein LOC105040...    222   9e-64   
ref|XP_010915554.1|  PREDICTED: uncharacterized protein LOC105040...    222   1e-63   
gb|EMT12651.1|  Casein kinase I-2-like protein                          222   1e-63   
ref|XP_010915546.1|  PREDICTED: uncharacterized protein LOC105040...    222   1e-63   
tpg|DAA35739.1|  TPA: putative homeodomain-like transcription fac...    223   1e-63   
ref|XP_003627012.1|  Casein kinase-like protein                         222   2e-63   
gb|KJB07477.1|  hypothetical protein B456_001G026300                    219   6e-63   
gb|AAP80674.1|  casein kinase-like protein                              203   1e-62   
gb|EPS62497.1|  hypothetical protein M569_12290                         217   2e-62   
emb|CAN74986.1|  hypothetical protein VITISV_008771                     223   2e-62   
ref|XP_002443446.1|  hypothetical protein SORBIDRAFT_08g019600          217   3e-62   
gb|KFK37829.1|  hypothetical protein AALP_AA3G034600                    210   4e-62   
gb|AFW85111.1|  hypothetical protein ZEAMMB73_338907                    207   3e-61   
ref|XP_010229461.1|  PREDICTED: casein kinase I isoform alpha-like      211   2e-60   
ref|XP_002958584.1|  histone kinase                                     209   3e-59   
tpg|DAA56574.1|  TPA: hypothetical protein ZEAMMB73_926529              204   3e-59   
ref|XP_011400089.1|  Casein kinase I-like protein 2                     207   4e-59   
ref|XP_001695320.1|  serine/threonine protein kinase, transcripti...    209   5e-59   
gb|AIS72786.1|  casein kinase-like protein                              192   1e-58   
ref|XP_004245392.1|  PREDICTED: uncharacterized protein LOC101249392    205   8e-58   
gb|KJB54177.1|  hypothetical protein B456_009G024100                    204   1e-57   
ref|XP_008452134.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    192   3e-57   
ref|XP_006574072.1|  PREDICTED: LOW QUALITY PROTEIN: casein kinas...    200   2e-56   
gb|EMT07061.1|  Casein kinase I-2-like protein                          203   2e-56   
ref|XP_002458472.1|  hypothetical protein SORBIDRAFT_03g034330          185   9e-56   
gb|AEO89321.1|  serine/threonine protein kinase                         194   8e-54   
gb|EMS61861.1|  Casein kinase I isoform delta-like protein              189   1e-51   
gb|EMT21083.1|  Casein kinase I-2-like protein                          187   2e-51   
gb|EMT25758.1|  Casein kinase I isoform delta-like protein              188   2e-51   
gb|KIY93350.1|  hypothetical protein MNEG_14612                         170   4e-50   
gb|AEW08952.1|  hypothetical protein CL2426Contig1_01                   168   2e-49   
ref|XP_005648473.1|  kinase-like protein                                177   9e-48   
ref|XP_010103948.1|  hypothetical protein L484_020200                   164   2e-45   
ref|XP_010090279.1|  hypothetical protein L484_001310                   166   2e-44   
gb|EYU34156.1|  hypothetical protein MIMGU_mgv1a003255mg                162   2e-42   
ref|XP_010109262.1|  hypothetical protein L484_014856                   157   1e-41   
ref|XP_010090282.1|  hypothetical protein L484_001313                   153   3e-41   



>ref|NP_001183608.1| uncharacterized protein LOC100502202 [Zea mays]
 gb|ACR37739.1| unknown [Zea mays]
Length=162

 Score =   283 bits (723),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 143/155 (92%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YIS+IAGA NGSSLVVMSKGTPYTQQSYKVSESFP+KWINKKWKEGFHVTSMTTAGSR
Sbjct  7    NYYISAIAGAMNGSSLVVMSKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSMTTAGSR  66

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+GYSEQVVELDFLYPSEGIHRRWE+GYRITS AAT DQAAFILSIP+RK+MD
Sbjct  67   WGVVMSRNSGYSEQVVELDFLYPSEGIHRRWENGYRITSTAATGDQAAFILSIPKRKLMD  126

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPS HVKEKW+KNLYIASICYGRTV
Sbjct  127  ETQETLRTSAFPSNHVKEKWAKNLYIASICYGRTV  161



>gb|AAM91528.1| putative casein kinase [Arabidopsis thaliana]
Length=303

 Score =   288 bits (736),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 146/156 (94%), Positives = 153/156 (98%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGA NGSSLVVM+KGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTTAGSR
Sbjct  148  NYYISSIAGANNGSSLVVMAKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTTAGSR  207

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+GYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAA ILSIP+RK+ D
Sbjct  208  WGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAALILSIPKRKITD  267

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTVC
Sbjct  268  ETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC  303



>gb|EPS68531.1| hypothetical protein M569_06230 [Genlisea aurea]
Length=704

 Score =   298 bits (763),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 153/156 (98%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            NFYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR
Sbjct  549  NFYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  608

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+GYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAF+LSIPRRKMMD
Sbjct  609  WGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFVLSIPRRKMMD  668

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTSAFPS+HVKEKWSKNLYIASICYGRTVC
Sbjct  669  ETQETLRTSAFPSSHVKEKWSKNLYIASICYGRTVC  704



>ref|XP_011075041.1| PREDICTED: uncharacterized protein LOC105159627 [Sesamum indicum]
Length=705

 Score =   298 bits (763),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 154/156 (99%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR
Sbjct  550  NYYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  609

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+GYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD
Sbjct  610  WGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  669

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  670  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  705



>emb|CDP14324.1| unnamed protein product [Coffea canephora]
Length=709

 Score =   298 bits (763),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 154/156 (99%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR
Sbjct  554  NYYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  613

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+GYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD
Sbjct  614  WGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  673

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  674  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  709


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 68/122 (56%), Gaps = 5/122 (4%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IH  435
            Y V++S   + ++K  ++G +++ + +A + W ++M    G+S QV EL  ++  +  I 
Sbjct  489  YNVADSRLRQHVDKGNEDGLYISCVASATNLWALIMDAGTGFSSQVYELSAVFLHKDWIM  548

Query  434  RRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIA  258
             +WE  Y I+S+A  A+ ++ ++     K    TQ++ + S +FP   + +KW +  ++ 
Sbjct  549  EQWEKNYYISSIAGAANGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVT  605

Query  257  SI  252
            S+
Sbjct  606  SM  607



>gb|KDO55049.1| hypothetical protein CISIN_1g005214mg [Citrus sinensis]
Length=537

 Score =   293 bits (750),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 149/156 (96%), Positives = 155/156 (99%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAG+ NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAG+R
Sbjct  382  NYYISSIAGSTNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGNR  441

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+GYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILS+PRRKM+D
Sbjct  442  WGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSVPRRKMVD  501

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  502  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  537



>ref|XP_009788026.1| PREDICTED: uncharacterized protein LOC104235895 [Nicotiana sylvestris]
 ref|XP_009788027.1| PREDICTED: uncharacterized protein LOC104235895 [Nicotiana sylvestris]
 ref|XP_009788028.1| PREDICTED: uncharacterized protein LOC104235895 [Nicotiana sylvestris]
 ref|XP_009788029.1| PREDICTED: uncharacterized protein LOC104235895 [Nicotiana sylvestris]
Length=708

 Score =   296 bits (758),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 152/156 (97%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR
Sbjct  553  NYYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  612

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+GYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILS+PRRKM+D
Sbjct  613  WGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSVPRRKMID  672

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  673  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  708


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 69/123 (56%), Gaps = 7/123 (6%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V++S   + ++K  ++G +++ + +A + W ++M    G+S QV +L   FL+  + I
Sbjct  488  YNVADSRLQQHVDKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSAVFLH-KDWI  546

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  Y I+S+A  A+ ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  547  MEQWEKNYYISSIAGAANGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHV  603

Query  260  ASI  252
             S+
Sbjct  604  TSM  606



>ref|XP_009771625.1| PREDICTED: uncharacterized protein LOC104222130 [Nicotiana sylvestris]
 ref|XP_009771626.1| PREDICTED: uncharacterized protein LOC104222130 [Nicotiana sylvestris]
 ref|XP_009771627.1| PREDICTED: uncharacterized protein LOC104222130 [Nicotiana sylvestris]
Length=714

 Score =   296 bits (759),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 152/156 (97%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR
Sbjct  559  NYYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  618

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+GYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILS+PRRKM+D
Sbjct  619  WGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSVPRRKMID  678

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  679  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  714


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 68/122 (56%), Gaps = 5/122 (4%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IH  435
            Y V++S   + ++K  ++G +++ + +A + W ++M    G+S QV EL  ++  +  I 
Sbjct  494  YNVADSRLRQHVDKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYELSAVFLHKDWIM  553

Query  434  RRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIA  258
             +WE  Y I+S+A  A+ ++ ++     K    TQ++ + S +FP   + +KW +  ++ 
Sbjct  554  EQWEKNYYISSIAGAANGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVT  610

Query  257  SI  252
            S+
Sbjct  611  SM  612



>ref|XP_009615719.1| PREDICTED: uncharacterized protein LOC104108400 [Nicotiana tomentosiformis]
 ref|XP_009615725.1| PREDICTED: uncharacterized protein LOC104108400 [Nicotiana tomentosiformis]
 ref|XP_009615727.1| PREDICTED: uncharacterized protein LOC104108400 [Nicotiana tomentosiformis]
 ref|XP_009615731.1| PREDICTED: uncharacterized protein LOC104108400 [Nicotiana tomentosiformis]
Length=708

 Score =   296 bits (758),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 152/156 (97%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR
Sbjct  553  NYYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  612

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+GYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILS+PRRKM+D
Sbjct  613  WGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSVPRRKMID  672

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  673  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  708


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 69/123 (56%), Gaps = 7/123 (6%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V++S   + ++K  ++G +++ + +A + W ++M    G+S QV +L   FL+  + I
Sbjct  488  YNVADSRLQQHVDKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYDLSAVFLH-KDWI  546

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  Y I+S+A  A+ ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  547  MEQWEKNYYISSIAGAANGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHV  603

Query  260  ASI  252
             S+
Sbjct  604  TSM  606



>ref|XP_009621585.1| PREDICTED: uncharacterized protein LOC104113184 [Nicotiana tomentosiformis]
 ref|XP_009621586.1| PREDICTED: uncharacterized protein LOC104113184 [Nicotiana tomentosiformis]
 ref|XP_009621587.1| PREDICTED: uncharacterized protein LOC104113184 [Nicotiana tomentosiformis]
Length=714

 Score =   296 bits (758),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 152/156 (97%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR
Sbjct  559  NYYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  618

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+GYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILS+PRRKM+D
Sbjct  619  WGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSVPRRKMID  678

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  679  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  714


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 68/122 (56%), Gaps = 5/122 (4%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IH  435
            Y V++S   + ++K  ++G +++ + +A + W ++M    G+S QV EL  ++  +  I 
Sbjct  494  YNVADSRLRQHVDKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYELSAVFLHKDWIM  553

Query  434  RRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIA  258
             +WE  Y I+S+A  A+ ++ ++     K    TQ++ + S +FP   + +KW +  ++ 
Sbjct  554  EQWEKNYYISSIAGAANGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVT  610

Query  257  SI  252
            S+
Sbjct  611  SM  612



>ref|XP_002525432.1| casein kinase, putative [Ricinus communis]
 gb|EEF36922.1| casein kinase, putative [Ricinus communis]
Length=705

 Score =   295 bits (756),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 151/156 (97%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            NFYISSIAGA+NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAG+R
Sbjct  550  NFYISSIAGASNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGNR  609

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRNAGYS+QVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIP+RKM+D
Sbjct  610  WGVVMSRNAGYSDQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPKRKMVD  669

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  670  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  705



>gb|AAO41895.1| putative casein kinase [Arabidopsis thaliana]
Length=307

 Score =   283 bits (723),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 140/156 (90%), Positives = 153/156 (98%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAG+ NG+SLVVMSKGT YTQQSYKVS+SFPFKWINKKWKE FHVTSMTTAG+R
Sbjct  152  NYYISSIAGSDNGNSLVVMSKGTSYTQQSYKVSDSFPFKWINKKWKEDFHVTSMTTAGNR  211

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+GYS+QVVELDFLYPS+GIHRRWESGYRITSMAATADQAAFILS+P+RKMMD
Sbjct  212  WGVVMSRNSGYSDQVVELDFLYPSDGIHRRWESGYRITSMAATADQAAFILSVPKRKMMD  271

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRT+AFPSTHVKEKW+KNLYIASIC+GRTVC
Sbjct  272  ETQETLRTTAFPSTHVKEKWAKNLYIASICFGRTVC  307



>ref|XP_008441978.1| PREDICTED: uncharacterized protein LOC103485979 [Cucumis melo]
 ref|XP_008441979.1| PREDICTED: uncharacterized protein LOC103485979 [Cucumis melo]
Length=708

 Score =   295 bits (754),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 151/156 (97%), Positives = 155/156 (99%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            NFYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR
Sbjct  553  NFYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  612

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRNAG+S+QVVELDFLYPSEGIHRRWESGYRIT MAATADQAAFILSIP+RK+MD
Sbjct  613  WGVVMSRNAGFSDQVVELDFLYPSEGIHRRWESGYRITCMAATADQAAFILSIPKRKLMD  672

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  673  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  708


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/123 (27%), Positives = 67/123 (54%), Gaps = 7/123 (6%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V++S   + I K  ++G  ++ + +A + W ++M    G+S QV EL   FL+  + I
Sbjct  488  YNVADSRLRQHIEKGNEDGLLISCVASASNLWALIMDAGTGFSSQVYELSSVFLH-KDWI  546

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  + I+S+A  A+ ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  547  MEQWEKNFYISSIAGAANGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHV  603

Query  260  ASI  252
             S+
Sbjct  604  TSM  606



>ref|XP_004147533.1| PREDICTED: uncharacterized protein LOC101221479 [Cucumis sativus]
 gb|KGN53942.1| Casein kinase [Cucumis sativus]
Length=708

 Score =   295 bits (754),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 151/156 (97%), Positives = 155/156 (99%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            NFYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR
Sbjct  553  NFYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  612

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRNAG+S+QVVELDFLYPSEGIHRRWESGYRIT MAATADQAAFILSIP+RK+MD
Sbjct  613  WGVVMSRNAGFSDQVVELDFLYPSEGIHRRWESGYRITCMAATADQAAFILSIPKRKLMD  672

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  673  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  708


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/123 (27%), Positives = 67/123 (54%), Gaps = 7/123 (6%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V++S   + I K  ++G  ++ + +A + W ++M    G+S QV EL   FL+  + I
Sbjct  488  YNVADSRLRQHIEKGNEDGLLISCVASASNLWALIMDAGTGFSSQVYELSSVFLH-KDWI  546

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  + I+S+A  A+ ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  547  MEQWEKNFYISSIAGAANGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHV  603

Query  260  ASI  252
             S+
Sbjct  604  TSM  606



>ref|XP_006443418.1| hypothetical protein CICLE_v10019090mg [Citrus clementina]
 ref|XP_006479105.1| PREDICTED: uncharacterized protein LOC102619111 isoform X2 [Citrus 
sinensis]
 gb|ESR56658.1| hypothetical protein CICLE_v10019090mg [Citrus clementina]
 gb|KDO55047.1| hypothetical protein CISIN_1g005214mg [Citrus sinensis]
Length=704

 Score =   295 bits (754),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 149/156 (96%), Positives = 155/156 (99%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAG+ NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAG+R
Sbjct  549  NYYISSIAGSTNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGNR  608

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+GYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILS+PRRKM+D
Sbjct  609  WGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSVPRRKMVD  668

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  669  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  704



>ref|XP_006479104.1| PREDICTED: uncharacterized protein LOC102619111 isoform X1 [Citrus 
sinensis]
 gb|KDO55048.1| hypothetical protein CISIN_1g005214mg [Citrus sinensis]
Length=708

 Score =   294 bits (753),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 149/156 (96%), Positives = 155/156 (99%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAG+ NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAG+R
Sbjct  553  NYYISSIAGSTNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGNR  612

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+GYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILS+PRRKM+D
Sbjct  613  WGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSVPRRKMVD  672

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  673  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  708



>ref|XP_004249304.1| PREDICTED: uncharacterized protein LOC101268442 [Solanum lycopersicum]
Length=709

 Score =   294 bits (753),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 151/156 (97%), Positives = 155/156 (99%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR
Sbjct  554  NYYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  613

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRNAGY+EQVVELDFLYPSEGIHRRWE G+RITSMAATADQAAFILSIPRRKM+D
Sbjct  614  WGVVMSRNAGYAEQVVELDFLYPSEGIHRRWEGGFRITSMAATADQAAFILSIPRRKMID  673

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  674  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  709


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 69/123 (56%), Gaps = 7/123 (6%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V+++   + ++K  ++G +++ + +A + W ++M    G+S QV EL   FL+  + I
Sbjct  489  YNVADTRLRQHVDKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYELSAAFLH-KDWI  547

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  Y I+S+A  A+ ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  548  MEQWEKNYYISSIAGAANGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHV  604

Query  260  ASI  252
             S+
Sbjct  605  TSM  607



>ref|XP_011078778.1| PREDICTED: uncharacterized protein LOC105162459 [Sesamum indicum]
Length=705

 Score =   294 bits (752),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 151/156 (97%), Positives = 155/156 (99%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR
Sbjct  550  NYYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  609

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+GYSEQVVELDFLYPSEGIHRRWE+GYRITSMAAT DQAAFILSIPRRKM+D
Sbjct  610  WGVVMSRNSGYSEQVVELDFLYPSEGIHRRWENGYRITSMAATGDQAAFILSIPRRKMID  669

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  670  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  705



>ref|XP_011021493.1| PREDICTED: uncharacterized protein LOC105123555 [Populus euphratica]
Length=707

 Score =   294 bits (752),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 150/156 (96%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGA+NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR
Sbjct  552  NYYISSIAGASNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  611

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRNAGYS+QVVELDFLYPSEGIHRRWESG+RITSMAATADQAAFILSIP+RKM+D
Sbjct  612  WGVVMSRNAGYSDQVVELDFLYPSEGIHRRWESGFRITSMAATADQAAFILSIPKRKMVD  671

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  672  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  707



>gb|EYU20664.1| hypothetical protein MIMGU_mgv1a002165mg [Erythranthe guttata]
Length=706

 Score =   293 bits (751),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 149/156 (96%), Positives = 155/156 (99%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGAANGSSLV+MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAG+R
Sbjct  551  NYYISSIAGAANGSSLVIMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGNR  610

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+GYSEQVVELDFLYPSEGIHRRWE+GYRIT+MAATADQ AFILSIPRRKMMD
Sbjct  611  WGVVMSRNSGYSEQVVELDFLYPSEGIHRRWENGYRITAMAATADQGAFILSIPRRKMMD  670

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  671  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  706


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 67/122 (55%), Gaps = 5/122 (4%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IH  435
            Y V++S   + + K  ++G +++ + +A + W ++M    G+S QV EL  ++  +  I 
Sbjct  486  YNVADSRLRQHVEKGNEDGLYISCVASASNLWALIMDAGTGFSSQVYELSAVFLHKDWIM  545

Query  434  RRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIA  258
             +WE  Y I+S+A  A+ ++ ++     K    TQ++ + S +FP   + +KW +  ++ 
Sbjct  546  EQWEKNYYISSIAGAANGSSLVI---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVT  602

Query  257  SI  252
            S+
Sbjct  603  SM  604



>ref|XP_004157014.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101221479 
[Cucumis sativus]
Length=742

 Score =   295 bits (754),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 151/156 (97%), Positives = 155/156 (99%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            NFYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR
Sbjct  587  NFYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  646

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRNAG+S+QVVELDFLYPSEGIHRRWESGYRIT MAATADQAAFILSIP+RK+MD
Sbjct  647  WGVVMSRNAGFSDQVVELDFLYPSEGIHRRWESGYRITCMAATADQAAFILSIPKRKLMD  706

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  707  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  742


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/123 (27%), Positives = 67/123 (54%), Gaps = 7/123 (6%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V++S   + I K  ++G  ++ + +A + W ++M    G+S QV EL   FL+  + I
Sbjct  522  YNVADSRLRQHIEKGNEDGLLISCVASASNLWALIMDAGTGFSSQVYELSSVFLH-KDWI  580

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  + I+S+A  A+ ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  581  MEQWEKNFYISSIAGAANGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHV  637

Query  260  ASI  252
             S+
Sbjct  638  TSM  640



>ref|XP_002325416.1| kinase family protein [Populus trichocarpa]
 gb|EEE99797.1| kinase family protein [Populus trichocarpa]
Length=720

 Score =   294 bits (752),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 150/156 (96%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGA+NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR
Sbjct  565  NYYISSIAGASNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  624

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRNAGYS+QVVELDFLYPSEGIHRRWESG+RITSMAATADQAAFILSIP+RKM+D
Sbjct  625  WGVVMSRNAGYSDQVVELDFLYPSEGIHRRWESGFRITSMAATADQAAFILSIPKRKMVD  684

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  685  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  720



>ref|XP_010088042.1| Casein kinase I isoform delta [Morus notabilis]
 gb|EXB31261.1| Casein kinase I isoform delta [Morus notabilis]
Length=706

 Score =   293 bits (750),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 150/156 (96%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            NFYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR
Sbjct  551  NFYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  610

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRNAGY+EQVVELDFLYPSEGIH+RWE+GYRITSMAATADQAAFILSIP+RK+MD
Sbjct  611  WGVVMSRNAGYAEQVVELDFLYPSEGIHKRWENGYRITSMAATADQAAFILSIPKRKLMD  670

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTSAFPS+HVKEKWSKNLYIASICYGRTVC
Sbjct  671  ETQETLRTSAFPSSHVKEKWSKNLYIASICYGRTVC  706



>ref|XP_006351365.1| PREDICTED: uncharacterized protein LOC102603072 [Solanum tuberosum]
Length=709

 Score =   293 bits (750),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 149/156 (96%), Positives = 154/156 (99%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAG+R
Sbjct  554  NYYISSIAGATNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGNR  613

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRNAGY+EQVVELDFLYPSEGIHRRWE G+RITSMAATADQAAFILSIPRRKM+D
Sbjct  614  WGVVMSRNAGYAEQVVELDFLYPSEGIHRRWEGGFRITSMAATADQAAFILSIPRRKMID  673

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  674  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  709


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 68/123 (55%), Gaps = 7/123 (6%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V+++   + ++K  ++G +++ + +A + W ++M    G+S QV EL   FL+  + I
Sbjct  489  YNVADTRLRQHVDKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYELSAAFLH-KDWI  547

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  Y I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  548  MEQWEKNYYISSIAGATNGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHV  604

Query  260  ASI  252
             S+
Sbjct  605  TSM  607



>gb|KDP39706.1| hypothetical protein JCGZ_02726 [Jatropha curcas]
Length=705

 Score =   292 bits (748),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 149/156 (96%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGA+NGSSLVVMSKGTP+TQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR
Sbjct  550  NYYISSIAGASNGSSLVVMSKGTPFTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  609

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRNAG+S+QVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIP+RKM+D
Sbjct  610  WGVVMSRNAGFSDQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPKRKMVD  669

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  670  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  705



>ref|XP_007204249.1| hypothetical protein PRUPE_ppa002161mg [Prunus persica]
 gb|EMJ05448.1| hypothetical protein PRUPE_ppa002161mg [Prunus persica]
Length=707

 Score =   292 bits (747),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 149/156 (96%), Positives = 153/156 (98%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            NFYISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAG R
Sbjct  552  NFYISSIAGATNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGIR  611

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRNAGYS+QVVELDFLYPSEGIHRRWESGYRITSMAAT DQAAFILSIP+RK+MD
Sbjct  612  WGVVMSRNAGYSDQVVELDFLYPSEGIHRRWESGYRITSMAATTDQAAFILSIPKRKLMD  671

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTSAFPS+HVKEKWSKNLYIASICYGRTVC
Sbjct  672  ETQETLRTSAFPSSHVKEKWSKNLYIASICYGRTVC  707


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 68/123 (55%), Gaps = 7/123 (6%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V+++   + ++K  ++G  ++S+ +A + W ++M    G+S QV EL   FL+  + I
Sbjct  487  YNVADTRLSQHVDKGNEDGLFISSVASAANLWALIMDAGTGFSSQVYELSTVFLH-KDWI  545

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  + I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  546  MEQWEKNFYISSIAGATNGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHV  602

Query  260  ASI  252
             S+
Sbjct  603  TSM  605



>ref|XP_009366444.1| PREDICTED: uncharacterized protein LOC103956210 [Pyrus x bretschneideri]
Length=707

 Score =   291 bits (746),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 149/156 (96%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            NFYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAG+R
Sbjct  552  NFYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGNR  611

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRNAG+S+QVVELDF+YPSEGIHRRWESGYRITSMAATADQAAFILSIP+RK+MD
Sbjct  612  WGVVMSRNAGFSDQVVELDFVYPSEGIHRRWESGYRITSMAATADQAAFILSIPKRKLMD  671

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTSAFPS+HVKEKWSKNLYIASICYGRTVC
Sbjct  672  ETQETLRTSAFPSSHVKEKWSKNLYIASICYGRTVC  707



>ref|XP_007030718.1| Kinase family protein [Theobroma cacao]
 gb|EOY11220.1| Kinase family protein [Theobroma cacao]
Length=705

 Score =   291 bits (746),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 147/156 (94%), Positives = 153/156 (98%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGA N SSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR
Sbjct  550  NYYISSIAGANNASSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  609

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+G+S+QVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIP+RKMMD
Sbjct  610  WGVVMSRNSGFSDQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPKRKMMD  669

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTSAFPS HVKEKW+KNLYIASICYGRTVC
Sbjct  670  ETQETLRTSAFPSAHVKEKWAKNLYIASICYGRTVC  705



>emb|CBI29940.3| unnamed protein product [Vitis vinifera]
Length=593

 Score =   288 bits (738),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 148/156 (95%), Positives = 154/156 (99%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR
Sbjct  438  NYYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  497

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+GY++QVVELDFLYPSEGIHRRWE GYRITSMAAT DQAAFILSIP+RKMMD
Sbjct  498  WGVVMSRNSGYTDQVVELDFLYPSEGIHRRWECGYRITSMAATNDQAAFILSIPKRKMMD  557

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTSAFPSTHVKEKWSKNLYIA+ICYGRTVC
Sbjct  558  ETQETLRTSAFPSTHVKEKWSKNLYIAAICYGRTVC  593


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 67/122 (55%), Gaps = 5/122 (4%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IH  435
            Y V++S   + + K  ++G H++ + ++ + W ++M    GYS QV EL  ++  +  I 
Sbjct  373  YNVADSRLPQHVEKGNEDGLHISCVASSSNLWALIMDAGTGYSSQVYELSAVFLHKDWIM  432

Query  434  RRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIA  258
             +WE  Y I+S+A  A+ ++ ++     K    TQ++ + S +FP   + +KW +  ++ 
Sbjct  433  EQWEKNYYISSIAGAANGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVT  489

Query  257  SI  252
            S+
Sbjct  490  SM  491



>gb|AAF00624.1|AC009540_1 unknown protein, 5' partial [Arabidopsis thaliana]
Length=494

 Score =   285 bits (730),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 146/156 (94%), Positives = 153/156 (98%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGA NGSSLVVM+KGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTTAGSR
Sbjct  339  NYYISSIAGANNGSSLVVMAKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTTAGSR  398

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+GYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAA ILSIP+RK+ D
Sbjct  399  WGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAALILSIPKRKITD  458

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTVC
Sbjct  459  ETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC  494



>ref|XP_010036218.1| PREDICTED: uncharacterized protein LOC104425268 [Eucalyptus grandis]
 ref|XP_010036219.1| PREDICTED: uncharacterized protein LOC104425268 [Eucalyptus grandis]
 ref|XP_010036220.1| PREDICTED: uncharacterized protein LOC104425268 [Eucalyptus grandis]
 ref|XP_010036222.1| PREDICTED: uncharacterized protein LOC104425268 [Eucalyptus grandis]
 gb|KCW47748.1| hypothetical protein EUGRSUZ_K01498 [Eucalyptus grandis]
 gb|KCW47749.1| hypothetical protein EUGRSUZ_K01498 [Eucalyptus grandis]
 gb|KCW47750.1| hypothetical protein EUGRSUZ_K01498 [Eucalyptus grandis]
Length=702

 Score =   291 bits (744),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 148/156 (95%), Positives = 156/156 (100%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGA+NGSSLVVMSKGTPYTQQSYKVSE+FPFKWINKKWKEGFHVTSMTTAGSR
Sbjct  547  NYYISSIAGASNGSSLVVMSKGTPYTQQSYKVSEAFPFKWINKKWKEGFHVTSMTTAGSR  606

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+G+S+QVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIP+RK+MD
Sbjct  607  WGVVMSRNSGFSDQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPKRKVMD  666

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  667  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  702


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/122 (24%), Positives = 66/122 (54%), Gaps = 5/122 (4%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IH  435
            Y V+++   + + K  ++G  ++ + ++ + W ++M    G+S QV EL  ++  +  I 
Sbjct  482  YNVADTRLNQHVEKGNEDGLFISCVASSSNLWALIMDAGTGFSSQVYELSAVFLHKDWIM  541

Query  434  RRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIA  258
             +WE  Y I+S+A  ++ ++ ++     K    TQ++ + S AFP   + +KW +  ++ 
Sbjct  542  EQWERNYYISSIAGASNGSSLVV---MSKGTPYTQQSYKVSEAFPFKWINKKWKEGFHVT  598

Query  257  SI  252
            S+
Sbjct  599  SM  600



>ref|XP_004288418.1| PREDICTED: uncharacterized protein LOC101290807 [Fragaria vesca 
subsp. vesca]
Length=692

 Score =   290 bits (743),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 147/156 (94%), Positives = 155/156 (99%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            NFYISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAG+R
Sbjct  537  NFYISSIAGANNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGNR  596

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRNAG+S+QVVELDFLYPSEGIHRRWESGYRITSMAAT+DQAAFILSIP+RK+MD
Sbjct  597  WGVVMSRNAGFSDQVVELDFLYPSEGIHRRWESGYRITSMAATSDQAAFILSIPKRKLMD  656

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTSAFPS+HVKEKWSKNLYIASIC+GRTVC
Sbjct  657  ETQETLRTSAFPSSHVKEKWSKNLYIASICFGRTVC  692


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 69/123 (56%), Gaps = 7/123 (6%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V++S   + ++K  ++G +++S+ +A + W ++M    G+S QV EL   FL+  + I
Sbjct  472  YNVADSRLRQHVDKGNEDGLYISSVASAANLWALIMDAGTGFSSQVYELSAVFLH-KDWI  530

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +W+  + I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  531  MEQWDKNFYISSIAGANNGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHV  587

Query  260  ASI  252
             S+
Sbjct  588  TSM  590



>ref|XP_003548750.1| PREDICTED: uncharacterized protein LOC100801967 isoform X1 [Glycine 
max]
 ref|XP_006598981.1| PREDICTED: uncharacterized protein LOC100801967 isoform X2 [Glycine 
max]
 gb|KHN46781.1| Casein kinase I like hhp1 [Glycine soja]
Length=709

 Score =   291 bits (744),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 147/156 (94%), Positives = 155/156 (99%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR
Sbjct  554  NYYISSIAGAVNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  613

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRNAGYS+QVVELDFLYPSEGIHRRWE+GYRITSMAAT+DQAAFILSIP+RK++D
Sbjct  614  WGVVMSRNAGYSDQVVELDFLYPSEGIHRRWENGYRITSMAATSDQAAFILSIPKRKLLD  673

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTVC
Sbjct  674  ETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC  709


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 68/123 (55%), Gaps = 7/123 (6%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V+++   + ++K  ++G +++ + +A + W ++M    G+S QV EL   FL+  + I
Sbjct  489  YNVADTRLRQHVDKGIEDGLYISCVASAANLWALIMDAGTGFSSQVYELSPAFLH-KDWI  547

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  Y I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  548  MEQWEKNYYISSIAGAVNGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHV  604

Query  260  ASI  252
             S+
Sbjct  605  TSM  607



>ref|XP_008240478.1| PREDICTED: uncharacterized protein LOC103338977 [Prunus mume]
Length=707

 Score =   290 bits (742),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 148/156 (95%), Positives = 153/156 (98%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            NFYISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAG R
Sbjct  552  NFYISSIAGANNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGIR  611

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRNAGYS+QVVELDFLYPSEGIHRRWESGYRITSMAAT DQAAFILSIP+RK+MD
Sbjct  612  WGVVMSRNAGYSDQVVELDFLYPSEGIHRRWESGYRITSMAATTDQAAFILSIPKRKLMD  671

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTSAFPS+HVKEKWSKNLYIASIC+GRTVC
Sbjct  672  ETQETLRTSAFPSSHVKEKWSKNLYIASICHGRTVC  707


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 68/123 (55%), Gaps = 7/123 (6%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V+++   + ++K  ++G  ++S+ +A + W ++M    G+S QV EL   FL+  + I
Sbjct  487  YNVADTRLSQHVDKGNEDGLFISSVASASNLWALIMDAGTGFSSQVYELSTVFLH-KDWI  545

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  + I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  546  MEQWEKNFYISSIAGANNGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHV  602

Query  260  ASI  252
             S+
Sbjct  603  TSM  605



>gb|KJB45108.1| hypothetical protein B456_007G289500 [Gossypium raimondii]
Length=706

 Score =   290 bits (742),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 148/156 (95%), Positives = 153/156 (98%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR
Sbjct  551  NYYISSIAGANNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  610

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRNAG+S+QVVELDFLYPSEGIHRRWESGYRITSMAAT DQAAFILSIP+RK MD
Sbjct  611  WGVVMSRNAGFSDQVVELDFLYPSEGIHRRWESGYRITSMAATVDQAAFILSIPKRKTMD  670

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTVC
Sbjct  671  ETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC  706



>ref|XP_002281952.1| PREDICTED: uncharacterized protein LOC100267624 [Vitis vinifera]
 emb|CAN59733.1| hypothetical protein VITISV_003914 [Vitis vinifera]
Length=708

 Score =   289 bits (740),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 148/156 (95%), Positives = 154/156 (99%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR
Sbjct  553  NYYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  612

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+GY++QVVELDFLYPSEGIHRRWE GYRITSMAAT DQAAFILSIP+RKMMD
Sbjct  613  WGVVMSRNSGYTDQVVELDFLYPSEGIHRRWECGYRITSMAATNDQAAFILSIPKRKMMD  672

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTSAFPSTHVKEKWSKNLYIA+ICYGRTVC
Sbjct  673  ETQETLRTSAFPSTHVKEKWSKNLYIAAICYGRTVC  708


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/123 (28%), Positives = 68/123 (55%), Gaps = 7/123 (6%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V++S   + + K  ++G H++ + ++ + W ++M    GYS QV EL   FL+  + I
Sbjct  488  YNVADSRLPQHVEKGNEDGLHISCVASSSNLWALIMDAGTGYSSQVYELSAVFLH-KDWI  546

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  Y I+S+A  A+ ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  547  MEQWEKNYYISSIAGAANGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHV  603

Query  260  ASI  252
             S+
Sbjct  604  TSM  606



>ref|XP_004493152.1| PREDICTED: uncharacterized protein LOC101504885 isoform X1 [Cicer 
arietinum]
 ref|XP_004493153.1| PREDICTED: uncharacterized protein LOC101504885 isoform X2 [Cicer 
arietinum]
Length=708

 Score =   289 bits (740),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 147/156 (94%), Positives = 154/156 (99%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR
Sbjct  553  NYYISSIAGAVNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  612

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRNAGYS+QVVELDFLYPSEGIHRRWE+ YRITSMAAT+DQAAFILSIP+RK++D
Sbjct  613  WGVVMSRNAGYSDQVVELDFLYPSEGIHRRWENNYRITSMAATSDQAAFILSIPKRKLLD  672

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  673  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  708


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 68/123 (55%), Gaps = 7/123 (6%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V+++   + ++K  ++G +++ + ++ + W ++M    G+S QV EL   FL+  + I
Sbjct  488  YNVADNRLRQHVDKGIEDGLYISCVASSANLWALIMDAGTGFSSQVYELSPAFLH-KDWI  546

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  Y I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  547  MEQWEKNYYISSIAGAVNGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHV  603

Query  260  ASI  252
             S+
Sbjct  604  TSM  606



>ref|XP_003624626.1| Casein kinase I isoform alpha [Medicago truncatula]
 gb|AES80844.1| casein kinase I-like protein [Medicago truncatula]
Length=708

 Score =   288 bits (738),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 147/156 (94%), Positives = 153/156 (98%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR
Sbjct  553  NYYISSIAGAVNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  612

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRNAGYS+QVVELDFLYPSEGIHRRWE+ YRITSMAAT DQAAFILSIP+RK++D
Sbjct  613  WGVVMSRNAGYSDQVVELDFLYPSEGIHRRWENNYRITSMAATNDQAAFILSIPKRKLLD  672

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  673  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  708


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 68/123 (55%), Gaps = 7/123 (6%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V+++   + ++K  ++G +++ + ++ + W ++M    G+S QV EL   FL+  + I
Sbjct  488  YNVADNRLRQHVDKGIEDGLYISCVASSANLWALIMDAGTGFSSQVYELSPAFLH-KDWI  546

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  Y I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  547  MEQWEKNYYISSIAGAVNGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHV  603

Query  260  ASI  252
             S+
Sbjct  604  TSM  606



>ref|XP_010558719.1| PREDICTED: uncharacterized protein LOC104827271 isoform X1 [Tarenaya 
hassleriana]
Length=703

 Score =   288 bits (738),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 145/156 (93%), Positives = 154/156 (99%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGA NGSSLVVMSKGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTTAGSR
Sbjct  548  NYYISSIAGANNGSSLVVMSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTTAGSR  607

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+GYS+QVVELDFLYPSEGIHRRWE GYRITSMAATADQAAFILSIP+RKM+D
Sbjct  608  WGVVMSRNSGYSDQVVELDFLYPSEGIHRRWEGGYRITSMAATADQAAFILSIPKRKMLD  667

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRT+AFPSTHVK+KW+KNLYIASICYGRTVC
Sbjct  668  ETQETLRTTAFPSTHVKDKWAKNLYIASICYGRTVC  703



>emb|CDY29971.1| BnaC01g40370D [Brassica napus]
Length=703

 Score =   288 bits (738),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 146/156 (94%), Positives = 153/156 (98%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            NFYISSIAGA NGSSLVVMSKGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTTAGSR
Sbjct  548  NFYISSIAGANNGSSLVVMSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTTAGSR  607

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+GYSEQVVELDFLYPSEGIHRRWESG+RITSMAATADQAA ILSIP+RK+ D
Sbjct  608  WGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGFRITSMAATADQAALILSIPKRKITD  667

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTSAFPSTHVKEKW+KNLY+ASICYGRTVC
Sbjct  668  ETQETLRTSAFPSTHVKEKWTKNLYLASICYGRTVC  703


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 66/123 (54%), Gaps = 7/123 (6%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V+E+   K + K  ++G  ++ + +A + W ++M    G+S QV EL   FL+  + I
Sbjct  483  YNVAETRLQKHVEKGTEDGLFISCVASAANLWALIMDAGTGFSSQVYELSTVFLH-KDWI  541

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  + I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  542  MEQWEKNFYISSIAGANNGSSLVV---MSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHV  598

Query  260  ASI  252
             S+
Sbjct  599  TSM  601



>gb|ADE75678.1| unknown [Picea sitchensis]
Length=260

 Score =   275 bits (703),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 138/155 (89%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            NFYIS+IAGA NGSSLVVMSKGTPYTQQSYKVS+SFPFKWI+KKWKEGF+VTSMTTAGSR
Sbjct  105  NFYISAIAGATNGSSLVVMSKGTPYTQQSYKVSDSFPFKWISKKWKEGFYVTSMTTAGSR  164

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRNAG+S+QVVELDFLYPSEGIHRRWE+GYRIT+ AAT DQAAFILS+P+RK+ D
Sbjct  165  WGVVMSRNAGFSDQVVELDFLYPSEGIHRRWENGYRITATAATCDQAAFILSVPKRKLTD  224

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPSTHVKEKWSKNLYIA++CYGRTV
Sbjct  225  ETQETLRTSAFPSTHVKEKWSKNLYIAAVCYGRTV  259



>ref|XP_010558720.1| PREDICTED: uncharacterized protein LOC104827271 isoform X2 [Tarenaya 
hassleriana]
Length=704

 Score =   288 bits (738),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 145/156 (93%), Positives = 154/156 (99%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGA NGSSLVVMSKGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTTAGSR
Sbjct  549  NYYISSIAGANNGSSLVVMSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTTAGSR  608

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+GYS+QVVELDFLYPSEGIHRRWE GYRITSMAATADQAAFILSIP+RKM+D
Sbjct  609  WGVVMSRNSGYSDQVVELDFLYPSEGIHRRWEGGYRITSMAATADQAAFILSIPKRKMLD  668

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRT+AFPSTHVK+KW+KNLYIASICYGRTVC
Sbjct  669  ETQETLRTTAFPSTHVKDKWAKNLYIASICYGRTVC  704



>ref|XP_007161937.1| hypothetical protein PHAVU_001G110300g [Phaseolus vulgaris]
 gb|ESW33931.1| hypothetical protein PHAVU_001G110300g [Phaseolus vulgaris]
Length=708

 Score =   288 bits (738),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 145/156 (93%), Positives = 155/156 (99%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR
Sbjct  553  NYYISSIAGAVNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  612

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+GYS+QVVE+DFLYPSEGIHRRWE+GYRITSMAAT+DQAAFILSIP+RK++D
Sbjct  613  WGVVMSRNSGYSDQVVEIDFLYPSEGIHRRWENGYRITSMAATSDQAAFILSIPKRKLLD  672

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTVC
Sbjct  673  ETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC  708


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/122 (23%), Positives = 66/122 (54%), Gaps = 5/122 (4%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IH  435
            Y V+++   + ++K  ++G +++ + ++ + W ++M    G+S QV EL   +  +  I 
Sbjct  488  YNVADTRLRQHVDKGIEDGLYISCVASSANLWALIMDAGTGFSSQVYELSLAFLHKDWIM  547

Query  434  RRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIA  258
             +WE  Y I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++ 
Sbjct  548  EQWEKNYYISSIAGAVNGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVT  604

Query  257  SI  252
            S+
Sbjct  605  SM  606



>ref|NP_187044.1| protein kinase family protein [Arabidopsis thaliana]
 gb|AAF05853.1|AC011698_4 putative casein kinase [Arabidopsis thaliana]
 gb|AEE74014.1| protein kinase family protein [Arabidopsis thaliana]
Length=701

 Score =   288 bits (737),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 146/156 (94%), Positives = 153/156 (98%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGA NGSSLVVM+KGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTTAGSR
Sbjct  546  NYYISSIAGANNGSSLVVMAKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTTAGSR  605

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+GYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAA ILSIP+RK+ D
Sbjct  606  WGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAALILSIPKRKITD  665

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTVC
Sbjct  666  ETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC  701



>ref|XP_006408240.1| hypothetical protein EUTSA_v10020173mg [Eutrema salsugineum]
 gb|ESQ49693.1| hypothetical protein EUTSA_v10020173mg [Eutrema salsugineum]
Length=701

 Score =   288 bits (736),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 145/156 (93%), Positives = 153/156 (98%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAG+ NGSSLVVMSKGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTTAGSR
Sbjct  546  NYYISSIAGSNNGSSLVVMSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTTAGSR  605

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+GYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAA ILSIP+RK+ D
Sbjct  606  WGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAALILSIPKRKISD  665

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTSAFPSTHVK+KW+KNLYIASICYGRTVC
Sbjct  666  ETQETLRTSAFPSTHVKDKWAKNLYIASICYGRTVC  701


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 67/123 (54%), Gaps = 7/123 (6%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y VS++   + + K  ++G  ++ + +A + W ++M    G+S QV EL   FL+  + I
Sbjct  481  YNVSDTRLHQHVEKGNEDGLFISCVASAANLWALIMDAGTGFSSQVYELSTVFLH-KDWI  539

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  Y I+S+A + + ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  540  MEQWEKNYYISSIAGSNNGSSLVV---MSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHV  596

Query  260  ASI  252
             S+
Sbjct  597  TSM  599



>ref|XP_006297091.1| hypothetical protein CARUB_v10013094mg [Capsella rubella]
 gb|EOA29989.1| hypothetical protein CARUB_v10013094mg [Capsella rubella]
Length=701

 Score =   288 bits (736),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 146/156 (94%), Positives = 153/156 (98%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGA NGSSLVVM+KGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTTAGSR
Sbjct  546  NYYISSIAGANNGSSLVVMAKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTTAGSR  605

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+GYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAA ILSIP+RK+ D
Sbjct  606  WGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAALILSIPKRKITD  665

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTVC
Sbjct  666  ETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC  701


 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 66/123 (54%), Gaps = 7/123 (6%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V++S   + + K  ++G  ++ + +A + W ++M    G+S QV EL   FL+  + I
Sbjct  481  YNVADSRLHQHVEKGNEDGLFISCVASAANLWAIIMDAGTGFSSQVYELSSVFLH-KDWI  539

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  Y I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  540  MEQWEKNYYISSIAGANNGSSLVVMA---KGTPYTQQSYKVSDSFPFKWINKKWKEGFHV  596

Query  260  ASI  252
             S+
Sbjct  597  TSM  599



>gb|KHG27523.1| hypothetical protein F383_15264 [Gossypium arboreum]
Length=706

 Score =   288 bits (736),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 146/156 (94%), Positives = 153/156 (98%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT+GSR
Sbjct  551  NYYISSIAGANNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTSGSR  610

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+G+S+QVVELDFLYPSEGIHRRWESGYRITSMAAT DQAAFILSIP+RK MD
Sbjct  611  WGVVMSRNSGFSDQVVELDFLYPSEGIHRRWESGYRITSMAATGDQAAFILSIPKRKTMD  670

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTVC
Sbjct  671  ETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC  706



>ref|XP_002884421.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60680.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=702

 Score =   288 bits (736),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 146/156 (94%), Positives = 153/156 (98%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGA NGSSLVVM+KGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTTAGSR
Sbjct  547  NYYISSIAGANNGSSLVVMAKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTTAGSR  606

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+GYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAA ILSIP+RK+ D
Sbjct  607  WGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAALILSIPKRKITD  666

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTVC
Sbjct  667  ETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC  702


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 66/123 (54%), Gaps = 7/123 (6%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V++S   + + K  ++G  ++ + +A + W ++M    G+S QV EL   FL+  + I
Sbjct  482  YNVADSRLAQHVEKGNEDGLFISCVASAANLWAIIMDAGTGFSSQVYELSSVFLH-KDWI  540

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  Y I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  541  MEQWEKNYYISSIAGANNGSSLVVMA---KGTPYTQQSYKVSDSFPFKWINKKWKEGFHV  597

Query  260  ASI  252
             S+
Sbjct  598  TSM  600



>gb|KHG17118.1| Casein kinase I isoform delta [Gossypium arboreum]
 gb|KHG17119.1| Casein kinase I isoform delta [Gossypium arboreum]
Length=706

 Score =   287 bits (735),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 147/156 (94%), Positives = 152/156 (97%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTA SR
Sbjct  551  NYYISSIAGANNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAASR  610

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRNAG+S+QVVELDFLYPSEGIHRRWESGYRITSMAAT DQAAFILSIP+RK MD
Sbjct  611  WGVVMSRNAGFSDQVVELDFLYPSEGIHRRWESGYRITSMAATVDQAAFILSIPKRKTMD  670

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTVC
Sbjct  671  ETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC  706


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/122 (25%), Positives = 65/122 (53%), Gaps = 5/122 (4%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IH  435
            Y V++S   + + K  ++G  ++ + +A + W ++M    G+S QV EL  ++  +  I 
Sbjct  486  YNVADSRLHQHVEKGNEDGLFISCVASAANLWALIMDAGTGFSSQVYELSAVFLHKDWIM  545

Query  434  RRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIA  258
             +WE  Y I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++ 
Sbjct  546  EQWERNYYISSIAGANNGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVT  602

Query  257  SI  252
            S+
Sbjct  603  SM  604



>emb|CDY21155.1| BnaA01g33860D [Brassica napus]
Length=704

 Score =   287 bits (735),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 145/156 (93%), Positives = 153/156 (98%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            NFYISSIAGA NGSSLVVMSKGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTTAGSR
Sbjct  549  NFYISSIAGANNGSSLVVMSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTTAGSR  608

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WG+VMSRN+GYSEQVVELDFLYPSEGIHRRWESG+RITSMAATADQAA ILSIP+RK+ D
Sbjct  609  WGIVMSRNSGYSEQVVELDFLYPSEGIHRRWESGFRITSMAATADQAALILSIPKRKITD  668

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTSAFPSTHVKEKW+KNLY+ASICYGRTVC
Sbjct  669  ETQETLRTSAFPSTHVKEKWTKNLYLASICYGRTVC  704


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 66/123 (54%), Gaps = 7/123 (6%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V+E+   K + K  ++G  ++ + +A + W ++M    G+S QV EL   FL+  + I
Sbjct  484  YNVAETRLQKHVEKGTEDGLFISCVASAANLWALIMDAGTGFSSQVYELSTVFLH-KDWI  542

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  + I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  543  MEQWEKNFYISSIAGANNGSSLVV---MSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHV  599

Query  260  ASI  252
             S+
Sbjct  600  TSM  602



>ref|XP_010276388.1| PREDICTED: uncharacterized protein LOC104611151 [Nelumbo nucifera]
 ref|XP_010276389.1| PREDICTED: uncharacterized protein LOC104611151 [Nelumbo nucifera]
 ref|XP_010276390.1| PREDICTED: uncharacterized protein LOC104611151 [Nelumbo nucifera]
 ref|XP_010276391.1| PREDICTED: uncharacterized protein LOC104611151 [Nelumbo nucifera]
Length=714

 Score =   288 bits (736),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 149/155 (96%), Positives = 153/155 (99%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR
Sbjct  559  NYYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  618

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+GYSEQVVELDFLYPSEGIHRRWESGYRITS AAT DQAAFILSIP+RK+MD
Sbjct  619  WGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITSTAATHDQAAFILSIPKRKLMD  678

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV
Sbjct  679  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  713



>gb|KJB82583.1| hypothetical protein B456_013G203000 [Gossypium raimondii]
Length=707

 Score =   287 bits (734),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 145/156 (93%), Positives = 154/156 (99%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGA NGSSLVVMSKGTPYTQQSYK+SESFPFKWINKKWKEGFHVTSMTTAGS 
Sbjct  552  NYYISSIAGANNGSSLVVMSKGTPYTQQSYKLSESFPFKWINKKWKEGFHVTSMTTAGSC  611

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+G+S+QVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIP+RKMMD
Sbjct  612  WGVVMSRNSGFSDQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPKRKMMD  671

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTSAFPSTHVK+KW+KNLY+ASICYGRTVC
Sbjct  672  ETQETLRTSAFPSTHVKDKWAKNLYLASICYGRTVC  707



>gb|KJB82579.1| hypothetical protein B456_013G203000 [Gossypium raimondii]
Length=706

 Score =   287 bits (734),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 145/156 (93%), Positives = 154/156 (99%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGA NGSSLVVMSKGTPYTQQSYK+SESFPFKWINKKWKEGFHVTSMTTAGS 
Sbjct  551  NYYISSIAGANNGSSLVVMSKGTPYTQQSYKLSESFPFKWINKKWKEGFHVTSMTTAGSC  610

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+G+S+QVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIP+RKMMD
Sbjct  611  WGVVMSRNSGFSDQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPKRKMMD  670

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTSAFPSTHVK+KW+KNLY+ASICYGRTVC
Sbjct  671  ETQETLRTSAFPSTHVKDKWAKNLYLASICYGRTVC  706



>ref|XP_010485760.1| PREDICTED: uncharacterized protein LOC104764028 isoform X1 [Camelina 
sativa]
 ref|XP_010485761.1| PREDICTED: uncharacterized protein LOC104764028 isoform X1 [Camelina 
sativa]
 ref|XP_010485762.1| PREDICTED: uncharacterized protein LOC104764028 isoform X1 [Camelina 
sativa]
Length=701

 Score =   287 bits (734),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 145/156 (93%), Positives = 153/156 (98%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGA NGSSLVVM+KGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTTAGSR
Sbjct  546  NYYISSIAGANNGSSLVVMAKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTTAGSR  605

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+GYSEQVVELDFLYPSEGIHRRWE+GYRITSMAATADQAA ILSIP+RK+ D
Sbjct  606  WGVVMSRNSGYSEQVVELDFLYPSEGIHRRWENGYRITSMAATADQAALILSIPKRKITD  665

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTVC
Sbjct  666  ETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC  701


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 66/123 (54%), Gaps = 7/123 (6%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V++S   + + K  ++G  ++ + +A + W ++M    G+S QV EL   FL+  + I
Sbjct  481  YNVADSRLHQHVEKGNEDGLFISCVASAANLWAIIMDAGTGFSSQVYELSSVFLH-KDWI  539

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  Y I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  540  MEQWEKNYYISSIAGANNGSSLVVMA---KGTPYTQQSYKVSDSFPFKWINKKWKEGFHV  596

Query  260  ASI  252
             S+
Sbjct  597  TSM  599



>ref|XP_010463863.1| PREDICTED: uncharacterized protein LOC104744499 [Camelina sativa]
Length=701

 Score =   286 bits (733),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 145/156 (93%), Positives = 153/156 (98%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGA NGSSLVVM+KGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTTAGSR
Sbjct  546  NYYISSIAGANNGSSLVVMAKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTTAGSR  605

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+GYSEQVVELDFLYPSEGIHRRWE+GYRITSMAATADQAA ILSIP+RK+ D
Sbjct  606  WGVVMSRNSGYSEQVVELDFLYPSEGIHRRWENGYRITSMAATADQAALILSIPKRKITD  665

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTVC
Sbjct  666  ETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC  701


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 66/123 (54%), Gaps = 7/123 (6%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V++S   + + K  ++G  ++ + +A + W ++M    G+S QV EL   FL+  + I
Sbjct  481  YNVADSRLHQHVEKGNEDGLFISCVASAANLWAIIMDAGTGFSSQVYELSSVFLH-KDWI  539

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  Y I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  540  MEQWEKNYYISSIAGANNGSSLVVMA---KGTPYTQQSYKVSDSFPFKWINKKWKEGFHV  596

Query  260  ASI  252
             S+
Sbjct  597  TSM  599



>gb|KHG04306.1| Casein kinase I-like protein [Gossypium arboreum]
Length=706

 Score =   287 bits (734),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 144/156 (92%), Positives = 154/156 (99%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGA NGSSLVVMSKGTPYTQQSYK+SESFPFKWINKKWKEGFHVTSMTTAGS 
Sbjct  551  NYYISSIAGATNGSSLVVMSKGTPYTQQSYKLSESFPFKWINKKWKEGFHVTSMTTAGSC  610

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+G+S+QVVELDFLYPSEGIHRRWESGYRITSMAATADQAAF+LSIP+RKMMD
Sbjct  611  WGVVMSRNSGFSDQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFVLSIPKRKMMD  670

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTSAFPSTHVKEKW+KNLY+AS+CYGRTVC
Sbjct  671  ETQETLRTSAFPSTHVKEKWAKNLYLASVCYGRTVC  706


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/131 (26%), Positives = 69/131 (53%), Gaps = 12/131 (9%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V++S   + + K  ++G  ++ + +A + W ++M    G+S QV EL   FL+  + I
Sbjct  486  YNVADSRLRQHVEKGNEDGLFISCVASAANLWALIMDAGTGFSSQVYELSTVFLH-KDWI  544

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  Y I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  545  MEQWEKNYYISSIAGATNGSSLVV---MSKGTPYTQQSYKLSESFPFKWINKKWKEGFHV  601

Query  260  ASI-----CYG  243
             S+     C+G
Sbjct  602  TSMTTAGSCWG  612



>ref|XP_010516062.1| PREDICTED: uncharacterized protein LOC104791759 isoform X1 [Camelina 
sativa]
Length=700

 Score =   286 bits (733),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 145/156 (93%), Positives = 153/156 (98%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGA NGSSLVVM+KGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTTAGSR
Sbjct  545  NYYISSIAGANNGSSLVVMAKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTTAGSR  604

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+GYSEQVVELDFLYPSEGIHRRWE+GYRITSMAATADQAA ILSIP+RK+ D
Sbjct  605  WGVVMSRNSGYSEQVVELDFLYPSEGIHRRWENGYRITSMAATADQAALILSIPKRKITD  664

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTVC
Sbjct  665  ETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC  700


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 66/123 (54%), Gaps = 7/123 (6%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V++S   + + K  ++G  ++ + +A + W ++M    G+S QV EL   FL+  + I
Sbjct  480  YNVADSRLHQHVEKGNEDGLFISCVASAANLWAIIMDAGTGFSSQVYELSSVFLH-KDWI  538

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  Y I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  539  MEQWEKNYYISSIAGANNGSSLVVMA---KGTPYTQQSYKVSDSFPFKWINKKWKEGFHV  595

Query  260  ASI  252
             S+
Sbjct  596  TSM  598



>emb|CDY42890.1| BnaC05g47610D [Brassica napus]
Length=700

 Score =   286 bits (733),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 144/156 (92%), Positives = 153/156 (98%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGA NGSSLVVMSKGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTTAGSR
Sbjct  545  NYYISSIAGANNGSSLVVMSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTTAGSR  604

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WG+VMSRN+GYSEQVVELDFLYPSEGIHRRWESG+RITSMAATADQAA ILSIP+RK+ D
Sbjct  605  WGIVMSRNSGYSEQVVELDFLYPSEGIHRRWESGFRITSMAATADQAALILSIPKRKLTD  664

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTSAFPSTH+KEKW+KNLYIASICYGRTVC
Sbjct  665  ETQETLRTSAFPSTHIKEKWAKNLYIASICYGRTVC  700


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 67/123 (54%), Gaps = 7/123 (6%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V+E+   + + K  ++G +++ + +A + W ++M    G+S QV EL   FL+  + I
Sbjct  480  YNVAETRLPQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYELSTVFLH-KDWI  538

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  Y I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  539  MEQWEKNYYISSIAGANNGSSLVV---MSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHV  595

Query  260  ASI  252
             S+
Sbjct  596  TSM  598



>gb|ABR25333.1| protein kinase family protein [Oryza sativa Indica Group]
Length=137

 Score =   269 bits (687),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 126/137 (92%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  641  SKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD  462
            SKGTPYTQQSYKVSESFP+KWINKKWKEGFHVTSM TAG+RWGVVMSRNAGYS QVVELD
Sbjct  1    SKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSMATAGNRWGVVMSRNAGYSHQVVELD  60

Query  461  FLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEK  282
            FLYPSEGIHRRWE+GYRITS AAT DQAAFILSIP+RK MDETQETLRTS+FPS HVKEK
Sbjct  61   FLYPSEGIHRRWETGYRITSTAATPDQAAFILSIPKRKPMDETQETLRTSSFPSNHVKEK  120

Query  281  WSKNLYIASICYGRTVC  231
            WSKNLYIASICYGRTVC
Sbjct  121  WSKNLYIASICYGRTVC  137



>gb|KJB80963.1| hypothetical protein B456_013G123300 [Gossypium raimondii]
 gb|KJB80964.1| hypothetical protein B456_013G123300 [Gossypium raimondii]
 gb|KJB80966.1| hypothetical protein B456_013G123300 [Gossypium raimondii]
Length=706

 Score =   286 bits (733),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 144/156 (92%), Positives = 153/156 (98%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT+GSR
Sbjct  551  NYYISSIAGANNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTSGSR  610

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+G+S+QVVELDFLYPSEGIHRRWE+GYRITSMAAT DQAAFILSIP+RK MD
Sbjct  611  WGVVMSRNSGFSDQVVELDFLYPSEGIHRRWENGYRITSMAATGDQAAFILSIPKRKTMD  670

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTVC
Sbjct  671  ETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTVC  706



>gb|KJB80965.1| hypothetical protein B456_013G123300 [Gossypium raimondii]
Length=707

 Score =   286 bits (732),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 144/156 (92%), Positives = 153/156 (98%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTT+GSR
Sbjct  552  NYYISSIAGANNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTSGSR  611

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+G+S+QVVELDFLYPSEGIHRRWE+GYRITSMAAT DQAAFILSIP+RK MD
Sbjct  612  WGVVMSRNSGFSDQVVELDFLYPSEGIHRRWENGYRITSMAATGDQAAFILSIPKRKTMD  671

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTVC
Sbjct  672  ETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTVC  707



>ref|XP_009102089.1| PREDICTED: uncharacterized protein LOC103828226 [Brassica rapa]
Length=704

 Score =   286 bits (731),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 144/156 (92%), Positives = 152/156 (97%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            NFYISSIAGA NGSS VVMSKGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTTAGSR
Sbjct  549  NFYISSIAGANNGSSFVVMSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTTAGSR  608

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WG+VMSRN+GYSEQVVELDFLYPSEGIHRRWESG+RITSMAATADQAA ILSIP+RK+ D
Sbjct  609  WGIVMSRNSGYSEQVVELDFLYPSEGIHRRWESGFRITSMAATADQAALILSIPKRKITD  668

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTSAFPSTHVKEKW+KNLY+ASICYGRTVC
Sbjct  669  ETQETLRTSAFPSTHVKEKWTKNLYLASICYGRTVC  704


 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/123 (27%), Positives = 67/123 (54%), Gaps = 7/123 (6%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V+E+   K + K  ++G  ++ + +A + W ++M    G+S QV EL   FL+  + I
Sbjct  484  YNVAETRLQKHVEKGTEDGLFISCVASAANLWALIMDAGTGFSSQVYELSTVFLH-KDWI  542

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  + I+S+A   + ++F++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  543  MEQWEKNFYISSIAGANNGSSFVV---MSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHV  599

Query  260  ASI  252
             S+
Sbjct  600  TSM  602



>ref|XP_010672054.1| PREDICTED: uncharacterized protein LOC104888715 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=713

 Score =   286 bits (732),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 144/156 (92%), Positives = 152/156 (97%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            NFYISSIAGA NG+SLVVMSKGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTTA SR
Sbjct  558  NFYISSIAGATNGASLVVMSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTTAASR  617

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRNAG+++QVVELDFLYPSEGIHRRWESGYRITSMAAT DQAAF+LSIP+RK MD
Sbjct  618  WGVVMSRNAGFTDQVVELDFLYPSEGIHRRWESGYRITSMAATPDQAAFVLSIPKRKTMD  677

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTVC
Sbjct  678  ETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC  713


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 68/123 (55%), Gaps = 7/123 (6%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V+++   + I+K  ++G +++ + +A + W ++M    G+S QV EL   FL+  + I
Sbjct  493  YNVADARLKQHIDKGNEDGLYISCVASATNLWALIMDAGTGFSCQVWELSNVFLH-KDWI  551

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  + I+S+A   + A+ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  552  MEQWEKNFYISSIAGATNGASLVV---MSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHV  608

Query  260  ASI  252
             S+
Sbjct  609  TSM  611



>ref|XP_009413883.1| PREDICTED: uncharacterized protein LOC103995100 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009413884.1| PREDICTED: uncharacterized protein LOC103995100 [Musa acuminata 
subsp. malaccensis]
Length=714

 Score =   286 bits (731),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 143/156 (92%), Positives = 150/156 (96%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YIS+IAG  NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAG R
Sbjct  559  NYYISAIAGTTNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGGR  618

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+GYS+QVVELDFLYPSEGIHRRWESGYRITS AAT DQAAFILSIP+RK+MD
Sbjct  619  WGVVMSRNSGYSDQVVELDFLYPSEGIHRRWESGYRITSTAATPDQAAFILSIPKRKLMD  678

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTSAFPS HVKEKW+KNLYIASICYGRTVC
Sbjct  679  ETQETLRTSAFPSNHVKEKWAKNLYIASICYGRTVC  714



>ref|XP_009130401.1| PREDICTED: uncharacterized protein LOC103855200 [Brassica rapa]
 ref|XP_009130402.1| PREDICTED: uncharacterized protein LOC103855200 [Brassica rapa]
 ref|XP_009130403.1| PREDICTED: uncharacterized protein LOC103855200 [Brassica rapa]
Length=695

 Score =   285 bits (730),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 144/156 (92%), Positives = 153/156 (98%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGA NGSSLVVMSKGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTTAGSR
Sbjct  540  NYYISSIAGANNGSSLVVMSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTTAGSR  599

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WG+VMSRN+GYSEQVVELDFLYPSEGIHRRWESG+RITSMAATADQAA ILSIP+RK+ D
Sbjct  600  WGIVMSRNSGYSEQVVELDFLYPSEGIHRRWESGFRITSMAATADQAALILSIPKRKITD  659

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTSAFPSTHVK+KW+KNLYIASICYGRTVC
Sbjct  660  ETQETLRTSAFPSTHVKDKWAKNLYIASICYGRTVC  695


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 67/123 (54%), Gaps = 7/123 (6%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V+E+   + + K  ++G +++ + +A + W ++M    G+S QV EL   FL+  + I
Sbjct  475  YNVAETRLPQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYELSTVFLH-KDWI  533

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  Y I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  534  MEQWEKNYYISSIAGANNGSSLVV---MSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHV  590

Query  260  ASI  252
             S+
Sbjct  591  TSM  593



>ref|XP_010908708.1| PREDICTED: uncharacterized protein LOC105035016 [Elaeis guineensis]
Length=718

 Score =   285 bits (728),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 143/156 (92%), Positives = 152/156 (97%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YIS+IAGA+NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVT MTTAGSR
Sbjct  563  NYYISAIAGASNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTCMTTAGSR  622

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+GYS+QVVELDFLYPSEGIHRRWE+GYRITS AAT DQAAFILSIP+RK+MD
Sbjct  623  WGVVMSRNSGYSDQVVELDFLYPSEGIHRRWENGYRITSTAATPDQAAFILSIPKRKLMD  682

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTSAFPS HVKEKW+KNLYIASICYGRTVC
Sbjct  683  ETQETLRTSAFPSNHVKEKWAKNLYIASICYGRTVC  718



>gb|EEC71557.1| hypothetical protein OsI_03913 [Oryza sativa Indica Group]
Length=647

 Score =   282 bits (722),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 143/155 (92%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YIS+IAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR
Sbjct  492  NYYISAIAGATNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  551

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+G+SEQVVELDFLYPSEGIHRRWE+GYRITS AAT DQAAFILSIP+RK+MD
Sbjct  552  WGVVMSRNSGFSEQVVELDFLYPSEGIHRRWENGYRITSTAATGDQAAFILSIPKRKLMD  611

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPS HVKEKW+KNLYIASICYGRTV
Sbjct  612  ETQETLRTSAFPSNHVKEKWAKNLYIASICYGRTV  646



>ref|XP_008805378.1| PREDICTED: uncharacterized protein LOC103718369 [Phoenix dactylifera]
 ref|XP_008805379.1| PREDICTED: uncharacterized protein LOC103718369 [Phoenix dactylifera]
Length=718

 Score =   284 bits (726),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 143/156 (92%), Positives = 152/156 (97%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YIS+IAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVT MTTAGSR
Sbjct  563  NYYISAIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTCMTTAGSR  622

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+GYS+QVVELDFLYPSEGIHRRWE+GYRITS AAT DQAAFILSIP+RK+MD
Sbjct  623  WGVVMSRNSGYSDQVVELDFLYPSEGIHRRWENGYRITSTAATPDQAAFILSIPKRKLMD  682

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTSAFPS HVK+KW+KNLYIASICYGRTVC
Sbjct  683  ETQETLRTSAFPSNHVKDKWAKNLYIASICYGRTVC  718



>ref|XP_010257690.1| PREDICTED: uncharacterized protein LOC104597684 [Nelumbo nucifera]
Length=708

 Score =   283 bits (725),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 145/155 (94%), Positives = 152/155 (98%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM TAG+R
Sbjct  553  NYYISSIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMATAGNR  612

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+GYS+QVVELDFLYPSEGIH+RWESGYRITS AAT DQAAFILSIP+RK+MD
Sbjct  613  WGVVMSRNSGYSDQVVELDFLYPSEGIHKRWESGYRITSTAATVDQAAFILSIPKRKLMD  672

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV
Sbjct  673  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  707



>gb|ABF99312.1| protein kinase family protein, putative, expressed [Oryza sativa 
Japonica Group]
Length=522

 Score =   278 bits (712),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 141/156 (90%), Positives = 149/156 (96%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YI++IAGA NGSSLVVMSKGTPYTQQSYKVSESFP+KWINKKWKEGFHVTSM TAG+R
Sbjct  367  NYYITAIAGATNGSSLVVMSKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSMATAGNR  426

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRNAGYS QVVELDFLYPSEGIHRRWE+GYRITS AAT DQAAFILSIP+RK MD
Sbjct  427  WGVVMSRNAGYSHQVVELDFLYPSEGIHRRWETGYRITSTAATPDQAAFILSIPKRKPMD  486

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTS+FPS HVKEKWSKNLYIASICYGRTVC
Sbjct  487  ETQETLRTSSFPSNHVKEKWSKNLYIASICYGRTVC  522



>ref|NP_001044393.1| Os01g0772600 [Oryza sativa Japonica Group]
 dbj|BAB89852.1| putative serine/threonine protein kinase [Oryza sativa Japonica 
Group]
 dbj|BAF06307.1| Os01g0772600 [Oryza sativa Japonica Group]
 dbj|BAH00219.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE55461.1| hypothetical protein OsJ_03624 [Oryza sativa Japonica Group]
Length=698

 Score =   283 bits (724),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 143/155 (92%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YIS+IAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR
Sbjct  543  NYYISAIAGATNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  602

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+G+SEQVVELDFLYPSEGIHRRWE+GYRITS AAT DQAAFILSIP+RK+MD
Sbjct  603  WGVVMSRNSGFSEQVVELDFLYPSEGIHRRWENGYRITSTAATGDQAAFILSIPKRKLMD  662

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPS HVKEKW+KNLYIASICYGRTV
Sbjct  663  ETQETLRTSAFPSNHVKEKWAKNLYIASICYGRTV  697



>ref|XP_009418951.1| PREDICTED: uncharacterized protein LOC103999040 isoform X2 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009418952.1| PREDICTED: uncharacterized protein LOC103999040 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=716

 Score =   283 bits (725),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 140/156 (90%), Positives = 151/156 (97%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YIS++AGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR
Sbjct  561  NYYISAVAGATNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  620

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WG+VMSRN+GYS+QVVELDFLYPSEGIHRRWESGYRITS AAT DQAAFILS+P+RK+MD
Sbjct  621  WGIVMSRNSGYSDQVVELDFLYPSEGIHRRWESGYRITSTAATPDQAAFILSVPKRKLMD  680

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTS FPS HVK+KW+KNLYIASICYGRTVC
Sbjct  681  ETQETLRTSTFPSNHVKDKWAKNLYIASICYGRTVC  716


 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 67/123 (54%), Gaps = 7/123 (6%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V+++   + I K  ++G +++ + ++ + W ++M    G+S QV EL   FL+  + I
Sbjct  496  YNVADARLQQHIVKGMEDGLYISCVASSANLWALIMDAGTGFSSQVYELSPMFLH-KDWI  554

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  Y I+++A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  555  MEQWEKNYYISAVAGATNGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHV  611

Query  260  ASI  252
             S+
Sbjct  612  TSM  614



>ref|XP_006400366.1| hypothetical protein EUTSA_v10012841mg [Eutrema salsugineum]
 gb|ESQ41819.1| hypothetical protein EUTSA_v10012841mg [Eutrema salsugineum]
Length=695

 Score =   283 bits (723),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 143/156 (92%), Positives = 153/156 (98%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKWKE FHVTSMTTAG+R
Sbjct  540  NYYISSIAGADNGSSLVVMSKGTSYTQQSYKVSDSFPFKWINKKWKEDFHVTSMTTAGNR  599

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+G+SEQVVELDFLYPS+GIHRRWESGYRITSMAATADQAAFILSIP+RKMMD
Sbjct  600  WGVVMSRNSGFSEQVVELDFLYPSDGIHRRWESGYRITSMAATADQAAFILSIPKRKMMD  659

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRT+AFPSTHVK+KW+KNLYIASICYGRTVC
Sbjct  660  ETQETLRTTAFPSTHVKDKWAKNLYIASICYGRTVC  695



>dbj|BAJ90552.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96313.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=694

 Score =   283 bits (723),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 143/155 (92%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YIS+IAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAG+R
Sbjct  539  NYYISAIAGATNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGTR  598

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+GYSEQVVELDFLYPSEGIHRRWE+GYRITS AAT DQAAFILSIP+RK+MD
Sbjct  599  WGVVMSRNSGYSEQVVELDFLYPSEGIHRRWENGYRITSTAATGDQAAFILSIPKRKLMD  658

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPS HVKEKW+KNLYIASICYGRTV
Sbjct  659  ETQETLRTSAFPSNHVKEKWAKNLYIASICYGRTV  693



>ref|XP_003569928.1| PREDICTED: uncharacterized protein LOC100845295 [Brachypodium 
distachyon]
Length=698

 Score =   282 bits (722),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 132/140 (94%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRN+GYSEQV
Sbjct  558  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNSGYSEQV  617

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRWE+GYRITS AAT DQAAFILSIP+RK+MDETQETLRTSAFPS H
Sbjct  618  VELDFLYPSEGIHRRWENGYRITSTAATGDQAAFILSIPKRKLMDETQETLRTSAFPSNH  677

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW+KNLYIASICYGRTV
Sbjct  678  VKEKWAKNLYIASICYGRTV  697



>ref|NP_197320.1| protein kinase [Arabidopsis thaliana]
 dbj|BAB09477.1| casein kinase-like protein [Arabidopsis thaliana]
 gb|AED92517.1| protein kinase [Arabidopsis thaliana]
Length=691

 Score =   282 bits (721),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 140/156 (90%), Positives = 153/156 (98%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAG+ NG+SLVVMSKGT YTQQSYKVS+SFPFKWINKKWKE FHVTSMTTAG+R
Sbjct  536  NYYISSIAGSDNGNSLVVMSKGTSYTQQSYKVSDSFPFKWINKKWKEDFHVTSMTTAGNR  595

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+GYS+QVVELDFLYPS+GIHRRWESGYRITSMAATADQAAFILS+P+RKMMD
Sbjct  596  WGVVMSRNSGYSDQVVELDFLYPSDGIHRRWESGYRITSMAATADQAAFILSVPKRKMMD  655

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRT+AFPSTHVKEKW+KNLYIASIC+GRTVC
Sbjct  656  ETQETLRTTAFPSTHVKEKWAKNLYIASICFGRTVC  691



>ref|XP_009418950.1| PREDICTED: uncharacterized protein LOC103999040 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=751

 Score =   283 bits (725),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 140/156 (90%), Positives = 151/156 (97%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YIS++AGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR
Sbjct  596  NYYISAVAGATNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  655

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WG+VMSRN+GYS+QVVELDFLYPSEGIHRRWESGYRITS AAT DQAAFILS+P+RK+MD
Sbjct  656  WGIVMSRNSGYSDQVVELDFLYPSEGIHRRWESGYRITSTAATPDQAAFILSVPKRKLMD  715

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTS FPS HVK+KW+KNLYIASICYGRTVC
Sbjct  716  ETQETLRTSTFPSNHVKDKWAKNLYIASICYGRTVC  751


 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 28/122 (23%), Positives = 66/122 (54%), Gaps = 5/122 (4%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELDFLYPSEG-IH  435
            Y V+++   + I K  ++G +++ + ++ + W ++M    G+S QV EL  ++  +  I 
Sbjct  531  YNVADARLQQHIVKGMEDGLYISCVASSANLWALIMDAGTGFSSQVYELSPMFLHKDWIM  590

Query  434  RRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIA  258
             +WE  Y I+++A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++ 
Sbjct  591  EQWEKNYYISAVAGATNGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVT  647

Query  257  SI  252
            S+
Sbjct  648  SM  649



>ref|XP_006644782.1| PREDICTED: uncharacterized protein LOC102714869 [Oryza brachyantha]
Length=701

 Score =   282 bits (721),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 142/155 (92%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YIS+IAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR
Sbjct  546  NYYISAIAGATNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  605

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+G+SEQVVELDFLYPSEGIHRRWE+GYRITS AAT DQAAFILSIP+RK+MD
Sbjct  606  WGVVMSRNSGFSEQVVELDFLYPSEGIHRRWENGYRITSTAATGDQAAFILSIPKRKLMD  665

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPS HVK+KW+KNLYIASICYGRTV
Sbjct  666  ETQETLRTSAFPSNHVKDKWAKNLYIASICYGRTV  700



>ref|XP_010492820.1| PREDICTED: uncharacterized protein LOC104770147 [Camelina sativa]
 ref|XP_010492821.1| PREDICTED: uncharacterized protein LOC104770147 [Camelina sativa]
Length=692

 Score =   281 bits (720),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 140/156 (90%), Positives = 153/156 (98%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAG+ NGSSLV+MSKGT YTQQSYKVS+SFPFKWINKKWKE FHVTSMTTAG+R
Sbjct  537  NYYISSIAGSDNGSSLVIMSKGTSYTQQSYKVSDSFPFKWINKKWKEDFHVTSMTTAGNR  596

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+GYS+QVVELDFLYPS+GIHRRWESGYRITSMAATADQAAFILS+P+RKMMD
Sbjct  597  WGVVMSRNSGYSDQVVELDFLYPSDGIHRRWESGYRITSMAATADQAAFILSVPKRKMMD  656

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRT+AFPSTHVKEKW+KNLYIASIC+GRTVC
Sbjct  657  ETQETLRTTAFPSTHVKEKWAKNLYIASICFGRTVC  692



>emb|CDY38493.1| BnaA10g16650D [Brassica napus]
Length=690

 Score =   281 bits (720),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 142/156 (91%), Positives = 153/156 (98%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKWKE FHVTSMTTAG+R
Sbjct  535  NYYISSIAGADNGSSLVVMSKGTTYTQQSYKVSDSFPFKWINKKWKEDFHVTSMTTAGNR  594

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+G+S+QVVELDFLYPS+GIHRRWESGYRITSMAATADQAAFILSIP+RKMMD
Sbjct  595  WGVVMSRNSGFSDQVVELDFLYPSDGIHRRWESGYRITSMAATADQAAFILSIPKRKMMD  654

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRT+AFPSTHVKEKW+KNLYIAS+CYGRTVC
Sbjct  655  ETQETLRTTAFPSTHVKEKWAKNLYIASVCYGRTVC  690



>emb|CDY25451.1| BnaC09g39660D [Brassica napus]
Length=690

 Score =   281 bits (720),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 142/156 (91%), Positives = 153/156 (98%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKWKE FHVTSMTTAG+R
Sbjct  535  NYYISSIAGADNGSSLVVMSKGTTYTQQSYKVSDSFPFKWINKKWKEDFHVTSMTTAGNR  594

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+G+S+QVVELDFLYPS+GIHRRWESGYRITSMAATADQAAFILSIP+RKMMD
Sbjct  595  WGVVMSRNSGFSDQVVELDFLYPSDGIHRRWESGYRITSMAATADQAAFILSIPKRKMMD  654

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRT+AFPSTHVKEKW+KNLYIAS+CYGRTVC
Sbjct  655  ETQETLRTTAFPSTHVKEKWAKNLYIASVCYGRTVC  690



>ref|XP_010424160.1| PREDICTED: uncharacterized protein LOC104709208 [Camelina sativa]
Length=647

 Score =   280 bits (717),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 139/156 (89%), Positives = 153/156 (98%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAG+ NGSSLV+MSKGT YTQQSYKVS+SFPFKWINKKWKE FHVTSMTTAG+R
Sbjct  492  NYYISSIAGSDNGSSLVIMSKGTSYTQQSYKVSDSFPFKWINKKWKEDFHVTSMTTAGNR  551

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+G+S+QVVELDFLYPS+GIHRRWESGYRITSMAATADQAAFILS+P+RKMMD
Sbjct  552  WGVVMSRNSGFSDQVVELDFLYPSDGIHRRWESGYRITSMAATADQAAFILSVPKRKMMD  611

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRT+AFPSTHVKEKW+KNLYIASIC+GRTVC
Sbjct  612  ETQETLRTTAFPSTHVKEKWAKNLYIASICFGRTVC  647



>ref|XP_004970128.1| PREDICTED: uncharacterized protein LOC101772174 [Setaria italica]
Length=697

 Score =   281 bits (719),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 142/155 (92%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YIS+IAGA NGSSLVVMSKGTPYTQQSYKVSESFP+KWINKKWKEGFHVTSMTTAGSR
Sbjct  542  NYYISAIAGATNGSSLVVMSKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSMTTAGSR  601

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+GYSEQVVELDFLYPSEGIHRRWE+GYRITS AAT DQAAFILSIP+RK+MD
Sbjct  602  WGVVMSRNSGYSEQVVELDFLYPSEGIHRRWENGYRITSTAATGDQAAFILSIPKRKLMD  661

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPS HVKEKW+KNLYIASIC+GRTV
Sbjct  662  ETQETLRTSAFPSNHVKEKWAKNLYIASICFGRTV  696



>ref|XP_009121003.1| PREDICTED: uncharacterized protein LOC103845859 [Brassica rapa]
Length=691

 Score =   281 bits (718),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 141/156 (90%), Positives = 153/156 (98%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKWKE FH+TSMTTAG+R
Sbjct  536  NYYISSIAGADNGSSLVVMSKGTTYTQQSYKVSDSFPFKWINKKWKEDFHLTSMTTAGNR  595

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+G+S+QVVELDFLYPS+GIHRRWESGYRITSMAATADQAAFILSIP+RKMMD
Sbjct  596  WGVVMSRNSGFSDQVVELDFLYPSDGIHRRWESGYRITSMAATADQAAFILSIPKRKMMD  655

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRT+AFPSTHVKEKW+KNLYIAS+CYGRTVC
Sbjct  656  ETQETLRTTAFPSTHVKEKWAKNLYIASVCYGRTVC  691



>ref|XP_006287189.1| hypothetical protein CARUB_v10000361mg [Capsella rubella]
 gb|EOA20087.1| hypothetical protein CARUB_v10000361mg [Capsella rubella]
Length=692

 Score =   280 bits (717),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 140/156 (90%), Positives = 153/156 (98%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAG+ NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKWKE FHVTSMTTAG+R
Sbjct  537  NYYISSIAGSDNGSSLVVMSKGTSYTQQSYKVSDSFPFKWINKKWKEDFHVTSMTTAGNR  596

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+G+S+QVVELDFLYPS+GIHRRWESGYRITSMAATADQAAFILS+P+RKMMD
Sbjct  597  WGVVMSRNSGFSDQVVELDFLYPSDGIHRRWESGYRITSMAATADQAAFILSVPKRKMMD  656

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRT+AFPSTHVKEKW+KNLYIASIC+GRTVC
Sbjct  657  ETQETLRTTAFPSTHVKEKWAKNLYIASICFGRTVC  692



>ref|XP_010454044.1| PREDICTED: uncharacterized protein LOC104735873 [Camelina sativa]
Length=692

 Score =   280 bits (717),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 139/156 (89%), Positives = 153/156 (98%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAG+ NGSSLV+MSKGT YTQQSYKVS+SFPFKWINKKWKE FHVTSMTTAG+R
Sbjct  537  NYYISSIAGSDNGSSLVIMSKGTSYTQQSYKVSDSFPFKWINKKWKEDFHVTSMTTAGNR  596

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+G+S+QVVELDFLYPS+GIHRRWESGYRITSMAATADQAAFILS+P+RKMMD
Sbjct  597  WGVVMSRNSGFSDQVVELDFLYPSDGIHRRWESGYRITSMAATADQAAFILSVPKRKMMD  656

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRT+AFPSTHVKEKW+KNLYIASIC+GRTVC
Sbjct  657  ETQETLRTTAFPSTHVKEKWAKNLYIASICFGRTVC  692



>ref|NP_001058996.1| Os07g0171300 [Oryza sativa Japonica Group]
 dbj|BAC83610.1| putative casein kinase 1, delta isoform 1 [Oryza sativa Japonica 
Group]
 dbj|BAF20910.1| Os07g0171300 [Oryza sativa Japonica Group]
 dbj|BAG89932.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC81591.1| hypothetical protein OsI_25061 [Oryza sativa Indica Group]
 gb|EEE66647.1| hypothetical protein OsJ_23261 [Oryza sativa Japonica Group]
Length=699

 Score =   280 bits (717),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 139/156 (89%), Positives = 152/156 (97%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            NFYI++IAG+ANGSSLVVMSKGTPY+QQSYKVSESFPFKWINKKWKEGFHVTSM TAG+R
Sbjct  544  NFYITAIAGSANGSSLVVMSKGTPYSQQSYKVSESFPFKWINKKWKEGFHVTSMATAGNR  603

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+GYSEQVVELDFLYPSEGIHRRWE+GYRITS+AAT DQAAFILSIP+RK +D
Sbjct  604  WGVVMSRNSGYSEQVVELDFLYPSEGIHRRWETGYRITSIAATNDQAAFILSIPKRKPVD  663

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTSAFPS HVK+KW+KNLYIASIC+GRTVC
Sbjct  664  ETQETLRTSAFPSNHVKDKWAKNLYIASICFGRTVC  699



>ref|XP_010485763.1| PREDICTED: uncharacterized protein LOC104764028 isoform X2 [Camelina 
sativa]
Length=700

 Score =   280 bits (717),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 144/156 (92%), Positives = 152/156 (97%), Gaps = 1/156 (1%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGA NGSSLVVM+KGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTTAGSR
Sbjct  546  NYYISSIAGANNGSSLVVMAKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTTAGSR  605

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+GYSEQVVELDFLYPSEGIHRRWE+GYRITSMAATADQAA ILSIP+RK+ D
Sbjct  606  WGVVMSRNSGYSEQVVELDFLYPSEGIHRRWENGYRITSMAATADQAALILSIPKRKITD  665

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTSAFPSTHVK KW+KNLYIASICYGRTVC
Sbjct  666  ETQETLRTSAFPSTHVK-KWAKNLYIASICYGRTVC  700


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 66/123 (54%), Gaps = 7/123 (6%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V++S   + + K  ++G  ++ + +A + W ++M    G+S QV EL   FL+  + I
Sbjct  481  YNVADSRLHQHVEKGNEDGLFISCVASAANLWAIIMDAGTGFSSQVYELSSVFLH-KDWI  539

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  Y I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  540  MEQWEKNYYISSIAGANNGSSLVVMA---KGTPYTQQSYKVSDSFPFKWINKKWKEGFHV  596

Query  260  ASI  252
             S+
Sbjct  597  TSM  599



>ref|XP_008655390.1| PREDICTED: uncharacterized protein LOC100502202 isoform X1 [Zea 
mays]
 gb|AFW84937.1| hypothetical protein ZEAMMB73_351651 [Zea mays]
Length=812

 Score =   283 bits (723),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 143/155 (92%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YIS+IAGA NGSSLVVMSKGTPYTQQSYKVSESFP+KWINKKWKEGFHVTSMTTAGSR
Sbjct  657  NYYISAIAGAMNGSSLVVMSKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSMTTAGSR  716

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+GYSEQVVELDFLYPSEGIHRRWE+GYRITS AAT DQAAFILSIP+RK+MD
Sbjct  717  WGVVMSRNSGYSEQVVELDFLYPSEGIHRRWENGYRITSTAATGDQAAFILSIPKRKLMD  776

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPS HVKEKW+KNLYIASICYGRTV
Sbjct  777  ETQETLRTSAFPSNHVKEKWAKNLYIASICYGRTV  811



>ref|XP_010516137.1| PREDICTED: uncharacterized protein LOC104791759 isoform X2 [Camelina 
sativa]
 ref|XP_010516215.1| PREDICTED: uncharacterized protein LOC104791759 isoform X3 [Camelina 
sativa]
Length=699

 Score =   280 bits (716),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 144/156 (92%), Positives = 152/156 (97%), Gaps = 1/156 (1%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGA NGSSLVVM+KGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTTAGSR
Sbjct  545  NYYISSIAGANNGSSLVVMAKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTTAGSR  604

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+GYSEQVVELDFLYPSEGIHRRWE+GYRITSMAATADQAA ILSIP+RK+ D
Sbjct  605  WGVVMSRNSGYSEQVVELDFLYPSEGIHRRWENGYRITSMAATADQAALILSIPKRKITD  664

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTSAFPSTHVK KW+KNLYIASICYGRTVC
Sbjct  665  ETQETLRTSAFPSTHVK-KWAKNLYIASICYGRTVC  699


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 66/123 (54%), Gaps = 7/123 (6%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V++S   + + K  ++G  ++ + +A + W ++M    G+S QV EL   FL+  + I
Sbjct  480  YNVADSRLHQHVEKGNEDGLFISCVASAANLWAIIMDAGTGFSSQVYELSSVFLH-KDWI  538

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  Y I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  539  MEQWEKNYYISSIAGANNGSSLVVMA---KGTPYTQQSYKVSDSFPFKWINKKWKEGFHV  595

Query  260  ASI  252
             S+
Sbjct  596  TSM  598



>dbj|BAN15568.1| heading date 16 [Oryza sativa Japonica Group]
Length=707

 Score =   280 bits (717),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 141/156 (90%), Positives = 149/156 (96%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YI++IAGA NGSSLVVMSKGTPYTQQSYKVSESFP+KWINKKWKEGFHVTSM TAG+R
Sbjct  552  NYYITAIAGATNGSSLVVMSKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSMATAGNR  611

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRNAGYS QVVELDFLYPSEGIHRRWE+GYRITS AAT DQAAFILSIP+RK MD
Sbjct  612  WGVVMSRNAGYSHQVVELDFLYPSEGIHRRWETGYRITSTAATPDQAAFILSIPKRKPMD  671

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTS+FPS HVKEKWSKNLYIASICYGRTVC
Sbjct  672  ETQETLRTSSFPSNHVKEKWSKNLYIASICYGRTVC  707



>gb|KHF98002.1| hypothetical protein F383_12939 [Gossypium arboreum]
Length=668

 Score =   279 bits (714),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 139/155 (90%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YI+S+AGA N SSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGF+VTSMTTAG+R
Sbjct  513  NYYITSVAGANNESSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFYVTSMTTAGTR  572

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRNAG+S+QVVELDFLYPSEGIHRRWESGYRITSMAAT DQAAFILSIP+RK  D
Sbjct  573  WGVVMSRNAGFSDQVVELDFLYPSEGIHRRWESGYRITSMAATVDQAAFILSIPKRKTTD  632

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            +TQETLRT+AFPSTHVKEKW+KNLYIASICYGRTV
Sbjct  633  DTQETLRTTAFPSTHVKEKWAKNLYIASICYGRTV  667



>ref|NP_001051531.1| Os03g0793500 [Oryza sativa Japonica Group]
 gb|AAO37965.1| putative serine/threonine protein kinase [Oryza sativa Japonica 
Group]
 gb|ABF99311.1| protein kinase family protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF13445.1| Os03g0793500 [Oryza sativa Japonica Group]
 gb|EAZ28883.1| hypothetical protein OsJ_12923 [Oryza sativa Japonica Group]
 dbj|BAH00578.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAN15567.1| heading date 16 [Oryza sativa Japonica Group]
Length=707

 Score =   280 bits (716),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 141/156 (90%), Positives = 149/156 (96%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YI++IAGA NGSSLVVMSKGTPYTQQSYKVSESFP+KWINKKWKEGFHVTSM TAG+R
Sbjct  552  NYYITAIAGATNGSSLVVMSKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSMATAGNR  611

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRNAGYS QVVELDFLYPSEGIHRRWE+GYRITS AAT DQAAFILSIP+RK MD
Sbjct  612  WGVVMSRNAGYSHQVVELDFLYPSEGIHRRWETGYRITSTAATPDQAAFILSIPKRKPMD  671

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTS+FPS HVKEKWSKNLYIASICYGRTVC
Sbjct  672  ETQETLRTSSFPSNHVKEKWSKNLYIASICYGRTVC  707



>gb|EAY92152.1| hypothetical protein OsI_13865 [Oryza sativa Indica Group]
Length=707

 Score =   280 bits (716),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 141/156 (90%), Positives = 149/156 (96%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YI++IAGA NGSSLVVMSKGTPYTQQSYKVSESFP+KWINKKWKEGFHVTSM TAG+R
Sbjct  552  NYYITAIAGATNGSSLVVMSKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSMATAGNR  611

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRNAGYS QVVELDFLYPSEGIHRRWE+GYRITS AAT DQAAFILSIP+RK MD
Sbjct  612  WGVVMSRNAGYSHQVVELDFLYPSEGIHRRWETGYRITSTAATPDQAAFILSIPKRKPMD  671

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTS+FPS HVKEKWSKNLYIASICYGRTVC
Sbjct  672  ETQETLRTSSFPSNHVKEKWSKNLYIASICYGRTVC  707



>ref|XP_006657490.1| PREDICTED: uncharacterized protein LOC102719500 [Oryza brachyantha]
Length=702

 Score =   280 bits (716),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 139/156 (89%), Positives = 150/156 (96%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            NFYI++IAG+ NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM TAG+R
Sbjct  547  NFYITAIAGSTNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMATAGNR  606

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+GYSEQVVELDFLYPSEGIHRRWE+GYRITS AAT DQAAFILSIP+RK +D
Sbjct  607  WGVVMSRNSGYSEQVVELDFLYPSEGIHRRWETGYRITSTAATNDQAAFILSIPKRKPVD  666

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTSAFPS HVK+KW+KNLYIASIC+GRTVC
Sbjct  667  ETQETLRTSAFPSNHVKDKWAKNLYIASICFGRTVC  702



>emb|CDY50866.1| BnaA05g37270D [Brassica napus]
Length=798

 Score =   281 bits (720),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 143/155 (92%), Positives = 152/155 (98%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGA NGSSLVVMSKGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTTAGSR
Sbjct  544  NYYISSIAGANNGSSLVVMSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTTAGSR  603

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WG+VMSRN+GYSEQVVELDFLYPSEGIHRRWESG+RITSMAATADQAA ILSIP+RK+ D
Sbjct  604  WGIVMSRNSGYSEQVVELDFLYPSEGIHRRWESGFRITSMAATADQAALILSIPKRKITD  663

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPSTHVK+KW+KNLYIASICYGRTV
Sbjct  664  ETQETLRTSAFPSTHVKDKWAKNLYIASICYGRTV  698


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 67/123 (54%), Gaps = 7/123 (6%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V+E+   + + K  ++G +++ + +A + W ++M    G+S QV EL   FL+  + I
Sbjct  479  YNVAETRLPQHVEKGNEDGLYISCVASAANLWALIMDAGTGFSSQVYELSTVFLH-KDWI  537

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  Y I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  538  MEQWEKNYYISSIAGANNGSSLVV---MSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHV  594

Query  260  ASI  252
             S+
Sbjct  595  TSM  597



>ref|XP_002873876.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50135.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=691

 Score =   279 bits (714),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 140/156 (90%), Positives = 153/156 (98%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFP+KWINKKWKE FHVTSMTTAG+R
Sbjct  536  NYYISSIAGADNGSSLVVMSKGTSYTQQSYKVSDSFPYKWINKKWKEDFHVTSMTTAGNR  595

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+G+S+QVVELDFLYPS+GIHRRWESGYRITSMAATADQAAFILS+P+RKMMD
Sbjct  596  WGVVMSRNSGFSDQVVELDFLYPSDGIHRRWESGYRITSMAATADQAAFILSVPKRKMMD  655

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRT+AFPSTHVKEKW+KNLYIASIC+GRTVC
Sbjct  656  ETQETLRTTAFPSTHVKEKWAKNLYIASICFGRTVC  691



>ref|XP_010228600.1| PREDICTED: uncharacterized protein LOC100829940 [Brachypodium 
distachyon]
 ref|XP_010228605.1| PREDICTED: uncharacterized protein LOC100829940 [Brachypodium 
distachyon]
Length=709

 Score =   279 bits (714),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 139/156 (89%), Positives = 148/156 (95%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            NFYI++IAGA NGSSLVVMSKGTPYTQQSYKVSESFP+KWINKKWKEGFHVTSM TAG+R
Sbjct  554  NFYITAIAGATNGSSLVVMSKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSMGTAGNR  613

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRNAGYS+QVVELDFLYPSEG+HRRWE+GYRITS A T DQAAFILSIP+RK MD
Sbjct  614  WGVVMSRNAGYSDQVVELDFLYPSEGLHRRWETGYRITSSAGTPDQAAFILSIPKRKPMD  673

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTSAFPS HVKEKW+KNLYIASICYGRT C
Sbjct  674  ETQETLRTSAFPSNHVKEKWAKNLYIASICYGRTAC  709



>dbj|BAJ93086.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=707

 Score =   279 bits (713),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 139/156 (89%), Positives = 148/156 (95%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            NFYI++IAGA NGSSLVVMSKGTPYTQQSYKVSESFP+KWINKKWKEGFHVTSM TAG+R
Sbjct  552  NFYITAIAGATNGSSLVVMSKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSMGTAGNR  611

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRNAGYS+QVVELDFLYPSEG+HRRWESGYRITS A T DQAAFILSIP+RK +D
Sbjct  612  WGVVMSRNAGYSDQVVELDFLYPSEGLHRRWESGYRITSSAGTPDQAAFILSIPKRKPLD  671

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTSAFPS HVKEKW+KNLYIASICYGRT C
Sbjct  672  ETQETLRTSAFPSNHVKEKWAKNLYIASICYGRTAC  707



>gb|KJB46016.1| hypothetical protein B456_007G343500 [Gossypium raimondii]
Length=711

 Score =   278 bits (712),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YI+S+AGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGF+VTSMTTAG+R
Sbjct  556  NYYITSVAGANNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFYVTSMTTAGTR  615

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRNAG+S+QVVELDFLYPSEGIHRRWESGYRITSMAAT DQAAFILSIP+RK  D
Sbjct  616  WGVVMSRNAGFSDQVVELDFLYPSEGIHRRWESGYRITSMAATVDQAAFILSIPKRKTTD  675

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            +TQETLRT+AFPSTHVKEKW+KNLYIASICYGRTV
Sbjct  676  DTQETLRTTAFPSTHVKEKWAKNLYIASICYGRTV  710


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/123 (27%), Positives = 66/123 (54%), Gaps = 7/123 (6%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V++    + ++K  ++G  ++ + +A + W ++M    G+S QV EL   FL+  + I
Sbjct  491  YNVADLRLSQHVSKGNEDGLFISCVASAANLWALIMDAGTGFSSQVYELSTVFLH-KDWI  549

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  Y ITS+A   + ++ ++     K    TQ++ + S +FP   + +KW +  Y+
Sbjct  550  MEQWEKNYYITSVAGANNGSSLVV---MSKGTPYTQQSYKVSESFPFKWINKKWKEGFYV  606

Query  260  ASI  252
             S+
Sbjct  607  TSM  609



>ref|XP_009132256.1| PREDICTED: uncharacterized protein LOC103856881 [Brassica rapa]
Length=676

 Score =   278 bits (710),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 138/156 (88%), Positives = 153/156 (98%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAG+ NGSSLVVMSKGT Y+QQSYKVS+SFPFKWINKKWKE FHVTSMTTAG+R
Sbjct  521  NYYISSIAGSDNGSSLVVMSKGTTYSQQSYKVSDSFPFKWINKKWKEDFHVTSMTTAGNR  580

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+G+S+QVVELDFLYPS+GIHRRWE+GYRITSMAATADQAAFILSIP+RKM+D
Sbjct  581  WGVVMSRNSGFSDQVVELDFLYPSDGIHRRWENGYRITSMAATADQAAFILSIPKRKMVD  640

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRT+AFPSTHVK+KW+KNLYIASICYGRTVC
Sbjct  641  ETQETLRTTAFPSTHVKDKWAKNLYIASICYGRTVC  676



>emb|CDY51243.1| BnaA03g06950D [Brassica napus]
Length=684

 Score =   278 bits (710),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 138/156 (88%), Positives = 153/156 (98%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAG+ NGSSLVVMSKGT Y+QQSYKVS+SFPFKWINKKWKE FHVTSMTTAG+R
Sbjct  529  NYYISSIAGSDNGSSLVVMSKGTTYSQQSYKVSDSFPFKWINKKWKEDFHVTSMTTAGNR  588

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+G+S+QVVELDFLYPS+GIHRRWE+GYRITSMAATADQAAFILSIP+RKM+D
Sbjct  589  WGVVMSRNSGFSDQVVELDFLYPSDGIHRRWENGYRITSMAATADQAAFILSIPKRKMVD  648

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRT+AFPSTHVK+KW+KNLYIASICYGRTVC
Sbjct  649  ETQETLRTTAFPSTHVKDKWAKNLYIASICYGRTVC  684



>emb|CDX70801.1| BnaC03g08850D [Brassica napus]
Length=684

 Score =   278 bits (710),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 138/156 (88%), Positives = 153/156 (98%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAG+ NGSSLVVMSKGT Y+QQSYKVS+SFPFKWINKKWKE FHVTSMTTAG+R
Sbjct  529  NYYISSIAGSDNGSSLVVMSKGTTYSQQSYKVSDSFPFKWINKKWKEDFHVTSMTTAGNR  588

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+G+S+QVVELDFLYPS+GIHRRWE+GYRITSMAATADQAAFILSIP+RKM+D
Sbjct  589  WGVVMSRNSGFSDQVVELDFLYPSDGIHRRWENGYRITSMAATADQAAFILSIPKRKMVD  648

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRT+AFPSTHVK+KW+KNLYIASICYGRTVC
Sbjct  649  ETQETLRTTAFPSTHVKDKWAKNLYIASICYGRTVC  684



>gb|ADE77861.1| unknown [Picea sitchensis]
Length=186

 Score =   262 bits (669),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YIS+IAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGF+VTSM +AGSR
Sbjct  31   NYYISAIAGANNGSSLVVMSKGTNYTQQSYKVSDSFPFKWINKKWREGFYVTSMASAGSR  90

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRNAG+++QVVELDFLYPSEGIHRRW+ GYRIT+ AAT DQAAF+LS+PRRK  D
Sbjct  91   WGVVMSRNAGFTDQVVELDFLYPSEGIHRRWDHGYRITATAATWDQAAFVLSVPRRKPTD  150

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  151  ETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  185



>ref|XP_010672056.1| PREDICTED: uncharacterized protein LOC104888715 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=711

 Score =   277 bits (709),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 142/156 (91%), Positives = 150/156 (96%), Gaps = 2/156 (1%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            NFYISSIAGA NG+SLVVMSKGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSMTTA SR
Sbjct  558  NFYISSIAGATNGASLVVMSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMTTAASR  617

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRNAG+++QVVELDFLYPSEGIHRRWESGYRITSMAAT DQAAF+LSIP+RK MD
Sbjct  618  WGVVMSRNAGFTDQVVELDFLYPSEGIHRRWESGYRITSMAATPDQAAFVLSIPKRKTMD  677

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTSAFPSTH  EKW+KNLYIASICYGRTVC
Sbjct  678  ETQETLRTSAFPSTH--EKWAKNLYIASICYGRTVC  711


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 68/123 (55%), Gaps = 7/123 (6%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V+++   + I+K  ++G +++ + +A + W ++M    G+S QV EL   FL+  + I
Sbjct  493  YNVADARLKQHIDKGNEDGLYISCVASATNLWALIMDAGTGFSCQVWELSNVFLH-KDWI  551

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  + I+S+A   + A+ ++     K    TQ++ + S +FP   + +KW +  ++
Sbjct  552  MEQWEKNFYISSIAGATNGASLVV---MSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHV  608

Query  260  ASI  252
             S+
Sbjct  609  TSM  611



>ref|XP_003557523.1| PREDICTED: uncharacterized protein LOC100821235 [Brachypodium 
distachyon]
Length=702

 Score =   276 bits (706),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 139/156 (89%), Positives = 149/156 (96%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            +FYI++IAGA+NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM TAG+R
Sbjct  547  SFYITAIAGASNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMATAGNR  606

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+GYSEQVVELDFLYPSEGIHRRWE GYRITS AAT DQAAFILS P+RK +D
Sbjct  607  WGVVMSRNSGYSEQVVELDFLYPSEGIHRRWEQGYRITSSAATIDQAAFILSKPKRKPVD  666

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTSAFPS HVK+KW+KNLYIASICYGRTVC
Sbjct  667  ETQETLRTSAFPSNHVKDKWAKNLYIASICYGRTVC  702



>ref|XP_004955583.1| PREDICTED: uncharacterized protein LOC101773166 isoform X4 [Setaria 
italica]
Length=707

 Score =   276 bits (705),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 128/141 (91%), Positives = 135/141 (96%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGTPYTQQSYKVSESFP+KWINKKWKEGFHVTSM TAG+RWGVVMSRN+GYS QV
Sbjct  567  LVVMSKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSMATAGNRWGVVMSRNSGYSNQV  626

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRWE+GYRITS AAT DQAAFILS+P+RK MDETQETLRTSAFPS H
Sbjct  627  VELDFLYPSEGIHRRWETGYRITSTAATNDQAAFILSMPKRKPMDETQETLRTSAFPSGH  686

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VKEKW+KNLYIASICYGRTVC
Sbjct  687  VKEKWAKNLYIASICYGRTVC  707



>ref|NP_001152463.1| ATP binding protein [Zea mays]
 gb|ACG47741.1| ATP binding protein [Zea mays]
Length=704

 Score =   275 bits (704),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 128/141 (91%), Positives = 136/141 (96%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGTPYTQQSYKVSESFP+KWINKKWKEGFHVTSM TAG+RWGVVMSRN+G+S QV
Sbjct  564  LVVMSKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSMATAGNRWGVVMSRNSGFSTQV  623

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRWESGYRITS AAT DQAAFILS+P+RK MDETQETLRTSAFPS+H
Sbjct  624  VELDFLYPSEGIHRRWESGYRITSTAATNDQAAFILSMPKRKPMDETQETLRTSAFPSSH  683

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VKEKW+KNLYIASICYGRTVC
Sbjct  684  VKEKWAKNLYIASICYGRTVC  704



>ref|XP_008651588.1| PREDICTED: ATP binding protein isoform X1 [Zea mays]
 gb|ACR36803.1| unknown [Zea mays]
 tpg|DAA59714.1| TPA: ATP binding protein isoform 1 [Zea mays]
 tpg|DAA59715.1| TPA: ATP binding protein isoform 2 [Zea mays]
Length=704

 Score =   275 bits (704),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 128/141 (91%), Positives = 136/141 (96%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGTPYTQQSYKVSESFP+KWINKKWKEGFHVTSM TAG+RWGVVMSRN+G+S QV
Sbjct  564  LVVMSKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSMATAGNRWGVVMSRNSGFSTQV  623

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRWESGYRITS AAT DQAAFILS+P+RK MDETQETLRTSAFPS+H
Sbjct  624  VELDFLYPSEGIHRRWESGYRITSTAATNDQAAFILSMPKRKPMDETQETLRTSAFPSSH  683

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VKEKW+KNLYIASICYGRTVC
Sbjct  684  VKEKWAKNLYIASICYGRTVC  704



>ref|XP_004955580.1| PREDICTED: uncharacterized protein LOC101773166 isoform X1 [Setaria 
italica]
 ref|XP_004955581.1| PREDICTED: uncharacterized protein LOC101773166 isoform X2 [Setaria 
italica]
 ref|XP_004955582.1| PREDICTED: uncharacterized protein LOC101773166 isoform X3 [Setaria 
italica]
Length=732

 Score =   276 bits (706),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 128/141 (91%), Positives = 135/141 (96%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGTPYTQQSYKVSESFP+KWINKKWKEGFHVTSM TAG+RWGVVMSRN+GYS QV
Sbjct  592  LVVMSKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSMATAGNRWGVVMSRNSGYSNQV  651

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRWE+GYRITS AAT DQAAFILS+P+RK MDETQETLRTSAFPS H
Sbjct  652  VELDFLYPSEGIHRRWETGYRITSTAATNDQAAFILSMPKRKPMDETQETLRTSAFPSGH  711

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VKEKW+KNLYIASICYGRTVC
Sbjct  712  VKEKWAKNLYIASICYGRTVC  732



>emb|CDY02641.1| BnaC02g07940D [Brassica napus]
Length=686

 Score =   274 bits (701),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 136/156 (87%), Positives = 152/156 (97%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAG+ NGSSLVVMSKGT Y+QQSYKVS+SFP+KWINKKWKE FHVTSMTTAG+R
Sbjct  531  NYYISSIAGSDNGSSLVVMSKGTSYSQQSYKVSDSFPYKWINKKWKEDFHVTSMTTAGNR  590

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGV+MSRN+G+S+QVVELDFLYPS+GIHRRWESGYRITSMAATADQAAFILSIP+RK+ D
Sbjct  591  WGVIMSRNSGFSDQVVELDFLYPSDGIHRRWESGYRITSMAATADQAAFILSIPKRKLND  650

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRT+AFPSTHVK+KW+KNLYIASICYGRTVC
Sbjct  651  ETQETLRTTAFPSTHVKDKWAKNLYIASICYGRTVC  686



>gb|ACN36158.1| unknown [Zea mays]
Length=704

 Score =   275 bits (702),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/141 (90%), Positives = 136/141 (96%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGTPYTQQSYKVSESFP+KWINKKWKEGFHVTSM TAG+RWGVVMSRN+G+S QV
Sbjct  564  LVVMSKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSMATAGNRWGVVMSRNSGFSTQV  623

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRWESGYRITS AAT DQAAFILS+P+RK MDETQETLRTSAFPS+H
Sbjct  624  VELDFLYPSEGIHRRWESGYRITSTAATNDQAAFILSMPKRKPMDETQETLRTSAFPSSH  683

Query  293  VKEKWSKNLYIASICYGRTVC  231
            VKEKW+KNLYIASIC+GRTVC
Sbjct  684  VKEKWAKNLYIASICFGRTVC  704



>ref|NP_001152101.1| LOC100285738 [Zea mays]
 ref|XP_008668149.1| PREDICTED: LOC100285738 isoform X1 [Zea mays]
 gb|ACG45775.1| ATP binding protein [Zea mays]
 tpg|DAA42572.1| TPA: ATP binding protein isoform 1 [Zea mays]
 tpg|DAA42573.1| TPA: ATP binding protein isoform 2 [Zea mays]
 tpg|DAA42574.1| TPA: ATP binding protein isoform 3 [Zea mays]
Length=704

 Score =   275 bits (702),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 136/156 (87%), Positives = 151/156 (97%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            ++YI++IAG++NGSSLVVMSKGTPYTQQSYKVSESFP+KWINKKWKEGFHVTSM TAG+R
Sbjct  549  SYYITAIAGSSNGSSLVVMSKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSMATAGNR  608

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+G+S QVVELDFLYPSEGIHRRWESGYRITS AAT DQAAFILS+P+RK MD
Sbjct  609  WGVVMSRNSGFSTQVVELDFLYPSEGIHRRWESGYRITSTAATNDQAAFILSMPKRKPMD  668

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTSAFPS+HVKEKW+KNLYIASIC+GRTVC
Sbjct  669  ETQETLRTSAFPSSHVKEKWAKNLYIASICFGRTVC  704



>ref|XP_002466312.1| hypothetical protein SORBIDRAFT_01g005460 [Sorghum bicolor]
 gb|EER93310.1| hypothetical protein SORBIDRAFT_01g005460 [Sorghum bicolor]
Length=707

 Score =   274 bits (700),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 135/156 (87%), Positives = 149/156 (96%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YI++IAGA NGSSL+VMSKGTPYTQQSYKVSESFP+KWINKKWKEGFHVTSM TAG+R
Sbjct  552  NYYITAIAGATNGSSLIVMSKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSMATAGNR  611

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGV++SRNAGYS QVVELDFLYPSEGIHRRWE+GYRITS+AAT DQAAFILSIP+RK MD
Sbjct  612  WGVIVSRNAGYSTQVVELDFLYPSEGIHRRWETGYRITSIAATPDQAAFILSIPKRKPMD  671

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQE LRTSAFPS+HVKEKW KNLYI+S+CYGRTVC
Sbjct  672  ETQEILRTSAFPSSHVKEKWVKNLYISSVCYGRTVC  707



>ref|XP_004981469.1| PREDICTED: uncharacterized protein LOC101783890 isoform X1 [Setaria 
italica]
 ref|XP_004981470.1| PREDICTED: uncharacterized protein LOC101783890 isoform X2 [Setaria 
italica]
 ref|XP_004981471.1| PREDICTED: uncharacterized protein LOC101783890 isoform X3 [Setaria 
italica]
 ref|XP_004981472.1| PREDICTED: uncharacterized protein LOC101783890 isoform X4 [Setaria 
italica]
 ref|XP_004981473.1| PREDICTED: uncharacterized protein LOC101783890 isoform X5 [Setaria 
italica]
Length=706

 Score =   274 bits (700),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 137/156 (88%), Positives = 147/156 (94%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YI++IAGA NGSSLVVMSKGTPYTQQSYKVSESFP+KWINKKWKEGFHVTSM TAG+R
Sbjct  551  NYYITAIAGATNGSSLVVMSKGTPYTQQSYKVSESFPYKWINKKWKEGFHVTSMATAGNR  610

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+GY+ QVVELDFLYPSEGIH RWE+GYRITS AAT DQAAFILSIP+RK MD
Sbjct  611  WGVVMSRNSGYATQVVELDFLYPSEGIHHRWETGYRITSTAATPDQAAFILSIPKRKPMD  670

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTSAFPS HVKEKW KNLYI+SICYGRTVC
Sbjct  671  ETQETLRTSAFPSNHVKEKWVKNLYISSICYGRTVC  706



>ref|XP_009126244.1| PREDICTED: uncharacterized protein LOC103851164 [Brassica rapa]
Length=684

 Score =   273 bits (699),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 135/156 (87%), Positives = 152/156 (97%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAG+ NGSSLVVMSKGT Y+QQSYKVS+SFP+KWINKKWKE FHVTSMTTAG+R
Sbjct  529  NYYISSIAGSDNGSSLVVMSKGTSYSQQSYKVSDSFPYKWINKKWKEDFHVTSMTTAGNR  588

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGV+MSRN+G+S+QVVELDFLYPS+GIHRRWE+GYRITSMAATADQAAFILSIP+RK+ D
Sbjct  589  WGVIMSRNSGFSDQVVELDFLYPSDGIHRRWENGYRITSMAATADQAAFILSIPKRKLND  648

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRT+AFPSTHVK+KW+KNLYIASICYGRTVC
Sbjct  649  ETQETLRTTAFPSTHVKDKWAKNLYIASICYGRTVC  684



>emb|CDY53253.1| BnaA02g04010D [Brassica napus]
Length=762

 Score =   275 bits (702),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 136/156 (87%), Positives = 152/156 (97%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAG+ NGSSLVVMSKGT Y+QQSYKVS+SFP+KWINKKWKE FHVTSMTTAG+R
Sbjct  607  NYYISSIAGSDNGSSLVVMSKGTSYSQQSYKVSDSFPYKWINKKWKEDFHVTSMTTAGNR  666

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGV+MSRN+G+S+QVVELDFLYPS+GIHRRWESGYRITSMAATADQAAFILSIP+RK+ D
Sbjct  667  WGVIMSRNSGFSDQVVELDFLYPSDGIHRRWESGYRITSMAATADQAAFILSIPKRKLND  726

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRT+AFPSTHVK+KW+KNLYIASICYGRTVC
Sbjct  727  ETQETLRTTAFPSTHVKDKWAKNLYIASICYGRTVC  762



>ref|XP_006842223.1| hypothetical protein AMTR_s00078p00181940 [Amborella trichopoda]
 gb|ERN03898.1| hypothetical protein AMTR_s00078p00181940 [Amborella trichopoda]
Length=705

 Score =   273 bits (697),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGA NG SLVVMSKGTPY+QQSYKVS+SFPFKWINKKW+EGF+VTSMTT+G+R
Sbjct  550  NYYISSIAGANNGGSLVVMSKGTPYSQQSYKVSDSFPFKWINKKWREGFYVTSMTTSGNR  609

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRNAG+S+QVVELDFLYPSEGIHRRWE+G+RITS AAT DQAAFILS+P+RKM D
Sbjct  610  WGVVMSRNAGFSDQVVELDFLYPSEGIHRRWENGFRITSTAATVDQAAFILSVPKRKMSD  669

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPSTHVKEKWSKNLYIAS+CYGRTV
Sbjct  670  ETQETLRTSAFPSTHVKEKWSKNLYIASVCYGRTV  704



>gb|EMS51431.1| Casein kinase I isoform beta [Triticum urartu]
Length=695

 Score =   272 bits (695),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            +FYI++IAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM TAG+R
Sbjct  540  SFYITAIAGALNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMATAGNR  599

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+GYSEQ+VELDFLYPSEGIHRRWE GYRITS AAT DQAAFILS P+RK +D
Sbjct  600  WGVVMSRNSGYSEQIVELDFLYPSEGIHRRWEHGYRITSSAATGDQAAFILSKPKRKPVD  659

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPS HVK+KW+KNLYIASICYGRTV
Sbjct  660  ETQETLRTSAFPSNHVKDKWAKNLYIASICYGRTV  694



>ref|XP_010552201.1| PREDICTED: serine/threonine-protein kinase ste20-like [Tarenaya 
hassleriana]
Length=702

 Score =   271 bits (694),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAG+ NGSSLVVMSKGT +TQQSYKVS+SFPFKWINKKWKEGFHVTSM TAGSR
Sbjct  547  NYYISSIAGSNNGSSLVVMSKGTQFTQQSYKVSDSFPFKWINKKWKEGFHVTSMATAGSR  606

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRNAGYSEQVVELDFLYPSEGIHRRW SGYRITS AATADQ A +LSIPRR+++D
Sbjct  607  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWNSGYRITSTAATADQTALVLSIPRRRLVD  666

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTS FPSTHVKEKW KNLY+ASICYGRTV
Sbjct  667  ETQETLRTSQFPSTHVKEKWGKNLYLASICYGRTV  701



>ref|XP_010936996.1| PREDICTED: casein kinase I isoform gamma-1-like isoform X2 [Elaeis 
guineensis]
Length=600

 Score =   268 bits (686),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM T+GSR
Sbjct  445  NYYISSIAGANNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMATSGSR  504

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WG+VMSRNAG+S+QVVELDFLYPSEGIHRRW++GYRITSMAAT DQAA ILS+P+RK  D
Sbjct  505  WGIVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITSMAATWDQAALILSVPKRKPGD  564

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPS HVK+KW+KNLY+AS+CYGRTV
Sbjct  565  ETQETLRTSAFPSAHVKDKWAKNLYLASVCYGRTV  599



>ref|XP_010936995.1| PREDICTED: casein kinase I isoform gamma-1-like isoform X1 [Elaeis 
guineensis]
Length=601

 Score =   268 bits (686),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM T+GSR
Sbjct  446  NYYISSIAGANNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMATSGSR  505

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WG+VMSRNAG+S+QVVELDFLYPSEGIHRRW++GYRITSMAAT DQAA ILS+P+RK  D
Sbjct  506  WGIVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITSMAATWDQAALILSVPKRKPGD  565

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPS HVK+KW+KNLY+AS+CYGRTV
Sbjct  566  ETQETLRTSAFPSAHVKDKWAKNLYLASVCYGRTV  600



>ref|XP_010500967.1| PREDICTED: uncharacterized protein LOC104778257 isoform X2 [Camelina 
sativa]
Length=390

 Score =   263 bits (671),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSR
Sbjct  235  NYYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSR  294

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+GYSEQVVELDFLYPSEGIHRRW+ G+RITS AAT DQAA ILSIPRR+++D
Sbjct  295  WGVVMSRNSGYSEQVVELDFLYPSEGIHRRWDGGFRITSTAATTDQAALILSIPRRRLVD  354

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  355  ETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  389



>gb|EYU39997.1| hypothetical protein MIMGU_mgv1a002328mg [Erythranthe guttata]
Length=687

 Score =   270 bits (691),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 139/157 (89%), Positives = 151/157 (96%), Gaps = 1/157 (1%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YIS IAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWI+KKWKEGFHVTSMT+AGSR
Sbjct  531  NYYISCIAGAANGSSLVVMSKGTPYTQQSYKVSESFPFKWISKKWKEGFHVTSMTSAGSR  590

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRK-MM  342
            WGVVMSRN+GYSEQVVE+DF+YPSEGIHRRWESGYRITSMAAT DQ+AF+LSIPRRK MM
Sbjct  591  WGVVMSRNSGYSEQVVEVDFVYPSEGIHRRWESGYRITSMAATTDQSAFVLSIPRRKLMM  650

Query  341  DETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            DE QETLRTSAFPS+HVK KWS+NLYIAS+C+G TVC
Sbjct  651  DEAQETLRTSAFPSSHVKAKWSRNLYIASMCHGPTVC  687



>ref|XP_010472589.1| PREDICTED: uncharacterized protein LOC104752210 [Camelina sativa]
Length=257

 Score =   257 bits (657),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YI+++AGA+NGSS VVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VTSM TAGS+
Sbjct  102  NYYITAVAGASNGSSFVVMSKGTQYLQQSYKVSDSFPFKWINKKWREGFYVTSMATAGSK  161

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WG+VMSR A +S+QVVELDFLYPSEGIHRRWE+GYRITS+AAT DQAAF+LS+PRRK+ D
Sbjct  162  WGIVMSRGACFSDQVVELDFLYPSEGIHRRWENGYRITSVAATWDQAAFVLSVPRRKLTD  221

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPS HVKEKW KNLYIASICYGRTV
Sbjct  222  ETQETLRTSAFPSNHVKEKWGKNLYIASICYGRTV  256



>gb|AAC42254.1| unknown protein [Arabidopsis thaliana]
Length=282

 Score =   257 bits (657),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YI+++AGA +G+S VVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VTSM TAGS+
Sbjct  127  NYYITAVAGANSGNSFVVMSKGTQYLQQSYKVSDSFPFKWINKKWREGFYVTSMATAGSK  186

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WG+VMSR A +S+QV+ELDFLYPSEGIHRRWE+GYRITS+AAT DQAAF+LS+PRRK+ D
Sbjct  187  WGIVMSRGASFSDQVIELDFLYPSEGIHRRWENGYRITSVAATWDQAAFVLSVPRRKLTD  246

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPS HVKEKW KNLYIASICYGRTV
Sbjct  247  ETQETLRTSAFPSNHVKEKWGKNLYIASICYGRTV  281



>gb|KHN37292.1| Casein kinase I [Glycine soja]
Length=590

 Score =   266 bits (681),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 133/156 (85%), Positives = 146/156 (94%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            NFYI+SIAG+ NGSSLVVMSKGT YTQQSYKVSESFPFKWINKKW+EGFHVTSM TAGSR
Sbjct  435  NFYITSIAGSNNGSSLVVMSKGTQYTQQSYKVSESFPFKWINKKWREGFHVTSMATAGSR  494

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRNAG+S+QVVELDFLYPSEGIH+RW+ GYRIT+ AAT DQ+A ILSIPRRK+ D
Sbjct  495  WGVVMSRNAGFSKQVVELDFLYPSEGIHKRWDKGYRITATAATLDQSALILSIPRRKLSD  554

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTS FPSTHVK+KWSKNLY+A +CYGRTVC
Sbjct  555  ETQETLRTSQFPSTHVKDKWSKNLYLACLCYGRTVC  590



>ref|XP_006651899.1| PREDICTED: uncharacterized protein LOC102717146 [Oryza brachyantha]
Length=726

 Score =   269 bits (688),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 136/156 (87%), Positives = 147/156 (94%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YI++IAGA NGSSLVVMSK T YTQQSYKVSESFP+KWINKKWKEGFHVTSM TAG+R
Sbjct  571  NYYITAIAGANNGSSLVVMSKETSYTQQSYKVSESFPYKWINKKWKEGFHVTSMATAGNR  630

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN GYS QVVELDFLYPSEGIHRRWE+GYRITS AAT DQAAFIL++P+RK +D
Sbjct  631  WGVVMSRNTGYSHQVVELDFLYPSEGIHRRWETGYRITSTAATPDQAAFILTMPKRKPVD  690

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTS+FPSTHVKEKWSKNLYIASICYGRTVC
Sbjct  691  ETQETLRTSSFPSTHVKEKWSKNLYIASICYGRTVC  726



>ref|XP_010534909.1| PREDICTED: serine/threonine-protein kinase STE20-like [Tarenaya 
hassleriana]
Length=703

 Score =   268 bits (686),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGA NGSSLVVMSKGT +TQQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSR
Sbjct  548  NYYISSIAGANNGSSLVVMSKGTQFTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSR  607

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRNAGYSEQVVELDFLYPSEGIHRRW+ G+RITS AAT DQAA ILSIPRR+++D
Sbjct  608  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWDGGFRITSTAATTDQAALILSIPRRRLVD  667

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTS FPSTHVKEKW KNLY+AS+CYGRTV
Sbjct  668  ETQETLRTSQFPSTHVKEKWGKNLYLASLCYGRTV  702



>ref|XP_010542444.1| PREDICTED: serine/threonine-protein kinase STE20-like [Tarenaya 
hassleriana]
Length=703

 Score =   268 bits (685),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGA NGSSLVVMSKGT +TQQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSR
Sbjct  548  NYYISSIAGANNGSSLVVMSKGTQFTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSR  607

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRNAGYSEQVVELDFLYPSEGIH+RW+SG+RITS AAT DQAA ILSIPRR+++D
Sbjct  608  WGVVMSRNAGYSEQVVELDFLYPSEGIHKRWDSGFRITSTAATTDQAALILSIPRRRLVD  667

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTS FPSTHVKEKW KNLY+AS+CYGRTV
Sbjct  668  ETQETLRTSQFPSTHVKEKWGKNLYLASLCYGRTV  702



>gb|KHN27094.1| Casein kinase I [Glycine soja]
Length=657

 Score =   267 bits (682),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 133/156 (85%), Positives = 145/156 (93%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            NFYI+SIAG+ NGSSLVVMSKGT YTQQSYKVSESFPFKWINKKW+EGFHVTSM TAGSR
Sbjct  502  NFYITSIAGSNNGSSLVVMSKGTQYTQQSYKVSESFPFKWINKKWREGFHVTSMATAGSR  561

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRNAG+S+QVVELDFLYPSEGIH+RW+ GYRIT+ AAT DQ+A ILSIPRRK+ D
Sbjct  562  WGVVMSRNAGFSKQVVELDFLYPSEGIHKRWDKGYRITATAATLDQSALILSIPRRKLSD  621

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTS FP THVKEKWSKNLY+A +CYGRTVC
Sbjct  622  ETQETLRTSQFPGTHVKEKWSKNLYLACLCYGRTVC  657



>ref|XP_003536792.1| PREDICTED: uncharacterized protein LOC100783819 [Glycine max]
Length=672

 Score =   267 bits (683),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 133/156 (85%), Positives = 146/156 (94%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            NFYI+SIAG+ NGSSLVVMSKGT YTQQSYKVSESFPFKWINKKW+EGFHVTSM TAGSR
Sbjct  517  NFYITSIAGSNNGSSLVVMSKGTQYTQQSYKVSESFPFKWINKKWREGFHVTSMATAGSR  576

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRNAG+S+QVVELDFLYPSEGIH+RW+ GYRIT+ AAT DQ+A ILSIPRRK+ D
Sbjct  577  WGVVMSRNAGFSKQVVELDFLYPSEGIHKRWDKGYRITATAATLDQSALILSIPRRKLSD  636

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTS FPSTHVK+KWSKNLY+A +CYGRTVC
Sbjct  637  ETQETLRTSQFPSTHVKDKWSKNLYLACLCYGRTVC  672



>ref|XP_003556554.1| PREDICTED: uncharacterized protein LOC100807373 [Glycine max]
Length=669

 Score =   266 bits (681),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 133/156 (85%), Positives = 145/156 (93%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            NFYI+SIAG+ NGSSLVVMSKGT YTQQSYKVSESFPFKWINKKW+EGFHVTSM TAGSR
Sbjct  514  NFYITSIAGSNNGSSLVVMSKGTQYTQQSYKVSESFPFKWINKKWREGFHVTSMATAGSR  573

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRNAG+S+QVVELDFLYPSEGIH+RW+ GYRIT+ AAT DQ+A ILSIPRRK+ D
Sbjct  574  WGVVMSRNAGFSKQVVELDFLYPSEGIHKRWDKGYRITATAATLDQSALILSIPRRKLSD  633

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTS FP THVKEKWSKNLY+A +CYGRTVC
Sbjct  634  ETQETLRTSQFPGTHVKEKWSKNLYLACLCYGRTVC  669



>ref|XP_008797915.1| PREDICTED: uncharacterized protein LOC103712966 isoform X1 [Phoenix 
dactylifera]
Length=732

 Score =   268 bits (684),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM T+GSR
Sbjct  577  NYYISSIAGANNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMATSGSR  636

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WG+VMSRNAG+S+QVVELDFLYPSEGIHRRW++GYRITSMAAT DQAA ILS+P+R+  D
Sbjct  637  WGIVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITSMAATWDQAALILSVPKRRPGD  696

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPS HVK+KW+KNLY+A++CYGRTV
Sbjct  697  ETQETLRTSAFPSAHVKDKWAKNLYLAAVCYGRTV  731



>gb|KDP33655.1| hypothetical protein JCGZ_07226 [Jatropha curcas]
Length=664

 Score =   266 bits (681),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YI+S+AG ANGS+LVVMSKGTPYTQQSYKVS+ FPFKWINKKWKEGF VTSMTTAGS+
Sbjct  509  NYYITSVAGTANGSALVVMSKGTPYTQQSYKVSDVFPFKWINKKWKEGFSVTSMTTAGSK  568

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WG+VMSRNAGY  QVVELDFLYPSEGIHRRWESGYRITS AATADQAAFILS P+RK  D
Sbjct  569  WGIVMSRNAGYPNQVVELDFLYPSEGIHRRWESGYRITSTAATADQAAFILSAPKRKSSD  628

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
              QETLRTSAFPSTHVK+KWSKNLYIASICYGRTV
Sbjct  629  VAQETLRTSAFPSTHVKDKWSKNLYIASICYGRTV  663


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/123 (28%), Positives = 66/123 (54%), Gaps = 7/123 (6%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V +S   + + K  ++G +++ + ++ + W ++M    G++ QV EL   FL+  E I
Sbjct  444  YNVMDSRIDQHVEKGREDGLYISCVASSANLWAIIMDAGTGFTSQVHELSPIFLH-KEWI  502

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +W+  Y ITS+A TA+ +A ++     K    TQ++ + S  FP   + +KW +   +
Sbjct  503  MEQWDKNYYITSVAGTANGSALVV---MSKGTPYTQQSYKVSDVFPFKWINKKWKEGFSV  559

Query  260  ASI  252
             S+
Sbjct  560  TSM  562



>ref|XP_008797930.1| PREDICTED: uncharacterized protein LOC103712966 isoform X3 [Phoenix 
dactylifera]
Length=728

 Score =   268 bits (684),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM T+GSR
Sbjct  573  NYYISSIAGANNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMATSGSR  632

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WG+VMSRNAG+S+QVVELDFLYPSEGIHRRW++GYRITSMAAT DQAA ILS+P+R+  D
Sbjct  633  WGIVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITSMAATWDQAALILSVPKRRPGD  692

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPS HVK+KW+KNLY+A++CYGRTV
Sbjct  693  ETQETLRTSAFPSAHVKDKWAKNLYLAAVCYGRTV  727



>ref|XP_008797922.1| PREDICTED: uncharacterized protein LOC103712966 isoform X2 [Phoenix 
dactylifera]
Length=731

 Score =   268 bits (684),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM T+GSR
Sbjct  576  NYYISSIAGANNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMATSGSR  635

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WG+VMSRNAG+S+QVVELDFLYPSEGIHRRW++GYRITSMAAT DQAA ILS+P+R+  D
Sbjct  636  WGIVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITSMAATWDQAALILSVPKRRPGD  695

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPS HVK+KW+KNLY+A++CYGRTV
Sbjct  696  ETQETLRTSAFPSAHVKDKWAKNLYLAAVCYGRTV  730



>ref|XP_008797939.1| PREDICTED: uncharacterized protein LOC103712966 isoform X4 [Phoenix 
dactylifera]
Length=727

 Score =   268 bits (684),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM T+GSR
Sbjct  572  NYYISSIAGANNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMATSGSR  631

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WG+VMSRNAG+S+QVVELDFLYPSEGIHRRW++GYRITSMAAT DQAA ILS+P+R+  D
Sbjct  632  WGIVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITSMAATWDQAALILSVPKRRPGD  691

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPS HVK+KW+KNLY+A++CYGRTV
Sbjct  692  ETQETLRTSAFPSAHVKDKWAKNLYLAAVCYGRTV  726



>ref|XP_009382978.1| PREDICTED: uncharacterized protein LOC103970784 [Musa acuminata 
subsp. malaccensis]
Length=721

 Score =   267 bits (682),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YI+S+AG+ NGSSLVVMSKGT YTQQSYKVSESFPFKWINKKWKEGFHVTSM TAGSR
Sbjct  566  NYYITSLAGSNNGSSLVVMSKGTQYTQQSYKVSESFPFKWINKKWKEGFHVTSMATAGSR  625

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WG+VMSRNAG+S+QVVELDFLYPSEGIHRRW+SGYRITSM AT DQAA ILS+P+RK  D
Sbjct  626  WGIVMSRNAGFSDQVVELDFLYPSEGIHRRWDSGYRITSMGATWDQAALILSVPKRKPGD  685

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPS HVK+KW+KNLY+ASICYGRTV
Sbjct  686  ETQETLRTSAFPSAHVKDKWAKNLYLASICYGRTV  720


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 64/123 (52%), Gaps = 5/123 (4%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD-FLYPSEGIH  435
            Y V+++   + I +  ++G  ++ + +  + W ++M    G++ QV EL  F    E I 
Sbjct  501  YNVADARLAQHIERGNEDGLLISCVASCSNLWAIIMDAGTGFTSQVYELSPFFLHKEWIM  560

Query  434  RRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIA  258
             +WE  Y ITS+A + + ++ ++     K    TQ++ + S +FP   + +KW +  ++ 
Sbjct  561  EQWEKNYYITSLAGSNNGSSLVVM---SKGTQYTQQSYKVSESFPFKWINKKWKEGFHVT  617

Query  257  SIC  249
            S+ 
Sbjct  618  SMA  620



>tpg|DAA54811.1| TPA: hypothetical protein ZEAMMB73_098757 [Zea mays]
Length=186

 Score =   251 bits (641),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 123/156 (79%), Positives = 144/156 (92%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            +FYISS+AG+ NGSS+VVMSKGTPYTQQSYKVS+SFPFKWINKKWKEGFHVT+M T+G+R
Sbjct  31   SFYISSVAGSNNGSSIVVMSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTAMATSGNR  90

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            W +VMSR+AG+SEQVVELDFLYPSEGIHRRW++G+RIT+MAAT DQ+A ILS PRR+  D
Sbjct  91   WAIVMSRSAGFSEQVVELDFLYPSEGIHRRWDNGFRITAMAATMDQSALILSKPRRRPRD  150

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRT+ FPS HVK+KW+KNLY+A ICYGRTV 
Sbjct  151  ETQETLRTTQFPSQHVKDKWAKNLYLAGICYGRTVA  186



>gb|EMT21659.1| Casein kinase I-RAG8-like protein [Aegilops tauschii]
Length=640

 Score =   265 bits (677),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            +FYI++IAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM TAG+R
Sbjct  485  SFYITAIAGALNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMATAGNR  544

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+GYS Q+VELDFLYPSEGIH RWE GYRITS AAT DQAAFILS P+RK +D
Sbjct  545  WGVVMSRNSGYSGQIVELDFLYPSEGIHWRWEHGYRITSSAATGDQAAFILSKPKRKPVD  604

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPS HVK+KW+KNLYIASICYGRTV
Sbjct  605  ETQETLRTSAFPSNHVKDKWAKNLYIASICYGRTV  639



>ref|XP_001770883.1| predicted protein [Physcomitrella patens]
 gb|EDQ64213.1| predicted protein [Physcomitrella patens]
Length=603

 Score =   264 bits (674),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            NFYIS+IAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGF+VTSM TAGSR
Sbjct  448  NFYISAIAGANNGSSLVVMSKGTSYTQQSYKVSDSFPFKWINKKWREGFYVTSMATAGSR  507

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRNAG+S+QVVELDFLYPSEGIHRRW+SGYRITS AAT DQAAF+LS+PRRK  D
Sbjct  508  WGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDSGYRITSTAATWDQAAFVLSVPRRKPAD  567

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPSTHVKEKWSKNLYIA++ YGRTV
Sbjct  568  ETQETLRTSAFPSTHVKEKWSKNLYIAAVSYGRTV  602



>ref|XP_001764211.1| predicted protein [Physcomitrella patens]
 gb|EDQ71052.1| predicted protein [Physcomitrella patens]
Length=603

 Score =   264 bits (674),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            NFYIS+IAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGF+VTSM TAGSR
Sbjct  448  NFYISAIAGANNGSSLVVMSKGTSYTQQSYKVSDSFPFKWINKKWREGFYVTSMATAGSR  507

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRNAG+S+QVVELDFLYPSEGIHRRW+SGYRITS AAT DQAAF+LS+PRRK  D
Sbjct  508  WGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDSGYRITSTAATWDQAAFVLSVPRRKPAD  567

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPSTHVKEKWSKNLYIA++ YGRTV
Sbjct  568  ETQETLRTSAFPSTHVKEKWSKNLYIAAVSYGRTV  602



>emb|CDP13154.1| unnamed protein product [Coffea canephora]
Length=601

 Score =   264 bits (674),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 130/156 (83%), Positives = 146/156 (94%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YIS +AGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKWKEGFHVTSM TAG+R
Sbjct  446  NYYISCLAGATNGSSLVVMSKGTMYNQQSYKVSDSFPFKWINKKWKEGFHVTSMATAGTR  505

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            W VVMSRN+G+S+QVVELDFLYPSEGIH+RW+SGYRIT+ AAT DQAA ILS+PRRK++D
Sbjct  506  WAVVMSRNSGFSDQVVELDFLYPSEGIHKRWDSGYRITATAATWDQAALILSVPRRKLLD  565

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTS FPSTHVKEKW+KNLY+AS+CYGRTVC
Sbjct  566  ETQETLRTSQFPSTHVKEKWAKNLYLASLCYGRTVC  601



>emb|CDY23629.1| BnaC05g39650D [Brassica napus]
Length=525

 Score =   261 bits (668),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGA NGSSLVVMSKGT Y+QQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSR
Sbjct  370  NYYISSIAGATNGSSLVVMSKGTQYSQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSR  429

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+GYSEQVVELDFLYPSEG+HRRW+ GYRITS AAT DQAA ILSIPRR++ D
Sbjct  430  WGVVMSRNSGYSEQVVELDFLYPSEGVHRRWDGGYRITSTAATTDQAALILSIPRRRLAD  489

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  490  ETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  524



>ref|XP_006445886.1| hypothetical protein CICLE_v10014444mg [Citrus clementina]
 ref|XP_006492686.1| PREDICTED: uncharacterized protein LOC102618306 [Citrus sinensis]
 gb|ESR59126.1| hypothetical protein CICLE_v10014444mg [Citrus clementina]
 gb|KDO62936.1| hypothetical protein CISIN_1g048600mg [Citrus sinensis]
Length=707

 Score =   266 bits (679),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSR
Sbjct  552  NYYISSIAGATNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSR  611

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRNAG+SEQVVELDFLYPSEGIHRRW+ GYRITS AAT DQAA ILS+PRRK  D
Sbjct  612  WGVVMSRNAGFSEQVVELDFLYPSEGIHRRWDGGYRITSTAATCDQAALILSVPRRKPGD  671

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTS FPSTHVKEKW+KNLY+A +CYGRTV
Sbjct  672  ETQETLRTSQFPSTHVKEKWAKNLYLACLCYGRTV  706



>ref|XP_008367866.1| PREDICTED: casein kinase I [Malus domestica]
Length=540

 Score =   261 bits (668),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YIS IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGFHVT+M TAGSR
Sbjct  385  NYYISXIAGANNGSSLVVMSKGTQYLQQSYKVSDSFPFKWINKKWREGFHVTAMATAGSR  444

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            W +VMSR AG+S+QVVELDFLYPSEGIHRRW++GYRITS AAT DQAAF+LS+PRRK+ D
Sbjct  445  WAIVMSRGAGFSDQVVELDFLYPSEGIHRRWDNGYRITSTAATWDQAAFVLSVPRRKLAD  504

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPSTHVKEKW KNLYIASICYGRTV
Sbjct  505  ETQETLRTSAFPSTHVKEKWGKNLYIASICYGRTV  539



>ref|XP_002960894.1| hypothetical protein SELMODRAFT_139482 [Selaginella moellendorffii]
 gb|EFJ38433.1| hypothetical protein SELMODRAFT_139482 [Selaginella moellendorffii]
Length=596

 Score =   263 bits (672),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            NFYIS+IAGA NGSSLVVMSKGTPYTQQSYKVS+SFPFKWINKKW+EGF+VTSM TAG+R
Sbjct  441  NFYISAIAGANNGSSLVVMSKGTPYTQQSYKVSDSFPFKWINKKWREGFYVTSMATAGTR  500

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRNAG+++QVVELDFLYPSEGIHRRW+ GYRIT+ AAT DQAAF+LS+PRRK  D
Sbjct  501  WGVVMSRNAGFTDQVVELDFLYPSEGIHRRWDCGYRITATAATWDQAAFVLSVPRRKPAD  560

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPSTHVKEKWSKNLYIA++ YGRTV
Sbjct  561  ETQETLRTSAFPSTHVKEKWSKNLYIAAVSYGRTV  595



>ref|XP_002967119.1| hypothetical protein SELMODRAFT_144765 [Selaginella moellendorffii]
 gb|EFJ31718.1| hypothetical protein SELMODRAFT_144765 [Selaginella moellendorffii]
Length=596

 Score =   263 bits (672),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            NFYIS+IAGA NGSSLVVMSKGTPYTQQSYKVS+SFPFKWINKKW+EGF+VTSM TAG+R
Sbjct  441  NFYISAIAGANNGSSLVVMSKGTPYTQQSYKVSDSFPFKWINKKWREGFYVTSMATAGTR  500

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRNAG+++QVVELDFLYPSEGIHRRW+ GYRIT+ AAT DQAAF+LS+PRRK  D
Sbjct  501  WGVVMSRNAGFTDQVVELDFLYPSEGIHRRWDCGYRITATAATWDQAAFVLSVPRRKPAD  560

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPSTHVKEKWSKNLYIA++ YGRTV
Sbjct  561  ETQETLRTSAFPSTHVKEKWSKNLYIAAVSYGRTV  595



>emb|CBI28086.3| unnamed protein product [Vitis vinifera]
Length=629

 Score =   264 bits (674),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            NFYI+S+AGA+NG++LVVMSKGTPY QQSYKVS+ FPFKWINKKWKEGF VTSMTTAGSR
Sbjct  474  NFYITSVAGASNGNALVVMSKGTPYNQQSYKVSDVFPFKWINKKWKEGFFVTSMTTAGSR  533

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WG+VMSRNAG+S QVVELDFLYPSEGIHRRWESGYRITS AATADQAAFILS  +R+  D
Sbjct  534  WGIVMSRNAGFSNQVVELDFLYPSEGIHRRWESGYRITSTAATADQAAFILSTSKRRTQD  593

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             TQETLRTSAFP THVK+KWSKNLYIASICYGRTV
Sbjct  594  VTQETLRTSAFPCTHVKDKWSKNLYIASICYGRTV  628



>ref|XP_006407187.1| hypothetical protein EUTSA_v10020172mg [Eutrema salsugineum]
 gb|ESQ48640.1| hypothetical protein EUTSA_v10020172mg [Eutrema salsugineum]
Length=703

 Score =   265 bits (678),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKWKEGFHVTSM TAGSR
Sbjct  548  NYYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWKEGFHVTSMATAGSR  607

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+GYSEQVVELDFLYPSEGIHRRW+ G+RITS AAT DQAA ILSIPRR+++D
Sbjct  608  WGVVMSRNSGYSEQVVELDFLYPSEGIHRRWDGGFRITSTAATTDQAALILSIPRRRLVD  667

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  668  ETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  702



>ref|XP_006849555.1| hypothetical protein AMTR_s00024p00176520 [Amborella trichopoda]
 gb|ERN11136.1| hypothetical protein AMTR_s00024p00176520 [Amborella trichopoda]
Length=707

 Score =   265 bits (677),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YIS+I GA NGSSLVVMSKGT YTQQSYKVS++FPFKWINKKW+EGFHVTSM TAGSR
Sbjct  552  NYYISAIGGANNGSSLVVMSKGTQYTQQSYKVSDTFPFKWINKKWREGFHVTSMATAGSR  611

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRNAG+S+QVVELDFLYPSEGIHRRW+SGYRIT+ AAT DQAA ILS+P+RK  D
Sbjct  612  WGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDSGYRITATAATFDQAALILSVPKRKPGD  671

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPS+HVKEKWSKNLY+ASICYGRTV
Sbjct  672  ETQETLRTSAFPSSHVKEKWSKNLYLASICYGRTV  706



>ref|XP_007024284.1| Casein kinase I protein isoform 1 [Theobroma cacao]
 gb|EOY26906.1| Casein kinase I protein isoform 1 [Theobroma cacao]
Length=727

 Score =   265 bits (678),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YIS+IAGA NG SLVVMS+GT Y+QQSYKVSESFPFKWINKKWKEGFHVTSM T+GSR
Sbjct  572  NYYISAIAGATNGFSLVVMSRGTQYSQQSYKVSESFPFKWINKKWKEGFHVTSMATSGSR  631

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSR AG+S+QVVELDFLYPSEGIHRRW+ GYRIT+ AAT DQAAF+LS+PRRK MD
Sbjct  632  WGVVMSRGAGFSDQVVELDFLYPSEGIHRRWDCGYRITATAATWDQAAFVLSVPRRKPMD  691

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  692  ETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  726


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 60/122 (49%), Gaps = 5/122 (4%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V++    + I K  ++G  ++S+ +  + W ++M    G+S QV EL   FL+  E I
Sbjct  507  YNVADGRLAQHIEKGNEDGLFISSVASCQNLWALIMDAGTGFSSQVYELSPHFLH-KEWI  565

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIA  258
              +WE  Y I+++A   +   F L +  R      Q    + +FP   + +KW +  ++ 
Sbjct  566  MEQWEKNYYISAIAGATN--GFSLVVMSRGTQYSQQSYKVSESFPFKWINKKWKEGFHVT  623

Query  257  SI  252
            S+
Sbjct  624  SM  625



>ref|XP_009413490.1| PREDICTED: uncharacterized protein LOC103994778 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009413491.1| PREDICTED: uncharacterized protein LOC103994778 [Musa acuminata 
subsp. malaccensis]
Length=717

 Score =   265 bits (677),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YI+S+AG+ NGSSLVVMSKGT YTQQSYKVSESFPFKWINKKWKEGFHVTSM TAGSR
Sbjct  562  NYYITSLAGSNNGSSLVVMSKGTQYTQQSYKVSESFPFKWINKKWKEGFHVTSMATAGSR  621

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WG+VMSRNAG+S+QVVELDFLYPSEGIHRRW++GYRIT M AT DQAA ILS+P+RK  D
Sbjct  622  WGIVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITCMGATWDQAALILSVPKRKPCD  681

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPS HVK+KW+KNLY+ASICYGRTV
Sbjct  682  ETQETLRTSAFPSAHVKDKWAKNLYLASICYGRTV  716


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/122 (24%), Positives = 66/122 (54%), Gaps = 5/122 (4%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD-FLYPSEGIH  435
            Y V+++   + I+K  ++G  ++ + ++ + W ++M    G++ Q+ EL  F    E + 
Sbjct  497  YNVADARLAQHIDKGNEDGLLISCVASSSNLWALIMDAGTGFTSQIYELSPFFLHKEWVM  556

Query  434  RRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIA  258
             +WE  Y ITS+A + + ++ ++     K    TQ++ + S +FP   + +KW +  ++ 
Sbjct  557  DQWEKNYYITSLAGSNNGSSLVVM---SKGTQYTQQSYKVSESFPFKWINKKWKEGFHVT  613

Query  257  SI  252
            S+
Sbjct  614  SM  615



>ref|XP_008351086.1| PREDICTED: uncharacterized protein LOC103414488 [Malus domestica]
Length=486

 Score =   259 bits (662),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSR
Sbjct  331  NYYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSR  390

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRNAG+S+QVVELDFLYPSEGIHRRW++G+RITS AAT DQAA ILS+P+RK  D
Sbjct  391  WGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGFRITSTAATWDQAALILSVPKRKPGD  450

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTS FPSTHVKEKW+KNLY+A +CYGRTV
Sbjct  451  ETQETLRTSQFPSTHVKEKWAKNLYLACLCYGRTV  485



>ref|XP_003552750.1| PREDICTED: serine/threonine-protein kinase VRK1-like [Glycine 
max]
 gb|KHN12581.1| Casein kinase I isoform alpha [Glycine soja]
Length=672

 Score =   264 bits (675),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 133/156 (85%), Positives = 146/156 (94%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YI+SIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSR
Sbjct  517  NYYITSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSR  576

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRNAG+S+QVVELDFLYPSEGIHRRW++GYRIT+ AAT DQ+A ILSIPRR+  D
Sbjct  577  WGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITATAATWDQSALILSIPRRRPGD  636

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTS FPSTHVKEKWSKNLY+A +CYGRTVC
Sbjct  637  ETQETLRTSQFPSTHVKEKWSKNLYLACLCYGRTVC  672



>ref|XP_003532324.1| PREDICTED: serine/threonine-protein kinase VRK1-like [Glycine 
max]
Length=672

 Score =   264 bits (675),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 133/156 (85%), Positives = 146/156 (94%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YI+SIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSR
Sbjct  517  NYYITSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSR  576

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRNAG+S+QVVELDFLYPSEGIHRRW++GYRIT+ AAT DQ+A ILSIPRR+  D
Sbjct  577  WGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITATAATWDQSALILSIPRRRPGD  636

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTS FPSTHVKEKWSKNLY+A +CYGRTVC
Sbjct  637  ETQETLRTSQFPSTHVKEKWSKNLYLACLCYGRTVC  672



>gb|KHN24964.1| Casein kinase I isoform alpha [Glycine soja]
Length=708

 Score =   265 bits (676),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 133/156 (85%), Positives = 146/156 (94%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YI+SIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSR
Sbjct  553  NYYITSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSR  612

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRNAG+S+QVVELDFLYPSEGIHRRW++GYRIT+ AAT DQ+A ILSIPRR+  D
Sbjct  613  WGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITATAATWDQSALILSIPRRRPGD  672

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTS FPSTHVKEKWSKNLY+A +CYGRTVC
Sbjct  673  ETQETLRTSQFPSTHVKEKWSKNLYLACLCYGRTVC  708



>ref|XP_008787870.1| PREDICTED: uncharacterized protein LOC103705792 [Phoenix dactylifera]
Length=730

 Score =   265 bits (677),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N++ISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM T+GSR
Sbjct  575  NYFISSIAGANNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMATSGSR  634

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRNAG+S+QVVELDFLYPSEGIHRRW++GYRITS+AAT DQAA ILS+P+RK  D
Sbjct  635  WGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITSVAATWDQAALILSVPKRKPGD  694

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPS HVK+KW+KNLY+A++CYGRTV
Sbjct  695  ETQETLRTSAFPSAHVKDKWAKNLYLAAVCYGRTV  729



>ref|XP_009404157.1| PREDICTED: uncharacterized protein LOC103987553 [Musa acuminata 
subsp. malaccensis]
Length=725

 Score =   265 bits (677),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YI+S+AGA NGSSLVVMSKGT YTQQSYKVSESFPFKWINKKWKEGFHVTSM TAG+R
Sbjct  570  NYYITSLAGANNGSSLVVMSKGTQYTQQSYKVSESFPFKWINKKWKEGFHVTSMATAGTR  629

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WG+VMSRNAG+S+QVVELDFLYPSEGIHRRW+ GYRITSMAAT DQAA ILS+P+RK  D
Sbjct  630  WGIVMSRNAGFSDQVVELDFLYPSEGIHRRWDGGYRITSMAATWDQAALILSVPKRKPGD  689

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTS+FPS HVK+KW+KNLY+ASICYGRTV
Sbjct  690  ETQETLRTSSFPSAHVKDKWAKNLYLASICYGRTV  724



>emb|CBI16476.3| unnamed protein product [Vitis vinifera]
Length=603

 Score =   262 bits (670),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            NFYISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSR
Sbjct  448  NFYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSR  507

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRNAG+S+QVVELDFLYPSEGIHRRW+SGYRITS AAT DQ+A ILS+P+RK  D
Sbjct  508  WGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDSGYRITSTAATWDQSALILSVPKRKPGD  567

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTS FPSTHVKEKW+KNLY+A +CYGRTV
Sbjct  568  ETQETLRTSQFPSTHVKEKWAKNLYLACVCYGRTV  602



>gb|ADE76410.1| unknown [Picea sitchensis]
Length=444

 Score =   258 bits (658),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 119/140 (85%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  LVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQV  474
            LVVMSKGTPYTQQSYKVS+ FPFKWINKKWKEGF+VTSM+TA SRWGVVMSRNAG+S+QV
Sbjct  304  LVVMSKGTPYTQQSYKVSDFFPFKWINKKWKEGFYVTSMSTAASRWGVVMSRNAGFSDQV  363

Query  473  VELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTH  294
            VELDFLYPSEGIHRRW+ G+RIT+ AAT DQAAFILS+P+RK  DETQETLRTSAFPSTH
Sbjct  364  VELDFLYPSEGIHRRWDGGFRITATAATWDQAAFILSVPKRKPGDETQETLRTSAFPSTH  423

Query  293  VKEKWSKNLYIASICYGRTV  234
            VKEKW+KNLY+A++CYGRTV
Sbjct  424  VKEKWAKNLYLAAVCYGRTV  443



>ref|XP_010939945.1| PREDICTED: uncharacterized protein LOC105058653 isoform X1 [Elaeis 
guineensis]
 ref|XP_010939946.1| PREDICTED: uncharacterized protein LOC105058653 isoform X1 [Elaeis 
guineensis]
Length=729

 Score =   265 bits (677),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N++ISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM T+GSR
Sbjct  574  NYFISSIAGANNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMATSGSR  633

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRNAG+S+QVVELDFLYPSEGIHRRW++GYRITS+AAT DQAA ILS+P+RK  D
Sbjct  634  WGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITSVAATWDQAALILSVPKRKPGD  693

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPS HVK+KW+KNLY+A++CYGRTV
Sbjct  694  ETQETLRTSAFPSAHVKDKWAKNLYLAAVCYGRTV  728



>emb|CDY55141.1| BnaC01g44810D [Brassica napus]
Length=632

 Score =   263 bits (671),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGAANGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSR
Sbjct  477  NYYISSIAGAANGSSLVVMSKGTAYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSR  536

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+GYSEQVVELDFLYPSEG+HRRW+ G+RITS AAT DQAA ILSIPRR+++D
Sbjct  537  WGVVMSRNSGYSEQVVELDFLYPSEGVHRRWDGGFRITSTAATTDQAALILSIPRRRLVD  596

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  597  ETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  631



>ref|XP_010939947.1| PREDICTED: uncharacterized protein LOC105058653 isoform X2 [Elaeis 
guineensis]
Length=725

 Score =   265 bits (676),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 148/155 (95%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N++ISSIAGA NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSM T+GSR
Sbjct  570  NYFISSIAGANNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMATSGSR  629

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRNAG+S+QVVELDFLYPSEGIHRRW++GYRITS+AAT DQAA ILS+P+RK  D
Sbjct  630  WGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITSVAATWDQAALILSVPKRKPGD  689

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPS HVK+KW+KNLY+A++CYGRTV
Sbjct  690  ETQETLRTSAFPSAHVKDKWAKNLYLAAVCYGRTV  724



>ref|XP_002882838.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59097.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=703

 Score =   264 bits (675),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSR
Sbjct  548  NYYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSR  607

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+GYSEQVVELDFLYPSEGIHRRW+ G+RITS AAT DQAA ILSIPRR+++D
Sbjct  608  WGVVMSRNSGYSEQVVELDFLYPSEGIHRRWDGGFRITSTAATTDQAALILSIPRRRLVD  667

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  668  ETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  702



>ref|XP_010656334.1| PREDICTED: uncharacterized protein LOC100254414 [Vitis vinifera]
 ref|XP_010656335.1| PREDICTED: uncharacterized protein LOC100254414 [Vitis vinifera]
 ref|XP_010656336.1| PREDICTED: uncharacterized protein LOC100254414 [Vitis vinifera]
Length=700

 Score =   264 bits (675),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            NFYI+S+AGA+NG++LVVMSKGTPY QQSYKVS+ FPFKWINKKWKEGF VTSMTTAGSR
Sbjct  545  NFYITSVAGASNGNALVVMSKGTPYNQQSYKVSDVFPFKWINKKWKEGFFVTSMTTAGSR  604

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WG+VMSRNAG+S QVVELDFLYPSEGIHRRWESGYRITS AATADQAAFILS  +R+  D
Sbjct  605  WGIVMSRNAGFSNQVVELDFLYPSEGIHRRWESGYRITSTAATADQAAFILSTSKRRTQD  664

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
             TQETLRTSAFP THVK+KWSKNLYIASICYGRTV
Sbjct  665  VTQETLRTSAFPCTHVKDKWSKNLYIASICYGRTV  699



>ref|XP_003621013.1| Casein kinase I isoform alpha [Medicago truncatula]
 gb|AES77231.1| casein kinase I-like protein [Medicago truncatula]
Length=599

 Score =   262 bits (669),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 132/156 (85%), Positives = 144/156 (92%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YI+SIAG  NGSSLVVMSKGT YTQQSYKVSESFPFKWINKKW+EGFHVTSM TAGSR
Sbjct  444  NYYITSIAGVTNGSSLVVMSKGTQYTQQSYKVSESFPFKWINKKWREGFHVTSMATAGSR  503

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRNAG+S+QVVELDFLYPSEGIHRRW++GYRIT+ AAT DQ+A ILS PRR+  D
Sbjct  504  WGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITATAATWDQSALILSKPRRRPAD  563

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTS FPSTHVKEKWSKNLY+A +CYGRTVC
Sbjct  564  ETQETLRTSQFPSTHVKEKWSKNLYLACLCYGRTVC  599



>gb|KFK38714.1| hypothetical protein AALP_AA3G150500 [Arabis alpina]
Length=700

 Score =   264 bits (675),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSR
Sbjct  545  NYYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSR  604

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+GYSEQVVELDFLYPSEGIHRRW+ G+RITS AAT DQAA ILSIPRR+++D
Sbjct  605  WGVVMSRNSGYSEQVVELDFLYPSEGIHRRWDGGFRITSTAATTDQAALILSIPRRRLVD  664

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  665  ETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  699



>ref|XP_007139114.1| hypothetical protein PHAVU_008G002500g [Phaseolus vulgaris]
 gb|ESW11108.1| hypothetical protein PHAVU_008G002500g [Phaseolus vulgaris]
Length=675

 Score =   263 bits (673),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 132/156 (85%), Positives = 146/156 (94%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            NFYI+SIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSR
Sbjct  520  NFYITSIAGANNGSSLVVMSKGTHYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSR  579

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+GY++QV+ELDFLYPSEGIHRRW++GYRIT+ AAT DQ+A ILSIPRR+  D
Sbjct  580  WGVVMSRNSGYTDQVIELDFLYPSEGIHRRWDNGYRITATAATWDQSALILSIPRRRPGD  639

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTS FPSTHVKEKWSKNLY+A +CYGRTVC
Sbjct  640  ETQETLRTSQFPSTHVKEKWSKNLYLACLCYGRTVC  675



>ref|XP_006297084.1| hypothetical protein CARUB_v10013087mg [Capsella rubella]
 gb|EOA29982.1| hypothetical protein CARUB_v10013087mg [Capsella rubella]
Length=704

 Score =   264 bits (674),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSR
Sbjct  549  NYYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSR  608

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+GYSEQVVELDFLYPSEGIHRRW+ G+RITS AAT DQAA ILSIPRR+++D
Sbjct  609  WGVVMSRNSGYSEQVVELDFLYPSEGIHRRWDGGFRITSTAATTDQAALILSIPRRRLVD  668

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  669  ETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  703



>emb|CDY51730.1| BnaA01g37130D [Brassica napus]
Length=684

 Score =   263 bits (673),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGAANGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSR
Sbjct  529  NYYISSIAGAANGSSLVVMSKGTAYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSR  588

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+GYSEQVVELDFLYPSEG+HRRW+ G+RITS AAT DQAA ILSIPRR+++D
Sbjct  589  WGVVMSRNSGYSEQVVELDFLYPSEGVHRRWDGGFRITSTAATTDQAALILSIPRRRLVD  648

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  649  ETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  683



>ref|XP_010500960.1| PREDICTED: uncharacterized protein LOC104778257 isoform X1 [Camelina 
sativa]
Length=711

 Score =   264 bits (674),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSR
Sbjct  556  NYYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSR  615

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+GYSEQVVELDFLYPSEGIHRRW+ G+RITS AAT DQAA ILSIPRR+++D
Sbjct  616  WGVVMSRNSGYSEQVVELDFLYPSEGIHRRWDGGFRITSTAATTDQAALILSIPRRRLVD  675

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  676  ETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  710



>ref|XP_010465212.1| PREDICTED: uncharacterized protein LOC104745616 [Camelina sativa]
Length=714

 Score =   264 bits (674),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSR
Sbjct  559  NYYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSR  618

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+GYSEQVVELDFLYPSEGIHRRW+ G+RITS AAT DQAA ILSIPRR+++D
Sbjct  619  WGVVMSRNSGYSEQVVELDFLYPSEGIHRRWDGGFRITSTAATTDQAALILSIPRRRLVD  678

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  679  ETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  713



>emb|CDX75726.1| BnaC03g38090D [Brassica napus]
Length=652

 Score =   262 bits (670),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAG+R
Sbjct  497  NYYISSIAGATNGSSLVVMSKGTAYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGTR  556

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+GYSEQVVELDFLYPSEGIHRRW+ G+RITS AAT DQAA ILSIPRR+++D
Sbjct  557  WGVVMSRNSGYSEQVVELDFLYPSEGIHRRWDGGFRITSTAATTDQAALILSIPRRRLVD  616

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  617  ETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  651



>ref|XP_010487127.1| PREDICTED: serine/threonine-protein kinase STE20-like [Camelina 
sativa]
Length=717

 Score =   264 bits (674),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSR
Sbjct  562  NYYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSR  621

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+GYSEQVVELDFLYPSEGIHRRW+ G+RITS AAT DQAA ILSIPRR+++D
Sbjct  622  WGVVMSRNSGYSEQVVELDFLYPSEGIHRRWDGGFRITSTAATTDQAALILSIPRRRLVD  681

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  682  ETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  716



>emb|CDX97505.1| BnaA05g25740D [Brassica napus]
Length=653

 Score =   262 bits (670),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGA NGSSLVVMSKGT Y+QQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSR
Sbjct  498  NYYISSIAGATNGSSLVVMSKGTQYSQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSR  557

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+GYSEQVVELDFLYPSEG+HRRW+ GYRITS AAT DQAA ILSIPRR++ D
Sbjct  558  WGVVMSRNSGYSEQVVELDFLYPSEGVHRRWDGGYRITSTAATTDQAALILSIPRRRLAD  617

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  618  ETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  652



>gb|KDP44321.1| hypothetical protein JCGZ_19188 [Jatropha curcas]
Length=710

 Score =   263 bits (672),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAG+ NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSR
Sbjct  555  NYYISSIAGSNNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSR  614

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRNAG+S+QVVELDFLYPSEGIHRRW++G+RITS AAT DQAA ILS+PRRK  D
Sbjct  615  WGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGFRITSTAATLDQAALILSVPRRKPGD  674

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTS FPSTHVKEKW+KNLY+A +CYGRTV
Sbjct  675  ETQETLRTSQFPSTHVKEKWAKNLYLACLCYGRTV  709



>emb|CAN69523.1| hypothetical protein VITISV_040873 [Vitis vinifera]
Length=670

 Score =   262 bits (670),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            NFYISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSR
Sbjct  515  NFYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSR  574

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRNAG+S+QVVELDFLYPSEGIHRRW+SGYRITS AAT DQ+A ILS+P+RK  D
Sbjct  575  WGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDSGYRITSTAATWDQSALILSVPKRKPGD  634

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTS FPSTHVKEKW+KNLY+A +CYGRTV
Sbjct  635  ETQETLRTSQFPSTHVKEKWAKNLYLACVCYGRTV  669



>gb|KHN18151.1| Casein kinase I like 2 [Glycine soja]
Length=486

 Score =   258 bits (658),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VT+M TAGSR
Sbjct  331  NYYISAIAGANNGSSLVVMSKGTQYLQQSYKVSDSFPFKWINKKWREGFYVTAMATAGSR  390

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            W +VMSR AG+S+QVVELDFLYPSEGIHRRW++GYRITS AAT DQAAF+LS+PRRK  D
Sbjct  391  WAIVMSRGAGFSDQVVELDFLYPSEGIHRRWDNGYRITSTAATWDQAAFVLSVPRRKPAD  450

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTV
Sbjct  451  ETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTV  485



>ref|XP_008352012.1| PREDICTED: uncharacterized protein LOC103415457 [Malus domestica]
Length=677

 Score =   262 bits (670),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YIS+IAGA NGSSLVVMSKGT Y QQSYKVSESFPFKWINKKW+EGFHVT+M TAGSR
Sbjct  522  NYYISAIAGANNGSSLVVMSKGTQYLQQSYKVSESFPFKWINKKWREGFHVTAMATAGSR  581

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            W +VMSR AG+SEQVVELDFLYPSEGIHRRW++GYRITS AAT DQAAF+LS+PRRK  D
Sbjct  582  WAIVMSRGAGFSEQVVELDFLYPSEGIHRRWDNGYRITSTAATWDQAAFVLSVPRRKPAD  641

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPSTHVKEKW KNLYIASICYGRTV
Sbjct  642  ETQETLRTSAFPSTHVKEKWGKNLYIASICYGRTV  676



>ref|XP_009146466.1| PREDICTED: uncharacterized protein LOC103870106 [Brassica rapa]
Length=689

 Score =   263 bits (671),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGAANGSSLVVMSKGT Y+QQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSR
Sbjct  534  NYYISSIAGAANGSSLVVMSKGTQYSQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSR  593

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+GYSEQVVELDFLYPSEG+HRRW+ GYRITS AAT DQAA ILSIPRR++ D
Sbjct  594  WGVVMSRNSGYSEQVVELDFLYPSEGVHRRWDGGYRITSTAATTDQAALILSIPRRRLAD  653

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  654  ETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  688



>ref|XP_010257513.1| PREDICTED: uncharacterized protein LOC104597586 [Nelumbo nucifera]
 ref|XP_010257516.1| PREDICTED: uncharacterized protein LOC104597586 [Nelumbo nucifera]
 ref|XP_010257517.1| PREDICTED: uncharacterized protein LOC104597586 [Nelumbo nucifera]
Length=726

 Score =   263 bits (673),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSR
Sbjct  571  NYYISSIAGATNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSR  630

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WG+VMSRNAG+S+QVVELDFLYPSEGIHRRW+SGYRITS AAT DQAA ILS+P+RK  D
Sbjct  631  WGIVMSRNAGFSDQVVELDFLYPSEGIHRRWDSGYRITSTAATWDQAALILSVPKRKPGD  690

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTS FPSTHVKEKW+KNLY+AS+CYGRTV
Sbjct  691  ETQETLRTSQFPSTHVKEKWAKNLYLASLCYGRTV  725



>ref|XP_004142151.1| PREDICTED: uncharacterized protein LOC101213194 [Cucumis sativus]
 ref|XP_008449783.1| PREDICTED: uncharacterized protein LOC103491568 [Cucumis melo]
 gb|KGN54092.1| hypothetical protein Csa_4G285680 [Cucumis sativus]
Length=694

 Score =   263 bits (671),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSR
Sbjct  539  NYYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSR  598

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRNAG+S+QVVELDFLYPSEGIHRRW++GYRITS AAT DQAA ILS+PRRK  D
Sbjct  599  WGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITSTAATWDQAALILSVPRRKPGD  658

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTS FPSTHVKEKW+KNLY+A +CYGRTV
Sbjct  659  ETQETLRTSQFPSTHVKEKWAKNLYLACLCYGRTV  693



>ref|XP_007013209.1| Kinase family protein isoform 5 [Theobroma cacao]
 gb|EOY30828.1| Kinase family protein isoform 5 [Theobroma cacao]
Length=473

 Score =   257 bits (657),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            NFYI+S+AGA NGS+LVVMSKGTPYTQQSYKVS+ FPFKWINKKWKEGF VTSMTTAGS+
Sbjct  318  NFYITSVAGAGNGSALVVMSKGTPYTQQSYKVSDVFPFKWINKKWKEGFSVTSMTTAGSK  377

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WG+VMSRNAGY  QVVELDFLYPSEGIHRRWE GYRITS AAT DQAAFILS P+RK  D
Sbjct  378  WGIVMSRNAGYPSQVVELDFLYPSEGIHRRWEKGYRITSAAATQDQAAFILSAPKRKSQD  437

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
              QETLRT+AFPSTHVK+KW KNLYI+ ICYGRTV
Sbjct  438  IMQETLRTTAFPSTHVKDKWLKNLYISCICYGRTV  472



>gb|KDO79864.1| hypothetical protein CISIN_1g005420mg [Citrus sinensis]
Length=512

 Score =   258 bits (659),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VT+M TAGSR
Sbjct  357  NYYISAIAGANNGSSLVVMSKGTQYLQQSYKVSDSFPFKWINKKWREGFYVTAMATAGSR  416

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            W +VMSR AG+S+QVVELDFLYPSEGIHRRW+SGYRITS AAT DQAAF+LS+PRRK  D
Sbjct  417  WAIVMSRGAGFSDQVVELDFLYPSEGIHRRWDSGYRITSTAATWDQAAFVLSVPRRKPAD  476

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  477  ETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  511


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/121 (21%), Positives = 63/121 (52%), Gaps = 3/121 (2%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD-FLYPSEGIH  435
            Y V+++   + I K  ++G  ++S+ +  + W ++M    G+S QV EL  +    E I 
Sbjct  292  YNVADARLSQHIEKGNEDGLFISSVASCSNLWALIMDAGTGFSAQVYELSPYFLHKEWIM  351

Query  434  RRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIAS  255
             +WE  Y I+++A   + ++ ++     + + ++ +   + +FP   + +KW +  Y+ +
Sbjct  352  EQWEKNYYISAIAGANNGSSLVVMSKGTQYLQQSYKV--SDSFPFKWINKKWREGFYVTA  409

Query  254  I  252
            +
Sbjct  410  M  410



>ref|XP_004162011.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101213194 
[Cucumis sativus]
Length=694

 Score =   263 bits (671),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSR
Sbjct  539  NYYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSR  598

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRNAG+S+QVVELDFLYPSEGIHRRW++GYRITS AAT DQAA ILS+PRRK  D
Sbjct  599  WGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITSTAATWDQAALILSVPRRKPGD  658

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTS FPSTHVKEKW+KNLY+A +CYGRTV
Sbjct  659  ETQETLRTSQFPSTHVKEKWAKNLYLACLCYGRTV  693



>ref|XP_008338530.1| PREDICTED: casein kinase I homolog 2-like [Malus domestica]
Length=538

 Score =   259 bits (661),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSR
Sbjct  383  NYYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSR  442

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRNAG+S+QVVELDFLYPSEGIHRRW+ G+RITS AAT DQAA ILS+P+RK  D
Sbjct  443  WGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDGGFRITSTAATWDQAALILSVPKRKPGD  502

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTS FPSTHVKEKW+KNLY+A +CYGRTV
Sbjct  503  ETQETLRTSQFPSTHVKEKWAKNLYLACLCYGRTV  537



>dbj|BAJ99119.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=480

 Score =   257 bits (657),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 125/156 (80%), Positives = 143/156 (92%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            NFYISS+AGA  GSSLVVMSKGTPYTQQSYKVS+SFPFKWINKKWKEGF+VTSM T+GSR
Sbjct  325  NFYISSVAGANTGSSLVVMSKGTPYTQQSYKVSDSFPFKWINKKWKEGFYVTSMATSGSR  384

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            W +VMSRNAG+++QVVELDFLYPSEG+HRRW++GYRIT+MAAT DQ+A ILS+PRR+  D
Sbjct  385  WAIVMSRNAGFTDQVVELDFLYPSEGVHRRWDNGYRITAMAATMDQSALILSMPRRRPRD  444

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLR S FPS HVK+KW+KNLY+A ICYGRTV 
Sbjct  445  ETQETLRASQFPSAHVKDKWAKNLYLAGICYGRTVA  480



>gb|EMS55588.1| Casein kinase I-like protein 2 [Triticum urartu]
Length=597

 Score =   260 bits (665),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 127/156 (81%), Positives = 144/156 (92%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            NFYISS+AGA  GSSLVVMSKGTPYTQQSYKVS+SFPFKWINKKWKEGFHVTSM T+GSR
Sbjct  442  NFYISSVAGANIGSSLVVMSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTSMATSGSR  501

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            W +VMSRNAG+++QVVELDFLYPSEG+HRRW++GYRIT+MAAT DQ+A ILS+PRR+  D
Sbjct  502  WAIVMSRNAGFTDQVVELDFLYPSEGVHRRWDNGYRITAMAATMDQSALILSMPRRRPRD  561

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTS FPS HVK+KW+KNLY+A ICYGRTV 
Sbjct  562  ETQETLRTSQFPSAHVKDKWAKNLYLAGICYGRTVA  597



>ref|NP_187977.1| protein kinase family protein [Arabidopsis thaliana]
 dbj|BAB01914.1| casein kinase-like protein [Arabidopsis thaliana]
 gb|AAL85021.1| putative casein kinase [Arabidopsis thaliana]
 gb|AAM51279.1| putative casein kinase [Arabidopsis thaliana]
 gb|AEE75390.1| protein kinase family protein [Arabidopsis thaliana]
Length=703

 Score =   263 bits (671),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGA+NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAG+R
Sbjct  548  NYYISSIAGASNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGNR  607

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+GYSEQVVELDFLYPSEGIHRRW+ G+RITS AAT DQAA ILSIPRR+++D
Sbjct  608  WGVVMSRNSGYSEQVVELDFLYPSEGIHRRWDGGFRITSTAATTDQAALILSIPRRRLVD  667

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  668  ETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  702



>gb|KJB56821.1| hypothetical protein B456_009G137100 [Gossypium raimondii]
Length=719

 Score =   263 bits (672),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YIS+IAGA NG SLVVMSKGT Y QQSYKVSESFPFKWINKKW+EGFHVTSM T+GSR
Sbjct  564  NYYISAIAGATNGGSLVVMSKGTSYLQQSYKVSESFPFKWINKKWREGFHVTSMATSGSR  623

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSR AG+S+QVVELDFLYPSEGIHRRW+SGYRIT+ AAT DQAAF+LS+PRR+  D
Sbjct  624  WGVVMSRGAGFSDQVVELDFLYPSEGIHRRWDSGYRITATAATWDQAAFVLSVPRRRPAD  683

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  684  ETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  718



>ref|XP_002283346.1| PREDICTED: uncharacterized protein LOC100263956 [Vitis vinifera]
Length=714

 Score =   263 bits (671),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            NFYISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSR
Sbjct  559  NFYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSR  618

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRNAG+S+QVVELDFLYPSEGIHRRW+SGYRITS AAT DQ+A ILS+P+RK  D
Sbjct  619  WGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDSGYRITSTAATWDQSALILSVPKRKPGD  678

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTS FPSTHVKEKW+KNLY+A +CYGRTV
Sbjct  679  ETQETLRTSQFPSTHVKEKWAKNLYLACVCYGRTV  713



>emb|CBI36074.3| unnamed protein product [Vitis vinifera]
Length=606

 Score =   260 bits (665),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            NFYIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VTSM T+GSR
Sbjct  451  NFYISAIAGATNGSSLVVMSKGTQYLQQSYKVSDSFPFKWINKKWREGFYVTSMATSGSR  510

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSR AG+SEQVVELDFLYPSEGIHRRW++G+RIT+ AAT DQAAF+LS+PRRK +D
Sbjct  511  WGVVMSRGAGFSEQVVELDFLYPSEGIHRRWDNGFRITATAATWDQAAFVLSVPRRKPVD  570

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  571  ETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  605



>tpg|DAA54810.1| TPA: hypothetical protein ZEAMMB73_098757 [Zea mays]
Length=326

 Score =   252 bits (644),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 123/156 (79%), Positives = 144/156 (92%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            +FYISS+AG+ NGSS+VVMSKGTPYTQQSYKVS+SFPFKWINKKWKEGFHVT+M T+G+R
Sbjct  171  SFYISSVAGSNNGSSIVVMSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTAMATSGNR  230

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            W +VMSR+AG+SEQVVELDFLYPSEGIHRRW++G+RIT+MAAT DQ+A ILS PRR+  D
Sbjct  231  WAIVMSRSAGFSEQVVELDFLYPSEGIHRRWDNGFRITAMAATMDQSALILSKPRRRPRD  290

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRT+ FPS HVK+KW+KNLY+A ICYGRTV 
Sbjct  291  ETQETLRTTQFPSQHVKDKWAKNLYLAGICYGRTVA  326



>ref|XP_010915404.1| PREDICTED: uncharacterized protein LOC105040538 [Elaeis guineensis]
Length=683

 Score =   262 bits (669),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YIS++AGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKWKEGF+VT+M TAGSR
Sbjct  528  NYYISALAGANNGSSLVVMSKGTQYAQQSYKVSDSFPFKWINKKWKEGFYVTAMATAGSR  587

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            W VVMSRNAG+S+QVVELDFLYPSEGIHRRW+SGYRIT+ AAT DQAAF+LS+PRRK  D
Sbjct  588  WAVVMSRNAGFSDQVVELDFLYPSEGIHRRWDSGYRITATAATWDQAAFVLSVPRRKPAD  647

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPS HVKEKWSKNLYIASICYGRTV
Sbjct  648  ETQETLRTSAFPSQHVKEKWSKNLYIASICYGRTV  682


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 65/123 (53%), Gaps = 7/123 (6%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V+++   + I K  ++G  ++S+ +  + W ++M    GY+ QV EL   FL+  E I
Sbjct  463  YNVADARLAQHIEKGNEDGLFISSVASCTNLWALIMDAGTGYTAQVYELSPCFLH-KEWI  521

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  Y I+++A   + ++ ++     K     Q++ + S +FP   + +KW +  Y+
Sbjct  522  MEQWEKNYYISALAGANNGSSLVVM---SKGTQYAQQSYKVSDSFPFKWINKKWKEGFYV  578

Query  260  ASI  252
             ++
Sbjct  579  TAM  581



>ref|XP_008228435.1| PREDICTED: uncharacterized protein LOC103327845 [Prunus mume]
Length=706

 Score =   262 bits (670),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YIS+IAGA NGSSLVVMSKGTP+TQQSYKVS++FPFKWINKKW+EGF+VT+M T+GSR
Sbjct  551  NYYISAIAGATNGSSLVVMSKGTPFTQQSYKVSDTFPFKWINKKWREGFYVTAMATSGSR  610

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            W VVMSR AGYSEQVVELDFLYPSEGIHRRW+SGYRIT+ AAT DQAAF+LS+PRRK  D
Sbjct  611  WAVVMSRGAGYSEQVVELDFLYPSEGIHRRWDSGYRITATAATWDQAAFVLSVPRRKPQD  670

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  671  ETQETLRTSAFPSTHVKEKWAKNLYIASMCYGRTV  705



>ref|XP_009406168.1| PREDICTED: uncharacterized protein LOC103989128 [Musa acuminata 
subsp. malaccensis]
Length=685

 Score =   262 bits (669),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YI+++AGA N SSLVVMSKGT Y QQSYKVSESFPFKWINKKW+EGF+VT+M TAG+R
Sbjct  530  NYYITALAGANNVSSLVVMSKGTQYVQQSYKVSESFPFKWINKKWREGFYVTAMATAGTR  589

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRNAG+S+QVVELDFLYPSEGIHRRW+ GYRIT+ AAT DQAAF+LS+PRRK  D
Sbjct  590  WGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDGGYRITATAATMDQAAFVLSVPRRKPTD  649

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPS HVKEKW+KNLYIAS+CYGRTV
Sbjct  650  ETQETLRTSAFPSQHVKEKWAKNLYIASVCYGRTV  684



>gb|KJB21848.1| hypothetical protein B456_004G018000 [Gossypium raimondii]
Length=704

 Score =   262 bits (670),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAG+ +G+SLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGF+VTSMTTAGSR
Sbjct  549  NYYISSIAGSNSGNSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFYVTSMTTAGSR  608

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRNAG+S+QVVELDFLYPSEGIHRRW+SGYRITS AAT DQAA ILSIP+RK  D
Sbjct  609  WGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDSGYRITSTAATLDQAALILSIPKRKPGD  668

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTS FPS HVKEKW+KNLY+A +CYGRTV
Sbjct  669  ETQETLRTSQFPSIHVKEKWAKNLYLACLCYGRTV  703



>ref|XP_004491691.1| PREDICTED: serine/threonine-protein kinase VRK1-like [Cicer arietinum]
Length=667

 Score =   261 bits (668),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 131/156 (84%), Positives = 144/156 (92%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YI+SIAG  NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSR
Sbjct  512  NYYITSIAGVTNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSR  571

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRNAG+S+QVVELDFLYPSEGIHRRW++GYRIT+ AAT DQ+A ILS PRR+  D
Sbjct  572  WGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITATAATWDQSALILSKPRRRPAD  631

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTS FPSTHVKEKWSKNLY+A +CYGRTVC
Sbjct  632  ETQETLRTSQFPSTHVKEKWSKNLYLACLCYGRTVC  667



>ref|XP_008655737.1| PREDICTED: uncharacterized protein LOC103634938 [Zea mays]
 gb|AFW80326.1| hypothetical protein ZEAMMB73_054184 [Zea mays]
 gb|AFW80327.1| hypothetical protein ZEAMMB73_054184 [Zea mays]
Length=332

 Score =   252 bits (644),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 126/155 (81%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            NFYI+++AGA NGSSLV+MS+GT Y QQSYKVS++FPFKWINKKWKEGF+VT+M TAGSR
Sbjct  177  NFYITALAGANNGSSLVIMSRGTQYAQQSYKVSDTFPFKWINKKWKEGFYVTAMATAGSR  236

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            W VVMSRNAG++ QVVELDFLYPSEGIH RW++GYRIT+ AAT DQAAFILSIPRRK  D
Sbjct  237  WAVVMSRNAGFTSQVVELDFLYPSEGIHMRWDNGYRITATAATWDQAAFILSIPRRKPSD  296

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPS HVK+KWSKNLY+ASICYGR+V
Sbjct  297  ETQETLRTSAFPSQHVKDKWSKNLYLASICYGRSV  331



>ref|XP_009117581.1| PREDICTED: uncharacterized protein LOC103842673 [Brassica rapa]
Length=683

 Score =   261 bits (668),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGAANGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSR
Sbjct  528  NYYISSIAGAANGSSLVVMSKGTAYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSR  587

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+GYSEQVVELDFLYPSEG+HRRW+ G+RITS AAT DQAA ILSIPRR+++D
Sbjct  588  WGVVMSRNSGYSEQVVELDFLYPSEGVHRRWDGGFRITSTAATTDQAALILSIPRRRLVD  647

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            +TQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  648  KTQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  682



>emb|CDX82524.1| BnaA03g32970D [Brassica napus]
Length=654

 Score =   261 bits (666),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGAANGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAG+R
Sbjct  499  NYYISSIAGAANGSSLVVMSKGTAYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGTR  558

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+GYSEQVVELDFLYPSEGIHRRW+ G+RITS AAT DQ A ILSIPRR+++D
Sbjct  559  WGVVMSRNSGYSEQVVELDFLYPSEGIHRRWDGGFRITSTAATTDQTALILSIPRRRLVD  618

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  619  ETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  653



>ref|XP_009395056.1| PREDICTED: uncharacterized protein LOC103980386 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=680

 Score =   261 bits (668),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISS+AGA NGSSLVVMSKGTPY QQSYKVSESFPFKWINKKW+EGF+VT+M TAG+R
Sbjct  525  NYYISSLAGADNGSSLVVMSKGTPYAQQSYKVSESFPFKWINKKWREGFYVTAMATAGNR  584

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            W VVMSRNAG+ EQVVELDFLYPSEGIHRRW+SGYRIT+ AAT DQAAF+LS+PRRK +D
Sbjct  585  WAVVMSRNAGFLEQVVELDFLYPSEGIHRRWDSGYRITATAATWDQAAFVLSVPRRKPVD  644

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPS HVKEKW+KNLY+AS+CYGRTV
Sbjct  645  ETQETLRTSAFPSQHVKEKWAKNLYLASVCYGRTV  679



>gb|KFK32550.1| hypothetical protein AALP_AA6G257400 [Arabis alpina]
Length=673

 Score =   261 bits (667),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YI+++AGA NGSS VVMSKGTPY QQSYKVS+SFPFKWINKKWKEGF+VTSM TAGS+
Sbjct  518  NYYITAVAGANNGSSFVVMSKGTPYLQQSYKVSDSFPFKWINKKWKEGFYVTSMATAGSK  577

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WG+VMSR AG+S+QVVELDFLYPSEGIHRRW++GYRITS+AAT DQAA +LS+PRRK  D
Sbjct  578  WGIVMSRGAGFSDQVVELDFLYPSEGIHRRWDNGYRITSVAATCDQAALVLSVPRRKPSD  637

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPSTHVKEKW+KNLYI+S+CYGRTV
Sbjct  638  ETQETLRTSAFPSTHVKEKWAKNLYISSMCYGRTV  672



>ref|XP_009135319.1| PREDICTED: uncharacterized protein LOC103859531 [Brassica rapa]
Length=676

 Score =   261 bits (667),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGAANGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAG+R
Sbjct  521  NYYISSIAGAANGSSLVVMSKGTAYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGTR  580

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRN+GYSEQVVELDFLYPSEGIHRRW+ G+RITS AAT DQ A ILSIPRR+++D
Sbjct  581  WGVVMSRNSGYSEQVVELDFLYPSEGIHRRWDGGFRITSTAATTDQTALILSIPRRRLVD  640

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTS FPSTHVKEKW KNLY+AS+ YGRTV
Sbjct  641  ETQETLRTSQFPSTHVKEKWGKNLYLASLSYGRTV  675



>ref|XP_009395055.1| PREDICTED: uncharacterized protein LOC103980386 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=684

 Score =   261 bits (667),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISS+AGA NGSSLVVMSKGTPY QQSYKVSESFPFKWINKKW+EGF+VT+M TAG+R
Sbjct  529  NYYISSLAGADNGSSLVVMSKGTPYAQQSYKVSESFPFKWINKKWREGFYVTAMATAGNR  588

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            W VVMSRNAG+ EQVVELDFLYPSEGIHRRW+SGYRIT+ AAT DQAAF+LS+PRRK +D
Sbjct  589  WAVVMSRNAGFLEQVVELDFLYPSEGIHRRWDSGYRITATAATWDQAAFVLSVPRRKPVD  648

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPS HVKEKW+KNLY+AS+CYGRTV
Sbjct  649  ETQETLRTSAFPSQHVKEKWAKNLYLASVCYGRTV  683



>gb|KHG14825.1| hypothetical protein F383_08945 [Gossypium arboreum]
Length=719

 Score =   262 bits (669),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YIS+IAGA NG SLVVMSKGT Y QQSYKVSESFPFKWINKKW+EGFHVTSM T+GSR
Sbjct  564  NYYISAIAGATNGGSLVVMSKGTSYLQQSYKVSESFPFKWINKKWREGFHVTSMATSGSR  623

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSR AG+S+QVVELDFLYPSEGIHRRW++GYRIT+ AAT DQAAF+LS+PRR+  D
Sbjct  624  WGVVMSRGAGFSDQVVELDFLYPSEGIHRRWDNGYRITATAATWDQAAFVLSVPRRRPTD  683

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  684  ETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  718



>ref|XP_002531638.1| casein kinase, putative [Ricinus communis]
 gb|EEF30734.1| casein kinase, putative [Ricinus communis]
Length=703

 Score =   261 bits (668),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSR
Sbjct  548  NYYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSR  607

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRNAG+S+QVVELDFLYPSEGIHRRW++G+RITS AAT DQAA ILS+PRRK  D
Sbjct  608  WGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGFRITSTAATFDQAALILSVPRRKPGD  667

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTS FPSTHVKEKW+KNLY+A +CYGRTV
Sbjct  668  ETQETLRTSQFPSTHVKEKWAKNLYLACLCYGRTV  702



>tpg|DAA54809.1| TPA: hypothetical protein ZEAMMB73_098757 [Zea mays]
Length=346

 Score =   252 bits (643),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            +FYISS+AG+ NGSS+VVMSKGTPYTQQSYKVS+SFPFKWINKKWKEGFHVT+M T+G+R
Sbjct  191  SFYISSVAGSNNGSSIVVMSKGTPYTQQSYKVSDSFPFKWINKKWKEGFHVTAMATSGNR  250

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            W +VMSR+AG+SEQVVELDFLYPSEGIHRRW++G+RIT+MAAT DQ+A ILS PRR+  D
Sbjct  251  WAIVMSRSAGFSEQVVELDFLYPSEGIHRRWDNGFRITAMAATMDQSALILSKPRRRPRD  310

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRT+ FPS HVK+KW+KNLY+A ICYGRTV
Sbjct  311  ETQETLRTTQFPSQHVKDKWAKNLYLAGICYGRTV  345



>ref|XP_010249522.1| PREDICTED: uncharacterized protein LOC104592067 isoform X2 [Nelumbo 
nucifera]
Length=693

 Score =   261 bits (668),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VTSM TAGSR
Sbjct  538  NYYISAIAGANNGSSLVVMSKGTQYAQQSYKVSDSFPFKWINKKWREGFYVTSMATAGSR  597

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSR+AG+S+QVVELDFLYPSEGIHRRW+SGYRIT+ AAT DQAAF+LS+PRRK  D
Sbjct  598  WGVVMSRSAGFSDQVVELDFLYPSEGIHRRWDSGYRITATAATWDQAAFVLSVPRRKPAD  657

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPSTHVK+KW+KNLYIAS+CYGRTV
Sbjct  658  ETQETLRTSAFPSTHVKDKWAKNLYIASVCYGRTV  692



>ref|XP_010249521.1| PREDICTED: uncharacterized protein LOC104592067 isoform X1 [Nelumbo 
nucifera]
Length=697

 Score =   261 bits (668),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VTSM TAGSR
Sbjct  542  NYYISAIAGANNGSSLVVMSKGTQYAQQSYKVSDSFPFKWINKKWREGFYVTSMATAGSR  601

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSR+AG+S+QVVELDFLYPSEGIHRRW+SGYRIT+ AAT DQAAF+LS+PRRK  D
Sbjct  602  WGVVMSRSAGFSDQVVELDFLYPSEGIHRRWDSGYRITATAATWDQAAFVLSVPRRKPAD  661

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPSTHVK+KW+KNLYIAS+CYGRTV
Sbjct  662  ETQETLRTSAFPSTHVKDKWAKNLYIASVCYGRTV  696



>ref|XP_002283957.2| PREDICTED: uncharacterized protein LOC100253221 [Vitis vinifera]
Length=704

 Score =   261 bits (668),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            NFYIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VTSM T+GSR
Sbjct  549  NFYISAIAGATNGSSLVVMSKGTQYLQQSYKVSDSFPFKWINKKWREGFYVTSMATSGSR  608

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSR AG+SEQVVELDFLYPSEGIHRRW++G+RIT+ AAT DQAAF+LS+PRRK +D
Sbjct  609  WGVVMSRGAGFSEQVVELDFLYPSEGIHRRWDNGFRITATAATWDQAAFVLSVPRRKPVD  668

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  669  ETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  703



>emb|CAN77676.1| hypothetical protein VITISV_013722 [Vitis vinifera]
Length=710

 Score =   261 bits (668),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            NFYIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VTSM T+GSR
Sbjct  555  NFYISAIAGATNGSSLVVMSKGTQYLQQSYKVSDSFPFKWINKKWREGFYVTSMATSGSR  614

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSR AG+SEQVVELDFLYPSEGIHRRW++G+RIT+ AAT DQAAF+LS+PRRK +D
Sbjct  615  WGVVMSRGAGFSEQVVELDFLYPSEGIHRRWDNGFRITATAATWDQAAFVLSVPRRKPVD  674

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  675  ETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  709



>ref|XP_007014775.1| Kinase family protein isoform 2 [Theobroma cacao]
 gb|EOY32394.1| Kinase family protein isoform 2 [Theobroma cacao]
Length=701

 Score =   261 bits (667),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 147/155 (95%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YIS+IAG+++GSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGF+VTSM TAGSR
Sbjct  546  NYYISAIAGSSSGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFYVTSMATAGSR  605

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRNAG+S+QVVELDFLYPSEGIHRRW++GYRITS AAT+DQAA ILSIP+RK  D
Sbjct  606  WGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGYRITSTAATSDQAALILSIPKRKPGD  665

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTS FPSTHVKEKW+KNLY+A +CYGRTV
Sbjct  666  ETQETLRTSQFPSTHVKEKWAKNLYLACLCYGRTV  700



>ref|XP_007024285.1| Kinase family protein isoform 2 [Theobroma cacao]
 gb|EOY26907.1| Kinase family protein isoform 2 [Theobroma cacao]
Length=483

 Score =   256 bits (653),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 144/155 (93%), Gaps = 2/155 (1%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YIS+IAGA NG SLVVMS+GT Y+QQSYKVSESFPFKWINKKWKEGFHVTSM T+GSR
Sbjct  330  NYYISAIAGATNGFSLVVMSRGTQYSQQSYKVSESFPFKWINKKWKEGFHVTSMATSGSR  389

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSR AG+S+QVVELDFLYPSEGIHRRW+ GYRIT+ AAT DQAAF+LS+PRRK MD
Sbjct  390  WGVVMSRGAGFSDQVVELDFLYPSEGIHRRWDCGYRITATAATWDQAAFVLSVPRRKPMD  449

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPSTHV  KW+KNLYIAS+CYGRTV
Sbjct  450  ETQETLRTSAFPSTHV--KWAKNLYIASVCYGRTV  482


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 60/122 (49%), Gaps = 5/122 (4%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V++    + I K  ++G  ++S+ +  + W ++M    G+S QV EL   FL+  E I
Sbjct  265  YNVADGRLAQHIEKGNEDGLFISSVASCQNLWALIMDAGTGFSSQVYELSPHFLH-KEWI  323

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIA  258
              +WE  Y I+++A   +   F L +  R      Q    + +FP   + +KW +  ++ 
Sbjct  324  MEQWEKNYYISAIAGATN--GFSLVVMSRGTQYSQQSYKVSESFPFKWINKKWKEGFHVT  381

Query  257  SI  252
            S+
Sbjct  382  SM  383



>ref|XP_010267169.1| PREDICTED: uncharacterized protein LOC104604501 isoform X2 [Nelumbo 
nucifera]
Length=693

 Score =   261 bits (666),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VTSM TAGSR
Sbjct  538  NYYISAIAGANNGSSLVVMSKGTQYAQQSYKVSDSFPFKWINKKWREGFYVTSMATAGSR  597

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            W VVMSR+AG+S+QVVELDFLYPSEGIHRRW+SGYRIT+ AAT DQAAF+LS+PRRK  D
Sbjct  598  WAVVMSRSAGFSDQVVELDFLYPSEGIHRRWDSGYRITATAATWDQAAFVLSVPRRKPAD  657

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  658  ETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  692



>ref|XP_010267167.1| PREDICTED: uncharacterized protein LOC104604501 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010267168.1| PREDICTED: uncharacterized protein LOC104604501 isoform X1 [Nelumbo 
nucifera]
Length=697

 Score =   261 bits (666),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VTSM TAGSR
Sbjct  542  NYYISAIAGANNGSSLVVMSKGTQYAQQSYKVSDSFPFKWINKKWREGFYVTSMATAGSR  601

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            W VVMSR+AG+S+QVVELDFLYPSEGIHRRW+SGYRIT+ AAT DQAAF+LS+PRRK  D
Sbjct  602  WAVVMSRSAGFSDQVVELDFLYPSEGIHRRWDSGYRITATAATWDQAAFVLSVPRRKPAD  661

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  662  ETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  696



>gb|AAT44311.1| putative casein kinase [Oryza sativa Japonica Group]
 gb|AAV59374.1| putative casein kinase [Oryza sativa Japonica Group]
Length=608

 Score =   259 bits (661),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            NFYI+S+AGA NGSSLVVMS+GT Y QQSYKVS+SFPFKWINKKWKEGF+VT+M TAGSR
Sbjct  453  NFYITSLAGANNGSSLVVMSRGTQYAQQSYKVSDSFPFKWINKKWKEGFYVTAMATAGSR  512

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            W VVMSRNAG+++QVVELDFLYPSEGIHRRW++G+RIT+ AAT DQAAFILSIPRRK  D
Sbjct  513  WAVVMSRNAGFTDQVVELDFLYPSEGIHRRWDNGFRITATAATWDQAAFILSIPRRKPAD  572

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPS HVKEKWSKNLY+ASICYGRTV
Sbjct  573  ETQETLRTSAFPSQHVKEKWSKNLYLASICYGRTV  607



>gb|ACO87665.1| protein kinase [Brachypodium sylvaticum]
Length=648

 Score =   259 bits (663),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 127/156 (81%), Positives = 145/156 (93%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            NFYISS+AG+ NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGF+VTSM T+GSR
Sbjct  493  NFYISSVAGSNNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFYVTSMATSGSR  552

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            W +VMSRNAG+++QVVELDFLYPSEGIH+RW++GYRIT+MAAT DQ+A ILS+PRR+  D
Sbjct  553  WAIVMSRNAGFTDQVVELDFLYPSEGIHKRWDNGYRITAMAATMDQSALILSMPRRRPRD  612

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTS FPS HVK+KW+KNLY+A ICYGRTV 
Sbjct  613  ETQETLRTSQFPSAHVKDKWAKNLYLAGICYGRTVA  648



>ref|XP_010526089.1| PREDICTED: casein kinase I-like [Tarenaya hassleriana]
 ref|XP_010526090.1| PREDICTED: casein kinase I-like [Tarenaya hassleriana]
 ref|XP_010526091.1| PREDICTED: casein kinase I-like [Tarenaya hassleriana]
 ref|XP_010526092.1| PREDICTED: casein kinase I-like [Tarenaya hassleriana]
 ref|XP_010526093.1| PREDICTED: casein kinase I-like [Tarenaya hassleriana]
 ref|XP_010526094.1| PREDICTED: casein kinase I-like [Tarenaya hassleriana]
 ref|XP_010526095.1| PREDICTED: casein kinase I-like [Tarenaya hassleriana]
Length=601

 Score =   258 bits (660),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YI++IAGA NGSSLVVMSKGT Y QQSYKVSESFPFKWINKKW+EGF+VTSM TAGSR
Sbjct  446  NYYITAIAGANNGSSLVVMSKGTQYLQQSYKVSESFPFKWINKKWREGFYVTSMATAGSR  505

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            W +VMSR AG+S+QVVELDFLYPSEG+HRRW++GYRITS+AAT+DQAA +LS+PRRK  D
Sbjct  506  WAIVMSRGAGFSDQVVELDFLYPSEGVHRRWDNGYRITSIAATSDQAALVLSVPRRKPAD  565

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPSTHVKEKW KNLYIA ICYGRTV
Sbjct  566  ETQETLRTSAFPSTHVKEKWGKNLYIACICYGRTV  600


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/122 (24%), Positives = 64/122 (52%), Gaps = 5/122 (4%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V++    + I+K  ++G  ++S+ +  + W ++M    GY+ QV +L   FL+  E I
Sbjct  381  YNVTDMRLAQHIDKGNEDGLFISSVASCSNLWALIMDAGTGYTAQVYQLSPCFLH-KEWI  439

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIA  258
               WE  Y IT++A   + ++ ++     + + ++ +   + +FP   + +KW +  Y+ 
Sbjct  440  MENWEKNYYITAIAGANNGSSLVVMSKGTQYLQQSYKV--SESFPFKWINKKWREGFYVT  497

Query  257  SI  252
            S+
Sbjct  498  SM  499



>gb|EEC78673.1| hypothetical protein OsI_18806 [Oryza sativa Indica Group]
Length=607

 Score =   259 bits (661),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            NFYI+S+AGA NGSSLVVMS+GT Y QQSYKVS+SFPFKWINKKWKEGF+VT+M TAGSR
Sbjct  452  NFYITSLAGANNGSSLVVMSRGTQYAQQSYKVSDSFPFKWINKKWKEGFYVTAMATAGSR  511

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            W VVMSRNAG+++QVVELDFLYPSEGIHRRW++G+RIT+ AAT DQAAFILSIPRRK  D
Sbjct  512  WAVVMSRNAGFTDQVVELDFLYPSEGIHRRWDNGFRITATAATWDQAAFILSIPRRKPAD  571

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPS HVKEKWSKNLY+ASICYGRTV
Sbjct  572  ETQETLRTSAFPSQHVKEKWSKNLYLASICYGRTV  606



>dbj|BAG92829.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE62667.1| hypothetical protein OsJ_17470 [Oryza sativa Japonica Group]
Length=607

 Score =   259 bits (661),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            NFYI+S+AGA NGSSLVVMS+GT Y QQSYKVS+SFPFKWINKKWKEGF+VT+M TAGSR
Sbjct  452  NFYITSLAGANNGSSLVVMSRGTQYAQQSYKVSDSFPFKWINKKWKEGFYVTAMATAGSR  511

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            W VVMSRNAG+++QVVELDFLYPSEGIHRRW++G+RIT+ AAT DQAAFILSIPRRK  D
Sbjct  512  WAVVMSRNAGFTDQVVELDFLYPSEGIHRRWDNGFRITATAATWDQAAFILSIPRRKPAD  571

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPS HVKEKWSKNLY+ASICYGRTV
Sbjct  572  ETQETLRTSAFPSQHVKEKWSKNLYLASICYGRTV  606



>ref|XP_002516524.1| casein kinase, putative [Ricinus communis]
 gb|EEF45865.1| casein kinase, putative [Ricinus communis]
Length=671

 Score =   260 bits (664),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            NFYIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VT+M TAGSR
Sbjct  516  NFYISAIAGANNGSSLVVMSKGTQYLQQSYKVSDSFPFKWINKKWREGFYVTAMATAGSR  575

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            W +VMSR AG+S+QVVELDFLYPSEGIHRRW+SGYRITS AAT DQAAF+LS+PRRK  D
Sbjct  576  WAIVMSRGAGFSDQVVELDFLYPSEGIHRRWDSGYRITSTAATWDQAAFVLSVPRRKPAD  635

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  636  ETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  670



>ref|XP_008378069.1| PREDICTED: uncharacterized protein LOC103441148 [Malus domestica]
Length=683

 Score =   260 bits (665),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YIS+IAGA NGSSLVVMSKGT Y QQSYKVSESFPFKWINKKW+EGFHVT+M TAGSR
Sbjct  528  NYYISAIAGANNGSSLVVMSKGTQYLQQSYKVSESFPFKWINKKWREGFHVTAMATAGSR  587

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            W +VMSR AG+S QVVELDFLYPSEGIHRRW++GYRITS AAT DQAAF+LS+PRRK  D
Sbjct  588  WAIVMSRGAGFSXQVVELDFLYPSEGIHRRWDNGYRITSTAATWDQAAFVLSVPRRKPAD  647

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPSTHVKEKW KNLYIASICYGRTV
Sbjct  648  ETQETLRTSAFPSTHVKEKWGKNLYIASICYGRTV  682



>emb|CDY21505.1| BnaC03g26920D [Brassica napus]
Length=615

 Score =   258 bits (660),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YI+++AGA NGSS VVMSKGTPY QQSYKVS+SFPFKWINKKW+EGF+VTSM TAGS+
Sbjct  460  NYYITAVAGADNGSSFVVMSKGTPYLQQSYKVSDSFPFKWINKKWREGFYVTSMATAGSK  519

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WG+VMSR A +S+QVVELDFLYPSEGIHRRW++GYRITS+AAT DQAAF+LS+PRRK  D
Sbjct  520  WGIVMSRGAAFSDQVVELDFLYPSEGIHRRWDNGYRITSIAATWDQAAFVLSVPRRKPTD  579

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPS HVKEKWSKNLYI+SICYGRTV
Sbjct  580  ETQETLRTSAFPSNHVKEKWSKNLYISSICYGRTV  614



>ref|XP_010047289.1| PREDICTED: uncharacterized protein LOC104436263 [Eucalyptus grandis]
 gb|KCW79164.1| hypothetical protein EUGRSUZ_C00608 [Eucalyptus grandis]
Length=605

 Score =   258 bits (660),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YI+++AGA+NGSSLVVMSKGTPY QQSYKVS+SFPFKWINKKW+EGF+VTSM TAG+R
Sbjct  450  NYYITAVAGASNGSSLVVMSKGTPYLQQSYKVSDSFPFKWINKKWREGFYVTSMATAGTR  509

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            W V+MSR AG+++QVVELDFLYPSEGIHRRW+ GYRITS AAT DQ+A ILSIPRRK  D
Sbjct  510  WAVIMSRGAGFTDQVVELDFLYPSEGIHRRWDCGYRITSTAATLDQSALILSIPRRKPTD  569

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  570  ETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  604


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/123 (27%), Positives = 67/123 (54%), Gaps = 7/123 (6%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V++    + I+K  ++G  ++S+ +  + W ++M    G+S+QV EL   FL+  E I
Sbjct  385  YNVADIRLSQHIDKGNEDGLFISSVASCSNLWALIMDAGTGFSDQVYELSSYFLH-KEWI  443

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYI  261
              +WE  Y IT++A  ++ ++ ++     K     Q++ + S +FP   + +KW +  Y+
Sbjct  444  MEQWEKNYYITAVAGASNGSSLVV---MSKGTPYLQQSYKVSDSFPFKWINKKWREGFYV  500

Query  260  ASI  252
             S+
Sbjct  501  TSM  503



>ref|XP_010033842.1| PREDICTED: uncharacterized protein LOC104423081 [Eucalyptus grandis]
 ref|XP_010033843.1| PREDICTED: uncharacterized protein LOC104423081 [Eucalyptus grandis]
 gb|KCW53681.1| hypothetical protein EUGRSUZ_J02945 [Eucalyptus grandis]
Length=709

 Score =   261 bits (666),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YIS+I G+ NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKWKEGF+VTSM TAGSR
Sbjct  554  NYYISAIGGSTNGSSLVVMSKGTQYLQQSYKVSDSFPFKWINKKWKEGFYVTSMGTAGSR  613

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            W +VMSR AG+SEQVVELDFLYPSEGIHRRW+SGYRIT+ AAT DQAAF+LSIPRRK  D
Sbjct  614  WAIVMSRGAGFSEQVVELDFLYPSEGIHRRWDSGYRITATAATWDQAAFVLSIPRRKPTD  673

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPSTHVKEKW+KNLY+ASICYGRTV
Sbjct  674  ETQETLRTSAFPSTHVKEKWAKNLYLASICYGRTV  708



>gb|EMT06030.1| Casein kinase I-2-like protein [Aegilops tauschii]
Length=597

 Score =   258 bits (659),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 126/156 (81%), Positives = 144/156 (92%), Gaps = 0/156 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            NFYISS+AGA  GSSLVVMSKGTPYTQQSYKVS+SFPFKWINKKWKEGF+VTSM T+GSR
Sbjct  442  NFYISSVAGANIGSSLVVMSKGTPYTQQSYKVSDSFPFKWINKKWKEGFYVTSMATSGSR  501

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            W +VMSRNAG+++QVVELDFLYPSEG+HRRW++GYRIT+MAAT DQ+A ILS+PRR+  D
Sbjct  502  WAIVMSRNAGFTDQVVELDFLYPSEGVHRRWDNGYRITAMAATMDQSALILSMPRRRPRD  561

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC  231
            ETQETLRTS FPS HVK+KW+KNLY+A ICYGRTV 
Sbjct  562  ETQETLRTSQFPSAHVKDKWAKNLYLAGICYGRTVA  597



>ref|XP_008791563.1| PREDICTED: uncharacterized protein LOC103708420 [Phoenix dactylifera]
Length=683

 Score =   260 bits (664),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            NFYIS++AGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKWKEGF+VT+M TAG+R
Sbjct  528  NFYISALAGANNGSSLVVMSKGTQYAQQSYKVSDSFPFKWINKKWKEGFYVTAMATAGTR  587

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            W VVMSRNAG+S+QVVELDFLYPSEGIHRRW+ GYRIT+ AAT DQAAF+LS+PRRK  D
Sbjct  588  WAVVMSRNAGFSDQVVELDFLYPSEGIHRRWDGGYRITATAATWDQAAFVLSVPRRKPAD  647

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPS HVKEKW+KNLYIASICYGRTV
Sbjct  648  ETQETLRTSAFPSQHVKEKWAKNLYIASICYGRTV  682



>ref|XP_010546534.1| PREDICTED: uncharacterized protein LOC104818596 [Tarenaya hassleriana]
Length=701

 Score =   260 bits (665),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YI++IAG  NGSSLVVMSKGT Y QQSYKVSESFPFKWINKKW+EGF+VTSM TAGSR
Sbjct  546  NYYITAIAGTNNGSSLVVMSKGTQYLQQSYKVSESFPFKWINKKWREGFYVTSMATAGSR  605

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            W +VMSR AG+S+QVVELDFLYPSEGIHRRW+SGYRITS+AAT DQAA ILS+PRRK  D
Sbjct  606  WAIVMSRGAGFSDQVVELDFLYPSEGIHRRWDSGYRITSLAATLDQAALILSVPRRKPAD  665

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPSTHVKEKW KNLYIA ICYGRTV
Sbjct  666  ETQETLRTSAFPSTHVKEKWGKNLYIAYICYGRTV  700


 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 30/122 (25%), Positives = 67/122 (55%), Gaps = 5/122 (4%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD--FLYPSEGI  438
            Y V++    + I+K  ++G  ++S+ +  + W ++M    GY+ QV +L   FL+  E I
Sbjct  481  YNVADIRLAQHIDKGNEDGLFISSVASCSNLWALIMDAGTGYTAQVYQLSPCFLH-KEWI  539

Query  437  HRRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTSAFPSTHVKEKWSKNLYIA  258
              +WE+ Y IT++A T + ++ ++     + + ++ +   + +FP   + +KW +  Y+ 
Sbjct  540  MEQWENNYYITAIAGTNNGSSLVVMSKGTQYLQQSYKV--SESFPFKWINKKWREGFYVT  597

Query  257  SI  252
            S+
Sbjct  598  SM  599



>ref|XP_006853659.1| hypothetical protein AMTR_s00056p00104010 [Amborella trichopoda]
 gb|ERN15126.1| hypothetical protein AMTR_s00056p00104010 [Amborella trichopoda]
Length=703

 Score =   260 bits (665),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YIS+IAGA NGSSLVVMSKGT Y QQSYKVS++FPFKWINKKW+EGF VTSM TAGSR
Sbjct  548  NYYISAIAGANNGSSLVVMSKGTQYAQQSYKVSDTFPFKWINKKWREGFFVTSMATAGSR  607

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRNAG+++QVVELDFLYPSEGIHRRW+SGYRIT+ AAT DQAAF+LS+PR+K  D
Sbjct  608  WGVVMSRNAGFTDQVVELDFLYPSEGIHRRWDSGYRITATAATWDQAAFVLSVPRKKPAD  667

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  668  ETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  702



>ref|XP_007217013.1| hypothetical protein PRUPE_ppa002136mg [Prunus persica]
 gb|EMJ18212.1| hypothetical protein PRUPE_ppa002136mg [Prunus persica]
Length=711

 Score =   260 bits (665),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YIS+IAGA NGSSLVVMSKGTP+TQQSYKVS++FPFKWINKKW+EGF+VT+M T+GSR
Sbjct  556  NYYISAIAGATNGSSLVVMSKGTPFTQQSYKVSDTFPFKWINKKWREGFYVTAMATSGSR  615

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            W VVMSR AGYSEQVVELDFLYPSEGIHRRW+SGYRIT+ AAT DQAAF+LS+PRRK  D
Sbjct  616  WAVVMSRGAGYSEQVVELDFLYPSEGIHRRWDSGYRITATAATWDQAAFVLSVPRRKPQD  675

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPS HVKEKW+KNLYIAS+CYGRTV
Sbjct  676  ETQETLRTSAFPSPHVKEKWAKNLYIASMCYGRTV  710



>gb|KJB07481.1| hypothetical protein B456_001G026300 [Gossypium raimondii]
Length=485

 Score =   255 bits (651),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VT+M TAGSR
Sbjct  330  NYYISAIAGANNGSSLVVMSKGTQYLQQSYKVSDSFPFKWINKKWREGFYVTAMATAGSR  389

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            W +VMSR A +S+QVVELDFLYPSEGIHRRW+SGYRITS AAT DQAAF+LS+PRRK  D
Sbjct  390  WAIVMSRGAPFSDQVVELDFLYPSEGIHRRWDSGYRITSTAATWDQAAFVLSVPRRKPAD  449

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  450  ETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  484



>ref|XP_007208054.1| hypothetical protein PRUPE_ppa002206mg [Prunus persica]
 gb|EMJ09253.1| hypothetical protein PRUPE_ppa002206mg [Prunus persica]
Length=701

 Score =   260 bits (664),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSR
Sbjct  546  NYYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSR  605

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRNAG+S+QVVELDFLYPSEGIHRRW++G+RITS AAT DQAA ILS+P+RK  D
Sbjct  606  WGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGFRITSTAATWDQAALILSVPKRKPGD  665

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTS FPSTHVKEKW+KNLY+A +CYGRTV
Sbjct  666  ETQETLRTSQFPSTHVKEKWAKNLYLACLCYGRTV  700



>ref|XP_009375296.1| PREDICTED: uncharacterized protein LOC103964127 [Pyrus x bretschneideri]
Length=697

 Score =   260 bits (664),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSR
Sbjct  542  NYYISSIAGATNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSR  601

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRNAG+S+QVVELDFLYPSEGIHRRW++G+RITS AAT DQAA ILS+P+RK  D
Sbjct  602  WGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGFRITSTAATWDQAALILSVPKRKPGD  661

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTS FPSTHVKEKW+KNLY+A +CYGRTV
Sbjct  662  ETQETLRTSQFPSTHVKEKWAKNLYLACLCYGRTV  696



>ref|XP_008338507.1| PREDICTED: uncharacterized protein LOC103401567 isoform X2 [Malus 
domestica]
Length=699

 Score =   260 bits (664),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSR
Sbjct  544  NYYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSR  603

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRNAG+S+QVVELDFLYPSEGIHRRW+ G+RITS AAT DQAA ILS+P+RK  D
Sbjct  604  WGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDGGFRITSTAATWDQAALILSVPKRKPGD  663

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTS FPSTHVKEKW+KNLY+A +CYGRTV
Sbjct  664  ETQETLRTSQFPSTHVKEKWAKNLYLACLCYGRTV  698



>ref|XP_008390151.1| PREDICTED: uncharacterized protein LOC103452441 [Malus domestica]
Length=697

 Score =   260 bits (664),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSR
Sbjct  542  NYYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSR  601

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRNAG+S+QVVELDFLYPSEGIHRRW++G+RITS AAT DQAA ILS+P+RK  D
Sbjct  602  WGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGFRITSTAATWDQAALILSVPKRKPGD  661

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTS FPSTHVKEKW+KNLY+A +CYGRTV
Sbjct  662  ETQETLRTSQFPSTHVKEKWAKNLYLACLCYGRTV  696



>ref|XP_008338505.1| PREDICTED: uncharacterized protein LOC103401567 isoform X1 [Malus 
domestica]
Length=699

 Score =   260 bits (664),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSR
Sbjct  544  NYYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSR  603

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRNAG+S+QVVELDFLYPSEGIHRRW+ G+RITS AAT DQAA ILS+P+RK  D
Sbjct  604  WGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDGGFRITSTAATWDQAALILSVPKRKPGD  663

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTS FPSTHVKEKW+KNLY+A +CYGRTV
Sbjct  664  ETQETLRTSQFPSTHVKEKWAKNLYLACLCYGRTV  698



>gb|KHN39248.1| Casein kinase I isoform delta-like, partial [Glycine soja]
Length=661

 Score =   259 bits (662),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VTSM T+GSR
Sbjct  506  NYYISAIAGAVNGSSLVVMSKGTQYLQQSYKVSDSFPFKWINKKWREGFYVTSMATSGSR  565

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSR AG+S+QVVELDFLYPSEGIH+RW+ GYRIT+ AAT DQAAF+LS+PRRK +D
Sbjct  566  WGVVMSRGAGFSDQVVELDFLYPSEGIHKRWDCGYRITATAATWDQAAFVLSVPRRKPLD  625

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTV
Sbjct  626  ETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTV  660



>ref|XP_009364099.1| PREDICTED: uncharacterized protein LOC103954016 [Pyrus x bretschneideri]
Length=699

 Score =   260 bits (664),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSR
Sbjct  544  NYYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSR  603

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRNAG+S+QVVELDFLYPSEGIHRRW+ G+RITS AAT DQAA ILS+P+RK  D
Sbjct  604  WGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDGGFRITSTAATWDQAALILSVPKRKPGD  663

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTS FPSTHVKEKW+KNLY+A +CYGRTV
Sbjct  664  ETQETLRTSQFPSTHVKEKWAKNLYLACLCYGRTV  698



>gb|KHN10182.1| Casein kinase I like 2 [Glycine soja]
Length=606

 Score =   258 bits (658),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VT+M TAGSR
Sbjct  451  NYYISAIAGANNGSSLVVMSKGTQYLQQSYKVSDSFPFKWINKKWREGFYVTAMATAGSR  510

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            W +VMSR AG+S+QVVELDFLYPSEGIHRRW+SGYRITS AAT DQAAF+LS+PRRK  D
Sbjct  511  WAIVMSRGAGFSDQVVELDFLYPSEGIHRRWDSGYRITSTAATWDQAAFVLSVPRRKPAD  570

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFP THVKEKW+KNLYIASICYGRTV
Sbjct  571  ETQETLRTSAFPGTHVKEKWAKNLYIASICYGRTV  605



>ref|XP_011019588.1| PREDICTED: uncharacterized protein LOC105122267 isoform X2 [Populus 
euphratica]
Length=483

 Score =   254 bits (650),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VT+M TAGSR
Sbjct  328  NYYISAIAGANNGSSLVVMSKGTQYLQQSYKVSDSFPFKWINKKWREGFYVTTMATAGSR  387

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            W +VMSR  G+S+QVVELDFLYPSEGIHRRW+SGYRITS AAT DQAAF+LS+PRRK +D
Sbjct  388  WAIVMSRGTGFSDQVVELDFLYPSEGIHRRWDSGYRITSTAATWDQAAFVLSVPRRKPVD  447

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPSTHVKEKW+ NLYIAS+CYGRTV
Sbjct  448  ETQETLRTSAFPSTHVKEKWATNLYIASVCYGRTV  482



>ref|XP_004294964.1| PREDICTED: uncharacterized protein LOC101294343 [Fragaria vesca 
subsp. vesca]
Length=731

 Score =   260 bits (665),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YISSIAGA NGSSLVVMSKGT YTQQSYKVS+SFPFKWINKKW+EGFHVTSM TAGSR
Sbjct  576  NYYISSIAGANNGSSLVVMSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVTSMATAGSR  635

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WGVVMSRNAG+S+QVVELDFLYPSEGIHRRW++G+RITS AAT DQAA ILS+P+RK  D
Sbjct  636  WGVVMSRNAGFSDQVVELDFLYPSEGIHRRWDNGFRITSTAATWDQAALILSVPKRKPGD  695

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTS FPSTHVKEKW+KNLY+A +CYGRTV
Sbjct  696  ETQETLRTSQFPSTHVKEKWAKNLYLACLCYGRTV  730


 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 29/122 (24%), Positives = 63/122 (52%), Gaps = 5/122 (4%)
 Frame = -2

Query  611  YKVSESFPFKWINKKWKEGFHVTSMTTAGSRWGVVMSRNAGYSEQVVELD-FLYPSEGIH  435
            Y V+++   + + +   +G  ++ +++  + W ++M    G+S QV EL  F    E I 
Sbjct  511  YNVADARLAQHVERGIADGLLISCVSSCSNLWALIMDAGTGFSNQVYELSPFFLHKEWIM  570

Query  434  RRWESGYRITSMAATADQAAFILSIPRRKMMDETQETLRTS-AFPSTHVKEKWSKNLYIA  258
             +WE  Y I+S+A   + ++ ++     K    TQ++ + S +FP   + +KW +  ++ 
Sbjct  571  EQWEKNYYISSIAGANNGSSLVV---MSKGTQYTQQSYKVSDSFPFKWINKKWREGFHVT  627

Query  257  SI  252
            S+
Sbjct  628  SM  629



>emb|CDY11509.1| BnaA09g40750D [Brassica napus]
Length=565

 Score =   256 bits (655),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 126/155 (81%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YI+++AGA NGSS VVMSKGTPY QQSYKVS+SFPFKWINKKW+EGF+VTSM TAGS+
Sbjct  410  NYYITAVAGANNGSSFVVMSKGTPYLQQSYKVSDSFPFKWINKKWREGFYVTSMATAGSK  469

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WG+VMSR A +S+QVVELDFLYPSEGIHRRWE+GYRITS+A T DQ+AF+LS+PRRK  D
Sbjct  470  WGIVMSRGAAFSDQVVELDFLYPSEGIHRRWENGYRITSIAGTCDQSAFVLSVPRRKPSD  529

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPS HVKEKW KNLYI+SICYGRTV
Sbjct  530  ETQETLRTSAFPSNHVKEKWGKNLYISSICYGRTV  564



>ref|NP_001054881.2| Os05g0200500 [Oryza sativa Japonica Group]
 dbj|BAF16795.2| Os05g0200500, partial [Oryza sativa Japonica Group]
Length=649

 Score =   258 bits (660),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            NFYI+S+AGA NGSSLVVMS+GT Y QQSYKVS+SFPFKWINKKWKEGF+VT+M TAGSR
Sbjct  494  NFYITSLAGANNGSSLVVMSRGTQYAQQSYKVSDSFPFKWINKKWKEGFYVTAMATAGSR  553

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            W VVMSRNAG+++QVVELDFLYPSEGIHRRW++G+RIT+ AAT DQAAFILSIPRRK  D
Sbjct  554  WAVVMSRNAGFTDQVVELDFLYPSEGIHRRWDNGFRITATAATWDQAAFILSIPRRKPAD  613

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPS HVKEKWSKNLY+ASICYGRTV
Sbjct  614  ETQETLRTSAFPSQHVKEKWSKNLYLASICYGRTV  648



>ref|XP_008445007.1| PREDICTED: uncharacterized protein LOC103488176 [Cucumis melo]
Length=699

 Score =   259 bits (663),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VT+M TAG R
Sbjct  544  NYYISAIAGANNGSSLVVMSKGTQYLQQSYKVSDSFPFKWINKKWREGFYVTAMATAGGR  603

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            W +VMSR AG+S+QVVELDFLYPSEGIHRRW+SGYRITS AAT DQAAF+LS+PRRK  D
Sbjct  604  WAIVMSRGAGFSDQVVELDFLYPSEGIHRRWDSGYRITSTAATLDQAAFVLSVPRRKPAD  663

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTV
Sbjct  664  ETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTV  698



>ref|XP_006408871.1| hypothetical protein EUTSA_v10001925mg [Eutrema salsugineum]
 gb|ESQ50324.1| hypothetical protein EUTSA_v10001925mg [Eutrema salsugineum]
Length=676

 Score =   259 bits (661),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YI+++AGA NGSS VVMSKGTPY QQSYKVS+SFPFKWINKKW+EGF+VTSM TAGS+
Sbjct  521  NYYITAVAGANNGSSFVVMSKGTPYLQQSYKVSDSFPFKWINKKWREGFYVTSMATAGSK  580

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            WG+VMSR A +SEQVVELDFLYPSEGIHRRW++GYRITS AAT DQAAF+LS+PRRK  D
Sbjct  581  WGIVMSRGAAFSEQVVELDFLYPSEGIHRRWDNGYRITSTAATWDQAAFVLSVPRRKPTD  640

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPS HVKEKWSKNLYI+SICYGRTV
Sbjct  641  ETQETLRTSAFPSNHVKEKWSKNLYISSICYGRTV  675



>ref|XP_009367436.1| PREDICTED: uncharacterized protein LOC103957076 [Pyrus x bretschneideri]
Length=677

 Score =   259 bits (661),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGFHVT+M TA SR
Sbjct  522  NYYISAIAGANNGSSLVVMSKGTQYLQQSYKVSDSFPFKWINKKWREGFHVTAMATARSR  581

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            W +VMSR AG+S+QVVELDFLYPSEGIHRRW++GYRITS AAT DQAAF+LS+PRRK+ D
Sbjct  582  WAIVMSRGAGFSDQVVELDFLYPSEGIHRRWDNGYRITSTAATWDQAAFVLSVPRRKLAD  641

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPSTHVKEKW KNLYIASICYGRTV
Sbjct  642  ETQETLRTSAFPSTHVKEKWGKNLYIASICYGRTV  676



>ref|XP_011006418.1| PREDICTED: uncharacterized protein LOC105112417 [Populus euphratica]
 ref|XP_011006419.1| PREDICTED: uncharacterized protein LOC105112417 [Populus euphratica]
 ref|XP_011006420.1| PREDICTED: uncharacterized protein LOC105112417 [Populus euphratica]
 ref|XP_011006421.1| PREDICTED: uncharacterized protein LOC105112417 [Populus euphratica]
Length=691

 Score =   259 bits (662),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = -2

Query  698  NFYissiagaangsSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGSR  519
            N+YIS+IAGA NGSSLVVMSKGT Y QQSYKVS+SFPFKWINKKW+EGF+VT+M TAGSR
Sbjct  536  NYYISAIAGANNGSSLVVMSKGTQYLQQSYKVSDSFPFKWINKKWREGFYVTAMATAGSR  595

Query  518  WGVVMSRNAGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSIPRRKMMD  339
            W +VMSR AG+S+QVVELDFLYPSEGIHRRW+ GYRITS AAT DQAAF+LS+PRRK+ D
Sbjct  596  WAIVMSRGAGFSDQVVELDFLYPSEGIHRRWDGGYRITSTAATWDQAAFVLSVPRRKLAD  655

Query  338  ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTV  234
            ETQETLRTSAFPSTHVKEKW+KNLYIAS+CYGRTV
Sbjct  656  ETQETLRTSAFPSTHVKEKWAKNLYIASVCYGRTV  690



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1179751321320