BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF007H18

Length=750
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KHG18085.1|  putative CCR4-associated factor 1 -like protein         357   3e-120   Gossypium arboreum [tree cotton]
gb|KJB68026.1|  hypothetical protein B456_010G222500                    356   4e-120   Gossypium raimondii
ref|XP_009605547.1|  PREDICTED: probable CCR4-associated factor 1...    355   5e-120   Nicotiana tomentosiformis
ref|XP_002527306.1|  ccr4-associated factor, putative                   355   7e-120   Ricinus communis
ref|XP_011034532.1|  PREDICTED: probable CCR4-associated factor 1...    353   4e-119   Populus euphratica
gb|KDP41983.1|  hypothetical protein JCGZ_27001                         351   3e-118   Jatropha curcas
ref|XP_009793121.1|  PREDICTED: probable CCR4-associated factor 1...    350   8e-118   Nicotiana sylvestris
ref|XP_004235935.1|  PREDICTED: probable CCR4-associated factor 1...    350   9e-118   Solanum lycopersicum
gb|KDP33530.1|  hypothetical protein JCGZ_07101                         350   1e-117   Jatropha curcas
ref|XP_007023404.1|  Polynucleotidyl transferase, ribonuclease H-...    348   1e-117   
ref|XP_002272165.1|  PREDICTED: probable CCR4-associated factor 1...    349   2e-117   Vitis vinifera
ref|XP_011020623.1|  PREDICTED: probable CCR4-associated factor 1...    348   3e-117   Populus euphratica
ref|XP_007023403.1|  Polynucleotidyl transferase, ribonuclease H-...    348   3e-117   
ref|XP_006341359.1|  PREDICTED: probable CCR4-associated factor 1...    348   4e-117   Solanum tuberosum [potatoes]
ref|XP_009760590.1|  PREDICTED: probable CCR4-associated factor 1...    347   1e-116   Nicotiana sylvestris
ref|XP_011082241.1|  PREDICTED: probable CCR4-associated factor 1...    347   1e-116   Sesamum indicum [beniseed]
ref|XP_002515442.1|  ccr4-associated factor, putative                   346   2e-116   
ref|XP_010089956.1|  putative CCR4-associated factor 1-7-like pro...    346   3e-116   Morus notabilis
ref|XP_007023408.1|  Polynucleotidyl transferase, ribonuclease H-...    346   4e-116   Theobroma cacao [chocolate]
ref|XP_009594641.1|  PREDICTED: probable CCR4-associated factor 1...    345   4e-116   Nicotiana tomentosiformis
ref|XP_002303842.1|  hypothetical protein POPTR_0003s17950g             345   7e-116   
ref|XP_007023407.1|  CCR4-associated factor 1                           348   1e-115   
ref|XP_002324905.2|  hypothetical protein POPTR_0018s02370g             345   1e-115   Populus trichocarpa [western balsam poplar]
ref|XP_007215794.1|  hypothetical protein PRUPE_ppa009874mg             344   2e-115   Prunus persica
ref|XP_008228784.1|  PREDICTED: probable CCR4-associated factor 1...    343   3e-115   Prunus mume [ume]
ref|XP_004305482.1|  PREDICTED: probable CCR4-associated factor 1...    343   3e-115   Fragaria vesca subsp. vesca
ref|XP_011036659.1|  PREDICTED: probable CCR4-associated factor 1...    343   4e-115   Populus euphratica
ref|XP_010275748.1|  PREDICTED: probable CCR4-associated factor 1...    342   6e-115   Nelumbo nucifera [Indian lotus]
ref|XP_007011965.1|  Polynucleotidyl transferase, ribonuclease H-...    342   1e-114   
emb|CDO98220.1|  unnamed protein product                                342   1e-114   Coffea canephora [robusta coffee]
ref|XP_008375521.1|  PREDICTED: probable CCR4-associated factor 1...    342   2e-114   Malus domestica [apple tree]
ref|XP_002309667.1|  hypothetical protein POPTR_0006s27840g             342   2e-114   Populus trichocarpa [western balsam poplar]
ref|XP_010265638.1|  PREDICTED: probable CCR4-associated factor 1...    341   2e-114   Nelumbo nucifera [Indian lotus]
gb|KJB07590.1|  hypothetical protein B456_001G031500                    341   2e-114   Gossypium raimondii
gb|EYU24608.1|  hypothetical protein MIMGU_mgv1a011718mg                341   3e-114   Erythranthe guttata [common monkey flower]
ref|XP_003526204.1|  PREDICTED: probable CCR4-associated factor 1...    341   3e-114   Glycine max [soybeans]
ref|XP_006356242.1|  PREDICTED: probable CCR4-associated factor 1...    340   3e-114   Solanum tuberosum [potatoes]
ref|XP_009354185.1|  PREDICTED: probable CCR4-associated factor 1...    340   4e-114   Pyrus x bretschneideri [bai li]
ref|XP_004241682.1|  PREDICTED: probable CCR4-associated factor 1...    340   4e-114   Solanum lycopersicum
gb|KJB68416.1|  hypothetical protein B456_010G244300                    340   4e-114   Gossypium raimondii
gb|KJB66334.1|  hypothetical protein B456_010G136400                    340   5e-114   Gossypium raimondii
ref|XP_004507083.1|  PREDICTED: probable CCR4-associated factor 1...    340   9e-114   Cicer arietinum [garbanzo]
ref|XP_003530297.1|  PREDICTED: probable CCR4-associated factor 1...    339   1e-113   Glycine max [soybeans]
ref|XP_010092187.1|  putative CCR4-associated factor 1-7-like pro...    339   1e-113   Morus notabilis
ref|XP_007136961.1|  hypothetical protein PHAVU_009G088600g             339   1e-113   Phaseolus vulgaris [French bean]
ref|XP_006427595.1|  hypothetical protein CICLE_v10026260mg             339   2e-113   
ref|XP_006294779.1|  hypothetical protein CARUB_v10023830mg             339   2e-113   Capsella rubella
ref|XP_010665982.1|  PREDICTED: probable CCR4-associated factor 1...    338   3e-113   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006465196.1|  PREDICTED: probable CCR4-associated factor 1...    338   4e-113   Citrus sinensis [apfelsine]
ref|XP_010510101.1|  PREDICTED: probable CCR4-associated factor 1...    338   4e-113   Camelina sativa [gold-of-pleasure]
ref|XP_009128391.1|  PREDICTED: probable CCR4-associated factor 1...    338   4e-113   Brassica rapa
ref|XP_010532089.1|  PREDICTED: probable CCR4-associated factor 1...    338   4e-113   Tarenaya hassleriana [spider flower]
ref|XP_006857184.1|  hypothetical protein AMTR_s00065p00182000          338   5e-113   Amborella trichopoda
gb|ACU24625.1|  unknown                                                 338   5e-113   Glycine max [soybeans]
ref|XP_010469632.1|  PREDICTED: probable CCR4-associated factor 1...    338   5e-113   Camelina sativa [gold-of-pleasure]
ref|XP_011039582.1|  PREDICTED: probable CCR4-associated factor 1...    338   5e-113   Populus euphratica
ref|XP_003522433.1|  PREDICTED: probable CCR4-associated factor 1...    337   6e-113   Glycine max [soybeans]
gb|KHG00404.1|  putative CCR4-associated factor 1 -like protein         337   6e-113   Gossypium arboreum [tree cotton]
gb|KDO42998.1|  hypothetical protein CISIN_1g023991mg                   337   6e-113   Citrus sinensis [apfelsine]
ref|XP_003604226.1|  Ribonuclease CAF1                                  337   7e-113   
ref|XP_009417447.1|  PREDICTED: probable CCR4-associated factor 1...    337   1e-112   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010414034.1|  PREDICTED: probable CCR4-associated factor 1...    337   1e-112   Camelina sativa [gold-of-pleasure]
emb|CDY63973.1|  BnaC02g46620D                                          337   2e-112   Brassica napus [oilseed rape]
gb|KHG16599.1|  putative CCR4-associated factor 1 -like protein         336   2e-112   Gossypium arboreum [tree cotton]
gb|KJB55043.1|  hypothetical protein B456_009G061200                    336   2e-112   Gossypium raimondii
ref|XP_009390565.1|  PREDICTED: probable CCR4-associated factor 1...    336   3e-112   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008445259.1|  PREDICTED: probable CCR4-associated factor 1...    335   4e-112   Cucumis melo [Oriental melon]
ref|XP_002862886.1|  hypothetical protein ARALYDRAFT_920160             335   4e-112   
ref|XP_011082251.1|  PREDICTED: probable CCR4-associated factor 1...    335   5e-112   Sesamum indicum [beniseed]
ref|XP_010532085.1|  PREDICTED: probable CCR4-associated factor 1...    335   5e-112   Tarenaya hassleriana [spider flower]
ref|XP_002881215.1|  hypothetical protein ARALYDRAFT_902256             335   6e-112   Arabidopsis lyrata subsp. lyrata
ref|XP_010929136.1|  PREDICTED: probable CCR4-associated factor 1...    335   8e-112   Elaeis guineensis
ref|XP_010048142.1|  PREDICTED: probable CCR4-associated factor 1...    334   1e-111   Eucalyptus grandis [rose gum]
ref|XP_004138705.1|  PREDICTED: probable CCR4-associated factor 1...    333   1e-111   
gb|KHN07034.1|  Putative CCR4-associated factor 1 like 7                334   1e-111   Glycine soja [wild soybean]
ref|NP_565735.1|  polynucleotidyl transferase, ribonuclease H-lik...    334   1e-111   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010942117.1|  PREDICTED: probable CCR4-associated factor 1...    334   1e-111   Elaeis guineensis
ref|XP_004138704.1|  PREDICTED: probable CCR4-associated factor 1...    334   2e-111   Cucumis sativus [cucumbers]
gb|EPS71126.1|  hypothetical protein M569_03633                         333   2e-111   Genlisea aurea
ref|XP_010472873.1|  PREDICTED: probable CCR4-associated factor 1...    333   3e-111   Camelina sativa [gold-of-pleasure]
ref|XP_003531734.1|  PREDICTED: probable CCR4-associated factor 1...    333   3e-111   
ref|XP_010532091.1|  PREDICTED: probable CCR4-associated factor 1...    333   3e-111   Tarenaya hassleriana [spider flower]
gb|ACU20942.1|  unknown                                                 333   4e-111   Glycine max [soybeans]
ref|XP_011073341.1|  PREDICTED: probable CCR4-associated factor 1...    332   6e-111   Sesamum indicum [beniseed]
ref|XP_008794330.1|  PREDICTED: probable CCR4-associated factor 1...    332   6e-111   Phoenix dactylifera
ref|XP_006389834.1|  hypothetical protein EUTSA_v10018990mg             332   1e-110   Eutrema salsugineum [saltwater cress]
ref|XP_009144015.1|  PREDICTED: probable CCR4-associated factor 1...    332   1e-110   Brassica rapa
ref|XP_004291948.1|  PREDICTED: probable CCR4-associated factor 1...    332   1e-110   Fragaria vesca subsp. vesca
ref|NP_178193.1|  putative CCR4-associated factor 1-like 6              331   2e-110   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006302671.1|  hypothetical protein CARUB_v10020778mg             331   2e-110   Capsella rubella
emb|CDP10211.1|  unnamed protein product                                331   2e-110   Coffea canephora [robusta coffee]
ref|XP_010048831.1|  PREDICTED: probable CCR4-associated factor 1...    331   2e-110   Eucalyptus grandis [rose gum]
ref|XP_010691601.1|  PREDICTED: probable CCR4-associated factor 1...    331   3e-110   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007135810.1|  hypothetical protein PHAVU_010G160400g             331   3e-110   Phaseolus vulgaris [French bean]
ref|XP_006483458.1|  PREDICTED: probable CCR4-associated factor 1...    330   3e-110   Citrus sinensis [apfelsine]
ref|XP_009106716.1|  PREDICTED: probable CCR4-associated factor 1...    330   5e-110   Brassica rapa
gb|KHF99352.1|  putative CCR4-associated factor 1 -like protein         332   8e-110   Gossypium arboreum [tree cotton]
ref|XP_009399558.1|  PREDICTED: probable CCR4-associated factor 1...    330   8e-110   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006473977.1|  PREDICTED: probable CCR4-associated factor 1...    329   1e-109   Citrus sinensis [apfelsine]
ref|XP_009801027.1|  PREDICTED: probable CCR4-associated factor 1...    329   1e-109   Nicotiana sylvestris
emb|CDY12234.1|  BnaC04g12640D                                          329   2e-109   Brassica napus [oilseed rape]
ref|XP_008445257.1|  PREDICTED: LOW QUALITY PROTEIN: probable CCR...    328   2e-109   Cucumis melo [Oriental melon]
ref|XP_010429900.1|  PREDICTED: probable CCR4-associated factor 1...    328   2e-109   Camelina sativa [gold-of-pleasure]
ref|NP_001185452.1|  putative CCR4-associated factor 1-like 6           328   3e-109   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003603309.1|  Ribonuclease CAF1                                  328   3e-109   
ref|XP_010648684.1|  PREDICTED: probable CCR4-associated factor 1...    327   6e-109   Vitis vinifera
ref|XP_009620266.1|  PREDICTED: probable CCR4-associated factor 1...    327   6e-109   Nicotiana tomentosiformis
ref|XP_004138706.1|  PREDICTED: probable CCR4-associated factor 1...    327   7e-109   Cucumis sativus [cucumbers]
ref|XP_008799630.1|  PREDICTED: probable CCR4-associated factor 1...    327   8e-109   Phoenix dactylifera
gb|ACJ84891.1|  unknown                                                 327   8e-109   Medicago truncatula
gb|AFK43307.1|  unknown                                                 327   8e-109   Lotus japonicus
emb|CAN79806.1|  hypothetical protein VITISV_031504                     327   1e-108   Vitis vinifera
ref|XP_006450304.1|  hypothetical protein CICLE_v10008276mg             333   1e-108   
emb|CDY39943.1|  BnaC06g40210D                                          327   1e-108   Brassica napus [oilseed rape]
ref|XP_004501372.1|  PREDICTED: probable CCR4-associated factor 1...    327   1e-108   
ref|XP_010417661.1|  PREDICTED: probable CCR4-associated factor 1...    326   2e-108   Camelina sativa [gold-of-pleasure]
ref|XP_004160761.1|  PREDICTED: LOW QUALITY PROTEIN: probable CCR...    325   3e-108   
ref|XP_006453661.1|  hypothetical protein CICLE_v10009159mg             325   3e-108   Citrus clementina [clementine]
gb|KJB06631.1|  hypothetical protein B456_001G037000                    323   5e-108   Gossypium raimondii
ref|XP_006356929.1|  PREDICTED: probable CCR4-associated factor 1...    325   6e-108   Solanum tuberosum [potatoes]
gb|KJB06633.1|  hypothetical protein B456_001G037000                    322   7e-108   Gossypium raimondii
ref|XP_009363839.1|  PREDICTED: probable CCR4-associated factor 1...    324   9e-108   Pyrus x bretschneideri [bai li]
gb|KJB06630.1|  hypothetical protein B456_001G037000                    323   2e-107   Gossypium raimondii
gb|ABK21469.1|  unknown                                                 322   2e-107   Picea sitchensis
gb|KHN38030.1|  Putative CCR4-associated factor 1 like 7                323   2e-107   Glycine soja [wild soybean]
ref|XP_004504674.1|  PREDICTED: probable CCR4-associated factor 1...    323   3e-107   Cicer arietinum [garbanzo]
gb|ACN40154.1|  unknown                                                 323   4e-107   Picea sitchensis
ref|XP_010063560.1|  PREDICTED: probable CCR4-associated factor 1...    322   7e-107   Eucalyptus grandis [rose gum]
gb|ABK24400.1|  unknown                                                 322   8e-107   Picea sitchensis
ref|XP_010541577.1|  PREDICTED: probable CCR4-associated factor 1...    320   1e-106   Tarenaya hassleriana [spider flower]
ref|XP_008378874.1|  PREDICTED: probable CCR4-associated factor 1...    321   1e-106   Malus domestica [apple tree]
ref|XP_010541576.1|  PREDICTED: probable CCR4-associated factor 1...    321   2e-106   Tarenaya hassleriana [spider flower]
ref|XP_004250764.1|  PREDICTED: probable CCR4-associated factor 1...    320   3e-106   Solanum lycopersicum
ref|XP_011073532.1|  PREDICTED: probable CCR4-associated factor 1...    320   4e-106   Sesamum indicum [beniseed]
gb|AFK45143.1|  unknown                                                 319   1e-105   Lotus japonicus
ref|XP_002279241.1|  PREDICTED: probable CCR4-associated factor 1...    318   2e-105   Vitis vinifera
ref|XP_008377668.1|  PREDICTED: probable CCR4-associated factor 1...    317   4e-105   Malus domestica [apple tree]
emb|CAN68032.1|  hypothetical protein VITISV_022019                     315   2e-104   Vitis vinifera
ref|XP_006410344.1|  hypothetical protein EUTSA_v10017059mg             315   6e-104   Eutrema salsugineum [saltwater cress]
ref|XP_008352217.1|  PREDICTED: probable CCR4-associated factor 1...    311   6e-104   
gb|EYU21723.1|  hypothetical protein MIMGU_mgv1a019889mg                314   7e-104   Erythranthe guttata [common monkey flower]
gb|KHN29617.1|  Putative CCR4-associated factor 1 like 7                313   2e-103   Glycine soja [wild soybean]
ref|XP_008344039.1|  PREDICTED: probable CCR4-associated factor 1...    312   4e-103   
ref|XP_009366159.1|  PREDICTED: probable CCR4-associated factor 1...    313   7e-103   Pyrus x bretschneideri [bai li]
ref|XP_008336906.1|  PREDICTED: probable CCR4-associated factor 1...    311   3e-102   
ref|XP_008220692.1|  PREDICTED: probable CCR4-associated factor 1...    310   4e-102   Prunus mume [ume]
ref|XP_008354337.1|  PREDICTED: probable CCR4-associated factor 1...    310   5e-102   
ref|XP_010556071.1|  PREDICTED: probable CCR4-associated factor 1...    309   8e-102   Tarenaya hassleriana [spider flower]
ref|XP_007202386.1|  hypothetical protein PRUPE_ppa009376mg             310   1e-101   Prunus persica
ref|XP_009358471.1|  PREDICTED: probable CCR4-associated factor 1...    309   1e-101   Pyrus x bretschneideri [bai li]
ref|XP_010537879.1|  PREDICTED: probable CCR4-associated factor 1...    308   2e-101   Tarenaya hassleriana [spider flower]
ref|XP_008242960.1|  PREDICTED: probable CCR4-associated factor 1...    308   7e-101   Prunus mume [ume]
ref|XP_004287117.1|  PREDICTED: probable CCR4-associated factor 1...    306   2e-100   Fragaria vesca subsp. vesca
emb|CDX70376.1|  BnaC03g04600D                                          306   2e-100   
ref|XP_008242959.1|  PREDICTED: probable CCR4-associated factor 1...    306   3e-100   
gb|EYU32376.1|  hypothetical protein MIMGU_mgv1a026872mg                305   4e-100   Erythranthe guttata [common monkey flower]
gb|ACE98441.1|  ribonuclease CAF1                                       300   6e-100   Populus tremula [European aspen]
ref|XP_006399590.1|  hypothetical protein EUTSA_v10014350mg             304   8e-100   Eutrema salsugineum [saltwater cress]
ref|XP_002871445.1|  hypothetical protein ARALYDRAFT_487926             304   1e-99    
ref|NP_196657.1|  polynucleotidyl transferase, ribonuclease H-lik...    304   1e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002309331.1|  hypothetical protein POPTR_0006s20130g             303   2e-99    Populus trichocarpa [western balsam poplar]
ref|XP_011033459.1|  PREDICTED: probable CCR4-associated factor 1...    301   8e-99    Populus euphratica
ref|XP_006286536.1|  hypothetical protein CARUB_v10001652mg             302   8e-99    Capsella rubella
ref|XP_010419649.1|  PREDICTED: probable CCR4-associated factor 1...    301   8e-99    Camelina sativa [gold-of-pleasure]
gb|AEN81307.1|  AT1G80780-like protein                                  298   9e-99    Capsella rubella
gb|AAK92792.1|  putative CCR4-associated factor                         301   1e-98    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010453129.1|  PREDICTED: probable CCR4-associated factor 1...    301   1e-98    Camelina sativa [gold-of-pleasure]
gb|ABK22659.1|  unknown                                                 301   2e-98    Picea sitchensis
ref|XP_010491786.1|  PREDICTED: probable CCR4-associated factor 1...    300   3e-98    Camelina sativa [gold-of-pleasure]
ref|XP_004954218.1|  PREDICTED: probable CCR4-associated factor 1...    299   1e-97    Setaria italica
emb|CDX69796.1|  BnaA10g21450D                                          298   1e-97    
ref|XP_009122009.1|  PREDICTED: probable CCR4-associated factor 1...    298   2e-97    Brassica rapa
emb|CDX97069.1|  BnaC09g45560D                                          298   2e-97    
ref|XP_009131188.1|  PREDICTED: probable CCR4-associated factor 1...    297   4e-97    Brassica rapa
ref|NP_001148663.1|  CCR4-NOT transcription complex subunit 7           296   5e-97    Zea mays [maize]
gb|ACL53982.1|  unknown                                                 297   7e-97    Zea mays [maize]
ref|XP_002452981.1|  hypothetical protein SORBIDRAFT_04g035960          297   8e-97    Sorghum bicolor [broomcorn]
ref|XP_007222518.1|  hypothetical protein PRUPE_ppa009848mg             296   1e-96    Prunus persica
gb|EMS46974.1|  putative CCR4-associated factor 1-like protein 7        293   3e-96    Triticum urartu
gb|EMT24915.1|  Putative CCR4-associated factor 1-7-like protein        292   4e-96    
gb|EEC74173.1|  hypothetical protein OsI_09281                          295   4e-96    Oryza sativa Indica Group [Indian rice]
ref|NP_001048387.1|  Os02g0796300                                       295   4e-96    
dbj|BAD19081.1|  putative CCR4-NOT transcription complex subunit 7      295   5e-96    Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ92910.1|  predicted protein                                      293   4e-95    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003570299.1|  PREDICTED: probable CCR4-associated factor 1...    290   6e-94    Brachypodium distachyon [annual false brome]
ref|XP_006648046.1|  PREDICTED: probable CCR4-associated factor 1...    290   8e-94    
ref|XP_006368924.1|  hypothetical protein POPTR_0001s14860g             287   1e-93    
gb|EPS59819.1|  hypothetical protein M569_14984                         287   4e-93    Genlisea aurea
ref|XP_002460215.1|  hypothetical protein SORBIDRAFT_02g024730          287   6e-93    Sorghum bicolor [broomcorn]
ref|XP_001766532.1|  predicted protein                                  285   2e-92    
ref|NP_001136747.1|  uncharacterized protein LOC100216888               286   2e-92    Zea mays [maize]
ref|XP_001755261.1|  predicted protein                                  285   2e-92    
dbj|BAK01540.1|  predicted protein                                      285   3e-92    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006665053.1|  PREDICTED: probable CCR4-associated factor 1...    285   8e-92    Oryza brachyantha
ref|XP_002965900.1|  hypothetical protein SELMODRAFT_84624              281   8e-91    Selaginella moellendorffii
ref|XP_006660627.1|  PREDICTED: probable CCR4-associated factor 1...    281   1e-90    Oryza brachyantha
gb|KCW80614.1|  hypothetical protein EUGRSUZ_C01981                     278   2e-90    Eucalyptus grandis [rose gum]
ref|NP_001063181.1|  Os09g0416800                                       279   5e-90    
ref|XP_010048148.1|  PREDICTED: probable CCR4-associated factor 1...    279   9e-90    Eucalyptus grandis [rose gum]
ref|NP_001132298.1|  CCR4-NOT transcription complex subunit 7 iso...    274   5e-88    
ref|XP_003578122.1|  PREDICTED: probable CCR4-associated factor 1...    271   6e-87    Brachypodium distachyon [annual false brome]
gb|KCW62735.1|  hypothetical protein EUGRSUZ_G00324                     268   9e-87    Eucalyptus grandis [rose gum]
ref|XP_004956826.1|  PREDICTED: probable CCR4-associated factor 1...    269   6e-86    Setaria italica
ref|XP_006416864.1|  hypothetical protein EUTSA_v10008404mg             268   2e-85    Eutrema salsugineum [saltwater cress]
ref|XP_009395282.1|  PREDICTED: probable CCR4-associated factor 1...    264   3e-84    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009396102.1|  PREDICTED: probable CCR4-associated factor 1...    264   4e-84    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009418496.1|  PREDICTED: probable CCR4-associated factor 1...    263   2e-83    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009395283.1|  PREDICTED: probable CCR4-associated factor 1...    262   3e-83    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002981023.1|  hypothetical protein SELMODRAFT_444748             260   2e-82    Selaginella moellendorffii
ref|XP_002982500.1|  hypothetical protein SELMODRAFT_179583             260   2e-82    Selaginella moellendorffii
gb|KFK43832.1|  hypothetical protein AALP_AA1G179300                    259   4e-82    Arabis alpina [alpine rockcress]
ref|XP_002890137.1|  hypothetical protein ARALYDRAFT_312582             258   8e-82    Arabidopsis lyrata subsp. lyrata
ref|NP_173044.1|  polynucleotidyl transferase, ribonuclease H-lik...    258   2e-81    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009385031.1|  PREDICTED: probable CCR4-associated factor 1...    257   3e-81    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010932239.1|  PREDICTED: probable CCR4-associated factor 1...    256   3e-81    Elaeis guineensis
ref|XP_003574542.1|  PREDICTED: probable CCR4-associated factor 1...    257   4e-81    Brachypodium distachyon [annual false brome]
ref|XP_008796886.1|  PREDICTED: probable CCR4-associated factor 1...    254   2e-80    Phoenix dactylifera
gb|ABY89387.1|  chromatin assembly factor 1                             250   7e-80    Pinus taeda
ref|XP_006304066.1|  hypothetical protein CARUB_v10009915mg             253   1e-79    Capsella rubella
ref|XP_001697447.1|  CCR4-associated factor                             253   1e-79    Chlamydomonas reinhardtii
ref|XP_010459127.1|  PREDICTED: probable CCR4-associated factor 1...    249   4e-78    Camelina sativa [gold-of-pleasure]
gb|EAZ07127.1|  hypothetical protein OsI_29374                          248   4e-78    Oryza sativa Indica Group [Indian rice]
ref|XP_010927524.1|  PREDICTED: probable CCR4-associated factor 1...    248   5e-78    Elaeis guineensis
ref|XP_010476692.1|  PREDICTED: probable CCR4-associated factor 1...    249   6e-78    Camelina sativa [gold-of-pleasure]
ref|XP_010497514.1|  PREDICTED: probable CCR4-associated factor 1...    248   7e-78    Camelina sativa [gold-of-pleasure]
ref|XP_002950174.1|  hypothetical protein VOLCADRAFT_80930              249   1e-77    Volvox carteri f. nagariensis
dbj|BAD09890.1|  putative CCR4-NOT transcription complex, subunit 7     248   1e-77    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009149028.1|  PREDICTED: probable CCR4-associated factor 1...    247   2e-77    Brassica rapa
gb|EMS59499.1|  putative CCR4-associated factor 1-like protein 7        248   2e-77    Triticum urartu
ref|XP_003056015.1|  predicted protein                                  247   2e-77    Micromonas pusilla CCMP1545
emb|CDY35049.1|  BnaA06g10590D                                          246   3e-77    Brassica napus [oilseed rape]
ref|XP_005649974.1|  CCR4-associated factor                             247   3e-77    Coccomyxa subellipsoidea C-169
gb|EYU24605.1|  hypothetical protein MIMGU_mgv1a011876mg                245   9e-77    Erythranthe guttata [common monkey flower]
gb|AFK36856.1|  unknown                                                 240   8e-76    Medicago truncatula
ref|XP_006659446.1|  PREDICTED: probable CCR4-associated factor 1...    242   2e-75    
emb|CDY33367.1|  BnaC05g12160D                                          246   6e-75    Brassica napus [oilseed rape]
gb|KCW53891.1|  hypothetical protein EUGRSUZ_J03104                     239   8e-75    Eucalyptus grandis [rose gum]
ref|XP_010469633.1|  PREDICTED: probable CCR4-associated factor 1...    239   8e-75    Camelina sativa [gold-of-pleasure]
emb|CDY12236.1|  BnaC04g12660D                                          243   4e-74    Brassica napus [oilseed rape]
gb|ACH59934.1|  ccr4-NOT transcription complex protein                  234   6e-74    Pseudotsuga menziesii
ref|XP_008779663.1|  PREDICTED: probable CCR4-associated factor 1...    235   6e-73    Phoenix dactylifera
gb|KDD75431.1|  CAF1 family ribonuclease                                234   9e-73    Helicosporidium sp. ATCC 50920
emb|CDG58373.1|  putative CCR4-associated factor 1-homolog 6            229   2e-72    Leucadendron flexuosum
emb|CDO45621.1|  Putative CCR4-associated factor 1-homolog 6            228   4e-72    Leucadendron flexuosum
ref|XP_002507260.1|  predicted protein                                  233   4e-72    Micromonas commoda
ref|XP_005843563.1|  hypothetical protein CHLNCDRAFT_59811              234   4e-72    Chlorella variabilis
emb|CDG58396.1|  putative CCR4-associated factor 1-homolog 6            227   1e-71    Mimetes cucullatus
emb|CDG58367.1|  putative CCR4-associated factor 1-homolog 6            227   1e-71    Leucadendron discolor
emb|CDG58389.1|  putative CCR4-associated factor 1-homolog 6            226   2e-71    Leucadendron sericeum
emb|CDG58360.1|  putative CCR4-associated factor 1-homolog 6            226   2e-71    Leucadendron album
emb|CDG58392.1|  putative CCR4-associated factor 1-homolog 6            226   3e-71    Leucadendron spissifolium subsp. fragrans
ref|XP_011395961.1|  putative CCR4-associated factor 1-like prote...    231   4e-71    Auxenochlorella protothecoides
emb|CDG58377.1|  putative CCR4-associated factor 1-homolog 6            224   1e-70    Leucadendron laureolum
gb|EMT15436.1|  Putative CCR4-associated factor 1-7-like protein        227   1e-70    
ref|XP_011006693.1|  PREDICTED: probable CCR4-associated factor 1...    226   3e-69    Populus euphratica
gb|KDP27391.1|  hypothetical protein JCGZ_20215                         223   4e-68    Jatropha curcas
ref|NP_001140241.1|  uncharacterized protein LOC100272282               223   4e-68    Zea mays [maize]
ref|XP_007509231.1|  Caf1 CCR4-associated (transcription) factor 1      223   6e-68    Bathycoccus prasinos
ref|XP_002444415.1|  hypothetical protein SORBIDRAFT_07g021610          223   7e-68    Sorghum bicolor [broomcorn]
ref|XP_011006712.1|  PREDICTED: probable CCR4-associated factor 1...    222   8e-68    Populus euphratica
ref|XP_006384784.1|  CCR4-NOT transcription complex family protein      222   1e-67    Populus trichocarpa [western balsam poplar]
emb|CDG58387.1|  putative CCR4-associated factor 1-homolog 6            216   1e-67    Leucadendron platyspermum
ref|XP_010510103.1|  PREDICTED: probable CCR4-associated factor 1...    221   1e-67    Camelina sativa [gold-of-pleasure]
ref|XP_005707256.1|  CCR4-NOT transcription complex subunit 7/8         222   2e-67    Galdieria sulphuraria
ref|XP_007015724.1|  Polynucleotidyl transferase, ribonuclease H-...    221   3e-67    
ref|XP_006361099.1|  PREDICTED: probable CCR4-associated factor 1...    221   3e-67    Solanum tuberosum [potatoes]
gb|AGT16865.1|  transcription complex                                   221   3e-67    Saccharum hybrid cultivar R570
ref|XP_002523862.1|  ccr4-associated factor, putative                   220   7e-67    Ricinus communis
ref|XP_006854719.1|  hypothetical protein AMTR_s00030p00236350          219   2e-66    
gb|KHN33170.1|  Putative CCR4-associated factor 1 like 11               218   2e-66    Glycine soja [wild soybean]
ref|XP_003521484.1|  PREDICTED: probable CCR4-associated factor 1...    218   2e-66    
ref|XP_010246433.1|  PREDICTED: probable CCR4-associated factor 1...    218   3e-66    Nelumbo nucifera [Indian lotus]
ref|XP_001416204.1|  polyA tail-shortening ribonuclease, probable       218   3e-66    Ostreococcus lucimarinus CCE9901
ref|XP_010104797.1|  putative CCR4-associated factor 1-9-like pro...    218   3e-66    Morus notabilis
gb|AGV54478.1|  CCR4-associated factor 1-like protein 11                218   4e-66    Phaseolus vulgaris [French bean]
ref|XP_010262944.1|  PREDICTED: probable CCR4-associated factor 1...    218   6e-66    Nelumbo nucifera [Indian lotus]
ref|XP_007162950.1|  hypothetical protein PHAVU_001G193900g             217   8e-66    Phaseolus vulgaris [French bean]
ref|XP_009369921.1|  PREDICTED: probable CCR4-associated factor 1...    217   8e-66    Pyrus x bretschneideri [bai li]
ref|XP_006854720.1|  hypothetical protein AMTR_s00030p00236940          217   9e-66    
ref|XP_003554457.1|  PREDICTED: probable CCR4-associated factor 1...    217   1e-65    
ref|XP_002271636.1|  PREDICTED: probable CCR4-associated factor 1...    217   1e-65    
ref|XP_004139505.1|  PREDICTED: probable CCR4-associated factor 1...    216   2e-65    
emb|CAN76920.1|  hypothetical protein VITISV_015622                     216   2e-65    
ref|XP_004241342.1|  PREDICTED: probable CCR4-associated factor 1...    215   3e-65    
gb|KJB35417.1|  hypothetical protein B456_006G114000                    216   4e-65    
ref|XP_008342289.1|  PREDICTED: probable CCR4-associated factor 1...    217   6e-65    
ref|XP_008463638.1|  PREDICTED: probable CCR4-associated factor 1...    215   8e-65    
ref|XP_010907244.1|  PREDICTED: probable CCR4-associated factor 1...    214   1e-64    
gb|ABG66307.1|  CCR4 associated factor 1-related protein                213   2e-64    
gb|KJB09109.1|  hypothetical protein B456_001G123600                    214   2e-64    
ref|XP_004494232.1|  PREDICTED: probable CCR4-associated factor 1...    214   2e-64    
gb|KJB21739.1|  hypothetical protein B456_004G011500                    214   2e-64    
gb|AFS65102.1|  CCR4-associated factor 1-related protein                213   2e-64    
ref|XP_006379358.1|  hypothetical protein POPTR_0009s16310g             213   2e-64    
ref|XP_010031548.1|  PREDICTED: probable CCR4-associated factor 1...    212   6e-64    
ref|XP_007023405.1|  Polynucleotidyl transferase, ribonuclease H-...    209   7e-64    
ref|XP_010932240.1|  PREDICTED: probable CCR4-associated factor 1...    212   1e-63    
gb|ABP35526.1|  CCR4-associated factor                                  212   1e-63    
ref|XP_011090316.1|  PREDICTED: probable CCR4-associated factor 1...    211   1e-63    
ref|XP_009616495.1|  PREDICTED: probable CCR4-associated factor 1...    211   1e-63    
ref|NP_001131670.1|  uncharacterized protein LOC100193030               211   2e-63    
ref|XP_010685418.1|  PREDICTED: probable CCR4-associated factor 1...    211   2e-63    
emb|CDX98586.1|  BnaC05g37890D                                          211   2e-63    
ref|XP_004251085.1|  PREDICTED: probable CCR4-associated factor 1...    211   2e-63    
gb|KDP38660.1|  hypothetical protein JCGZ_04013                         210   3e-63    
ref|XP_011088949.1|  PREDICTED: probable CCR4-associated factor 1...    211   3e-63    
ref|XP_010045176.1|  PREDICTED: probable CCR4-associated factor 1...    211   3e-63    
ref|XP_009405313.1|  PREDICTED: probable CCR4-associated factor 1...    210   4e-63    
emb|CDX92371.1|  BnaA10g14100D                                          210   5e-63    
ref|XP_009804843.1|  PREDICTED: probable CCR4-associated factor 1...    209   7e-63    
ref|XP_010059294.1|  PREDICTED: probable CCR4-associated factor 1...    209   8e-63    
ref|XP_010102028.1|  putative CCR4-associated factor 1-11-like pr...    209   9e-63    
emb|CAN61475.1|  hypothetical protein VITISV_021407                     209   1e-62    
ref|XP_002281138.1|  PREDICTED: probable CCR4-associated factor 1...    209   1e-62    
ref|XP_009120675.1|  PREDICTED: probable CCR4-associated factor 1...    209   1e-62    
ref|XP_009419420.1|  PREDICTED: probable CCR4-associated factor 1...    209   2e-62    
ref|XP_008798872.1|  PREDICTED: probable CCR4-associated factor 1...    209   2e-62    
gb|ACL52816.1|  unknown                                                 209   2e-62    
ref|XP_003540260.1|  PREDICTED: probable CCR4-associated factor 1...    209   2e-62    
ref|XP_006362860.1|  PREDICTED: probable CCR4-associated factor 1...    209   2e-62    
ref|XP_006400731.1|  hypothetical protein EUTSA_v10014297mg             208   3e-62    
emb|CDP06864.1|  unnamed protein product                                208   3e-62    
emb|CEG00911.1|  Ribonuclease H-like domain                             206   7e-62    
ref|XP_007205684.1|  hypothetical protein PRUPE_ppa009650mg             207   8e-62    
ref|XP_008391953.1|  PREDICTED: probable CCR4-associated factor 1...    207   1e-61    
ref|XP_006481524.1|  PREDICTED: probable CCR4-associated factor 1...    207   1e-61    
ref|XP_010493298.1|  PREDICTED: probable CCR4-associated factor 1...    206   1e-61    
gb|EYU36042.1|  hypothetical protein MIMGU_mgv1a011524mg                206   1e-61    
ref|XP_011043248.1|  PREDICTED: probable CCR4-associated factor 1...    206   1e-61    
ref|XP_003635867.1|  CCR4-associated factor                             211   1e-61    
ref|NP_197617.1|  CCR4-associated factor 1B                             206   1e-61    
ref|XP_004337732.1|  ccr4associated factor, putative                    206   2e-61    
ref|XP_003074753.1|  Caf1 CCR4-associated (transcription) factor,...    206   2e-61    
ref|XP_002874054.1|  hypothetical protein ARALYDRAFT_489075             206   2e-61    
gb|ACU19702.1|  unknown                                                 207   2e-61    
gb|KJB46419.1|  hypothetical protein B456_007G366900                    206   2e-61    
ref|XP_006424139.1|  hypothetical protein CICLE_v10028965mg             206   3e-61    
ref|XP_003538097.1|  PREDICTED: probable CCR4-associated factor 1...    205   4e-61    
gb|KDO58265.1|  hypothetical protein CISIN_1g022773mg                   206   4e-61    
ref|XP_004354599.1|  CAF1 family protein                                209   4e-61    
emb|CDX88806.1|  BnaA03g08430D                                          205   4e-61    
ref|XP_009349767.1|  PREDICTED: probable CCR4-associated factor 1...    205   5e-61    
ref|XP_010421012.1|  PREDICTED: probable CCR4-associated factor 1...    205   5e-61    
gb|KFK26333.1|  hypothetical protein AALP_AA8G234200                    205   5e-61    
ref|XP_010454487.1|  PREDICTED: probable CCR4-associated factor 1...    204   7e-61    
ref|XP_009604779.1|  PREDICTED: probable CCR4-associated factor 1...    204   7e-61    
ref|XP_004291682.1|  PREDICTED: probable CCR4-associated factor 1...    204   8e-61    
ref|XP_009347151.1|  PREDICTED: probable CCR4-associated factor 1...    204   8e-61    
ref|XP_009349269.1|  PREDICTED: probable CCR4-associated factor 1...    204   8e-61    
ref|XP_008246147.1|  PREDICTED: probable CCR4-associated factor 1...    204   1e-60    
ref|XP_009802120.1|  PREDICTED: probable CCR4-associated factor 1...    203   2e-60    
ref|XP_009372560.1|  PREDICTED: probable CCR4-associated factor 1...    204   2e-60    
emb|CDH53595.1|  caf1 family protein                                    204   2e-60    
ref|XP_004140166.1|  PREDICTED: probable CCR4-associated factor 1...    203   2e-60    
ref|XP_007027917.1|  Polynucleotidyl transferase                        203   2e-60    
dbj|BAM20372.1|  ccr4-associated factor                                 204   3e-60    
gb|KDP36143.1|  hypothetical protein JCGZ_08787                         203   3e-60    
ref|XP_007346111.1|  CAF1-domain-containing protein                     204   5e-60    
gb|ELT91034.1|  hypothetical protein CAPTEDRAFT_96823                   203   5e-60    
ref|XP_009131865.1|  PREDICTED: probable CCR4-associated factor 1...    202   5e-60    
gb|EFA83975.1|  CAF1 family protein                                     213   5e-60    
emb|CDY08688.1|  BnaC03g54940D                                          202   6e-60    
emb|CBQ71168.1|  probable CCR4-NOT transcription complex, subunit 7     203   6e-60    
ref|XP_007150040.1|  hypothetical protein PHAVU_005G121100g             203   7e-60    
ref|XP_009126529.1|  PREDICTED: probable CCR4-associated factor 1...    202   7e-60    
ref|XP_009396725.1|  PREDICTED: probable CCR4-associated factor 1...    202   7e-60    
ref|XP_005823461.1|  hypothetical protein GUITHDRAFT_97567              204   9e-60    
ref|XP_009033148.1|  hypothetical protein AURANDRAFT_52324              204   9e-60    
gb|EFN64855.1|  CCR4-NOT transcription complex subunit 7                201   1e-59    
gb|ENN82986.1|  hypothetical protein YQE_00650                          200   1e-59    
gb|KDN37229.1|  CAF1-domain-containing protein                          204   1e-59    
ref|XP_006286717.1|  hypothetical protein CARUB_v10002891mg             201   1e-59    
ref|XP_011160727.1|  PREDICTED: CCR4-NOT transcription complex su...    202   1e-59    
ref|XP_008243475.1|  PREDICTED: probable CCR4-associated factor 1...    201   1e-59    
ref|XP_004517160.1|  PREDICTED: probable CCR4-associated factor 1...    201   1e-59    
ref|XP_009123303.1|  PREDICTED: probable CCR4-associated factor 1...    201   1e-59    
ref|XP_011337289.1|  PREDICTED: CCR4-NOT transcription complex su...    202   1e-59    
ref|XP_011160728.1|  PREDICTED: CCR4-NOT transcription complex su...    201   1e-59    
ref|XP_011261446.1|  PREDICTED: CCR4-NOT transcription complex su...    202   1e-59    
ref|XP_008387054.1|  PREDICTED: probable CCR4-associated factor 1...    201   1e-59    
ref|XP_007877414.1|  hypothetical protein PFL1_01713                    202   1e-59    
gb|EGI59892.1|  CCR4-NOT transcription complex subunit 7                201   2e-59    
emb|CDH54244.1|  ccr4-not transcription complex subunit 7               201   2e-59    
gb|EWM25650.1|  ccr4-associated factor                                  203   2e-59    
emb|CDP10624.1|  unnamed protein product                                201   2e-59    
ref|XP_001731698.1|  hypothetical protein MGL_0966                      201   3e-59    
dbj|GAK65069.1|  ribonuclease CAF1                                      202   3e-59    
emb|CDY35673.1|  BnaC02g09390D                                          200   3e-59    
emb|CDY47299.1|  BnaA06g38950D                                          200   3e-59    
gb|ETS62597.1|  hypothetical protein PaG_03234                          201   3e-59    
ref|XP_003033973.1|  hypothetical protein SCHCODRAFT_66866              202   3e-59    
ref|XP_006680570.1|  hypothetical protein BATDEDRAFT_90073              200   3e-59    
ref|XP_011388715.1|  putative CCR4-NOT core exoribonuclease subun...    201   4e-59    
gb|ERL90972.1|  hypothetical protein D910_08314                         201   4e-59    
dbj|GAC98607.1|  potential mRNA deadenylase and CCR4-NOT complex ...    201   4e-59    
gb|EMS21915.1|  CCR4-NOT transcription complex subunit 7/8              201   4e-59    
ref|XP_008548221.1|  PREDICTED: CCR4-NOT transcription complex su...    200   4e-59    
emb|CDI55400.1|  probable CCR4-NOT transcription complex, subunit 7     201   4e-59    
ref|XP_010535711.1|  PREDICTED: probable CCR4-associated factor 1...    200   4e-59    
gb|AEE62054.1|  unknown                                                 200   4e-59    
ref|XP_007202414.1|  hypothetical protein PRUPE_ppa009651mg             200   5e-59    
ref|XP_008548220.1|  PREDICTED: CCR4-NOT transcription complex su...    200   5e-59    
ref|NP_190012.1|  putative CCR4-associated factor 1                     200   5e-59    
ref|XP_006568302.1|  PREDICTED: CCR4-NOT transcription complex su...    200   6e-59    
ref|XP_008548219.1|  PREDICTED: CCR4-NOT transcription complex su...    200   6e-59    
ref|XP_011135448.1|  PREDICTED: CCR4-NOT transcription complex su...    200   6e-59    
ref|XP_006568301.1|  PREDICTED: CCR4-NOT transcription complex su...    200   6e-59    
gb|EPS70860.1|  hypothetical protein M569_03896                         199   7e-59    
ref|XP_003396031.1|  PREDICTED: CCR4-NOT transcription complex su...    200   7e-59    
ref|XP_010525704.1|  PREDICTED: probable CCR4-associated factor 1...    199   7e-59    
dbj|GAM18889.1|  hypothetical protein SAMD00019534_020640               201   7e-59    
ref|XP_786386.1|  PREDICTED: CCR4-NOT transcription complex subun...    199   7e-59    
ref|XP_010520453.1|  PREDICTED: probable CCR4-associated factor 1...    199   8e-59    
ref|XP_002877329.1|  hypothetical protein ARALYDRAFT_484842             199   8e-59    
emb|CEG62914.1|  Putative CCR4-NOT transcription complex subunit 7      199   8e-59    
ref|XP_002061857.1|  GK17222                                            199   9e-59    
gb|KFH71636.1|  hypothetical protein MVEG_01932                         200   9e-59    
ref|XP_011501465.1|  PREDICTED: CCR4-NOT transcription complex su...    199   1e-58    
ref|XP_003424661.1|  PREDICTED: CCR4-NOT transcription complex su...    199   1e-58    
gb|EYU26744.1|  hypothetical protein MIMGU_mgv1a019885mg                199   1e-58    
gb|EYU28523.1|  hypothetical protein MIMGU_mgv1a011187mg                199   1e-58    
ref|XP_011299715.1|  PREDICTED: CCR4-NOT transcription complex su...    199   1e-58    
ref|XP_004497679.1|  PREDICTED: probable CCR4-associated factor 1...    198   1e-58    
emb|CEP13830.1|  hypothetical protein                                   199   1e-58    
ref|XP_004927883.1|  PREDICTED: CCR4-NOT transcription complex su...    199   1e-58    
ref|XP_003539842.1|  PREDICTED: probable CCR4-associated factor 1...    198   2e-58    
ref|XP_008896820.1|  hypothetical protein PPTG_05090                    198   2e-58    
ref|XP_008206873.1|  PREDICTED: CCR4-NOT transcription complex su...    199   2e-58    
ref|XP_003693870.1|  PREDICTED: CCR4-NOT transcription complex su...    200   2e-58    
gb|ETP32561.1|  hypothetical protein F442_18752                         198   2e-58    
gb|KDE04055.1|  hypothetical protein MVLG_05494                         201   2e-58    
ref|XP_001601395.1|  PREDICTED: CCR4-NOT transcription complex su...    199   2e-58    
ref|XP_011299712.1|  PREDICTED: CCR4-NOT transcription complex su...    199   2e-58    
ref|XP_002679115.1|  predicted protein                                  199   2e-58    
gb|EST05943.1|  CCR4-NOT transcription complex, subunit 7               199   2e-58    
ref|XP_011501464.1|  PREDICTED: CCR4-NOT transcription complex su...    200   2e-58    
ref|XP_009020258.1|  hypothetical protein HELRODRAFT_81531              199   2e-58    
emb|CCU99951.1|  unnamed protein product                                199   2e-58    
ref|XP_003491312.1|  PREDICTED: LOW QUALITY PROTEIN: CCR4-NOT tra...    200   3e-58    
ref|XP_008206772.1|  PREDICTED: CCR4-NOT transcription complex su...    199   3e-58    
emb|CDY09125.1|  BnaA02g05510D                                          197   3e-58    
ref|XP_006481554.1|  PREDICTED: probable CCR4-associated factor 1...    197   3e-58    
gb|KDQ62591.1|  hypothetical protein JAAARDRAFT_171083                  199   3e-58    
ref|XP_002008770.1|  GI13677                                            199   3e-58    
ref|XP_001957405.1|  GF10398                                            198   4e-58    
emb|CDS05253.1|  Putative CCR4-NOT transcription complex subunit7       197   4e-58    
emb|CCF48047.1|  probable CCR4-NOT transcription complex, subunit 7     199   4e-58    
ref|XP_002403308.1|  CCR4-associated factor, putative                   199   4e-58    
ref|XP_004927882.1|  PREDICTED: CCR4-NOT transcription complex su...    197   4e-58    
ref|XP_001985184.1|  GH16922                                            199   4e-58    
ref|XP_003424663.1|  PREDICTED: CCR4-NOT transcription complex su...    199   4e-58    
ref|XP_010430949.1|  PREDICTED: probable CCR4-associated factor 1...    197   5e-58    
ref|XP_005854806.1|  CCR4-NOT transcription complex subunit 7/8         204   5e-58    
gb|ENN73721.1|  hypothetical protein YQE_09671                          197   5e-58    
gb|EGU13456.1|  hypothetical protein RTG_00172                          208   5e-58    
ref|XP_007132477.1|  hypothetical protein PHAVU_011G097400g             197   5e-58    
gb|KFM79896.1|  CCR4-NOT transcription complex subunit 7                197   5e-58    
ref|XP_002323399.1|  hypothetical protein POPTR_0016s07390g             197   5e-58    
ref|XP_006404478.1|  hypothetical protein EUTSA_v10010623mg             197   6e-58    
ref|XP_008245949.1|  PREDICTED: probable CCR4-associated factor 1...    197   6e-58    
ref|XP_002048516.1|  GJ14014                                            198   7e-58    
ref|XP_006292804.1|  hypothetical protein CARUB_v10019055mg             196   7e-58    
ref|XP_010503079.1|  PREDICTED: probable CCR4-associated factor 1...    197   8e-58    
ref|XP_007271716.1|  CAF1-domain-containing protein                     199   8e-58    
gb|EHJ70264.1|  hypothetical protein KGM_18080                          197   8e-58    
gb|KGG51291.1|  subunit 7 of CCR4-NOT transcription complex             197   9e-58    
ref|XP_001972481.1|  GG13860                                            197   1e-57    
ref|XP_011299711.1|  PREDICTED: CCR4-NOT transcription complex su...    198   1e-57    
emb|CDS11386.1|  Putative CCR4-NOT transcription complex subunit7       196   1e-57    
ref|XP_002309398.1|  hypothetical protein POPTR_0006s22200g             197   1e-57    
dbj|GAA97487.1|  hypothetical protein E5Q_04165                         197   1e-57    
ref|XP_638302.1|  CAF1 family protein                                   197   1e-57    
ref|XP_975202.1|  PREDICTED: CCR4-NOT transcription complex subun...    196   2e-57    
ref|XP_002024844.1|  GL17886                                            196   2e-57    
gb|EYU18096.1|  hypothetical protein MIMGU_mgv1a010802mg                196   2e-57    
dbj|GAN07390.1|  CCR4 associated factor                                 197   2e-57    
ref|XP_007379942.1|  ribonuclease CAF1                                  195   2e-57    
ref|XP_007206659.1|  hypothetical protein PRUPE_ppa022680mg             196   2e-57    
emb|CCI48565.1|  unnamed protein product                                195   2e-57    
ref|NP_729775.1|  Pop2, isoform B                                       196   2e-57    
ref|XP_004487463.1|  PREDICTED: uncharacterized protein LOC101496250    202   2e-57    
ref|XP_001363106.2|  PREDICTED: CCR4-NOT transcription complex su...    197   3e-57    
ref|XP_011044042.1|  PREDICTED: probable CCR4-associated factor 1...    196   3e-57    
ref|XP_638651.1|  CAF1 family protein                                   198   3e-57    
ref|NP_648538.1|  Pop2, isoform A                                       196   3e-57    
ref|XP_001363668.3|  PREDICTED: CCR4-NOT transcription complex su...    198   3e-57    
gb|EXX67656.1|  Pop2p                                                   198   3e-57    
ref|XP_004318849.1|  PREDICTED: CCR4-NOT transcription complex su...    192   4e-57    
dbj|BAM20457.1|  ccr4-associated factor                                 195   4e-57    
ref|XP_003703401.1|  PREDICTED: LOW QUALITY PROTEIN: CCR4-NOT tra...    197   5e-57    
gb|KDR17086.1|  CCR4-NOT transcription complex subunit 7                197   5e-57    
ref|XP_011441179.1|  PREDICTED: CCR4-NOT transcription complex su...    195   5e-57    
ref|XP_007899528.1|  PREDICTED: CCR4-NOT transcription complex su...    194   6e-57    
ref|XP_009517666.1|  hypothetical protein PHYSODRAFT_474397             194   7e-57    
ref|NP_001089689.1|  CCR4-NOT transcription complex subunit 7           194   7e-57    
ref|XP_001660003.1|  AAEL009400-PB                                      197   7e-57    
ref|XP_004303510.1|  PREDICTED: probable CCR4-associated factor 1...    195   7e-57    
ref|XP_010306411.1|  PREDICTED: CCR4-NOT transcription complex su...    194   1e-56    
ref|XP_003283707.1|  hypothetical protein DICPUDRAFT_20033              194   1e-56    
emb|CEI89573.1|  Putative CCR4-NOT transcription complex subunit 7      193   1e-56    



>gb|KHG18085.1| putative CCR4-associated factor 1 -like protein [Gossypium arboreum]
Length=300

 Score =   357 bits (916),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 167/191 (87%), Positives = 183/191 (96%), Gaps = 0/191 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDEKGNLPTCGTDKYCIWQFNFREF+ NEDVFA+DSIELLRQ GIDF+KN E GI+A RF
Sbjct  108  SDEKGNLPTCGTDKYCIWQFNFREFNVNEDVFANDSIELLRQSGIDFKKNNEKGIDAMRF  167

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSGIVLND+VHWVTFHSGYDFGYLLK+LTCQ LP+TQ GFF+LIN+YFP ++DIK
Sbjct  168  GELLMSSGIVLNDNVHWVTFHSGYDFGYLLKLLTCQNLPDTQVGFFSLINIYFPTLYDIK  227

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM++CNSLHGGLNKLAELLEVERVG+CHQAGSDSLLTACTFRKLK+NFFSGSLE+YSGV
Sbjct  228  HLMKYCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTACTFRKLKENFFSGSLEKYSGV  287

Query  208  LYGLGVENGQN  176
            LYGLGVENGQN
Sbjct  288  LYGLGVENGQN  298



>gb|KJB68026.1| hypothetical protein B456_010G222500 [Gossypium raimondii]
Length=274

 Score =   356 bits (913),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 167/191 (87%), Positives = 183/191 (96%), Gaps = 0/191 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDEKGNLPTCGTDKYCIWQFNFREF+ NEDVFA+DSIELLRQ GIDF+KN E GI+A RF
Sbjct  82   SDEKGNLPTCGTDKYCIWQFNFREFNVNEDVFANDSIELLRQSGIDFKKNNEKGIDAMRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSGIVLND+VHWVTFHSGYDFGYLLK+LTCQ LP+TQ GFF+LIN+YFP ++DIK
Sbjct  142  GELLMSSGIVLNDNVHWVTFHSGYDFGYLLKLLTCQNLPDTQVGFFSLINIYFPTLYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLTACTFRKLK+NFFSGSLE+YSGV
Sbjct  202  HLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTACTFRKLKENFFSGSLEKYSGV  261

Query  208  LYGLGVENGQN  176
            LYGLGVENGQ+
Sbjct  262  LYGLGVENGQS  272



>ref|XP_009605547.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Nicotiana 
tomentosiformis]
Length=275

 Score =   355 bits (912),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 166/191 (87%), Positives = 182/191 (95%), Gaps = 0/191 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDEKGNLP CGTDKYCIWQFNFREF+PNEDVFA+DSIELLRQ GIDF KN E GI+A+RF
Sbjct  82   SDEKGNLPKCGTDKYCIWQFNFREFNPNEDVFANDSIELLRQSGIDFTKNIEKGIDAKRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSGIVLND+V+WVTFHSGYDFGYLLK+LTCQ+LP+TQ  FF L+N+YFP +FDIK
Sbjct  142  GELLMSSGIVLNDNVYWVTFHSGYDFGYLLKLLTCQDLPDTQADFFTLMNVYFPVIFDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLK+NFFSGSLE+Y+GV
Sbjct  202  HLMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKENFFSGSLEKYAGV  261

Query  208  LYGLGVENGQN  176
            LYGLGVENGQN
Sbjct  262  LYGLGVENGQN  272



>ref|XP_002527306.1| ccr4-associated factor, putative [Ricinus communis]
 gb|EEF35058.1| ccr4-associated factor, putative [Ricinus communis]
Length=274

 Score =   355 bits (911),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 167/191 (87%), Positives = 182/191 (95%), Gaps = 0/191 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE+GNLPTCGTDKYCIWQFNFREF+ NEDVFA+DSIELLRQ GIDF+KN E GI+A RF
Sbjct  82   SDEQGNLPTCGTDKYCIWQFNFREFNVNEDVFANDSIELLRQSGIDFKKNNERGIDAMRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSGIVLNDSVHWVTFHSGYDFGYLLK+LTCQ LP+TQ GFF LINMYFP ++DIK
Sbjct  142  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKLLTCQNLPDTQLGFFNLINMYFPTLYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLTACTFRKLK+NFFSGSLE+Y+GV
Sbjct  202  HLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTACTFRKLKENFFSGSLEKYAGV  261

Query  208  LYGLGVENGQN  176
            LYGLGVENGQ+
Sbjct  262  LYGLGVENGQS  272



>ref|XP_011034532.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Populus 
euphratica]
Length=274

 Score =   353 bits (906),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 166/191 (87%), Positives = 183/191 (96%), Gaps = 0/191 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE+GNLPTCGTDKYCIWQFNFREF+ NEDVFA+DSIELLRQ GIDF+KN E+GI+A RF
Sbjct  82   SDEQGNLPTCGTDKYCIWQFNFREFNLNEDVFANDSIELLRQSGIDFKKNNENGIDAVRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSGIVLND+V+WVTFHSGYDFGYLLK+LTCQ LP+TQ GFF LINMYFP ++DIK
Sbjct  142  GELLMSSGIVLNDNVYWVTFHSGYDFGYLLKLLTCQNLPDTQAGFFNLINMYFPTLYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLTACTFRKLK+NFFSGSLE+Y+GV
Sbjct  202  HLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTACTFRKLKENFFSGSLEKYAGV  261

Query  208  LYGLGVENGQN  176
            LYGLGVENGQN
Sbjct  262  LYGLGVENGQN  272



>gb|KDP41983.1| hypothetical protein JCGZ_27001 [Jatropha curcas]
Length=274

 Score =   351 bits (900),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 165/191 (86%), Positives = 182/191 (95%), Gaps = 0/191 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE+GNLPTCGT K+CIWQFNFREF+ NEDVFA+DSIELLRQ GIDF+KN E+GI+A +F
Sbjct  82   SDEQGNLPTCGTGKFCIWQFNFREFNVNEDVFANDSIELLRQSGIDFKKNNENGIDAMQF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSGIVLNDSVHWVTFHSGYDFGYLLK+LTCQ LP+TQ GFF LINMYFP ++DIK
Sbjct  142  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKLLTCQNLPDTQVGFFNLINMYFPTLYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLTACTFRKLK+NFFSGSLE+Y+GV
Sbjct  202  HLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTACTFRKLKENFFSGSLEKYAGV  261

Query  208  LYGLGVENGQN  176
            LYGLGVENGQN
Sbjct  262  LYGLGVENGQN  272



>ref|XP_009793121.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Nicotiana 
sylvestris]
Length=275

 Score =   350 bits (898),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 164/191 (86%), Positives = 180/191 (94%), Gaps = 0/191 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDEKGNLP CGTDKYCIWQFNFREF+PNEDVFA+DSIELLRQ GIDF KN E GI+A+RF
Sbjct  82   SDEKGNLPKCGTDKYCIWQFNFREFNPNEDVFANDSIELLRQSGIDFTKNIEKGIDAKRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSGIVLND+V+WVTFHSGYDFGYLL +LTCQ+LP+TQ  FF L+N+YFP +FDIK
Sbjct  142  GELLMSSGIVLNDNVYWVTFHSGYDFGYLLNLLTCQDLPDTQADFFTLMNVYFPVIFDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLK+NFFS SLE+Y+GV
Sbjct  202  HLMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKENFFSCSLEKYAGV  261

Query  208  LYGLGVENGQN  176
            LYGLGVENGQN
Sbjct  262  LYGLGVENGQN  272



>ref|XP_004235935.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Solanum 
lycopersicum]
Length=274

 Score =   350 bits (897),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 163/191 (85%), Positives = 179/191 (94%), Gaps = 0/191 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLP CGTDKYCIWQFNFREF+PNEDVFA+DSIELLRQ GIDF+ N E GI+A+ F
Sbjct  82   SDENGNLPKCGTDKYCIWQFNFREFNPNEDVFANDSIELLRQSGIDFKMNNEKGIDAKHF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
             ELLMSSGIVLNDSV WVTFHSGYDFGYLLK+LTCQ+LPETQ GFF LIN+YFP +FDIK
Sbjct  142  AELLMSSGIVLNDSVSWVTFHSGYDFGYLLKVLTCQDLPETQAGFFTLINVYFPVIFDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLTACTFRKLK+NFFSGSL++Y+GV
Sbjct  202  HLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTACTFRKLKENFFSGSLDKYAGV  261

Query  208  LYGLGVENGQN  176
            LYGLGVENGQ+
Sbjct  262  LYGLGVENGQS  272



>gb|KDP33530.1| hypothetical protein JCGZ_07101 [Jatropha curcas]
Length=275

 Score =   350 bits (897),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 162/191 (85%), Positives = 180/191 (94%), Gaps = 0/191 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLPTCGTDK+CIWQFNFREF+ +ED+FASDSIELLRQCGIDF+KN E GI+  RF
Sbjct  83   SDENGNLPTCGTDKFCIWQFNFREFNISEDIFASDSIELLRQCGIDFKKNNEKGIDVNRF  142

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSG+VLNDSV+WVTFHSGYDFGYLLK+LTC+ LP+TQ GFF LINMYFP V+DIK
Sbjct  143  GELLMSSGVVLNDSVYWVTFHSGYDFGYLLKLLTCRSLPDTQAGFFDLINMYFPVVYDIK  202

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLT+CTFRKL+DNFF+GS E+Y+GV
Sbjct  203  HLMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTSCTFRKLRDNFFNGSAEKYAGV  262

Query  208  LYGLGVENGQN  176
            LYGLGVENGQN
Sbjct  263  LYGLGVENGQN  273



>ref|XP_007023404.1| Polynucleotidyl transferase, ribonuclease H-like superfamily 
protein isoform 2 [Theobroma cacao]
 gb|EOY26026.1| Polynucleotidyl transferase, ribonuclease H-like superfamily 
protein isoform 2 [Theobroma cacao]
Length=236

 Score =   348 bits (893),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 164/191 (86%), Positives = 182/191 (95%), Gaps = 0/191 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE+GNLPTCGTDKYCIWQFNFREF+ NEDVFA+DSIELLRQ GIDF+KN E GI+A RF
Sbjct  44   SDEEGNLPTCGTDKYCIWQFNFREFNVNEDVFANDSIELLRQSGIDFKKNNEKGIDAMRF  103

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSGIVLNDSVHWVTFHSGYDFGYLLK+LTCQ LP+TQ GFF+LIN+YFP ++DIK
Sbjct  104  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKLLTCQNLPDTQVGFFSLINIYFPTLYDIK  163

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSL+GGLNKLAELLEVERVG+CHQAGSDSLLT+CTF KLK+NFFSGSLE+YSGV
Sbjct  164  HLMKFCNSLYGGLNKLAELLEVERVGICHQAGSDSLLTSCTFMKLKENFFSGSLEKYSGV  223

Query  208  LYGLGVENGQN  176
            LYGLGVENGQ+
Sbjct  224  LYGLGVENGQS  234



>ref|XP_002272165.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Vitis 
vinifera]
 ref|XP_010655010.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Vitis 
vinifera]
Length=274

 Score =   349 bits (895),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 164/191 (86%), Positives = 181/191 (95%), Gaps = 0/191 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE+GNLPTCGTDKYCIWQFNFREF+ NEDVFA+DSIELLRQ GIDF KN E GI+A RF
Sbjct  82   SDEQGNLPTCGTDKYCIWQFNFREFNVNEDVFANDSIELLRQSGIDFMKNNEKGIDAVRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSGIVLND+V+WVTFHSGYDFGYLLK+LTC+ LP+TQ GFF LINMYFP ++DIK
Sbjct  142  GELLMSSGIVLNDNVYWVTFHSGYDFGYLLKLLTCKNLPDTQAGFFNLINMYFPVLYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT+CTFRKLK+NFFSGSLE+Y+GV
Sbjct  202  HLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTFRKLKENFFSGSLEKYAGV  261

Query  208  LYGLGVENGQN  176
            LYGLGVENGQN
Sbjct  262  LYGLGVENGQN  272



>ref|XP_011020623.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Populus 
euphratica]
Length=274

 Score =   348 bits (894),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 163/190 (86%), Positives = 180/190 (95%), Gaps = 0/190 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SD++GNLPTCGTDKYCIWQFNFREF+ NEDVFA+DSIELLRQ GID  KN E+GI+A RF
Sbjct  82   SDDQGNLPTCGTDKYCIWQFNFREFNVNEDVFANDSIELLRQSGIDLNKNNENGIDAVRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSGIVLNDSV+WVTFHSGYDFGYLLK+LTCQ LP+TQ GFF LINMYFP ++DIK
Sbjct  142  GELLMSSGIVLNDSVYWVTFHSGYDFGYLLKLLTCQNLPDTQAGFFNLINMYFPTLYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLEVER+G+CHQAGSDSLLTACTFRKLK+NFFSGSLE+Y+GV
Sbjct  202  HLMKFCNSLHGGLNKLAELLEVERIGICHQAGSDSLLTACTFRKLKENFFSGSLEKYAGV  261

Query  208  LYGLGVENGQ  179
            LYGLGVENGQ
Sbjct  262  LYGLGVENGQ  271



>ref|XP_007023403.1| Polynucleotidyl transferase, ribonuclease H-like superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY26025.1| Polynucleotidyl transferase, ribonuclease H-like superfamily 
protein isoform 1 [Theobroma cacao]
Length=274

 Score =   348 bits (894),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 164/191 (86%), Positives = 182/191 (95%), Gaps = 0/191 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE+GNLPTCGTDKYCIWQFNFREF+ NEDVFA+DSIELLRQ GIDF+KN E GI+A RF
Sbjct  82   SDEEGNLPTCGTDKYCIWQFNFREFNVNEDVFANDSIELLRQSGIDFKKNNEKGIDAMRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSGIVLNDSVHWVTFHSGYDFGYLLK+LTCQ LP+TQ GFF+LIN+YFP ++DIK
Sbjct  142  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKLLTCQNLPDTQVGFFSLINIYFPTLYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSL+GGLNKLAELLEVERVG+CHQAGSDSLLT+CTF KLK+NFFSGSLE+YSGV
Sbjct  202  HLMKFCNSLYGGLNKLAELLEVERVGICHQAGSDSLLTSCTFMKLKENFFSGSLEKYSGV  261

Query  208  LYGLGVENGQN  176
            LYGLGVENGQ+
Sbjct  262  LYGLGVENGQS  272



>ref|XP_006341359.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Solanum 
tuberosum]
Length=274

 Score =   348 bits (893),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 162/191 (85%), Positives = 179/191 (94%), Gaps = 0/191 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLP CGTDKYCIWQFNFREF+PNEDVFA+DSIELLRQ GIDF+ N E G++A+ F
Sbjct  82   SDENGNLPKCGTDKYCIWQFNFREFNPNEDVFANDSIELLRQSGIDFKMNHEKGVDAKHF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
             ELLMSSGIVLNDSV WVTFHSGYDFGYLLK+LTCQ+LPETQ GFF LIN+YFP +FDIK
Sbjct  142  AELLMSSGIVLNDSVSWVTFHSGYDFGYLLKLLTCQDLPETQAGFFTLINVYFPVIFDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLTACTFRKLK+NFFSGSL++Y+GV
Sbjct  202  HLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTACTFRKLKENFFSGSLDKYAGV  261

Query  208  LYGLGVENGQN  176
            LYGLGVENGQ+
Sbjct  262  LYGLGVENGQS  272



>ref|XP_009760590.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Nicotiana 
sylvestris]
Length=275

 Score =   347 bits (890),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 166/192 (86%), Positives = 181/192 (94%), Gaps = 1/192 (1%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLP CGTDKYCIWQFNF +F+PNEDV+A+DSIELLRQ GIDF+KN E GI+A RF
Sbjct  82   SDENGNLPKCGTDKYCIWQFNFCDFNPNEDVYANDSIELLRQSGIDFKKNIEKGIDATRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSGIVLND+V+WVTFHSGYDFGYLLKILTCQ+LP+TQ GFF LINMYFP VFDIK
Sbjct  142  GELLMSSGIVLNDNVYWVTFHSGYDFGYLLKILTCQDLPDTQTGFFNLINMYFPVVFDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLK+NFFSGS+E+Y+GV
Sbjct  202  HLMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKENFFSGSMEKYAGV  261

Query  208  LYGLG-VENGQN  176
            LYGLG VENGQN
Sbjct  262  LYGLGVVENGQN  273



>ref|XP_011082241.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Sesamum 
indicum]
Length=272

 Score =   347 bits (889),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 162/191 (85%), Positives = 180/191 (94%), Gaps = 0/191 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDEKGNLP CGTDKYCIWQFNFREF+PNEDVFA+DSIELLRQ GIDF +N E GI++RRF
Sbjct  82   SDEKGNLPDCGTDKYCIWQFNFREFNPNEDVFANDSIELLRQSGIDFARNNEKGIDSRRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
             ELLMSSGIVLN++V+WVTFHSGYDFGYLLK+LTCQ LPETQ GFF LIN+YFP ++DIK
Sbjct  142  AELLMSSGIVLNNNVYWVTFHSGYDFGYLLKLLTCQNLPETQAGFFTLINIYFPVLYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+F NSLHGGLNKLAELLEVERVGVCHQAGSDSLLT+CTFRKLK+NFFSGSLE+YSGV
Sbjct  202  HLMKFSNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTSCTFRKLKENFFSGSLEKYSGV  261

Query  208  LYGLGVENGQN  176
            LYGLGVE+GQ+
Sbjct  262  LYGLGVESGQS  272



>ref|XP_002515442.1| ccr4-associated factor, putative [Ricinus communis]
 gb|EEF46891.1| ccr4-associated factor, putative [Ricinus communis]
Length=274

 Score =   346 bits (888),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 160/191 (84%), Positives = 178/191 (93%), Gaps = 0/191 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLPTCGTDK+CIWQFNFREF+ +ED+FASDSIELLRQCGIDF+KN E GI+  RF
Sbjct  82   SDENGNLPTCGTDKFCIWQFNFREFNISEDIFASDSIELLRQCGIDFKKNNEKGIDVNRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GEL+MSSGIVLND VHWVTFHSGYDFGYLLK+LTC+ LP+TQ GFF LIN YFP V+DIK
Sbjct  142  GELMMSSGIVLNDGVHWVTFHSGYDFGYLLKLLTCRSLPDTQAGFFDLINTYFPMVYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT+CTFRKL+DNFF+GS E+Y+GV
Sbjct  202  HLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTFRKLRDNFFNGSTEKYAGV  261

Query  208  LYGLGVENGQN  176
            LYGLGVENGQN
Sbjct  262  LYGLGVENGQN  272



>ref|XP_010089956.1| putative CCR4-associated factor 1-7-like protein [Morus notabilis]
 gb|EXB38652.1| putative CCR4-associated factor 1-7-like protein [Morus notabilis]
Length=276

 Score =   346 bits (888),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 161/190 (85%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLPTCGTDK+CIWQFNFREF+ +ED+FASDSIELLRQCGIDF+KN E GI+  RF
Sbjct  84   SDENGNLPTCGTDKFCIWQFNFREFNISEDIFASDSIELLRQCGIDFKKNNEKGIDVNRF  143

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSGIVLND VHWVTFHSGYDFGYLLK+LTCQ LP+TQ GFF LIN+YFP V+DIK
Sbjct  144  GELLMSSGIVLNDGVHWVTFHSGYDFGYLLKLLTCQSLPDTQAGFFDLINVYFPMVYDIK  203

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLT+CTFRKL+D FF+GS E+Y+GV
Sbjct  204  HLMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTSCTFRKLRDTFFNGSTEKYAGV  263

Query  208  LYGLGVENGQ  179
            LYGLGVENGQ
Sbjct  264  LYGLGVENGQ  273



>ref|XP_007023408.1| Polynucleotidyl transferase, ribonuclease H-like superfamily 
protein isoform 1 [Theobroma cacao]
 ref|XP_007023409.1| Polynucleotidyl transferase, ribonuclease H-like superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY26030.1| Polynucleotidyl transferase, ribonuclease H-like superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY26031.1| Polynucleotidyl transferase, ribonuclease H-like superfamily 
protein isoform 1 [Theobroma cacao]
Length=274

 Score =   346 bits (887),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 162/191 (85%), Positives = 181/191 (95%), Gaps = 0/191 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SD++GNLPTCGTDKYCIWQFNF EF+ NEDVFA+DSIELLRQ GIDF+KN E GI+A RF
Sbjct  82   SDDQGNLPTCGTDKYCIWQFNFCEFNVNEDVFANDSIELLRQSGIDFKKNNEKGIDAMRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSGIVLNDSVHWVTFHSGYDFGYLLK+LTCQ LP+TQ  FF+LIN+YFP ++DIK
Sbjct  142  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKLLTCQNLPDTQVEFFSLINIYFPTLYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT+CTFRKLK+NFFSGSLE+YSGV
Sbjct  202  HLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTFRKLKENFFSGSLEKYSGV  261

Query  208  LYGLGVENGQN  176
            LYGLG+ENGQ+
Sbjct  262  LYGLGIENGQS  272



>ref|XP_009594641.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Nicotiana 
tomentosiformis]
Length=275

 Score =   345 bits (886),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 165/192 (86%), Positives = 181/192 (94%), Gaps = 1/192 (1%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLP CGTDKY IWQFNF +F+PNEDV+A+DSIELLRQ GIDF+KN E GI+A+RF
Sbjct  82   SDENGNLPKCGTDKYYIWQFNFCDFNPNEDVYANDSIELLRQSGIDFKKNIEKGIDAKRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSGIVLND+V+WVTFHSGYDFGYLLKILTCQ+LP+TQ GFF LINMYFP VFDIK
Sbjct  142  GELLMSSGIVLNDTVYWVTFHSGYDFGYLLKILTCQDLPDTQAGFFNLINMYFPVVFDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLK+NFFSGS+E+Y+GV
Sbjct  202  HLMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKENFFSGSMEKYAGV  261

Query  208  LYGLG-VENGQN  176
            LYGLG VENGQN
Sbjct  262  LYGLGVVENGQN  273



>ref|XP_002303842.1| hypothetical protein POPTR_0003s17950g [Populus trichocarpa]
 ref|XP_006385927.1| CCR4-NOT transcription complex family protein [Populus trichocarpa]
 gb|EEE78821.1| hypothetical protein POPTR_0003s17950g [Populus trichocarpa]
 gb|ERP63724.1| CCR4-NOT transcription complex family protein [Populus trichocarpa]
Length=274

 Score =   345 bits (885),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 162/190 (85%), Positives = 179/190 (94%), Gaps = 0/190 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SD++GNLPTCGTDKYCIWQFNFREF+ NEDVFA+DSIELLRQ GID  KN E+GI+A RF
Sbjct  82   SDDQGNLPTCGTDKYCIWQFNFREFNVNEDVFANDSIELLRQSGIDLNKNNENGIDAVRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSGIVLNDSV+WVTFHSGYDFGYLLK+LTCQ LP+TQ GFF LINMYFP ++DIK
Sbjct  142  GELLMSSGIVLNDSVYWVTFHSGYDFGYLLKLLTCQNLPDTQAGFFNLINMYFPTLYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLEVER+G+CHQAGSDSLLTACTFRKLK+NFFS SLE+Y+GV
Sbjct  202  HLMKFCNSLHGGLNKLAELLEVERIGICHQAGSDSLLTACTFRKLKENFFSCSLEKYAGV  261

Query  208  LYGLGVENGQ  179
            LYGLGVENGQ
Sbjct  262  LYGLGVENGQ  271



>ref|XP_007023407.1| CCR4-associated factor 1 [Theobroma cacao]
 gb|EOY26029.1| CCR4-associated factor 1 [Theobroma cacao]
Length=356

 Score =   348 bits (892),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 163/190 (86%), Positives = 180/190 (95%), Gaps = 0/190 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE+GNLPTC TDKYCIWQFNFREF+ NEDVFA+DSIELLRQ GIDF+KN E GI+A RF
Sbjct  82   SDEEGNLPTCATDKYCIWQFNFREFNVNEDVFANDSIELLRQSGIDFKKNNEKGIDAMRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSGIVLNDSVHWVTFHSGYDFGYLLK+LTCQ LP+TQ GFF+LIN+YFP ++DIK
Sbjct  142  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKLLTCQNLPDTQAGFFSLINIYFPTLYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+F NSL+GGLNKLAELLEVERVG+CHQAGSDSLLT+CTFRKLK+NFFSGSLE+YSGV
Sbjct  202  HLMKFSNSLYGGLNKLAELLEVERVGICHQAGSDSLLTSCTFRKLKENFFSGSLEKYSGV  261

Query  208  LYGLGVENGQ  179
            LYGLGVENGQ
Sbjct  262  LYGLGVENGQ  271



>ref|XP_002324905.2| hypothetical protein POPTR_0018s02370g [Populus trichocarpa]
 gb|EEF03470.2| hypothetical protein POPTR_0018s02370g [Populus trichocarpa]
Length=277

 Score =   345 bits (884),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 160/191 (84%), Positives = 178/191 (93%), Gaps = 0/191 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLPTCGTDK+CIWQFNFREF+  ED+FASDSIELLRQCGIDF+KN+E GI+  RF
Sbjct  85   SDENGNLPTCGTDKFCIWQFNFREFNVTEDIFASDSIELLRQCGIDFKKNSEMGIDVNRF  144

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSGIVLND V+WVTFHSGYDFGYLLK+LTC+ LP++Q GFF LINMYFP V+DIK
Sbjct  145  GELLMSSGIVLNDGVNWVTFHSGYDFGYLLKLLTCRSLPDSQAGFFDLINMYFPMVYDIK  204

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLEVER+GVCHQAGSDSLLT+ TF+KLKDNFFSGS E+Y+GV
Sbjct  205  HLMKFCNSLHGGLNKLAELLEVERIGVCHQAGSDSLLTSSTFKKLKDNFFSGSTEKYAGV  264

Query  208  LYGLGVENGQN  176
            LYGLGVENGQN
Sbjct  265  LYGLGVENGQN  275



>ref|XP_007215794.1| hypothetical protein PRUPE_ppa009874mg [Prunus persica]
 gb|EMJ16993.1| hypothetical protein PRUPE_ppa009874mg [Prunus persica]
Length=274

 Score =   344 bits (882),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 161/191 (84%), Positives = 180/191 (94%), Gaps = 0/191 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE+GNLPTCGTDK+CIWQFNFREF+ NEDVFA+DSIELLRQ GIDF+KN E GI+A+RF
Sbjct  82   SDEQGNLPTCGTDKHCIWQFNFREFNLNEDVFANDSIELLRQSGIDFKKNNEKGIDAKRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSGIVLND+VHWVTFHSGYDFGYLLK+LTCQ LPETQ  FF LIN+YFP ++DIK
Sbjct  142  GELLMSSGIVLNDTVHWVTFHSGYDFGYLLKLLTCQNLPETQAEFFNLINIYFPTIYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT+CTFRKLK++FFSGSLE+Y+GV
Sbjct  202  HLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTFRKLKESFFSGSLEKYAGV  261

Query  208  LYGLGVENGQN  176
            LYGLGVEN  N
Sbjct  262  LYGLGVENVLN  272



>ref|XP_008228784.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Prunus 
mume]
 ref|XP_008228785.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Prunus 
mume]
 ref|XP_008228786.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Prunus 
mume]
Length=274

 Score =   343 bits (880),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 160/191 (84%), Positives = 179/191 (94%), Gaps = 0/191 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE+GNLPTCGTDK+CIWQFNFREF+ NEDVFA+DSIELLRQ GIDF+KN E GI+A+R 
Sbjct  82   SDEQGNLPTCGTDKHCIWQFNFREFNLNEDVFANDSIELLRQSGIDFKKNNEKGIDAKRL  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSGIVLNDSVHWVTFHSGYDFGYL+K+LTC  LPETQ  FF LIN+YFP ++DIK
Sbjct  142  GELLMSSGIVLNDSVHWVTFHSGYDFGYLIKLLTCHNLPETQAEFFNLINIYFPTIYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT+CTFRKLK++FFSGSLE+Y+GV
Sbjct  202  HLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTFRKLKESFFSGSLEKYAGV  261

Query  208  LYGLGVENGQN  176
            LYGLGVENG N
Sbjct  262  LYGLGVENGLN  272



>ref|XP_004305482.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Fragaria 
vesca subsp. vesca]
Length=274

 Score =   343 bits (880),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 161/191 (84%), Positives = 180/191 (94%), Gaps = 0/191 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE+GNLPTCGTD+ CIWQFNFREF+ NEDVFA+DSIELLRQ GIDF+KN E GI+A+ F
Sbjct  82   SDEEGNLPTCGTDQQCIWQFNFREFNLNEDVFANDSIELLRQSGIDFKKNNEKGIDAKLF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSGIVLNDSVHWVTFHSGYDFGYLLK+LTCQ LP+TQ GFF LIN+YFP ++DIK
Sbjct  142  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKVLTCQNLPDTQVGFFNLINIYFPTIYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT+CTFRKLK+NFFSGSLE+Y+GV
Sbjct  202  HLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTFRKLKENFFSGSLEKYAGV  261

Query  208  LYGLGVENGQN  176
            LYGLGVENG +
Sbjct  262  LYGLGVENGHS  272



>ref|XP_011036659.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Populus 
euphratica]
Length=277

 Score =   343 bits (880),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 159/191 (83%), Positives = 178/191 (93%), Gaps = 0/191 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLPTCGTDK+CIWQFNFREF+  ED+FASDSIELLRQCGIDF+KN+E GI+  RF
Sbjct  85   SDENGNLPTCGTDKFCIWQFNFREFNVTEDIFASDSIELLRQCGIDFKKNSEMGIDVNRF  144

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSGIVLND V+WVTFHSGYDFGYLLK+LTC+ LP++Q GFF LINMYFP V+DIK
Sbjct  145  GELLMSSGIVLNDGVNWVTFHSGYDFGYLLKLLTCRSLPDSQAGFFDLINMYFPMVYDIK  204

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLEVER+GVCHQAGSDSLLT+ TF+KLKDNFFSGS ++Y+GV
Sbjct  205  HLMKFCNSLHGGLNKLAELLEVERIGVCHQAGSDSLLTSSTFKKLKDNFFSGSTKKYAGV  264

Query  208  LYGLGVENGQN  176
            LYGLGVENGQN
Sbjct  265  LYGLGVENGQN  275



>ref|XP_010275748.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Nelumbo 
nucifera]
Length=274

 Score =   342 bits (878),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 159/191 (83%), Positives = 177/191 (93%), Gaps = 0/191 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLPTCGTDKYC+WQFNFREF+ +EDVFA+DSIELLRQ GIDF+KN E GI+A+RF
Sbjct  82   SDEAGNLPTCGTDKYCVWQFNFREFNVSEDVFANDSIELLRQSGIDFKKNNEKGIDAQRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSGIVLNDSV WVTFHSGYDFGYLLK+LTCQ LP+TQ GFF LI MYFP V+DIK
Sbjct  142  GELLMSSGIVLNDSVLWVTFHSGYDFGYLLKLLTCQNLPDTQAGFFTLIKMYFPTVYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLEVER+G+CHQAGSDSLLT+CTFRKLK+ FF+G  E+Y+GV
Sbjct  202  HLMKFCNSLHGGLNKLAELLEVERIGICHQAGSDSLLTSCTFRKLKEAFFNGQTEKYAGV  261

Query  208  LYGLGVENGQN  176
            LYGLGVENGQN
Sbjct  262  LYGLGVENGQN  272



>ref|XP_007011965.1| Polynucleotidyl transferase, ribonuclease H-like superfamily 
protein [Theobroma cacao]
 gb|EOY29584.1| Polynucleotidyl transferase, ribonuclease H-like superfamily 
protein [Theobroma cacao]
Length=274

 Score =   342 bits (877),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 155/191 (81%), Positives = 178/191 (93%), Gaps = 0/191 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SD+KGNLPTCGTDK+C+WQFNFREFDPNEDV+A+DSIELL Q GIDF+KN E G+ A RF
Sbjct  82   SDDKGNLPTCGTDKFCVWQFNFREFDPNEDVYANDSIELLSQSGIDFKKNKEKGVSAHRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
             ELLMSSG+VLNDSVHWVTFHSGYDFGYLLK+LTC+ LPETQ  FF+LI++YFP ++DIK
Sbjct  142  SELLMSSGVVLNDSVHWVTFHSGYDFGYLLKLLTCKNLPETQAEFFSLIDIYFPTLYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELL+VER+G+CHQAGSDSLLT+CTF KLK+NFFSGS E+Y+GV
Sbjct  202  HLMKFCNSLHGGLNKLAELLDVERIGICHQAGSDSLLTSCTFMKLKENFFSGSTEKYAGV  261

Query  208  LYGLGVENGQN  176
            LYGLGVENGQN
Sbjct  262  LYGLGVENGQN  272



>emb|CDO98220.1| unnamed protein product [Coffea canephora]
Length=275

 Score =   342 bits (877),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 162/192 (84%), Positives = 177/192 (92%), Gaps = 1/192 (1%)
 Frame = -3

Query  748  SDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARR  572
            SDEKGNLP CG D KYC WQFNFREF+PNEDVFA+DSIELLRQ G DF KN E GI+A+ 
Sbjct  82   SDEKGNLPKCGVDNKYCTWQFNFREFNPNEDVFANDSIELLRQSGFDFAKNNEKGIDAKH  141

Query  571  FGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDI  392
            FGELLMSSGIVLND+V+WVTFHSGYDFGYLLK+LTCQ LP+TQ  FF LIN+YFP ++DI
Sbjct  142  FGELLMSSGIVLNDNVYWVTFHSGYDFGYLLKLLTCQNLPDTQAEFFTLINIYFPVIYDI  201

Query  391  KHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSG  212
            KHLM+FCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLK+NFFSGSLE+Y+G
Sbjct  202  KHLMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKENFFSGSLEKYTG  261

Query  211  VLYGLGVENGQN  176
            VLYGLGVENGQN
Sbjct  262  VLYGLGVENGQN  273



>ref|XP_008375521.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Malus 
domestica]
 ref|XP_008375525.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Malus 
domestica]
Length=274

 Score =   342 bits (876),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 157/191 (82%), Positives = 181/191 (95%), Gaps = 0/191 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE+GN P+CGTDK CIWQFNFREF+ NEDVF+SDSIELLRQ GIDF+KN E GI+A+RF
Sbjct  82   SDEQGNFPSCGTDKQCIWQFNFREFNLNEDVFSSDSIELLRQSGIDFKKNNEKGIDAKRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSGIVLND+VHWVTFHSGYDFGYLLK+LTCQ  P+TQ GFF LIN+YFP+++DIK
Sbjct  142  GELLMSSGIVLNDNVHWVTFHSGYDFGYLLKLLTCQNSPQTQAGFFNLINIYFPKIYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT+CTFRKLK++FFSGS+E+Y+GV
Sbjct  202  HLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTFRKLKESFFSGSMEKYAGV  261

Query  208  LYGLGVENGQN  176
            LYGLGV+NGQ+
Sbjct  262  LYGLGVDNGQD  272



>ref|XP_002309667.1| hypothetical protein POPTR_0006s27840g [Populus trichocarpa]
 gb|EEE93190.1| hypothetical protein POPTR_0006s27840g [Populus trichocarpa]
Length=277

 Score =   342 bits (876),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 158/191 (83%), Positives = 176/191 (92%), Gaps = 0/191 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLPTCGTDK+CIWQFNFREF+  +D+FASDSIELLRQCGIDF+ N E GI+  +F
Sbjct  85   SDENGNLPTCGTDKFCIWQFNFREFNVTKDIFASDSIELLRQCGIDFKMNNEKGIDVNQF  144

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSGIVLND VHWVTFHSGYDFGYLLK+LTC+ LP+T  GFF LINMYFP V+DIK
Sbjct  145  GELLMSSGIVLNDGVHWVTFHSGYDFGYLLKLLTCRSLPDTPAGFFDLINMYFPVVYDIK  204

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLEVER+GVCHQAGSDSLLT+CTFRKL+DNFF+GS E+Y+GV
Sbjct  205  HLMKFCNSLHGGLNKLAELLEVERIGVCHQAGSDSLLTSCTFRKLRDNFFNGSAEKYAGV  264

Query  208  LYGLGVENGQN  176
            LYGLGVENGQN
Sbjct  265  LYGLGVENGQN  275



>ref|XP_010265638.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Nelumbo 
nucifera]
 ref|XP_010265639.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Nelumbo 
nucifera]
Length=274

 Score =   341 bits (875),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 159/191 (83%), Positives = 176/191 (92%), Gaps = 0/191 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLPTCGTDKYC+WQFNFREF+ +EDVFA+DSIELLR+ GIDF+KN E GI+A RF
Sbjct  82   SDEAGNLPTCGTDKYCVWQFNFREFNVSEDVFANDSIELLRESGIDFKKNNEKGIDAHRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSGIVLNDSV WVTFHSGYDFGYLLK+LTCQ LP+TQ GFF LI MYFP V+DIK
Sbjct  142  GELLMSSGIVLNDSVLWVTFHSGYDFGYLLKLLTCQNLPDTQAGFFNLIKMYFPNVYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLEVER+G+CHQAGSDSLLT+CTFRKLKD FF+G  E+Y+GV
Sbjct  202  HLMKFCNSLHGGLNKLAELLEVERIGICHQAGSDSLLTSCTFRKLKDAFFNGQTEKYAGV  261

Query  208  LYGLGVENGQN  176
            LYGLGVENGQN
Sbjct  262  LYGLGVENGQN  272



>gb|KJB07590.1| hypothetical protein B456_001G031500 [Gossypium raimondii]
Length=274

 Score =   341 bits (875),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 158/191 (83%), Positives = 175/191 (92%), Gaps = 0/191 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SD KGNLPTCGTDKYC+WQFNFREFDPNEDV+A+DSIELL Q GIDF+KN E GI A  F
Sbjct  82   SDAKGNLPTCGTDKYCVWQFNFREFDPNEDVYANDSIELLSQSGIDFQKNKEKGISAHDF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
             ELLMSSGIVLND+VHWVTFHSGYDFGYLLK+LTC+ LPETQ GFF+LI +YFP ++DIK
Sbjct  142  SELLMSSGIVLNDNVHWVTFHSGYDFGYLLKLLTCKNLPETQTGFFSLIKIYFPTLYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLEVER+G+CHQAGSDSLLT CTF KLK+NFFSGS E+Y+GV
Sbjct  202  HLMKFCNSLHGGLNKLAELLEVERIGICHQAGSDSLLTCCTFMKLKENFFSGSAEKYAGV  261

Query  208  LYGLGVENGQN  176
            LYGLGVENGQN
Sbjct  262  LYGLGVENGQN  272



>gb|EYU24608.1| hypothetical protein MIMGU_mgv1a011718mg [Erythranthe guttata]
Length=272

 Score =   341 bits (874),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 159/189 (84%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDEKGNLPTCGTDKYCIWQFNFREF+ NEDVFA+DSIELLRQ GIDF KN ++GI+ARRF
Sbjct  82   SDEKGNLPTCGTDKYCIWQFNFREFNLNEDVFANDSIELLRQSGIDFAKNKDNGIDARRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSGIVLND+V WVTFHSGYDFGYLLK+LTCQ LP+TQ  FF LIN+YFP ++DIK
Sbjct  142  GELLMSSGIVLNDNVVWVTFHSGYDFGYLLKVLTCQNLPDTQTAFFNLINLYFPVLYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+F NSLHGGLNKLAELL+VERVG+CHQAGSDSLLT+CTFRKLK+NFFSGS++ YSGV
Sbjct  202  HLMKFSNSLHGGLNKLAELLDVERVGICHQAGSDSLLTSCTFRKLKENFFSGSMDRYSGV  261

Query  208  LYGLGVENG  182
            LYGLGVENG
Sbjct  262  LYGLGVENG  270



>ref|XP_003526204.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Glycine 
max]
Length=273

 Score =   341 bits (874),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 159/190 (84%), Positives = 176/190 (93%), Gaps = 0/190 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLPTCGT+  CIWQFNFREF+ +ED+FASDSIELLRQCGIDF+KN+E GI+  RF
Sbjct  82   SDENGNLPTCGTESTCIWQFNFREFNISEDIFASDSIELLRQCGIDFKKNSEKGIDVNRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSGIVLND+VHWVTFHSGYDFGYLLK+LTC+ LPETQ GFF LI MYFP V+DIK
Sbjct  142  GELLMSSGIVLNDAVHWVTFHSGYDFGYLLKLLTCRSLPETQAGFFDLIKMYFPMVYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLT+CTFRKL+D FFSGS E+Y+GV
Sbjct  202  HLMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTSCTFRKLRDAFFSGSTEKYAGV  261

Query  208  LYGLGVENGQ  179
            LYGLGVE+GQ
Sbjct  262  LYGLGVESGQ  271



>ref|XP_006356242.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Solanum 
tuberosum]
Length=273

 Score =   340 bits (873),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 161/190 (85%), Positives = 181/190 (95%), Gaps = 1/190 (1%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLP CGTDKYCIWQFNF +F+PNEDV+A+DSIELLRQ GIDF+KN E+GI+A+RF
Sbjct  82   SDENGNLPKCGTDKYCIWQFNFCDFNPNEDVYANDSIELLRQSGIDFKKNIENGIDAKRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GE+LMSSGIVLND+V+WVTFHSGYDFGYLLKILTCQ+LPETQ+GFF LINMYFP ++D+K
Sbjct  142  GEILMSSGIVLNDNVYWVTFHSGYDFGYLLKILTCQDLPETQEGFFNLINMYFPVLYDVK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLK+NFF GSLE+Y+GV
Sbjct  202  HLMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKENFFIGSLEKYAGV  261

Query  208  LYGLG-VENG  182
            LYGLG VENG
Sbjct  262  LYGLGVVENG  271



>ref|XP_009354185.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Pyrus 
x bretschneideri]
Length=274

 Score =   340 bits (873),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 156/191 (82%), Positives = 181/191 (95%), Gaps = 0/191 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE+GN P+CGTDK CIWQFNFREF+ N+DVF+SDSIELLRQ GIDF+KN E GI+A+RF
Sbjct  82   SDEQGNFPSCGTDKQCIWQFNFREFNLNKDVFSSDSIELLRQSGIDFKKNNEKGIDAKRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSGIVLND+VHWVTFHSGYDFGYLLK+LTCQ  P+TQ GFF LIN+YFP+++DIK
Sbjct  142  GELLMSSGIVLNDNVHWVTFHSGYDFGYLLKLLTCQNSPQTQAGFFNLINIYFPKIYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT+CTFRKLK++FFSGS+E+Y+GV
Sbjct  202  HLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTFRKLKESFFSGSMEKYAGV  261

Query  208  LYGLGVENGQN  176
            LYGLGV+NGQ+
Sbjct  262  LYGLGVDNGQD  272



>ref|XP_004241682.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Solanum 
lycopersicum]
Length=274

 Score =   340 bits (873),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 161/190 (85%), Positives = 181/190 (95%), Gaps = 1/190 (1%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLP CGTDKYCIWQFNF +F+PNEDV+A+DSIELLRQ GIDF+KN E+GI+A+RF
Sbjct  82   SDEDGNLPKCGTDKYCIWQFNFCDFNPNEDVYANDSIELLRQSGIDFKKNIENGIDAKRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GE+LMSSGIVLND+V+WVTFHSGYDFGYLLKILTCQ+LPETQ+GFF LINMYFP ++D+K
Sbjct  142  GEILMSSGIVLNDNVYWVTFHSGYDFGYLLKILTCQDLPETQEGFFNLINMYFPVLYDVK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLK+NFF GSLE+Y+GV
Sbjct  202  HLMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKENFFIGSLEKYAGV  261

Query  208  LYGLG-VENG  182
            LYGLG VENG
Sbjct  262  LYGLGVVENG  271



>gb|KJB68416.1| hypothetical protein B456_010G244300 [Gossypium raimondii]
Length=274

 Score =   340 bits (873),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 156/191 (82%), Positives = 177/191 (93%), Gaps = 0/191 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLPTCGTD +CIWQFNFREF+ +ED+FASDSIELLRQCGIDF+KN E GI+  RF
Sbjct  82   SDENGNLPTCGTDSFCIWQFNFREFNLSEDIFASDSIELLRQCGIDFKKNNEKGIDVTRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSG+VLND VHWVTFHSGYDFGYLLK+LTC+ LP++Q GFF LI +YFP V+DIK
Sbjct  142  GELLMSSGVVLNDDVHWVTFHSGYDFGYLLKLLTCRSLPDSQAGFFDLIKIYFPMVYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            H+M+FCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLT+CTFRKL+DNFF+GS E+Y+GV
Sbjct  202  HMMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTSCTFRKLRDNFFNGSTEKYAGV  261

Query  208  LYGLGVENGQN  176
            LYGLGV+NGQN
Sbjct  262  LYGLGVQNGQN  272



>gb|KJB66334.1| hypothetical protein B456_010G136400 [Gossypium raimondii]
 gb|KJB66335.1| hypothetical protein B456_010G136400 [Gossypium raimondii]
 gb|KJB66336.1| hypothetical protein B456_010G136400 [Gossypium raimondii]
Length=271

 Score =   340 bits (872),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 160/190 (84%), Positives = 178/190 (94%), Gaps = 0/190 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDEKGNLPTCGTDKYCIWQFNF EF+ +EDVFA+DSIELLRQ GIDF+KN E GI+A RF
Sbjct  82   SDEKGNLPTCGTDKYCIWQFNFCEFNVDEDVFANDSIELLRQSGIDFKKNNEKGIDAMRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELL+SSGIVLNDSV+WVTFHSGYDFGYLLK+LTCQ LP+TQ GFF LIN+YFP ++DIK
Sbjct  142  GELLISSGIVLNDSVYWVTFHSGYDFGYLLKLLTCQNLPDTQVGFFNLINIYFPTLYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT+CTFRKLK+NFFSG+LE+YSGV
Sbjct  202  HLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTFRKLKENFFSGTLEKYSGV  261

Query  208  LYGLGVENGQ  179
            LYGLGVEN  
Sbjct  262  LYGLGVENAH  271



>ref|XP_004507083.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Cicer 
arietinum]
Length=277

 Score =   340 bits (871),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 161/193 (83%), Positives = 179/193 (93%), Gaps = 2/193 (1%)
 Frame = -3

Query  748  SDEKGNLPTCGTD--KYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEAR  575
            SDE GNLP  G D  ++CIWQFNFREF+ NEDVFA+DSIELLRQ GIDF+KN E GI+AR
Sbjct  83   SDEHGNLPKIGDDDDRFCIWQFNFREFNVNEDVFANDSIELLRQSGIDFKKNNEEGIDAR  142

Query  574  RFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFD  395
            RFGELLMSSGIVLND+VHWVTFHSGYDFGYLLK+LTCQ LP+TQ GFF LINMYFP V+D
Sbjct  143  RFGELLMSSGIVLNDNVHWVTFHSGYDFGYLLKLLTCQNLPDTQVGFFNLINMYFPTVYD  202

Query  394  IKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYS  215
            IKHLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT+CTFRKLK+NFFSGS+E+Y+
Sbjct  203  IKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTFRKLKENFFSGSMEKYA  262

Query  214  GVLYGLGVENGQN  176
            GVLYGLGVENGQ+
Sbjct  263  GVLYGLGVENGQS  275



>ref|XP_003530297.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like isoform 
1 [Glycine max]
 ref|XP_003530298.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like isoform 
2 [Glycine max]
 gb|KHN04172.1| Putative CCR4-associated factor 1 like 7 [Glycine soja]
Length=277

 Score =   339 bits (870),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 162/192 (84%), Positives = 179/192 (93%), Gaps = 2/192 (1%)
 Frame = -3

Query  748  SDEKGNLPTCGTDK--YCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEAR  575
            SDE GNLPTCG +    CIWQFNFREF+ NEDVFA+DSIELLRQ GIDF++N E+GI+A 
Sbjct  83   SDEHGNLPTCGDESGTCCIWQFNFREFNVNEDVFANDSIELLRQSGIDFKRNNENGIDAH  142

Query  574  RFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFD  395
            RFGELLMSSGIVLND+VHWVTFHSGYDFGYLLK+LTCQ+LP+TQ GFF LINMYFP V+D
Sbjct  143  RFGELLMSSGIVLNDNVHWVTFHSGYDFGYLLKLLTCQDLPDTQVGFFNLINMYFPTVYD  202

Query  394  IKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYS  215
            IKHLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT+CTFRKLKDNFFSGSLE+Y+
Sbjct  203  IKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTFRKLKDNFFSGSLEKYA  262

Query  214  GVLYGLGVENGQ  179
            GVLYGLGVENGQ
Sbjct  263  GVLYGLGVENGQ  274



>ref|XP_010092187.1| putative CCR4-associated factor 1-7-like protein [Morus notabilis]
 gb|EXB50413.1| putative CCR4-associated factor 1-7-like protein [Morus notabilis]
Length=277

 Score =   339 bits (870),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 161/192 (84%), Positives = 177/192 (92%), Gaps = 1/192 (1%)
 Frame = -3

Query  748  SDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARR  572
            SDE GNLP CG   +YCIWQFNFREF+ NEDVFA+DSIELLRQ GID +KN E GI+A+R
Sbjct  82   SDEHGNLPACGASGEYCIWQFNFREFNVNEDVFANDSIELLRQSGIDLKKNNEEGIDAKR  141

Query  571  FGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDI  392
            FGELLMSSGIVLNDSVHWVTFHSGYDFGYLLK+LTCQ+LP+TQ GFF LINMYFP V+DI
Sbjct  142  FGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKLLTCQDLPDTQAGFFNLINMYFPTVYDI  201

Query  391  KHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSG  212
            KHLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT+C FRKLK+NFFSGSLE+Y+G
Sbjct  202  KHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCAFRKLKENFFSGSLEKYAG  261

Query  211  VLYGLGVENGQN  176
            VLYGLGVENG N
Sbjct  262  VLYGLGVENGLN  273



>ref|XP_007136961.1| hypothetical protein PHAVU_009G088600g [Phaseolus vulgaris]
 ref|XP_007136962.1| hypothetical protein PHAVU_009G088600g [Phaseolus vulgaris]
 gb|ESW08955.1| hypothetical protein PHAVU_009G088600g [Phaseolus vulgaris]
 gb|ESW08956.1| hypothetical protein PHAVU_009G088600g [Phaseolus vulgaris]
Length=273

 Score =   339 bits (870),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 176/190 (93%), Gaps = 0/190 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLPTCG++  CIWQFNFREF+ +ED+FASDSIELLRQCGIDF+KN+E GI+  RF
Sbjct  82   SDENGNLPTCGSESPCIWQFNFREFNISEDIFASDSIELLRQCGIDFKKNSEKGIDVNRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSGIVLND+VHWVTFHSGYDFGYLLK+LTC+ LP+TQ GFF LI MYFP V+DIK
Sbjct  142  GELLMSSGIVLNDAVHWVTFHSGYDFGYLLKLLTCRSLPDTQTGFFDLIKMYFPMVYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLT+CTFRKL+D FF+GS E+YSGV
Sbjct  202  HLMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTSCTFRKLRDTFFNGSTEKYSGV  261

Query  208  LYGLGVENGQ  179
            LYGLGVENGQ
Sbjct  262  LYGLGVENGQ  271



>ref|XP_006427595.1| hypothetical protein CICLE_v10026260mg [Citrus clementina]
 ref|XP_006427596.1| hypothetical protein CICLE_v10026260mg [Citrus clementina]
 gb|ESR40835.1| hypothetical protein CICLE_v10026260mg [Citrus clementina]
 gb|ESR40836.1| hypothetical protein CICLE_v10026260mg [Citrus clementina]
Length=274

 Score =   339 bits (869),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 158/191 (83%), Positives = 176/191 (92%), Gaps = 0/191 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLPTCGTDKYC+WQFNFREFD NED+FA+DSIELL+Q GI+F KN E GI+A RF
Sbjct  82   SDENGNLPTCGTDKYCVWQFNFREFDVNEDIFANDSIELLKQSGINFTKNNEIGIDAMRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GEL+MSSGIVL+DS+HWVTFHSGYDFGYLLK+LTCQ LP+TQ  FF LI +YFP V+DIK
Sbjct  142  GELMMSSGIVLSDSMHWVTFHSGYDFGYLLKLLTCQNLPDTQVEFFNLIRIYFPTVYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLTA TFRKLK+NFFS SLE+Y+GV
Sbjct  202  HLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTASTFRKLKENFFSSSLEKYAGV  261

Query  208  LYGLGVENGQN  176
            LYGLGVENGQN
Sbjct  262  LYGLGVENGQN  272



>ref|XP_006294779.1| hypothetical protein CARUB_v10023830mg [Capsella rubella]
 gb|EOA27677.1| hypothetical protein CARUB_v10023830mg [Capsella rubella]
Length=275

 Score =   339 bits (869),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 158/191 (83%), Positives = 177/191 (93%), Gaps = 1/191 (1%)
 Frame = -3

Query  748  SDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARR  572
            SDEKGNLPTCGTD KYCIWQFNFREFD   D+FA+DSIELLRQ GIDF KN + GI+++R
Sbjct  82   SDEKGNLPTCGTDNKYCIWQFNFREFDLESDIFATDSIELLRQSGIDFAKNNQMGIDSKR  141

Query  571  FGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDI  392
            F ELLMSSGIVLN++VHWVTFHSGYDFGYLLK+LTCQ LPETQ GFF +IN+YFP V+DI
Sbjct  142  FAELLMSSGIVLNENVHWVTFHSGYDFGYLLKLLTCQNLPETQTGFFEMINVYFPRVYDI  201

Query  391  KHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSG  212
            KHLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT+CTFRKL++NFF GS+E+YSG
Sbjct  202  KHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTFRKLQENFFIGSMEKYSG  261

Query  211  VLYGLGVENGQ  179
            VLYGLGVENGQ
Sbjct  262  VLYGLGVENGQ  272



>ref|XP_010665982.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Beta 
vulgaris subsp. vulgaris]
Length=272

 Score =   338 bits (867),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 157/189 (83%), Positives = 177/189 (94%), Gaps = 0/189 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDEKGNLPTCGTDK+CIWQFNFREFD  EDV+ASDSIELL+QCGIDFEKN+E GI++ RF
Sbjct  84   SDEKGNLPTCGTDKFCIWQFNFREFDVGEDVYASDSIELLKQCGIDFEKNSEMGIDSNRF  143

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
             ELLMSSGIVLNDS+ WVTFHSGYDFGYLLK+LTC++LPETQ GFF LIN+YFP V+DIK
Sbjct  144  AELLMSSGIVLNDSIKWVTFHSGYDFGYLLKLLTCRDLPETQSGFFNLINIYFPMVYDIK  203

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLEVER+G+CHQAGSDSLLT CTF KLK+NFF+GS E+Y+GV
Sbjct  204  HLMKFCNSLHGGLNKLAELLEVERIGICHQAGSDSLLTCCTFMKLKENFFNGSTEKYAGV  263

Query  208  LYGLGVENG  182
            LYGLGVE+G
Sbjct  264  LYGLGVEDG  272



>ref|XP_006465196.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Citrus 
sinensis]
Length=274

 Score =   338 bits (867),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 157/191 (82%), Positives = 175/191 (92%), Gaps = 0/191 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLPTCGTDKYC+WQFNFREFD NED+FA+DSIELL+Q GI+F KN E GI+A RF
Sbjct  82   SDENGNLPTCGTDKYCVWQFNFREFDVNEDIFANDSIELLKQSGINFTKNNEIGIDAMRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GE +MSSGIVL+DS+HWVTFHSGYDFGYLLK+LTCQ LP+TQ  FF LI +YFP V+DIK
Sbjct  142  GEFMMSSGIVLSDSIHWVTFHSGYDFGYLLKLLTCQNLPDTQVEFFNLIRIYFPTVYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLTA TFRKLK+NFFS SLE+Y+GV
Sbjct  202  HLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTASTFRKLKENFFSSSLEKYAGV  261

Query  208  LYGLGVENGQN  176
            LYGLGVENGQN
Sbjct  262  LYGLGVENGQN  272



>ref|XP_010510101.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Camelina 
sativa]
Length=275

 Score =   338 bits (867),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 158/191 (83%), Positives = 177/191 (93%), Gaps = 1/191 (1%)
 Frame = -3

Query  748  SDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARR  572
            SDEKGNLPTCG D KYCIWQFNFREFD   D+FA+DSIELLRQ GIDF KN E GI+++R
Sbjct  82   SDEKGNLPTCGPDNKYCIWQFNFREFDLESDIFATDSIELLRQSGIDFAKNNEMGIDSKR  141

Query  571  FGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDI  392
            F ELLMSSGIVLN++VHWVTFHSGYDFGYLLK+LTCQ+LPETQ GFF +IN+YFP V+DI
Sbjct  142  FAELLMSSGIVLNENVHWVTFHSGYDFGYLLKLLTCQDLPETQTGFFEMINVYFPRVYDI  201

Query  391  KHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSG  212
            KHLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT+CTFRKL++NFF GS+E+YSG
Sbjct  202  KHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTFRKLQENFFIGSMEKYSG  261

Query  211  VLYGLGVENGQ  179
            VLYGLGVENGQ
Sbjct  262  VLYGLGVENGQ  272



>ref|XP_009128391.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Brassica 
rapa]
 emb|CDY53227.1| BnaA02g19410D [Brassica napus]
Length=274

 Score =   338 bits (866),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 154/190 (81%), Positives = 178/190 (94%), Gaps = 0/190 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            S+E+GNLPTCGTDKYCIWQFNFREFD + D+FA DSI+LL+Q GIDF KNT+ GIE+ RF
Sbjct  82   SNEQGNLPTCGTDKYCIWQFNFREFDLDSDIFAVDSIDLLKQSGIDFAKNTQEGIESNRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
             ELLMSSGIVLN++VHWVTFHSGYDFGYLLK+LTCQ+LP++Q GFF LIN+YFP V+DIK
Sbjct  142  AELLMSSGIVLNENVHWVTFHSGYDFGYLLKLLTCQDLPDSQTGFFQLINVYFPMVYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT+CTFRKLK+NFF+G L++Y+GV
Sbjct  202  HLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTFRKLKENFFAGPLQKYAGV  261

Query  208  LYGLGVENGQ  179
            LYGLGVENGQ
Sbjct  262  LYGLGVENGQ  271



>ref|XP_010532089.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010532090.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 isoform 
X1 [Tarenaya hassleriana]
Length=274

 Score =   338 bits (866),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 157/190 (83%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDEKGNLPTCGTDKYCIWQFNFREFD N D+FA DSI+LLRQ GIDF KN ++GI++RR+
Sbjct  82   SDEKGNLPTCGTDKYCIWQFNFREFDLNSDIFARDSIDLLRQSGIDFAKNNDNGIDSRRY  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
             ELLMSSGIVLN++VHWVTFHSGYDFGYLLK+LTCQ LPE   GFF LI +YFP V+DIK
Sbjct  142  AELLMSSGIVLNENVHWVTFHSGYDFGYLLKLLTCQNLPEKASGFFELIKIYFPMVYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT+CTF KLK+NFFSGS+E+YSGV
Sbjct  202  HLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTFWKLKENFFSGSMEKYSGV  261

Query  208  LYGLGVENGQ  179
            LYGLGVENGQ
Sbjct  262  LYGLGVENGQ  271



>ref|XP_006857184.1| hypothetical protein AMTR_s00065p00182000 [Amborella trichopoda]
 gb|ERN18651.1| hypothetical protein AMTR_s00065p00182000 [Amborella trichopoda]
Length=274

 Score =   338 bits (866),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 157/191 (82%), Positives = 178/191 (93%), Gaps = 0/191 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLPTCGTDK+ IWQFNFREF+  EDV+A+DSIELLRQ GIDF+KN E GI+A+RF
Sbjct  82   SDEDGNLPTCGTDKFYIWQFNFREFNVLEDVYANDSIELLRQSGIDFKKNNEKGIDAQRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSGIVLND+VHWVTFHSGYDFGYLLK+LTCQ LPETQ GFF LINMYFP V+DIK
Sbjct  142  GELLMSSGIVLNDTVHWVTFHSGYDFGYLLKLLTCQNLPETQAGFFGLINMYFPTVYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELL+VER+G+CHQAGSDSLLT+CTFRKLK++FF+GS E+Y+GV
Sbjct  202  HLMKFCNSLHGGLNKLAELLDVERIGICHQAGSDSLLTSCTFRKLKESFFNGSTEKYAGV  261

Query  208  LYGLGVENGQN  176
            LYGLGVENG +
Sbjct  262  LYGLGVENGNS  272



>gb|ACU24625.1| unknown [Glycine max]
Length=277

 Score =   338 bits (866),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 161/192 (84%), Positives = 178/192 (93%), Gaps = 2/192 (1%)
 Frame = -3

Query  748  SDEKGNLPTCGTDK--YCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEAR  575
            SDE GNLPTCG +    CIWQFNFREF+ NEDVFA+DSIELLRQ GIDF++N E+GI+A 
Sbjct  83   SDEHGNLPTCGDESGTCCIWQFNFREFNVNEDVFANDSIELLRQSGIDFKRNNENGIDAH  142

Query  574  RFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFD  395
            RFGELLMSSGIVLND+VHWVTFHSGYDFGYLLK+LTCQ+LP+TQ GFF LINMYFP V+D
Sbjct  143  RFGELLMSSGIVLNDNVHWVTFHSGYDFGYLLKLLTCQDLPDTQVGFFNLINMYFPTVYD  202

Query  394  IKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYS  215
            IKHLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDS LT+CTFRKLKDNFFSGSLE+Y+
Sbjct  203  IKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSFLTSCTFRKLKDNFFSGSLEKYA  262

Query  214  GVLYGLGVENGQ  179
            GVLYGLGVENGQ
Sbjct  263  GVLYGLGVENGQ  274



>ref|XP_010469632.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Camelina 
sativa]
Length=275

 Score =   338 bits (866),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 157/191 (82%), Positives = 177/191 (93%), Gaps = 1/191 (1%)
 Frame = -3

Query  748  SDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARR  572
            SDEKGNLPTCG D KYCIWQFNFREFD   D+FA+DSIELLRQ GIDF KN + GI+++R
Sbjct  82   SDEKGNLPTCGADNKYCIWQFNFREFDLESDIFATDSIELLRQSGIDFAKNNQMGIDSKR  141

Query  571  FGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDI  392
            F ELLMSSGIVLN++VHWVTFHSGYDFGYLLK+LTCQ+LPETQ GFF +IN+YFP V+DI
Sbjct  142  FAELLMSSGIVLNENVHWVTFHSGYDFGYLLKLLTCQDLPETQTGFFEMINVYFPRVYDI  201

Query  391  KHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSG  212
            KHLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT+CTFRKL++NFF GS+E+YSG
Sbjct  202  KHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTFRKLQENFFIGSMEKYSG  261

Query  211  VLYGLGVENGQ  179
            VLYGLGVENGQ
Sbjct  262  VLYGLGVENGQ  272



>ref|XP_011039582.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Populus 
euphratica]
Length=277

 Score =   338 bits (866),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 157/191 (82%), Positives = 174/191 (91%), Gaps = 0/191 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLPTCGTDK CIWQFNFREF+  +D+FASDSIELLRQCGIDF+ N E GI+  +F
Sbjct  85   SDENGNLPTCGTDKSCIWQFNFREFNVTKDIFASDSIELLRQCGIDFKMNNEKGIDVNQF  144

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSGIVLND VHWVTFHSGYDFGYLLK+LTC+ LP+T  GFF LINMYFP V+DIK
Sbjct  145  GELLMSSGIVLNDGVHWVTFHSGYDFGYLLKLLTCRSLPDTPAGFFDLINMYFPVVYDIK  204

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLEVER+GVCHQAGSDSLLT+CTFRKL+DNFF+GS  +Y+GV
Sbjct  205  HLMKFCNSLHGGLNKLAELLEVERIGVCHQAGSDSLLTSCTFRKLRDNFFNGSAVKYAGV  264

Query  208  LYGLGVENGQN  176
            LYGLGVENGQN
Sbjct  265  LYGLGVENGQN  275



>ref|XP_003522433.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Glycine 
max]
Length=273

 Score =   337 bits (865),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 176/190 (93%), Gaps = 0/190 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLPTCGT+  CIWQFNFREF+ +ED+FASDSIELLRQCGIDF+KN+E+GI+  RF
Sbjct  82   SDENGNLPTCGTESPCIWQFNFREFNVSEDIFASDSIELLRQCGIDFKKNSENGIDVNRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSGIVLNDSV WVTFHSGYDFGYLLK+LTC+ LP+TQ GFF LI MYFP V+DIK
Sbjct  142  GELLMSSGIVLNDSVRWVTFHSGYDFGYLLKLLTCRSLPDTQAGFFDLIKMYFPMVYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLT+CTFRKL+D FFSGS E+Y+GV
Sbjct  202  HLMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTSCTFRKLRDTFFSGSTEKYAGV  261

Query  208  LYGLGVENGQ  179
            LYGLGVE+GQ
Sbjct  262  LYGLGVESGQ  271



>gb|KHG00404.1| putative CCR4-associated factor 1 -like protein [Gossypium arboreum]
Length=274

 Score =   337 bits (865),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 156/191 (82%), Positives = 174/191 (91%), Gaps = 0/191 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SD KGNLPTCGTDKYC+WQFNFREFDPNEDV+A+DSIELL Q GIDF+KN E GI +  F
Sbjct  82   SDAKGNLPTCGTDKYCVWQFNFREFDPNEDVYANDSIELLSQSGIDFQKNKEKGISSHDF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
             ELLMSSGIVLND+VHWVTFHSGYDFGYLLK+LTC+ LPETQ GFF+LI +YFP ++DIK
Sbjct  142  SELLMSSGIVLNDNVHWVTFHSGYDFGYLLKLLTCKNLPETQTGFFSLIKIYFPTLYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLEVER+G+CHQAGSDSLLT CTF KLK+NFFSG  E+Y+GV
Sbjct  202  HLMKFCNSLHGGLNKLAELLEVERIGICHQAGSDSLLTCCTFMKLKENFFSGLAEKYAGV  261

Query  208  LYGLGVENGQN  176
            LYGLGVENGQN
Sbjct  262  LYGLGVENGQN  272



>gb|KDO42998.1| hypothetical protein CISIN_1g023991mg [Citrus sinensis]
Length=274

 Score =   337 bits (865),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 157/191 (82%), Positives = 175/191 (92%), Gaps = 0/191 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLPTCGTDKYC+WQFNFREFD NED+FA+DSIELL+Q GI+F KN E GI+A RF
Sbjct  82   SDENGNLPTCGTDKYCVWQFNFREFDVNEDIFANDSIELLKQSGINFTKNNEIGIDAMRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GE +MSSGIVL+DS+HWVTFHSGYDFGYLLK+LTCQ LP+TQ  FF LI +YFP V+DIK
Sbjct  142  GEFMMSSGIVLSDSMHWVTFHSGYDFGYLLKLLTCQNLPDTQVEFFNLIRIYFPTVYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLTA TFRKLK+NFFS SLE+Y+GV
Sbjct  202  HLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTASTFRKLKENFFSSSLEKYAGV  261

Query  208  LYGLGVENGQN  176
            LYGLGVENGQN
Sbjct  262  LYGLGVENGQN  272



>ref|XP_003604226.1| Ribonuclease CAF1 [Medicago truncatula]
Length=277

 Score =   337 bits (865),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 159/192 (83%), Positives = 179/192 (93%), Gaps = 1/192 (1%)
 Frame = -3

Query  748  SDEKGNLPTCG-TDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARR  572
            SDE GNLPTCG  D++CIWQFNFREF+ NEDVFA+DSIELLRQ GIDF+KN E GI+ARR
Sbjct  84   SDEHGNLPTCGEDDRFCIWQFNFREFNVNEDVFANDSIELLRQSGIDFKKNNEDGIDARR  143

Query  571  FGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDI  392
            FGELLMSSGIVLND+VHW+TFHSGYDFGYLLK+LTCQ LP+TQ GFF LINMYFP ++DI
Sbjct  144  FGELLMSSGIVLNDNVHWITFHSGYDFGYLLKLLTCQNLPDTQVGFFNLINMYFPMLYDI  203

Query  391  KHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSG  212
            KHLM+FCNSLHGGLNKLAELLEV+RVG+CHQAGSDSLLT+  FRKLK+NFFSGSLE+Y+G
Sbjct  204  KHLMKFCNSLHGGLNKLAELLEVKRVGICHQAGSDSLLTSSAFRKLKENFFSGSLEKYAG  263

Query  211  VLYGLGVENGQN  176
            VLYGLGVENGQ+
Sbjct  264  VLYGLGVENGQS  275



>ref|XP_009417447.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Musa 
acuminata subsp. malaccensis]
Length=275

 Score =   337 bits (864),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 157/190 (83%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE G+LPTCGTD+ C+WQFNFREFD   DVFASDSIELLRQ GIDF+KN E GI+A+RF
Sbjct  83   SDEHGSLPTCGTDRGCVWQFNFREFDIQRDVFASDSIELLRQSGIDFKKNNEKGIDAQRF  142

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSGIVLNDSVHWVTFHSGYDFGYLLK+LTCQ LPETQ GFF LI +YFP V+DIK
Sbjct  143  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKLLTCQNLPETQAGFFNLIKIYFPTVYDIK  202

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELL+VERVG+CHQAGSDSLLT+C FRKLK++FF+GS E+Y+GV
Sbjct  203  HLMKFCNSLHGGLNKLAELLDVERVGICHQAGSDSLLTSCAFRKLKESFFNGSTEKYAGV  262

Query  208  LYGLGVENGQ  179
            LYGLGVENGQ
Sbjct  263  LYGLGVENGQ  272



>ref|XP_010414034.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Camelina 
sativa]
Length=275

 Score =   337 bits (863),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 157/191 (82%), Positives = 176/191 (92%), Gaps = 1/191 (1%)
 Frame = -3

Query  748  SDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARR  572
            SDEKGNLPTCG D KYCIWQFNFREFD   D+FA+DSIELLRQ GIDF KN + GI++ R
Sbjct  82   SDEKGNLPTCGADSKYCIWQFNFREFDLESDIFATDSIELLRQSGIDFAKNNQMGIDSER  141

Query  571  FGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDI  392
            F ELLMSSGIVLN++VHWVTFHSGYDFGYLLK+LTCQ+LPETQ GFF +IN+YFP V+DI
Sbjct  142  FAELLMSSGIVLNENVHWVTFHSGYDFGYLLKLLTCQDLPETQTGFFEMINVYFPRVYDI  201

Query  391  KHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSG  212
            KHLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT+CTFRKL++NFF GS+E+YSG
Sbjct  202  KHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTFRKLQENFFIGSMEKYSG  261

Query  211  VLYGLGVENGQ  179
            VLYGLGVENGQ
Sbjct  262  VLYGLGVENGQ  272



>emb|CDY63973.1| BnaC02g46620D [Brassica napus]
Length=274

 Score =   337 bits (863),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 153/190 (81%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            S+E+GNLPTCGTDKYCIWQFNFREFD + D+FA DSI+LL+Q GIDF KNT+ GIE+ RF
Sbjct  82   SNEQGNLPTCGTDKYCIWQFNFREFDLDSDIFAVDSIDLLKQSGIDFAKNTQEGIESNRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
             ELLMSSGIVLN++VHWVTFHSGYDFGYLLK+LTCQ+LP++Q GFF LIN+YFP V+DIK
Sbjct  142  AELLMSSGIVLNENVHWVTFHSGYDFGYLLKLLTCQDLPDSQTGFFQLINVYFPMVYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT+CTFRKLK+NFF+G L++Y+GV
Sbjct  202  HLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTFRKLKENFFAGPLQKYAGV  261

Query  208  LYGLGVENGQ  179
            LYGLGVEN Q
Sbjct  262  LYGLGVENAQ  271



>gb|KHG16599.1| putative CCR4-associated factor 1 -like protein [Gossypium arboreum]
Length=270

 Score =   336 bits (861),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 176/189 (93%), Gaps = 0/189 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLPTCGTD +CIWQFNFREF+ +ED+FASDSIELLRQCGIDF+KN E GI+ +RF
Sbjct  82   SDENGNLPTCGTDSFCIWQFNFREFNLSEDIFASDSIELLRQCGIDFKKNNEKGIDVKRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSG+VLND VHWVTFHSGYDFGYLLK+LTC+ LP++Q GFF LI +YFP V+DIK
Sbjct  142  GELLMSSGVVLNDDVHWVTFHSGYDFGYLLKLLTCRSLPDSQAGFFDLIKIYFPMVYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            H+M+FCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLT+CTFRKL+DNFF+GS ++Y+GV
Sbjct  202  HMMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTSCTFRKLRDNFFNGSTKKYAGV  261

Query  208  LYGLGVENG  182
            LYGLGV+NG
Sbjct  262  LYGLGVQNG  270



>gb|KJB55043.1| hypothetical protein B456_009G061200 [Gossypium raimondii]
Length=274

 Score =   336 bits (861),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLPTCGTD  CIWQFNF EF+ +ED+FASDSIELLRQCGIDF+KN E GI+ +RF
Sbjct  82   SDENGNLPTCGTDSSCIWQFNFCEFNISEDIFASDSIELLRQCGIDFKKNNEKGIDVKRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSGIVLND VHWVTFHSGYDFGYLLK+LTC+ LP+ Q GFF LINMYFP ++DIK
Sbjct  142  GELLMSSGIVLNDGVHWVTFHSGYDFGYLLKLLTCRSLPDNQAGFFDLINMYFPMLYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            H+M+FCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLT+CTFRKL+DNFF+GS E+Y+GV
Sbjct  202  HMMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTSCTFRKLRDNFFNGSTEKYAGV  261

Query  208  LYGLGVENGQ  179
            LYGLGVE+GQ
Sbjct  262  LYGLGVESGQ  271



>ref|XP_009390565.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Musa 
acuminata subsp. malaccensis]
Length=275

 Score =   336 bits (861),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 154/190 (81%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SD+ GNLPTCGTD+ C+WQFNFREFD  +DVFASDSI+LLRQ GIDF+KN E GI+++RF
Sbjct  83   SDQLGNLPTCGTDRGCVWQFNFREFDIQQDVFASDSIDLLRQSGIDFQKNNEKGIDSQRF  142

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSGIVLNDSVHWVTFHSGYDFGYLLK+LTCQ LP+TQ GFF LIN+YFP V+DIK
Sbjct  143  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKLLTCQNLPDTQAGFFNLINIYFPTVYDIK  202

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            H+M+FCNSLHGGLNKLAELL+VERVG+CHQAGSDSLLT+C FRKLK++FF+GS E+Y+GV
Sbjct  203  HIMKFCNSLHGGLNKLAELLDVERVGICHQAGSDSLLTSCAFRKLKESFFNGSTEKYAGV  262

Query  208  LYGLGVENGQ  179
            LYGLGVENGQ
Sbjct  263  LYGLGVENGQ  272



>ref|XP_008445259.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Cucumis 
melo]
Length=274

 Score =   335 bits (860),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 155/190 (82%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLPTCGTDK+CIWQFNFREF+   D+FASDSIELLRQCGIDF+KN E GI+  RF
Sbjct  82   SDEDGNLPTCGTDKFCIWQFNFREFNIGSDIFASDSIELLRQCGIDFQKNNEEGIDVNRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSG+VLND V+WVTFHSGYDFGYLLK+LTC+ LP  Q GFF LIN+YFP V+DIK
Sbjct  142  GELLMSSGVVLNDDVNWVTFHSGYDFGYLLKLLTCRGLPNDQAGFFELINVYFPVVYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLEVER+GVCHQAGSDSLLTACTFRKL+D FF+GS+++Y+GV
Sbjct  202  HLMKFCNSLHGGLNKLAELLEVERIGVCHQAGSDSLLTACTFRKLRDTFFNGSIQKYAGV  261

Query  208  LYGLGVENGQ  179
            LYGLGVENGQ
Sbjct  262  LYGLGVENGQ  271



>ref|XP_002862886.1| hypothetical protein ARALYDRAFT_920160 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39145.1| hypothetical protein ARALYDRAFT_920160 [Arabidopsis lyrata subsp. 
lyrata]
Length=252

 Score =   335 bits (858),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 156/191 (82%), Positives = 177/191 (93%), Gaps = 1/191 (1%)
 Frame = -3

Query  748  SDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARR  572
            SDEKGNLPTCGTD KYCIWQFNFREFD   D++A+DSIELLRQ GIDF KN + GI+++R
Sbjct  59   SDEKGNLPTCGTDNKYCIWQFNFREFDLESDIYATDSIELLRQSGIDFAKNNQFGIDSKR  118

Query  571  FGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDI  392
            F ELLMSSGIVLN++VHWVTFHSGYDFGYLLK+LTCQ LPETQ GFF +I++YFP V+DI
Sbjct  119  FAELLMSSGIVLNENVHWVTFHSGYDFGYLLKLLTCQNLPETQTGFFEMISVYFPRVYDI  178

Query  391  KHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSG  212
            KHLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT+CTFRKL++NFF GS+E+YSG
Sbjct  179  KHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTFRKLQENFFIGSMEKYSG  238

Query  211  VLYGLGVENGQ  179
            VLYGLGVENGQ
Sbjct  239  VLYGLGVENGQ  249



>ref|XP_011082251.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Sesamum 
indicum]
Length=276

 Score =   335 bits (860),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 158/191 (83%), Positives = 178/191 (93%), Gaps = 0/191 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDEKGNLPTCGT+K CIWQFNF EF+PNEDVFA+DS+ELLRQ GIDF KN E GI+A+RF
Sbjct  82   SDEKGNLPTCGTNKQCIWQFNFCEFNPNEDVFANDSVELLRQSGIDFVKNNEKGIDAKRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSGIVLN+ ++WVTFHSGYDFGYLLK+LT Q LP+TQ GFF LIN++FP ++DIK
Sbjct  142  GELLMSSGIVLNNDMYWVTFHSGYDFGYLLKLLTRQNLPDTQAGFFTLINIFFPVLYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+F NSLHGGLNKLAELLEVERVGVCHQAGSDSLLT+CTFRKLK+NFF+GSLE+YSGV
Sbjct  202  HLMKFSNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTSCTFRKLKENFFNGSLEKYSGV  261

Query  208  LYGLGVENGQN  176
            LYGLGVENGQN
Sbjct  262  LYGLGVENGQN  272



>ref|XP_010532085.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Tarenaya 
hassleriana]
Length=274

 Score =   335 bits (859),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDEKGNLPTCGTDKYCIWQFNFREFD   D+FA DSIELL Q GIDF KN ++GI++RR+
Sbjct  82   SDEKGNLPTCGTDKYCIWQFNFREFDLTSDIFARDSIELLHQSGIDFAKNKDNGIDSRRY  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
             ELLMSSGIVLN++VHWVTFHSGYDFGYLLK+LTCQ LPE   GFF LI +YFP V+DIK
Sbjct  142  AELLMSSGIVLNENVHWVTFHSGYDFGYLLKLLTCQNLPEKASGFFELIKIYFPMVYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT+CTF KLK+NFFSGS+E+YSGV
Sbjct  202  HLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTFWKLKENFFSGSMEKYSGV  261

Query  208  LYGLGVENGQ  179
            LYGLGVENGQ
Sbjct  262  LYGLGVENGQ  271



>ref|XP_002881215.1| hypothetical protein ARALYDRAFT_902256 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57474.1| hypothetical protein ARALYDRAFT_902256 [Arabidopsis lyrata subsp. 
lyrata]
Length=275

 Score =   335 bits (859),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 156/191 (82%), Positives = 177/191 (93%), Gaps = 1/191 (1%)
 Frame = -3

Query  748  SDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARR  572
            SDEKGNLPTCGTD KYCIWQFNFREFD   D++A+DSIELLRQ GIDF KN + GI+++R
Sbjct  82   SDEKGNLPTCGTDNKYCIWQFNFREFDLESDIYATDSIELLRQSGIDFAKNNQFGIDSKR  141

Query  571  FGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDI  392
            F ELLMSSGIVLN++VHWVTFHSGYDFGYLLK+LTCQ LPETQ GFF +I++YFP V+DI
Sbjct  142  FAELLMSSGIVLNENVHWVTFHSGYDFGYLLKLLTCQNLPETQTGFFEMISVYFPRVYDI  201

Query  391  KHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSG  212
            KHLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT+CTFRKL++NFF GS+E+YSG
Sbjct  202  KHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTFRKLQENFFIGSMEKYSG  261

Query  211  VLYGLGVENGQ  179
            VLYGLGVENGQ
Sbjct  262  VLYGLGVENGQ  272



>ref|XP_010929136.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Elaeis 
guineensis]
Length=275

 Score =   335 bits (858),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 156/191 (82%), Positives = 173/191 (91%), Gaps = 0/191 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLPTCGT   C+WQFNFREFD + D+FASDSIELLRQ GIDF+KN E GI+  RF
Sbjct  83   SDESGNLPTCGTGHGCVWQFNFREFDVHHDIFASDSIELLRQSGIDFKKNNERGIDTNRF  142

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSGIVLNDSVHWVTFHSGYDFGYLLK+LTCQ LP+TQ GFF LI +YFP V+DIK
Sbjct  143  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKLLTCQNLPDTQAGFFNLIKIYFPTVYDIK  202

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELL+VERVG+CHQAGSDSLLT+CTFRKLK++FF+GS E Y+GV
Sbjct  203  HLMKFCNSLHGGLNKLAELLDVERVGICHQAGSDSLLTSCTFRKLKESFFNGSTERYAGV  262

Query  208  LYGLGVENGQN  176
            LYGLGVENGQN
Sbjct  263  LYGLGVENGQN  273



>ref|XP_010048142.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Eucalyptus 
grandis]
 ref|XP_010048359.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Eucalyptus 
grandis]
 gb|KCW80304.1| hypothetical protein EUGRSUZ_C01665 [Eucalyptus grandis]
 gb|KCW80609.1| hypothetical protein EUGRSUZ_C01976 [Eucalyptus grandis]
Length=274

 Score =   334 bits (857),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 156/189 (83%), Positives = 173/189 (92%), Gaps = 0/189 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLPTCGTDKYCIWQFNFREF+  ED+FA DSIELLR+CGIDF+KNTE G++ RRF
Sbjct  82   SDENGNLPTCGTDKYCIWQFNFREFNVTEDMFAGDSIELLRECGIDFKKNTEKGVDVRRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSGIVLN  VHWVTFHSGYDFGYLLK+LTC+ LP+TQ GFF LIN+YFP V+DIK
Sbjct  142  GELLMSSGIVLNADVHWVTFHSGYDFGYLLKLLTCRSLPDTQVGFFDLINIYFPMVYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLEVER GVCHQAGSDSLLTACTF KL+D FF+GS E+Y+GV
Sbjct  202  HLMKFCNSLHGGLNKLAELLEVERFGVCHQAGSDSLLTACTFLKLRDMFFNGSTEKYAGV  261

Query  208  LYGLGVENG  182
            LYGLGVE+G
Sbjct  262  LYGLGVEDG  270



>ref|XP_004138705.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like isoform 
2 [Cucumis sativus]
 ref|XP_004160760.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like isoform 
2 [Cucumis sativus]
Length=236

 Score =   333 bits (853),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 154/190 (81%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLPTCGTDK+CIWQFNFREF+   D+FASDSIELLRQCGIDF+KN E GI+  RF
Sbjct  44   SDEDGNLPTCGTDKFCIWQFNFREFNIGSDIFASDSIELLRQCGIDFQKNNEEGIDVNRF  103

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSG+VLND V+WVTFHSGYDFGYLLK+LTC+ LP  Q GFF LIN+YFP ++DIK
Sbjct  104  GELLMSSGVVLNDDVNWVTFHSGYDFGYLLKLLTCRGLPNDQAGFFELINVYFPVLYDIK  163

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLEVER+GVCHQAGSDSLLTACTFRKL+D FF+GS+++Y+GV
Sbjct  164  HLMKFCNSLHGGLNKLAELLEVERIGVCHQAGSDSLLTACTFRKLRDTFFNGSIQKYAGV  223

Query  208  LYGLGVENGQ  179
            LYGLGVENGQ
Sbjct  224  LYGLGVENGQ  233



>gb|KHN07034.1| Putative CCR4-associated factor 1 like 7 [Glycine soja]
Length=274

 Score =   334 bits (856),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 159/191 (83%), Positives = 175/191 (92%), Gaps = 1/191 (1%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLPTCGT+  CIWQFNFREF+ +ED+FASDSIELLRQCGIDF+KN+E GI+  RF
Sbjct  82   SDENGNLPTCGTESTCIWQFNFREFNISEDIFASDSIELLRQCGIDFKKNSEKGIDVNRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSG-YDFGYLLKILTCQELPETQQGFFALINMYFPEVFDI  392
            GELLMSSGIVLNDSV WVTFHSG YDFGYLLK+LTC+ LPETQ GFF LI MYFP V+DI
Sbjct  142  GELLMSSGIVLNDSVRWVTFHSGGYDFGYLLKLLTCRSLPETQAGFFDLIKMYFPMVYDI  201

Query  391  KHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSG  212
            KHLM+FCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLT+CTFRKL+D FFSGS E+Y+G
Sbjct  202  KHLMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTSCTFRKLRDAFFSGSTEKYAG  261

Query  211  VLYGLGVENGQ  179
            VLYGLGVE+GQ
Sbjct  262  VLYGLGVESGQ  272



>ref|NP_565735.1| polynucleotidyl transferase, ribonuclease H-like superfamily 
protein [Arabidopsis thaliana]
 sp|Q9SKZ2.2|CAF1G_ARATH RecName: Full=Probable CCR4-associated factor 1 homolog 7 [Arabidopsis 
thaliana]
 gb|AAK93623.1| putative CCR4-associated factor [Arabidopsis thaliana]
 gb|AAD15397.2| putative CCR4-associated factor [Arabidopsis thaliana]
 gb|AAN13153.1| putative CCR4-associated factor [Arabidopsis thaliana]
 gb|AEC08630.1| polynucleotidyl transferase, ribonuclease H-like superfamily 
protein [Arabidopsis thaliana]
Length=275

 Score =   334 bits (856),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 156/191 (82%), Positives = 177/191 (93%), Gaps = 1/191 (1%)
 Frame = -3

Query  748  SDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARR  572
            SDEKGNLPTCGTD KYCIWQFNFREFD   D++A+DSIELLRQ GIDF KN E GI+++R
Sbjct  82   SDEKGNLPTCGTDNKYCIWQFNFREFDLESDIYATDSIELLRQSGIDFVKNNEFGIDSKR  141

Query  571  FGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDI  392
            F ELLMSSGIVLN++VHWVTFHSGYDFGYLLK+LTCQ LPETQ GFF +I++YFP V+DI
Sbjct  142  FAELLMSSGIVLNENVHWVTFHSGYDFGYLLKLLTCQNLPETQTGFFEMISVYFPRVYDI  201

Query  391  KHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSG  212
            KHLM+FCNSLHGGLNKLAELL+VERVG+CHQAGSDSLLT+CTFRKL++NFF GS+E+YSG
Sbjct  202  KHLMKFCNSLHGGLNKLAELLDVERVGICHQAGSDSLLTSCTFRKLQENFFIGSMEKYSG  261

Query  211  VLYGLGVENGQ  179
            VLYGLGVENGQ
Sbjct  262  VLYGLGVENGQ  272



>ref|XP_010942117.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Elaeis 
guineensis]
Length=275

 Score =   334 bits (856),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 155/191 (81%), Positives = 174/191 (91%), Gaps = 0/191 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLPTCGT + C+WQFNFREFD   D+FASDSIELLRQ GIDF+KN E GI+A RF
Sbjct  83   SDEFGNLPTCGTGRGCVWQFNFREFDAQRDIFASDSIELLRQSGIDFKKNNERGIDASRF  142

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSGIVLNDSVHWVTFHSGYDFGYLLK+L+CQ LP+TQ GFF LI ++FP V+DIK
Sbjct  143  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKLLSCQNLPDTQAGFFNLIKIFFPTVYDIK  202

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELL+VERVG+CHQAGSDSLLT+CTFRKLK++FF+GS E Y+GV
Sbjct  203  HLMKFCNSLHGGLNKLAELLDVERVGICHQAGSDSLLTSCTFRKLKESFFNGSTERYAGV  262

Query  208  LYGLGVENGQN  176
            LYGLGVENGQN
Sbjct  263  LYGLGVENGQN  273



>ref|XP_004138704.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like isoform 
1 [Cucumis sativus]
 ref|XP_004160759.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like isoform 
1 [Cucumis sativus]
 gb|KGN62988.1| hypothetical protein Csa_2G382610 [Cucumis sativus]
Length=274

 Score =   334 bits (856),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 154/190 (81%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLPTCGTDK+CIWQFNFREF+   D+FASDSIELLRQCGIDF+KN E GI+  RF
Sbjct  82   SDEDGNLPTCGTDKFCIWQFNFREFNIGSDIFASDSIELLRQCGIDFQKNNEEGIDVNRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSG+VLND V+WVTFHSGYDFGYLLK+LTC+ LP  Q GFF LIN+YFP ++DIK
Sbjct  142  GELLMSSGVVLNDDVNWVTFHSGYDFGYLLKLLTCRGLPNDQAGFFELINVYFPVLYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLEVER+GVCHQAGSDSLLTACTFRKL+D FF+GS+++Y+GV
Sbjct  202  HLMKFCNSLHGGLNKLAELLEVERIGVCHQAGSDSLLTACTFRKLRDTFFNGSIQKYAGV  261

Query  208  LYGLGVENGQ  179
            LYGLGVENGQ
Sbjct  262  LYGLGVENGQ  271



>gb|EPS71126.1| hypothetical protein M569_03633, partial [Genlisea aurea]
Length=268

 Score =   333 bits (854),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 158/187 (84%), Positives = 174/187 (93%), Gaps = 0/187 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDEKGNLP+ GTDK CIWQFNFREF+PNEDVFA+DSIELLRQ GIDF  N + GI+  RF
Sbjct  82   SDEKGNLPSFGTDKRCIWQFNFREFNPNEDVFANDSIELLRQSGIDFVMNNDKGIDVGRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSGIVLND+V+WVTFHSGYDFGYLLK+LTCQ LPETQ GFF+LINM+FP ++DIK
Sbjct  142  GELLMSSGIVLNDNVYWVTFHSGYDFGYLLKLLTCQRLPETQAGFFSLINMFFPVLYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+F NSLHGGLNKLAELLEVERVGVCHQAGSDSLLT+CTFRKLK+NFFSGSLE+YSGV
Sbjct  202  HLMKFSNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTSCTFRKLKENFFSGSLEKYSGV  261

Query  208  LYGLGVE  188
            LYGLGVE
Sbjct  262  LYGLGVE  268



>ref|XP_010472873.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Camelina 
sativa]
Length=274

 Score =   333 bits (854),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 152/190 (80%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            S+E+G+LPTCGTDKYCIWQFNFREFD + D+FA DSIELL+Q GID  KNT+ GI+++RF
Sbjct  82   SNEQGDLPTCGTDKYCIWQFNFREFDLDSDIFAVDSIELLKQSGIDLAKNTQDGIDSKRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
             ELLMSSGIVLN++VHWVTFHSGYDFGYLLK+LTCQ LP++Q  FF LIN+YFP V+DIK
Sbjct  142  AELLMSSGIVLNENVHWVTFHSGYDFGYLLKLLTCQNLPDSQTDFFKLINVYFPTVYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT+CTFRKLK+NFF G L++YSGV
Sbjct  202  HLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTFRKLKENFFVGPLQKYSGV  261

Query  208  LYGLGVENGQ  179
            LYGLGVENGQ
Sbjct  262  LYGLGVENGQ  271



>ref|XP_003531734.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like isoform 
X1 [Glycine max]
 ref|XP_006585611.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like isoform 
X2 [Glycine max]
Length=281

 Score =   333 bits (854),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 160/196 (82%), Positives = 177/196 (90%), Gaps = 6/196 (3%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKY------CIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESG  587
            SDE GNLP CG D        CIWQFNFREF+ NEDVFA+DSIELLRQ GIDF++N E+G
Sbjct  83   SDEHGNLPMCGGDDEESDTCCCIWQFNFREFNVNEDVFANDSIELLRQSGIDFKRNNENG  142

Query  586  IEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFP  407
            I+A RFGELLMSSGIVLND++HWVTFHSGYDFGYLLK+LTCQ+LP+TQ GFF LINMYFP
Sbjct  143  IDAHRFGELLMSSGIVLNDNIHWVTFHSGYDFGYLLKLLTCQDLPDTQVGFFNLINMYFP  202

Query  406  EVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSL  227
             V+DIKHLM+FCNSLHGGLNKLAELLEVERVG+ HQAGSDSLLT+CTFRKLKDNFFSGSL
Sbjct  203  TVYDIKHLMKFCNSLHGGLNKLAELLEVERVGISHQAGSDSLLTSCTFRKLKDNFFSGSL  262

Query  226  EEYSGVLYGLGVENGQ  179
            E+Y+GVLYGLGVENGQ
Sbjct  263  EKYAGVLYGLGVENGQ  278



>ref|XP_010532091.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 isoform 
X2 [Tarenaya hassleriana]
Length=275

 Score =   333 bits (854),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 157/191 (82%), Positives = 175/191 (92%), Gaps = 1/191 (1%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDEKGNLPTCGTDKYCIWQFNFREFD N D+FA DSI+LLRQ GIDF KN ++GI++RR+
Sbjct  82   SDEKGNLPTCGTDKYCIWQFNFREFDLNSDIFARDSIDLLRQSGIDFAKNNDNGIDSRRY  141

Query  568  GELLMSSGIVLNDSVHWVTFHSG-YDFGYLLKILTCQELPETQQGFFALINMYFPEVFDI  392
             ELLMSSGIVLN++VHWVTFHSG YDFGYLLK+LTCQ LPE   GFF LI +YFP V+DI
Sbjct  142  AELLMSSGIVLNENVHWVTFHSGGYDFGYLLKLLTCQNLPEKASGFFELIKIYFPMVYDI  201

Query  391  KHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSG  212
            KHLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT+CTF KLK+NFFSGS+E+YSG
Sbjct  202  KHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTFWKLKENFFSGSMEKYSG  261

Query  211  VLYGLGVENGQ  179
            VLYGLGVENGQ
Sbjct  262  VLYGLGVENGQ  272



>gb|ACU20942.1| unknown [Glycine max]
Length=281

 Score =   333 bits (854),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 160/196 (82%), Positives = 177/196 (90%), Gaps = 6/196 (3%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKY------CIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESG  587
            SDE GNLP CG D        CIWQFNFREF+ NEDVFA+DSIELLRQ GIDF++N E+G
Sbjct  83   SDEHGNLPMCGGDDEESDTCCCIWQFNFREFNVNEDVFANDSIELLRQSGIDFKRNNENG  142

Query  586  IEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFP  407
            I+A RFGELLMSSGIVLND++HWVTFHSGYDFGYLLK+LTCQ+LP+TQ GFF LINMYFP
Sbjct  143  IDAHRFGELLMSSGIVLNDNIHWVTFHSGYDFGYLLKLLTCQDLPDTQVGFFNLINMYFP  202

Query  406  EVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSL  227
             V+DIKHLM+FCNSLHGGLNKLAELLEVERVG+ HQAGSDSLLT+CTFRKLKDNFFSGSL
Sbjct  203  TVYDIKHLMKFCNSLHGGLNKLAELLEVERVGISHQAGSDSLLTSCTFRKLKDNFFSGSL  262

Query  226  EEYSGVLYGLGVENGQ  179
            E+Y+GVLYGLGVENGQ
Sbjct  263  EKYAGVLYGLGVENGQ  278



>ref|XP_011073341.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Sesamum 
indicum]
Length=270

 Score =   332 bits (852),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 174/189 (92%), Gaps = 0/189 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDEKGNLPTCGTDK+CIWQFNFREF+P+EDVFA+DSIELL Q GID  +N E+GI+ARRF
Sbjct  82   SDEKGNLPTCGTDKFCIWQFNFREFNPDEDVFANDSIELLSQSGIDLVRNNENGIDARRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
             ELLMSSGIVLND+V+WVTFHSGYDFGYLLK+LTCQ LP+ Q  FF LIN+YFP V+DIK
Sbjct  142  AELLMSSGIVLNDNVNWVTFHSGYDFGYLLKLLTCQNLPDAQAAFFTLINVYFPVVYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLT CTF KLK NFFSGS+++Y+GV
Sbjct  202  HLMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTCCTFMKLKGNFFSGSMDKYAGV  261

Query  208  LYGLGVENG  182
            LYGLGVE+G
Sbjct  262  LYGLGVESG  270



>ref|XP_008794330.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Phoenix 
dactylifera]
Length=275

 Score =   332 bits (852),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 154/191 (81%), Positives = 173/191 (91%), Gaps = 0/191 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLPTCGT   C+WQFNFREFD + D+FA+DSIELLRQ GID +KN E GI+A RF
Sbjct  83   SDESGNLPTCGTGHGCVWQFNFREFDVHHDIFATDSIELLRQSGIDLKKNNERGIDANRF  142

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSGIVLNDSVHWVTFHSGYDFGYLLK+LTCQ LP+TQ GFF LI +YFP V+DIK
Sbjct  143  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKLLTCQNLPDTQPGFFNLIKIYFPTVYDIK  202

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELL+VERVG+CHQAGSDSLLT+CTFRKLK++FF+G+ E Y+GV
Sbjct  203  HLMKFCNSLHGGLNKLAELLDVERVGICHQAGSDSLLTSCTFRKLKESFFNGATERYAGV  262

Query  208  LYGLGVENGQN  176
            LYGLGVENGQN
Sbjct  263  LYGLGVENGQN  273



>ref|XP_006389834.1| hypothetical protein EUTSA_v10018990mg [Eutrema salsugineum]
 gb|ESQ27120.1| hypothetical protein EUTSA_v10018990mg [Eutrema salsugineum]
Length=274

 Score =   332 bits (851),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 150/190 (79%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            S+E+GNLPTCGT+KYCIWQFNFREFD + D++A DSI+LL+Q GIDF KNT+ G++++RF
Sbjct  82   SNEQGNLPTCGTEKYCIWQFNFREFDVDSDIYALDSIDLLKQSGIDFAKNTQQGVDSKRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
             ELLMSSGIVLN++VHWVTFHSGYDFGYLLK+LTCQ LP +Q  FF LIN+YFP V+DIK
Sbjct  142  AELLMSSGIVLNENVHWVTFHSGYDFGYLLKLLTCQNLPNSQTSFFELINVYFPTVYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT+CTFRKLK+NFF G L++YSGV
Sbjct  202  HLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTFRKLKENFFVGPLQKYSGV  261

Query  208  LYGLGVENGQ  179
            LYGLGVENGQ
Sbjct  262  LYGLGVENGQ  271



>ref|XP_009144015.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Brassica 
rapa]
 emb|CDY64914.1| BnaA05g35260D [Brassica napus]
Length=276

 Score =   332 bits (851),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 154/193 (80%), Positives = 178/193 (92%), Gaps = 2/193 (1%)
 Frame = -3

Query  748  SDEKGNLPTCGTD--KYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEAR  575
            SDE+GNLPTCG D  KYCIWQFNFREFD + D+FA DSIELLRQ GIDF+KN  +G+++R
Sbjct  82   SDERGNLPTCGPDDSKYCIWQFNFREFDLSSDIFAHDSIELLRQSGIDFDKNKRNGVDSR  141

Query  574  RFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFD  395
            RF ELLMSSGIVLN++VHWVTFHSGYDFGYLLK+LTC++LPETQ GFF +I +YFP V+D
Sbjct  142  RFAELLMSSGIVLNENVHWVTFHSGYDFGYLLKLLTCRDLPETQVGFFEMIRVYFPRVYD  201

Query  394  IKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYS  215
            IKHLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT+CTFRKL++NFF GS+E+YS
Sbjct  202  IKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTFRKLQENFFIGSMEKYS  261

Query  214  GVLYGLGVENGQN  176
            GVLYGLGVENGQ+
Sbjct  262  GVLYGLGVENGQS  274



>ref|XP_004291948.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Fragaria 
vesca subsp. vesca]
Length=272

 Score =   332 bits (850),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 152/191 (80%), Positives = 174/191 (91%), Gaps = 0/191 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLPTCGT+ + IWQFNFREF+  ED+FA+DSIELLRQCGIDF+KN+E GI+  RF
Sbjct  82   SDENGNLPTCGTENFFIWQFNFREFNVTEDIFAADSIELLRQCGIDFKKNSEKGIDVNRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
             ELLMSSGIVLND+VHWVTFHSGYDFGYLLK+LTC+ LP+TQ GFF LI MYFP V+DIK
Sbjct  142  AELLMSSGIVLNDAVHWVTFHSGYDFGYLLKLLTCRSLPDTQAGFFDLIKMYFPLVYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            H+M+FCNSLHGGLNKLAELL+VER+GVCHQAGSDSLLTACTFRKL+D+FF+GS E+Y+GV
Sbjct  202  HMMKFCNSLHGGLNKLAELLDVERIGVCHQAGSDSLLTACTFRKLRDSFFNGSTEKYAGV  261

Query  208  LYGLGVENGQN  176
            LYGLGVEN  N
Sbjct  262  LYGLGVENSTN  272



>ref|NP_178193.1| putative CCR4-associated factor 1-like 6 [Arabidopsis thaliana]
 ref|NP_849915.1| putative CCR4-associated factor 1-like 6 [Arabidopsis thaliana]
 sp|Q9SAI2.1|CAF1F_ARATH RecName: Full=Probable CCR4-associated factor 1 homolog 6 [Arabidopsis 
thaliana]
 gb|AAF14666.1|AC011713_14 Similar to gb|U21855 CCR4-associated factor 1 (CAF1) from Mus 
musculus. ESTs gb|AAA394972, gb|AA585812 and gb|H77015 come 
from this gene [Arabidopsis thaliana]
 gb|AAL49916.1| putative CCR4-associated factorCCR4-associated factor [Arabidopsis 
thaliana]
 gb|AAM20381.1| putative CCR4-associated factor [Arabidopsis thaliana]
 gb|AEE36448.1| putative CCR4-associated factor 1-6 [Arabidopsis thaliana]
 gb|AEE36449.1| putative CCR4-associated factor 1-6 [Arabidopsis thaliana]
Length=274

 Score =   331 bits (849),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 153/190 (81%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            S+E+GNLPTCGTDKYCIWQFNFREFD + D+FA DSIELL+Q GID  KNT  GI+++RF
Sbjct  82   SNEQGNLPTCGTDKYCIWQFNFREFDLDSDIFALDSIELLKQSGIDLAKNTLDGIDSKRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
             ELLMSSGIVLN++VHWVTFHSGYDFGYLLK+LTCQ LP++Q  FF LIN+YFP V+DIK
Sbjct  142  AELLMSSGIVLNENVHWVTFHSGYDFGYLLKLLTCQNLPDSQTDFFKLINVYFPTVYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT+CTFRKLK+NFF G L +YSGV
Sbjct  202  HLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTFRKLKENFFVGPLHKYSGV  261

Query  208  LYGLGVENGQ  179
            LYGLGVENGQ
Sbjct  262  LYGLGVENGQ  271



>ref|XP_006302671.1| hypothetical protein CARUB_v10020778mg [Capsella rubella]
 gb|EOA35569.1| hypothetical protein CARUB_v10020778mg [Capsella rubella]
Length=274

 Score =   331 bits (849),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 152/190 (80%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            S+E+GNLPTCGTDKYCIWQFNF EFD + D+FA DSIELL+Q GID  KNT+ GI+++RF
Sbjct  82   SNEQGNLPTCGTDKYCIWQFNFGEFDLDSDIFAVDSIELLKQSGIDLAKNTQDGIDSKRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
             ELLMSSGIVLN++VHWVTFHSGYDFGYLLK+LTCQ LP++Q  FF LIN+YFP V+DIK
Sbjct  142  AELLMSSGIVLNENVHWVTFHSGYDFGYLLKLLTCQNLPDSQTDFFKLINVYFPTVYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT+CTFRKLK+NFF G L++YSGV
Sbjct  202  HLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTFRKLKENFFVGPLQKYSGV  261

Query  208  LYGLGVENGQ  179
            LYGLGVENGQ
Sbjct  262  LYGLGVENGQ  271



>emb|CDP10211.1| unnamed protein product [Coffea canephora]
Length=274

 Score =   331 bits (848),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 153/191 (80%), Positives = 172/191 (90%), Gaps = 0/191 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDEKGNLPTCGT KYC+WQFNFREF+PNEDV+A DSIELLR+ G DF+KN ++G++A RF
Sbjct  82   SDEKGNLPTCGTGKYCVWQFNFREFNPNEDVYAHDSIELLRRSGFDFKKNVDNGVDAYRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
             ELLMSSGIVLNDSV WV FHSGYDFGYLLKILTCQ LPETQ+GFF LI MYFP V+DIK
Sbjct  142  SELLMSSGIVLNDSVSWVAFHSGYDFGYLLKILTCQNLPETQEGFFKLIKMYFPTVYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            H+MRFCN LHGGLNKLAELLEVERVG+CHQAGSDSLLT CTF KLK++FF G+ E+Y+GV
Sbjct  202  HMMRFCNHLHGGLNKLAELLEVERVGICHQAGSDSLLTCCTFMKLKESFFHGTTEKYAGV  261

Query  208  LYGLGVENGQN  176
            LYGLGV+NG N
Sbjct  262  LYGLGVDNGPN  272



>ref|XP_010048831.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Eucalyptus 
grandis]
 gb|KCW81224.1| hypothetical protein EUGRSUZ_C02596 [Eucalyptus grandis]
Length=274

 Score =   331 bits (848),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 154/191 (81%), Positives = 173/191 (91%), Gaps = 0/191 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            +DEKGNLPTCGTDKY +WQFNFREF+ NEDV+A DSI+LL Q GI+F+KN E G++ARRF
Sbjct  82   ADEKGNLPTCGTDKYYVWQFNFREFNLNEDVYAHDSIDLLSQSGINFKKNNEVGVDARRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
             ELLMSSGIVLNDSVHWVTFHSGYDFGYLLK+LTCQ LP TQ GFF LI MYFP ++DIK
Sbjct  142  SELLMSSGIVLNDSVHWVTFHSGYDFGYLLKVLTCQSLPSTQSGFFDLIKMYFPVLYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNK+AELLEVERVG+CHQAGSDSLLT  TF KLK+NFF+GS E+Y+GV
Sbjct  202  HLMKFCNSLHGGLNKVAELLEVERVGICHQAGSDSLLTCSTFMKLKENFFNGSPEKYAGV  261

Query  208  LYGLGVENGQN  176
            LYGLGVENGQN
Sbjct  262  LYGLGVENGQN  272



>ref|XP_010691601.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Beta 
vulgaris subsp. vulgaris]
Length=274

 Score =   331 bits (848),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 153/191 (80%), Positives = 177/191 (93%), Gaps = 0/191 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE+GNLPTCGT+++CIWQFNF EF+ NEDVFA DSI+LLRQ GIDF+KN + GI A RF
Sbjct  82   SDEQGNLPTCGTEQFCIWQFNFCEFNLNEDVFAHDSIQLLRQSGIDFQKNNDRGINALRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSG+VLND+VHW+TFHSGYDFGYLLK+LTCQ LP+TQ+ FF LINMYFP ++DIK
Sbjct  142  GELLMSSGVVLNDNVHWITFHSGYDFGYLLKLLTCQNLPDTQREFFHLINMYFPTLYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLEVER+GV HQAGSDSLLT+CTFRKLKDNFFSGS+E+Y+GV
Sbjct  202  HLMKFCNSLHGGLNKLAELLEVERIGVSHQAGSDSLLTSCTFRKLKDNFFSGSMEKYAGV  261

Query  208  LYGLGVENGQN  176
            LYGLG +NGQ+
Sbjct  262  LYGLGSDNGQS  272



>ref|XP_007135810.1| hypothetical protein PHAVU_010G160400g [Phaseolus vulgaris]
 gb|ESW07804.1| hypothetical protein PHAVU_010G160400g [Phaseolus vulgaris]
Length=283

 Score =   331 bits (848),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 160/198 (81%), Positives = 175/198 (88%), Gaps = 8/198 (4%)
 Frame = -3

Query  748  SDEKGNLPTCG--------TDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTE  593
            SDE GNLPTC         +   CIWQFNFREF+ NEDVFA+DSIELLRQ GIDF+KN E
Sbjct  83   SDEYGNLPTCAGAGDVDEESHSCCIWQFNFREFNVNEDVFANDSIELLRQSGIDFKKNNE  142

Query  592  SGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMY  413
             GI+A RFGELLMSSGIVLND+VHWVTFHSGYDFGYLLK+LTCQ LP+TQ  FF LINMY
Sbjct  143  DGIDAHRFGELLMSSGIVLNDNVHWVTFHSGYDFGYLLKLLTCQNLPDTQVEFFNLINMY  202

Query  412  FPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSG  233
            FP V+DIKHLM+FCNSLHGGLNKLAELLEVER+G+CHQAGSDSLLT+CTFRKLKDNFFSG
Sbjct  203  FPTVYDIKHLMKFCNSLHGGLNKLAELLEVERIGICHQAGSDSLLTSCTFRKLKDNFFSG  262

Query  232  SLEEYSGVLYGLGVENGQ  179
            SLE+Y+GVLYGLGVENGQ
Sbjct  263  SLEKYAGVLYGLGVENGQ  280



>ref|XP_006483458.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Citrus 
sinensis]
 gb|KDO67487.1| hypothetical protein CISIN_1g023967mg [Citrus sinensis]
Length=274

 Score =   330 bits (847),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 153/190 (81%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLPTCGTDK+CIWQFNFREF+  +D+FASDS+ELL QCGIDF+KN E GI+  RF
Sbjct  83   SDENGNLPTCGTDKFCIWQFNFREFNLIDDIFASDSVELLHQCGIDFKKNNEKGIDVNRF  142

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSGIVLND V WVTFHSGYDFGYLLK+LTC+ LP+TQ GFF LINMYFP V+DIK
Sbjct  143  GELLMSSGIVLNDVVRWVTFHSGYDFGYLLKLLTCRSLPDTQAGFFELINMYFPVVYDIK  202

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT+CTFRKL++NFF+G  E+Y+GV
Sbjct  203  HLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTFRKLRENFFNGCTEKYAGV  262

Query  208  LYGLGVENGQ  179
            LYGLGVEN +
Sbjct  263  LYGLGVENDK  272



>ref|XP_009106716.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Brassica 
rapa]
 emb|CDX87343.1| BnaA07g35300D [Brassica napus]
Length=275

 Score =   330 bits (846),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 154/191 (81%), Positives = 174/191 (91%), Gaps = 1/191 (1%)
 Frame = -3

Query  748  SDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARR  572
            S+E+GNLPTCGTD KYCIWQFNFREFD + D+FA DSI+LL+Q GIDF KNT  GIE+RR
Sbjct  82   SNEQGNLPTCGTDNKYCIWQFNFREFDLDSDIFAVDSIDLLKQSGIDFAKNTREGIESRR  141

Query  571  FGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDI  392
            F ELLMSSGIVLN +VHWVTFHSGYDFGYLLK+LTCQ LP++Q  FF LIN+YFP V+DI
Sbjct  142  FAELLMSSGIVLNGNVHWVTFHSGYDFGYLLKLLTCQNLPDSQTSFFELINVYFPTVYDI  201

Query  391  KHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSG  212
            KHLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT+CTFRKLK+NFF G L++Y+G
Sbjct  202  KHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTFRKLKENFFVGPLQKYAG  261

Query  211  VLYGLGVENGQ  179
            VLYGLGVENGQ
Sbjct  262  VLYGLGVENGQ  272



>gb|KHF99352.1| putative CCR4-associated factor 1 -like protein [Gossypium arboreum]
 gb|KHG05538.1| putative CCR4-associated factor 1 -like protein [Gossypium arboreum]
Length=327

 Score =   332 bits (850),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 154/190 (81%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLP+CGTD  CIWQFNF EF+ +ED+FASDSIELLRQCGIDF+KN E GI+ +RF
Sbjct  135  SDENGNLPSCGTDSSCIWQFNFCEFNISEDIFASDSIELLRQCGIDFKKNNEKGIDVKRF  194

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSGIVLND VHWVTFHSGYDFGYLLK+LTC+ LP+ Q  FF LINMYFP ++DIK
Sbjct  195  GELLMSSGIVLNDGVHWVTFHSGYDFGYLLKLLTCRSLPDNQARFFDLINMYFPMLYDIK  254

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            H+M+FCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLT+CTFRKL+DNFF+GS E+Y+GV
Sbjct  255  HMMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTSCTFRKLRDNFFNGSTEKYAGV  314

Query  208  LYGLGVENGQ  179
            LYGLGVE+GQ
Sbjct  315  LYGLGVESGQ  324



>ref|XP_009399558.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Musa 
acuminata subsp. malaccensis]
Length=275

 Score =   330 bits (845),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 153/191 (80%), Positives = 172/191 (90%), Gaps = 0/191 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLPTCGTD+ C+WQFNFREFD   DVFA+DSIELLRQ GIDF+KN + GI+A RF
Sbjct  83   SDELGNLPTCGTDRGCVWQFNFREFDMQLDVFATDSIELLRQSGIDFKKNNDKGIDAHRF  142

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSGIVLNDS++WVTFHSGYDFGYLLK+LTCQ LP+TQ GFF LI +YFP V+DIK
Sbjct  143  GELLMSSGIVLNDSIYWVTFHSGYDFGYLLKVLTCQNLPDTQAGFFNLIRIYFPTVYDIK  202

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELL+VERVG+CHQAGSDSLLT+C FRKLK++FFSGS E Y+GV
Sbjct  203  HLMKFCNSLHGGLNKLAELLDVERVGICHQAGSDSLLTSCAFRKLKESFFSGSTERYAGV  262

Query  208  LYGLGVENGQN  176
            LYGL VENGQ 
Sbjct  263  LYGLSVENGQT  273



>ref|XP_006473977.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Citrus 
sinensis]
 gb|KDO59415.1| hypothetical protein CISIN_1g024017mg [Citrus sinensis]
 gb|KDO59416.1| hypothetical protein CISIN_1g024017mg [Citrus sinensis]
Length=274

 Score =   329 bits (844),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 151/190 (79%), Positives = 171/190 (90%), Gaps = 0/190 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            +DE GNLP CGTDKYC+WQFNFREF P+EDV+A DSI+LL + GIDF+KN E G++A RF
Sbjct  82   TDENGNLPKCGTDKYCLWQFNFREFSPDEDVYAYDSIKLLSRSGIDFKKNKEKGVDAMRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
             ELLMSSGIVLNDSVHWVTFHSGYDFGYLLK+LTC++LPETQ  FF LI MYFP ++DIK
Sbjct  142  SELLMSSGIVLNDSVHWVTFHSGYDFGYLLKLLTCKDLPETQACFFDLIKMYFPTLYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLEVER+G+CHQAGSDSLLT CTF K+KDNFF GS E+Y+GV
Sbjct  202  HLMKFCNSLHGGLNKLAELLEVERIGICHQAGSDSLLTCCTFMKMKDNFFKGSPEKYAGV  261

Query  208  LYGLGVENGQ  179
            LYGLGVENGQ
Sbjct  262  LYGLGVENGQ  271



>ref|XP_009801027.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Nicotiana 
sylvestris]
 ref|XP_009801028.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Nicotiana 
sylvestris]
Length=274

 Score =   329 bits (844),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 150/191 (79%), Positives = 175/191 (92%), Gaps = 0/191 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLPTCG+++YCIWQFNFREFD + D+FA+DSIELL Q GIDF+KN E GI+A+RF
Sbjct  82   SDENGNLPTCGSERYCIWQFNFREFDTSADIFANDSIELLMQSGIDFKKNNEMGIDAKRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSGIVLND VHWVTFHSGYDFGYLLK+LTC+ LPETQ GFF L+N+YFP V+DIK
Sbjct  142  GELLMSSGIVLNDGVHWVTFHSGYDFGYLLKLLTCRTLPETQAGFFDLLNVYFPLVYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLE+ER+G+CHQAGSDSLLT+C F+KLKDNFF+G+ E+Y+GV
Sbjct  202  HLMKFCNSLHGGLNKLAELLELERIGICHQAGSDSLLTSCAFKKLKDNFFNGATEKYAGV  261

Query  208  LYGLGVENGQN  176
            LYGLGVE G +
Sbjct  262  LYGLGVEYGSD  272



>emb|CDY12234.1| BnaC04g12640D [Brassica napus]
Length=276

 Score =   329 bits (843),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 153/193 (79%), Positives = 176/193 (91%), Gaps = 2/193 (1%)
 Frame = -3

Query  748  SDEKGNLPTCGTD--KYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEAR  575
            SDE+GNLPTCG D  KYCIWQFNFREFD + D+FA DSIELLRQ GIDF+ N  +G+++R
Sbjct  82   SDERGNLPTCGPDDKKYCIWQFNFREFDLSSDIFAHDSIELLRQSGIDFDNNKRNGVDSR  141

Query  574  RFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFD  395
            RF ELLMSSGIVLN++VHWVTFHSGYDFGYLLK+LTCQ+LPETQ GFF +I +YFP V+D
Sbjct  142  RFAELLMSSGIVLNENVHWVTFHSGYDFGYLLKLLTCQDLPETQVGFFEMIRVYFPRVYD  201

Query  394  IKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYS  215
            IKHLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT+CTFRKL++NFF GS+E+YS
Sbjct  202  IKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTFRKLQENFFIGSMEKYS  261

Query  214  GVLYGLGVENGQN  176
            GVLYGLGVEN Q+
Sbjct  262  GVLYGLGVENVQS  274



>ref|XP_008445257.1| PREDICTED: LOW QUALITY PROTEIN: probable CCR4-associated factor 
1 homolog 7 [Cucumis melo]
Length=274

 Score =   328 bits (842),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 152/190 (80%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLPTCGTDK+CIWQFNFREF+  +D++ASDSIELLR+CGIDF+K  E GI+  RF
Sbjct  82   SDENGNLPTCGTDKFCIWQFNFREFNICDDIYASDSIELLRECGIDFQKTHEEGIDVNRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSGIVLND++ WVTFHSGYDFGYLLK+LTC+ LPETQ  FF LI+MYFP V+DIK
Sbjct  142  GELLMSSGIVLNDNIXWVTFHSGYDFGYLLKLLTCRNLPETQAEFFDLIHMYFPMVYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLMRFCNS HGGLNKLAELLEVER+GVCHQAGSDSLLTACTFRKL+D FF+GS+++Y+GV
Sbjct  202  HLMRFCNSFHGGLNKLAELLEVERIGVCHQAGSDSLLTACTFRKLRDTFFNGSIQKYAGV  261

Query  208  LYGLGVENGQ  179
            LYGLGVE GQ
Sbjct  262  LYGLGVETGQ  271



>ref|XP_010429900.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Camelina 
sativa]
 ref|XP_010429901.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Camelina 
sativa]
Length=275

 Score =   328 bits (842),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 152/191 (80%), Positives = 175/191 (92%), Gaps = 1/191 (1%)
 Frame = -3

Query  748  SDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARR  572
            S+E+G+LPTCGTD KYCIWQFNFREFD + D+FA DSIELL+Q GID  KNT+ GI+++R
Sbjct  82   SNEQGDLPTCGTDNKYCIWQFNFREFDLDSDIFAVDSIELLKQSGIDLAKNTQDGIDSKR  141

Query  571  FGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDI  392
            F ELLMSSGIVLN++VHWVTFHSGYDFGYLLK+LTCQ LP++Q  FF LIN+YFP V+DI
Sbjct  142  FAELLMSSGIVLNENVHWVTFHSGYDFGYLLKLLTCQNLPDSQTDFFKLINVYFPTVYDI  201

Query  391  KHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSG  212
            KHLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT+CTFRKLK+NFF G L++YSG
Sbjct  202  KHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTFRKLKENFFVGPLQKYSG  261

Query  211  VLYGLGVENGQ  179
            VLYGLGVENGQ
Sbjct  262  VLYGLGVENGQ  272



>ref|NP_001185452.1| putative CCR4-associated factor 1-like 6 [Arabidopsis thaliana]
 gb|AEE36450.1| putative CCR4-associated factor 1-6 [Arabidopsis thaliana]
Length=286

 Score =   328 bits (842),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 152/191 (80%), Positives = 172/191 (90%), Gaps = 0/191 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            S+E+GNLPTCGTDKYCIWQFNFREFD + D+FA DSIELL+Q GID  KNT  GI+++RF
Sbjct  82   SNEQGNLPTCGTDKYCIWQFNFREFDLDSDIFALDSIELLKQSGIDLAKNTLDGIDSKRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
             ELLMSSGIVLN++VHWVTFHSGYDFGYLLK+LTCQ LP++Q  FF LIN+YFP V+DIK
Sbjct  142  AELLMSSGIVLNENVHWVTFHSGYDFGYLLKLLTCQNLPDSQTDFFKLINVYFPTVYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT+CTFRKLK+NFF G L +YSGV
Sbjct  202  HLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTFRKLKENFFVGPLHKYSGV  261

Query  208  LYGLGVENGQN  176
            LYGLGVEN  N
Sbjct  262  LYGLGVENEAN  272



>ref|XP_003603309.1| Ribonuclease CAF1 [Medicago truncatula]
 gb|ACJ84747.1| unknown [Medicago truncatula]
 gb|AFK46979.1| unknown [Medicago truncatula]
Length=275

 Score =   328 bits (841),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 153/187 (82%), Positives = 172/187 (92%), Gaps = 0/187 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLPTCGTD  CIWQFNFREF+ +ED+FA+DSIELLRQCGIDF+KN+E GI+  RF
Sbjct  86   SDENGNLPTCGTDSPCIWQFNFREFNVSEDIFAADSIELLRQCGIDFKKNSEQGIDVNRF  145

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSGIVLND+VHWVTFHSGYDFGYLLK+LTC+ LP+TQ GFF LI +YFP V+DIK
Sbjct  146  GELLMSSGIVLNDNVHWVTFHSGYDFGYLLKLLTCRALPDTQAGFFDLIGIYFPIVYDIK  205

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELL+VERVGVCHQAGSDSLLTACTFRKL++ FF+G  E+YSGV
Sbjct  206  HLMKFCNSLHGGLNKLAELLDVERVGVCHQAGSDSLLTACTFRKLRETFFNGETEKYSGV  265

Query  208  LYGLGVE  188
            LYGLGVE
Sbjct  266  LYGLGVE  272



>ref|XP_010648684.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Vitis 
vinifera]
 ref|XP_010648686.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Vitis 
vinifera]
Length=273

 Score =   327 bits (839),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 152/190 (80%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SD  GNLPTCGTDK CIWQFNFREFD  EDVFASDSI++L++CG+DF+KN E GI+  +F
Sbjct  82   SDANGNLPTCGTDKLCIWQFNFREFDVTEDVFASDSIQMLQECGMDFKKNNEKGIDVNQF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSGIVLND+V WVTFHSGYDFGYLLK+LT + LP TQ GFF LINMYFP V+DIK
Sbjct  142  GELLMSSGIVLNDNVSWVTFHSGYDFGYLLKLLTRRSLPGTQAGFFDLINMYFPMVYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT+CTFRKL+D+FF+GS E+Y+GV
Sbjct  202  HLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTFRKLRDSFFNGSTEKYAGV  261

Query  208  LYGLGVENGQ  179
            LYGLGVE GQ
Sbjct  262  LYGLGVETGQ  271



>ref|XP_009620266.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Nicotiana 
tomentosiformis]
Length=274

 Score =   327 bits (839),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 149/191 (78%), Positives = 174/191 (91%), Gaps = 0/191 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLP CG+++YCIWQFNFREFD + D+FA+DSIELL Q GIDF+KN E GI+A+RF
Sbjct  82   SDENGNLPICGSERYCIWQFNFREFDTSADIFANDSIELLMQSGIDFKKNNEMGIDAKRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSGIVLND VHWVTFHSGYDFGYLLK+LTC+ LPETQ GFF L+N+YFP V+DIK
Sbjct  142  GELLMSSGIVLNDGVHWVTFHSGYDFGYLLKLLTCRTLPETQAGFFDLLNVYFPLVYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLE+ER+G+CHQAGSDSLLT+C F+KLKDNFF+G+ E+Y+GV
Sbjct  202  HLMKFCNSLHGGLNKLAELLELERIGICHQAGSDSLLTSCAFKKLKDNFFNGATEKYAGV  261

Query  208  LYGLGVENGQN  176
            LYGLGVE G +
Sbjct  262  LYGLGVEYGSD  272



>ref|XP_004138706.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Cucumis 
sativus]
 gb|KGN62986.1| Ccr4-associated factor [Cucumis sativus]
Length=274

 Score =   327 bits (839),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 152/190 (80%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLPTCGTDK+CIWQFNFREF+  +D++ASDSIELLR+CGIDF+K  E GI+  RF
Sbjct  82   SDENGNLPTCGTDKFCIWQFNFREFNICDDIYASDSIELLRECGIDFQKTHEEGIDVNRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSGIVLND++ WVTFHSGYDFGYLLK+LTC+ LPETQ  FF LI+MYFP V+DIK
Sbjct  142  GELLMSSGIVLNDNIFWVTFHSGYDFGYLLKLLTCRNLPETQAEFFDLIHMYFPMVYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLMRFCNS HGGLNKLAELLEVER+GVCHQAGSDSLLTACTFRKL+D FF+GS ++Y+GV
Sbjct  202  HLMRFCNSFHGGLNKLAELLEVERIGVCHQAGSDSLLTACTFRKLRDTFFNGSTQKYAGV  261

Query  208  LYGLGVENGQ  179
            LYGLGVE GQ
Sbjct  262  LYGLGVETGQ  271



>ref|XP_008799630.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Phoenix 
dactylifera]
Length=275

 Score =   327 bits (838),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 155/191 (81%), Positives = 172/191 (90%), Gaps = 0/191 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLPTCGT + C+WQFNFREFD   D+FASDSIELLRQ GIDF+KN E GI+A RF
Sbjct  83   SDEFGNLPTCGTGRGCVWQFNFREFDVQCDIFASDSIELLRQSGIDFKKNNERGIDANRF  142

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSGIVLNDSVHWVTFHSGYDFGYLLK+LT Q LP+TQ GFF LI ++FP V+DIK
Sbjct  143  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKLLTRQNLPDTQPGFFNLIKIFFPTVYDIK  202

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELL+VERVG+CHQAGSDSLLT+CTFRKLK +FF+GS E Y+GV
Sbjct  203  HLMKFCNSLHGGLNKLAELLDVERVGICHQAGSDSLLTSCTFRKLKGSFFNGSTERYAGV  262

Query  208  LYGLGVENGQN  176
            LYGLGVENGQN
Sbjct  263  LYGLGVENGQN  273



>gb|ACJ84891.1| unknown [Medicago truncatula]
Length=275

 Score =   327 bits (838),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 153/187 (82%), Positives = 171/187 (91%), Gaps = 0/187 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLPTCGTD  CIWQFNFREF+ +ED+FA+DSIELLRQCGIDF+KN+E GI+  RF
Sbjct  86   SDENGNLPTCGTDSPCIWQFNFREFNVSEDIFAADSIELLRQCGIDFKKNSEQGIDVNRF  145

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSGIVLND+VHWVTFHSGYDFGYLLK+LTC+ LP+TQ GFF LI +YFP V+DIK
Sbjct  146  GELLMSSGIVLNDNVHWVTFHSGYDFGYLLKLLTCRALPDTQAGFFDLIGIYFPIVYDIK  205

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELL+VERVGVCHQAGSDSLLTACTFRKL+  FF+G  E+YSGV
Sbjct  206  HLMKFCNSLHGGLNKLAELLDVERVGVCHQAGSDSLLTACTFRKLRGTFFNGETEKYSGV  265

Query  208  LYGLGVE  188
            LYGLGVE
Sbjct  266  LYGLGVE  272



>gb|AFK43307.1| unknown [Lotus japonicus]
Length=274

 Score =   327 bits (838),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 154/190 (81%), Positives = 174/190 (92%), Gaps = 1/190 (1%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE+GNLP+C     CIWQFNFREF+ NEDVFA+DSIELLRQ GIDF KN E GI+ARRF
Sbjct  83   SDEEGNLPSCDGSS-CIWQFNFREFNVNEDVFANDSIELLRQSGIDFSKNNEMGIDARRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSGIVLND++HWVTFHSGYDFGYLLK+LTCQ+LP+TQ GFF +INMYFP ++DIK
Sbjct  142  GELLMSSGIVLNDNIHWVTFHSGYDFGYLLKLLTCQDLPDTQVGFFNMINMYFPTLYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLEVERVG+ HQAGSDSLLT+CTFRKLK+NFFSGSLE+Y+G+
Sbjct  202  HLMKFCNSLHGGLNKLAELLEVERVGISHQAGSDSLLTSCTFRKLKENFFSGSLEKYAGI  261

Query  208  LYGLGVENGQ  179
            LYGLG ENG 
Sbjct  262  LYGLGCENGH  271



>emb|CAN79806.1| hypothetical protein VITISV_031504 [Vitis vinifera]
Length=270

 Score =   327 bits (837),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 152/190 (80%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SD  GNLPTCGTDK CIWQFNFREFD  EDVFASDSI++L++CG+DF+KN E GI+  +F
Sbjct  79   SDANGNLPTCGTDKLCIWQFNFREFDVTEDVFASDSIQMLQECGMDFKKNNEKGIDVNQF  138

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSGIVLND+V WVTFHSGYDFGYLLK+LT + LP TQ GFF LINMYFP V+DIK
Sbjct  139  GELLMSSGIVLNDNVSWVTFHSGYDFGYLLKLLTRRSLPGTQAGFFDLINMYFPMVYDIK  198

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT+CTFRKL+D+FF+GS E+Y+GV
Sbjct  199  HLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTFRKLRDSFFNGSTEKYAGV  258

Query  208  LYGLGVENGQ  179
            LYGLGVE GQ
Sbjct  259  LYGLGVETGQ  268



>ref|XP_006450304.1| hypothetical protein CICLE_v10008276mg [Citrus clementina]
 gb|ESR63544.1| hypothetical protein CICLE_v10008276mg [Citrus clementina]
Length=449

 Score =   333 bits (853),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 153/190 (81%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLPTCGTDK+CIWQFNFREF+  +D+FASDS+ELL QCGIDF+KN E GI+  RF
Sbjct  258  SDENGNLPTCGTDKFCIWQFNFREFNLIDDIFASDSVELLHQCGIDFKKNNEKGIDVNRF  317

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSGIVLND V WVTFHSGYDFGYLLK+LTC+ LP+TQ GFF LINMYFP V+DIK
Sbjct  318  GELLMSSGIVLNDVVRWVTFHSGYDFGYLLKLLTCRSLPDTQAGFFELINMYFPVVYDIK  377

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT+CTFRKL++NFF+G  E+Y+GV
Sbjct  378  HLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTFRKLRENFFNGCTEKYAGV  437

Query  208  LYGLGVENGQ  179
            LYGLGVEN +
Sbjct  438  LYGLGVENDK  447



>emb|CDY39943.1| BnaC06g40210D [Brassica napus]
Length=275

 Score =   327 bits (837),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 152/191 (80%), Positives = 173/191 (91%), Gaps = 1/191 (1%)
 Frame = -3

Query  748  SDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARR  572
            S+E+GNLPTCGTD KYCIWQFNFREFD + D+FA DSI+LL+Q GIDF KNT  GIE+ R
Sbjct  82   SNEQGNLPTCGTDSKYCIWQFNFREFDLDSDIFAVDSIDLLKQSGIDFAKNTRQGIESSR  141

Query  571  FGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDI  392
            F ELLMSSGIVLN +VHWVTFHSGYDFGYLLK+LTC+ LP++Q  FF LIN+YFP V+DI
Sbjct  142  FAELLMSSGIVLNGNVHWVTFHSGYDFGYLLKLLTCKNLPDSQTSFFELINVYFPTVYDI  201

Query  391  KHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSG  212
            KHLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT+CTFRKLK+NFF G L++Y+G
Sbjct  202  KHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTFRKLKENFFVGPLQKYAG  261

Query  211  VLYGLGVENGQ  179
            VLYGLGVENGQ
Sbjct  262  VLYGLGVENGQ  272



>ref|XP_004501372.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like isoform 
X1 [Cicer arietinum]
 ref|XP_004501373.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like isoform 
X2 [Cicer arietinum]
 ref|XP_004501374.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like isoform 
X3 [Cicer arietinum]
 ref|XP_004501375.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like isoform 
X4 [Cicer arietinum]
Length=271

 Score =   327 bits (837),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 151/187 (81%), Positives = 169/187 (90%), Gaps = 0/187 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLP CGTD  CIWQFNFREF+ +ED+FASDSIELLRQCGIDF+KN+E GI+  RF
Sbjct  82   SDENGNLPNCGTDSSCIWQFNFREFNVSEDIFASDSIELLRQCGIDFKKNSEKGIDVNRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
             ELLMSSGIVLND VHWVTFHSGYDFGYLLK+LTC+ LP+TQ GFF +I +YFP V+DIK
Sbjct  142  AELLMSSGIVLNDDVHWVTFHSGYDFGYLLKLLTCRTLPDTQTGFFDMIKIYFPVVYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCN+LHGGLNKLAELL+VERVGVCHQAGSDSLLTACTFRKL+D FF+G  E+YSGV
Sbjct  202  HLMKFCNNLHGGLNKLAELLDVERVGVCHQAGSDSLLTACTFRKLRDAFFNGETEKYSGV  261

Query  208  LYGLGVE  188
            LYGLGVE
Sbjct  262  LYGLGVE  268



>ref|XP_010417661.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Camelina 
sativa]
Length=275

 Score =   326 bits (836),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 150/191 (79%), Positives = 175/191 (92%), Gaps = 1/191 (1%)
 Frame = -3

Query  748  SDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARR  572
            S+E+G+LPTCGT+ KYCIWQFNFREFD + D+FA DSIELL+Q GID  KNT+ GI+++R
Sbjct  82   SNEQGDLPTCGTNNKYCIWQFNFREFDLDSDIFAVDSIELLKQSGIDLAKNTQDGIDSKR  141

Query  571  FGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDI  392
            F ELLMSSG+VLN++VHWVTFHSGYDFGYLLK+LTCQ LP++Q  FF LIN+YFP V+DI
Sbjct  142  FAELLMSSGVVLNENVHWVTFHSGYDFGYLLKLLTCQNLPDSQTDFFKLINVYFPTVYDI  201

Query  391  KHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSG  212
            KHLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT+CTFRKLK+NFF G L++YSG
Sbjct  202  KHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTFRKLKENFFVGPLQKYSG  261

Query  211  VLYGLGVENGQ  179
            VLYGLGVENGQ
Sbjct  262  VLYGLGVENGQ  272



>ref|XP_004160761.1| PREDICTED: LOW QUALITY PROTEIN: probable CCR4-associated factor 
1 homolog 7-like [Cucumis sativus]
Length=274

 Score =   325 bits (834),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 151/190 (79%), Positives = 171/190 (90%), Gaps = 0/190 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLPTCGTDK+CIWQFNFREF+  +D++ASDSIELLR+CGIDF+K  E GI+  RF
Sbjct  82   SDENGNLPTCGTDKFCIWQFNFREFNICDDIYASDSIELLRECGIDFQKTHEEGIDVNRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSGIVLND++ WVTFHSGYDFGYLLK+LTC+ LPETQ  F  LI+MYFP V+DIK
Sbjct  142  GELLMSSGIVLNDNIFWVTFHSGYDFGYLLKLLTCRNLPETQAEFLXLIHMYFPMVYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLMRFCNS HGGLNKLAELLEVER+GVCHQAGSDSLLTACTFRKL+D FF+GS ++Y+GV
Sbjct  202  HLMRFCNSFHGGLNKLAELLEVERIGVCHQAGSDSLLTACTFRKLRDTFFNGSTQKYAGV  261

Query  208  LYGLGVENGQ  179
            LYGLGVE GQ
Sbjct  262  LYGLGVETGQ  271



>ref|XP_006453661.1| hypothetical protein CICLE_v10009159mg [Citrus clementina]
 gb|ESR66901.1| hypothetical protein CICLE_v10009159mg [Citrus clementina]
Length=274

 Score =   325 bits (834),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 150/190 (79%), Positives = 170/190 (89%), Gaps = 0/190 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            +DE GNLP  GTDKYC+WQFNFREF P+EDV+A DSI+LL + GIDF+KN E G++A RF
Sbjct  82   TDENGNLPKYGTDKYCLWQFNFREFSPDEDVYAYDSIKLLSRSGIDFKKNKEKGVDAMRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
             ELLMSSGIVLNDSVHWVTFHSGYDFGYLLK+LTC++LPETQ  FF LI MYFP ++DIK
Sbjct  142  SELLMSSGIVLNDSVHWVTFHSGYDFGYLLKLLTCKDLPETQACFFDLIKMYFPTLYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLEVER+G+CHQAGSDSLLT CTF K+KDNFF GS E+Y+GV
Sbjct  202  HLMKFCNSLHGGLNKLAELLEVERIGICHQAGSDSLLTCCTFMKMKDNFFKGSPEKYAGV  261

Query  208  LYGLGVENGQ  179
            LYGLGVENGQ
Sbjct  262  LYGLGVENGQ  271



>gb|KJB06631.1| hypothetical protein B456_001G037000 [Gossypium raimondii]
Length=235

 Score =   323 bits (829),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 150/191 (79%), Positives = 171/191 (90%), Gaps = 1/191 (1%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SD  GNLPTCGTD +CIWQFNFREF+ +ED+F SDSIELL QCGIDF+KN E GI+ +RF
Sbjct  44   SDANGNLPTCGTDNFCIWQFNFREFNISEDIFVSDSIELLLQCGIDFKKNNEKGIDVKRF  103

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSGIVLND VHWVTFHSGYDFGYLLK+LTC+ LP++Q GFF LI +YFP V+DIK
Sbjct  104  GELLMSSGIVLNDDVHWVTFHSGYDFGYLLKLLTCRSLPDSQTGFFKLIKLYFPMVYDIK  163

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            H+M+FCN LHGGLNKLAELLEVERVGVCHQAGSDSLLT+CTFRKL+DNFF  S+++Y+GV
Sbjct  164  HMMKFCNGLHGGLNKLAELLEVERVGVCHQAGSDSLLTSCTFRKLRDNFFK-SVQKYAGV  222

Query  208  LYGLGVENGQN  176
            LYGL VE GQN
Sbjct  223  LYGLEVEGGQN  233



>ref|XP_006356929.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Solanum 
tuberosum]
Length=274

 Score =   325 bits (832),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 151/191 (79%), Positives = 173/191 (91%), Gaps = 0/191 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLPTCG++ Y IWQFNFREFD + D+FA+DSIELL Q GIDF+KN E GI+A++F
Sbjct  82   SDENGNLPTCGSEYYYIWQFNFREFDTSADIFANDSIELLIQSGIDFKKNNEMGIDAKQF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSGIVLND VHWVTFHSGYDFGYLLK+LTC+ LPETQ GFF L+NMYFP V+DIK
Sbjct  142  GELLMSSGIVLNDMVHWVTFHSGYDFGYLLKLLTCRTLPETQAGFFDLLNMYFPLVYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLE+ERVG+CHQAGSDSLLT+C F+KLKDNFF+GS E+Y+GV
Sbjct  202  HLMKFCNSLHGGLNKLAELLELERVGICHQAGSDSLLTSCAFKKLKDNFFNGSTEKYAGV  261

Query  208  LYGLGVENGQN  176
            LYGLGVE G +
Sbjct  262  LYGLGVEYGSD  272



>gb|KJB06633.1| hypothetical protein B456_001G037000 [Gossypium raimondii]
Length=206

 Score =   322 bits (825),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 150/191 (79%), Positives = 171/191 (90%), Gaps = 1/191 (1%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SD  GNLPTCGTD +CIWQFNFREF+ +ED+F SDSIELL QCGIDF+KN E GI+ +RF
Sbjct  15   SDANGNLPTCGTDNFCIWQFNFREFNISEDIFVSDSIELLLQCGIDFKKNNEKGIDVKRF  74

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSGIVLND VHWVTFHSGYDFGYLLK+LTC+ LP++Q GFF LI +YFP V+DIK
Sbjct  75   GELLMSSGIVLNDDVHWVTFHSGYDFGYLLKLLTCRSLPDSQTGFFKLIKLYFPMVYDIK  134

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            H+M+FCN LHGGLNKLAELLEVERVGVCHQAGSDSLLT+CTFRKL+DNFF  S+++Y+GV
Sbjct  135  HMMKFCNGLHGGLNKLAELLEVERVGVCHQAGSDSLLTSCTFRKLRDNFFK-SVQKYAGV  193

Query  208  LYGLGVENGQN  176
            LYGL VE GQN
Sbjct  194  LYGLEVEGGQN  204



>ref|XP_009363839.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Pyrus 
x bretschneideri]
Length=273

 Score =   324 bits (831),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 152/191 (80%), Positives = 172/191 (90%), Gaps = 0/191 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLPT GT+ + IWQFNFREF+ +ED+FASDSI+LLRQCGIDF+KN E GI+  RF
Sbjct  82   SDENGNLPTLGTENHYIWQFNFREFNVSEDIFASDSIDLLRQCGIDFKKNNEKGIDVNRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GE LMSSG+VL+D+VHWVTFHSGYDFGYLLK+LTC+ LPE Q  FF LI +YFP ++DIK
Sbjct  142  GEALMSSGLVLSDNVHWVTFHSGYDFGYLLKLLTCRSLPENQMEFFNLIKIYFPVLYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKL+D FFSGS E+YSGV
Sbjct  202  HLMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLRDTFFSGSAEKYSGV  261

Query  208  LYGLGVENGQN  176
            LYGLGVENGQ+
Sbjct  262  LYGLGVENGQS  272



>gb|KJB06630.1| hypothetical protein B456_001G037000 [Gossypium raimondii]
 gb|KJB06632.1| hypothetical protein B456_001G037000 [Gossypium raimondii]
Length=273

 Score =   323 bits (829),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 150/191 (79%), Positives = 171/191 (90%), Gaps = 1/191 (1%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SD  GNLPTCGTD +CIWQFNFREF+ +ED+F SDSIELL QCGIDF+KN E GI+ +RF
Sbjct  82   SDANGNLPTCGTDNFCIWQFNFREFNISEDIFVSDSIELLLQCGIDFKKNNEKGIDVKRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSGIVLND VHWVTFHSGYDFGYLLK+LTC+ LP++Q GFF LI +YFP V+DIK
Sbjct  142  GELLMSSGIVLNDDVHWVTFHSGYDFGYLLKLLTCRSLPDSQTGFFKLIKLYFPMVYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            H+M+FCN LHGGLNKLAELLEVERVGVCHQAGSDSLLT+CTFRKL+DNFF  S+++Y+GV
Sbjct  202  HMMKFCNGLHGGLNKLAELLEVERVGVCHQAGSDSLLTSCTFRKLRDNFFK-SVQKYAGV  260

Query  208  LYGLGVENGQN  176
            LYGL VE GQN
Sbjct  261  LYGLEVEGGQN  271



>gb|ABK21469.1| unknown [Picea sitchensis]
Length=236

 Score =   322 bits (825),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 147/191 (77%), Positives = 174/191 (91%), Gaps = 0/191 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLP CGTDKYCIWQFNFREF+ ++D++ASDSIELL+Q GIDF+KN E GI+A+ F
Sbjct  44   SDEDGNLPRCGTDKYCIWQFNFREFNLDKDMYASDSIELLQQSGIDFKKNNEKGIDAQVF  103

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
             ELLMSSGIVLND+VHWVTFHSGYDFGYLLK+LTCQ+LP T+ GFF LINMYFP V+DIK
Sbjct  104  AELLMSSGIVLNDTVHWVTFHSGYDFGYLLKLLTCQQLPPTRAGFFKLINMYFPTVYDIK  163

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSL+GGLNKLAELL+V+R+GVCHQAGSDSLLT+C FRKL++ FF+GS E+Y+GV
Sbjct  164  HLMKFCNSLYGGLNKLAELLDVKRIGVCHQAGSDSLLTSCAFRKLREGFFNGSTEKYAGV  223

Query  208  LYGLGVENGQN  176
            LYGL +E+GQ 
Sbjct  224  LYGLALEHGQT  234



>gb|KHN38030.1| Putative CCR4-associated factor 1 like 7 [Glycine soja]
Length=272

 Score =   323 bits (828),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 150/175 (86%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -3

Query  703  CIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSV  524
            CIWQFNFREF+ NEDVFA+DSIELLRQ GIDF++N E+GI+A RFGELLMSSGIVLND++
Sbjct  95   CIWQFNFREFNVNEDVFANDSIELLRQSGIDFKRNNENGIDAHRFGELLMSSGIVLNDNI  154

Query  523  HWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNK  344
            HWVTFHSGYDFGYLLK+LTCQ+LP+TQ GFF LINMYFP V+DIKHLM+FCNSLHGGLNK
Sbjct  155  HWVTFHSGYDFGYLLKLLTCQDLPDTQVGFFNLINMYFPTVYDIKHLMKFCNSLHGGLNK  214

Query  343  LAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGVLYGLGVENGQ  179
            LAELLEVERVG+ HQAGSDSLLT+CTFRKLKDNFFSGSLE+Y+GVLYGLGVENGQ
Sbjct  215  LAELLEVERVGISHQAGSDSLLTSCTFRKLKDNFFSGSLEKYAGVLYGLGVENGQ  269



>ref|XP_004504674.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Cicer 
arietinum]
Length=282

 Score =   323 bits (829),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 151/193 (78%), Positives = 176/193 (91%), Gaps = 2/193 (1%)
 Frame = -3

Query  748  SDEKGNLPTC--GTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEAR  575
            SDE GNLP      D++C+WQFNFREF+ +EDVFA+DSIELLRQ GIDF+KN + GI+A+
Sbjct  89   SDEDGNLPNFDDADDRFCVWQFNFREFNVSEDVFANDSIELLRQSGIDFKKNNDKGIDAQ  148

Query  574  RFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFD  395
             FG++LMSSGIVLND+VHW+TFHSGYDFGYLLK+LTCQ LP+TQ GFF LINMYFP V+D
Sbjct  149  CFGDILMSSGIVLNDNVHWLTFHSGYDFGYLLKLLTCQNLPDTQVGFFNLINMYFPNVYD  208

Query  394  IKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYS  215
            IKHLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT CTFRKLK+NFFSGS+E+Y+
Sbjct  209  IKHLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTLCTFRKLKENFFSGSMEKYA  268

Query  214  GVLYGLGVENGQN  176
            GVLYGLG+ENGQ+
Sbjct  269  GVLYGLGIENGQS  281



>gb|ACN40154.1| unknown [Picea sitchensis]
Length=274

 Score =   323 bits (827),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 147/191 (77%), Positives = 174/191 (91%), Gaps = 0/191 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLP CGTDKYCIWQFNFREF+ ++D++ASDSIELL+Q GIDF+KN E GI+A+ F
Sbjct  82   SDEDGNLPRCGTDKYCIWQFNFREFNLDKDMYASDSIELLQQSGIDFKKNNEKGIDAQVF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
             ELLMSSGIVLND+VHWVTFHSGYDFGYLLK+LTCQ+LP T+ GFF LINMYFP V+DIK
Sbjct  142  AELLMSSGIVLNDTVHWVTFHSGYDFGYLLKLLTCQQLPPTRAGFFKLINMYFPTVYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSL+GGLNKLAELL+V+R+GVCHQAGSDSLLT+C FRKL++ FF+GS E+Y+GV
Sbjct  202  HLMKFCNSLYGGLNKLAELLDVKRIGVCHQAGSDSLLTSCAFRKLREGFFNGSTEKYAGV  261

Query  208  LYGLGVENGQN  176
            LYGL +E+GQ 
Sbjct  262  LYGLALEHGQT  272



>ref|XP_010063560.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Eucalyptus 
grandis]
 ref|XP_010063561.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Eucalyptus 
grandis]
 ref|XP_010063562.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Eucalyptus 
grandis]
 ref|XP_010063564.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Eucalyptus 
grandis]
 gb|KCW70795.1| hypothetical protein EUGRSUZ_F03953 [Eucalyptus grandis]
Length=281

 Score =   322 bits (826),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 151/187 (81%), Positives = 172/187 (92%), Gaps = 0/187 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE+GNLPTCG+DK CIWQFNFREF+ NED FA DSIELL+Q GIDF+KN + GI A RF
Sbjct  82   SDERGNLPTCGSDKCCIWQFNFREFNANEDFFADDSIELLKQSGIDFKKNRDRGINAVRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSGIVLND+VHWVTFHSGYDFGYLLK+LTCQ LP+TQ GFF LI+MYFP ++DIK
Sbjct  142  GELLMSSGIVLNDNVHWVTFHSGYDFGYLLKVLTCQTLPDTQAGFFKLIHMYFPTLYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FC+SLHGGLNK+AELL+VERVGVCHQAGSDSLLT+ TF+KLK++FFSGSLE+YSGV
Sbjct  202  HLMKFCDSLHGGLNKVAELLKVERVGVCHQAGSDSLLTSSTFKKLKESFFSGSLEKYSGV  261

Query  208  LYGLGVE  188
            LYGL VE
Sbjct  262  LYGLCVE  268



>gb|ABK24400.1| unknown [Picea sitchensis]
Length=274

 Score =   322 bits (825),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 147/191 (77%), Positives = 173/191 (91%), Gaps = 0/191 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLP CGTDKYCIWQFNFREF+ ++D++A DSIELL+Q GIDF+KN E GI+A+ F
Sbjct  82   SDEDGNLPRCGTDKYCIWQFNFREFNLDKDMYAIDSIELLQQSGIDFKKNNEDGIDAQVF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSGIVLND+VHWVTFHSGYDFGY+LK+LTCQ+LP T  GFF LINMYFP V+DIK
Sbjct  142  GELLMSSGIVLNDTVHWVTFHSGYDFGYMLKLLTCQQLPPTPAGFFNLINMYFPTVYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELL+V+R+GVCHQAGSDSLLT+C FRKL++ FF+GS E+Y+GV
Sbjct  202  HLMKFCNSLHGGLNKLAELLDVKRIGVCHQAGSDSLLTSCAFRKLREGFFNGSTEKYAGV  261

Query  208  LYGLGVENGQN  176
            LYGL  +NGQ+
Sbjct  262  LYGLAFDNGQS  272



>ref|XP_010541577.1| PREDICTED: probable CCR4-associated factor 1 homolog 10 isoform 
X2 [Tarenaya hassleriana]
Length=238

 Score =   320 bits (820),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 174/191 (91%), Gaps = 0/191 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLPTCGTDK+CIWQFNFREF+P+ED++ ++SI+LL QCGIDF+KN E GI+ +RF
Sbjct  44   SDEDGNLPTCGTDKFCIWQFNFREFNPSEDIYVNESIDLLHQCGIDFKKNNEKGIDVKRF  103

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSG+VLND++ WVTFHSGYDFGYLLK+LTC+ LP  Q  FF L+N+YFP ++DIK
Sbjct  104  GELLMSSGVVLNDAMRWVTFHSGYDFGYLLKLLTCKALPVNQIEFFTLLNIYFPVIYDIK  163

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            H+M+FCN+LHGGL+KLAELLEVERVGV HQAGSDSLLT CTFRKLK++FF GS+++Y+GV
Sbjct  164  HMMKFCNNLHGGLSKLAELLEVERVGVSHQAGSDSLLTWCTFRKLKESFFKGSMKKYAGV  223

Query  208  LYGLGVENGQN  176
            LYGLGVENGQN
Sbjct  224  LYGLGVENGQN  234



>ref|XP_008378874.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Malus 
domestica]
 ref|XP_008343758.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Malus 
domestica]
Length=271

 Score =   321 bits (823),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 149/190 (78%), Positives = 171/190 (90%), Gaps = 0/190 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE G+LPT  T+ + IWQFNFREF+ +ED+FASDSI+LLRQCGIDF+KN E GI+  RF
Sbjct  82   SDENGDLPTLATENHYIWQFNFREFNVSEDIFASDSIDLLRQCGIDFKKNNEKGIDVNRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSG+VL+D+VHWVTFHSGYDFGYLLK+LTC+ LP+ Q  FF LI +YFP ++DIK
Sbjct  142  GELLMSSGLVLSDNVHWVTFHSGYDFGYLLKLLTCRSLPDNQMEFFNLIKIYFPVLYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKL+D FFSGS E+YSGV
Sbjct  202  HLMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLRDTFFSGSAEKYSGV  261

Query  208  LYGLGVENGQ  179
            LYGLG+ENGQ
Sbjct  262  LYGLGIENGQ  271



>ref|XP_010541576.1| PREDICTED: probable CCR4-associated factor 1 homolog 10 isoform 
X1 [Tarenaya hassleriana]
Length=275

 Score =   321 bits (823),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 174/191 (91%), Gaps = 0/191 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLPTCGTDK+CIWQFNFREF+P+ED++ ++SI+LL QCGIDF+KN E GI+ +RF
Sbjct  81   SDEDGNLPTCGTDKFCIWQFNFREFNPSEDIYVNESIDLLHQCGIDFKKNNEKGIDVKRF  140

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSG+VLND++ WVTFHSGYDFGYLLK+LTC+ LP  Q  FF L+N+YFP ++DIK
Sbjct  141  GELLMSSGVVLNDAMRWVTFHSGYDFGYLLKLLTCKALPVNQIEFFTLLNIYFPVIYDIK  200

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            H+M+FCN+LHGGL+KLAELLEVERVGV HQAGSDSLLT CTFRKLK++FF GS+++Y+GV
Sbjct  201  HMMKFCNNLHGGLSKLAELLEVERVGVSHQAGSDSLLTWCTFRKLKESFFKGSMKKYAGV  260

Query  208  LYGLGVENGQN  176
            LYGLGVENGQN
Sbjct  261  LYGLGVENGQN  271



>ref|XP_004250764.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Solanum 
lycopersicum]
 ref|XP_004250765.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Solanum 
lycopersicum]
Length=274

 Score =   320 bits (821),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 148/191 (77%), Positives = 171/191 (90%), Gaps = 0/191 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLPTC ++ Y +WQFNFREFD   ++FA+DSIELL Q GIDF+KN E GI+A++F
Sbjct  82   SDENGNLPTCESEYYYVWQFNFREFDTKANIFANDSIELLIQSGIDFKKNNEMGIDAKQF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSGIVLND VHWVTFHSGYDFGYLLK+LTC+ LPETQ GFF L+NMYFP V+DIK
Sbjct  142  GELLMSSGIVLNDMVHWVTFHSGYDFGYLLKLLTCRTLPETQSGFFDLLNMYFPLVYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLE+ERVG+CHQAGSDSLLT+C F+KLKDNFF+GS E+Y+GV
Sbjct  202  HLMKFCNSLHGGLNKLAELLEIERVGICHQAGSDSLLTSCAFKKLKDNFFNGSTEKYAGV  261

Query  208  LYGLGVENGQN  176
            LYGLGVE G +
Sbjct  262  LYGLGVEYGSD  272



>ref|XP_011073532.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Sesamum 
indicum]
Length=271

 Score =   320 bits (820),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 171/189 (90%), Gaps = 0/189 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLPTCGT+  CIWQFNFREF+ +ED+FA+DSIELLRQ GIDF+KN E GI+A RF
Sbjct  82   SDENGNLPTCGTNTCCIWQFNFREFNVSEDIFANDSIELLRQSGIDFKKNNELGIDAGRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
             ELLMSSGIVLND + WVTFHSGYDFGYLLK+LTC+ LPET  GFF L+N+YFP V+DIK
Sbjct  142  AELLMSSGIVLNDGMCWVTFHSGYDFGYLLKLLTCRSLPETPAGFFLLLNIYFPMVYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLEVER+GVCHQAGSDSLLT+C F+KLKDNFF+GS E+Y+GV
Sbjct  202  HLMKFCNSLHGGLNKLAELLEVERIGVCHQAGSDSLLTSCAFKKLKDNFFNGSTEKYAGV  261

Query  208  LYGLGVENG  182
            LYGLG+ENG
Sbjct  262  LYGLGIENG  270



>gb|AFK45143.1| unknown [Lotus japonicus]
Length=272

 Score =   319 bits (817),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 147/188 (78%), Positives = 170/188 (90%), Gaps = 0/188 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLPTCGT+  CIWQFNFREF+ +ED+FASDSIELLRQ GID +K  E GI+  RF
Sbjct  82   SDENGNLPTCGTETPCIWQFNFREFNVSEDIFASDSIELLRQSGIDLKKINEKGIDVSRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSG+VLND+VHWVTFHSGYDFGYLLK+LTC+ LPE+Q GFF LI +YFP ++DIK
Sbjct  142  GELLMSSGVVLNDNVHWVTFHSGYDFGYLLKLLTCRVLPESQAGFFELIKIYFPMLYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCN+LHGGLNKLAELLEV+RVG+CHQAGSDSLLT+CTFRKL+D +FSGS E+Y+GV
Sbjct  202  HLMKFCNNLHGGLNKLAELLEVDRVGMCHQAGSDSLLTSCTFRKLRDTYFSGSTEKYAGV  261

Query  208  LYGLGVEN  185
            LYGLGVEN
Sbjct  262  LYGLGVEN  269



>ref|XP_002279241.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Vitis 
vinifera]
Length=270

 Score =   318 bits (815),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 169/189 (89%), Gaps = 0/189 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GN PTCGT++YC+WQFNFREF+ NEDVFA DSIELL+Q GIDF+KN E G++ARRF
Sbjct  82   SDEHGNFPTCGTERYCVWQFNFREFNLNEDVFAHDSIELLKQSGIDFKKNNEKGVDARRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
             ELLMSSGIVLN+SVHWVTFHSGYDFGYLLK+LT Q LPETQ GFF LI +YFP ++DIK
Sbjct  142  SELLMSSGIVLNESVHWVTFHSGYDFGYLLKLLTSQNLPETQAGFFELIRIYFPILYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELL VER+G CHQAGSDSLLT CTF KLK +FF+GS E+Y+GV
Sbjct  202  HLMKFCNSLHGGLNKLAELLGVERIGSCHQAGSDSLLTCCTFMKLKKDFFNGSPEKYAGV  261

Query  208  LYGLGVENG  182
            LYGLGVE+G
Sbjct  262  LYGLGVESG  270



>ref|XP_008377668.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Malus 
domestica]
Length=273

 Score =   317 bits (813),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 148/190 (78%), Positives = 170/190 (89%), Gaps = 0/190 (0%)
 Frame = -3

Query  745  DEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRFG  566
            DE GNLPT  T+   IWQFNFREF+ +ED++ASDSIELLRQCGIDF+KN E GI+  RFG
Sbjct  83   DENGNLPTLSTENQYIWQFNFREFNVSEDIYASDSIELLRQCGIDFKKNNEKGIDVNRFG  142

Query  565  ELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIKH  386
            ELLM+SG+VL+D+V+WVTFHSGYDFGYLLK+LTC+ LP+ Q  FF LI +YFP ++DIKH
Sbjct  143  ELLMASGLVLSDNVYWVTFHSGYDFGYLLKLLTCRSLPDAQTEFFNLIKIYFPVLYDIKH  202

Query  385  LMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGVL  206
            LM+FCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKL+D FFSGS E+YSGVL
Sbjct  203  LMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLRDTFFSGSAEKYSGVL  262

Query  205  YGLGVENGQN  176
            YGLGVENGQ+
Sbjct  263  YGLGVENGQS  272



>emb|CAN68032.1| hypothetical protein VITISV_022019 [Vitis vinifera]
Length=270

 Score =   315 bits (808),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 168/189 (89%), Gaps = 0/189 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GN PTCGT++YC+WQFNFREF+ NEDVFA DSIELL+Q GIDF+KN E G++ARRF
Sbjct  82   SDEHGNFPTCGTERYCVWQFNFREFNLNEDVFAHDSIELLKQSGIDFKKNNEKGVDARRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
             ELLMSSGIVLNDSVHWVTFHSGYDFGYLLK+LT Q LPETQ GFF LI +YFP ++DIK
Sbjct  142  SELLMSSGIVLNDSVHWVTFHSGYDFGYLLKLLTSQNLPETQAGFFELIRIYFPILYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELL VER+G CHQAGSDSLLT CTF KLK +FF+GS E+ +GV
Sbjct  202  HLMKFCNSLHGGLNKLAELLGVERIGSCHQAGSDSLLTCCTFMKLKKDFFNGSPEKCAGV  261

Query  208  LYGLGVENG  182
            LYGLGVE+G
Sbjct  262  LYGLGVESG  270



>ref|XP_006410344.1| hypothetical protein EUTSA_v10017059mg [Eutrema salsugineum]
 gb|ESQ51797.1| hypothetical protein EUTSA_v10017059mg [Eutrema salsugineum]
Length=276

 Score =   315 bits (806),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 147/192 (77%), Positives = 168/192 (88%), Gaps = 2/192 (1%)
 Frame = -3

Query  748  SDEKGNLPTCG--TDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEAR  575
            SD+KGNLPTCG    K+CIWQFNFR+FD N D+FA DSIELLRQ GIDF KN + G+++R
Sbjct  82   SDDKGNLPTCGGSDKKHCIWQFNFRDFDLNSDIFAHDSIELLRQSGIDFVKNNQIGVDSR  141

Query  574  RFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFD  395
            RF EL MSSGIVLN+SVHWVTFHSGYDFGYLLK+LTCQ LPETQ GFF +I++YFP V+D
Sbjct  142  RFAELFMSSGIVLNESVHWVTFHSGYDFGYLLKLLTCQNLPETQTGFFEMISVYFPRVYD  201

Query  394  IKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYS  215
            +KHLM+FCNSLHGGLN LA  LEV RVGV HQAGSDSLLT+CTFRKL++NFF GS+E+YS
Sbjct  202  VKHLMKFCNSLHGGLNNLAAQLEVARVGVSHQAGSDSLLTSCTFRKLQENFFVGSMEKYS  261

Query  214  GVLYGLGVENGQ  179
            GVLYGLGVENG 
Sbjct  262  GVLYGLGVENGH  273



>ref|XP_008352217.1| PREDICTED: probable CCR4-associated factor 1 homolog 7, partial 
[Malus domestica]
Length=194

 Score =   311 bits (798),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 143/189 (76%), Positives = 168/189 (89%), Gaps = 0/189 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDEKGNLPTCGTDK+C+WQFNFR+F+PNEDV+ASDSIELL Q G+DF KN E G++A +F
Sbjct  2    SDEKGNLPTCGTDKHCVWQFNFRDFNPNEDVYASDSIELLSQSGMDFVKNNEKGVDASKF  61

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
             ELLM+SG+VL+D+V WVTFHSGYDFGYLLK+LT Q LP TQ GFF +I +YFP V+DIK
Sbjct  62   TELLMTSGVVLSDNVVWVTFHSGYDFGYLLKLLTGQSLPNTQVGFFKMIKVYFPTVYDIK  121

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLMRFCNSLHGGLNKLAELL+VER+G+ HQAGSDSLLT  TF KLK+ FF GS+++Y+GV
Sbjct  122  HLMRFCNSLHGGLNKLAELLDVERIGISHQAGSDSLLTCSTFMKLKETFFDGSIDKYAGV  181

Query  208  LYGLGVENG  182
            LYGLGVENG
Sbjct  182  LYGLGVENG  190



>gb|EYU21723.1| hypothetical protein MIMGU_mgv1a019889mg [Erythranthe guttata]
Length=272

 Score =   314 bits (805),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 149/191 (78%), Positives = 172/191 (90%), Gaps = 3/191 (2%)
 Frame = -3

Query  748  SDEKGNLPTC---GTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEA  578
            SDE GNLP C   G +++CIWQFNFREFDPNEDVFA+DSIELL + GID  +NTE+GIE+
Sbjct  82   SDENGNLPECSGAGKNRHCIWQFNFREFDPNEDVFANDSIELLSRSGIDLARNTENGIES  141

Query  577  RRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVF  398
            RRF ELLMSSGIVLN+SV+WVTFHSGYDFGYL+K++T Q+LPE Q+GFF LI++YFP V+
Sbjct  142  RRFAELLMSSGIVLNESVYWVTFHSGYDFGYLIKLVTGQKLPEEQEGFFGLIDVYFPVVY  201

Query  397  DIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEY  218
            DIKHLM+F NSLHGGLNKLAELLEVERVGVCHQAGSDSLLT CTF KLKDNFFSG+L +Y
Sbjct  202  DIKHLMKFVNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTCCTFFKLKDNFFSGTLHKY  261

Query  217  SGVLYGLGVEN  185
            SGVLYGLG+E+
Sbjct  262  SGVLYGLGIES  272



>gb|KHN29617.1| Putative CCR4-associated factor 1 like 7 [Glycine soja]
Length=265

 Score =   313 bits (802),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 150/190 (79%), Positives = 168/190 (88%), Gaps = 8/190 (4%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLPTCGT+  CIWQFNFREF+ +ED+FASDSIELLRQCGIDF+KN+E+GI+  RF
Sbjct  82   SDENGNLPTCGTESPCIWQFNFREFNVSEDIFASDSIELLRQCGIDFKKNSENGIDVNRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSGIV         FHSGYDFGYLLK+LTC+ LP+TQ GFF LI MYFP V+DIK
Sbjct  142  GELLMSSGIVF--------FHSGYDFGYLLKLLTCRSLPDTQAGFFDLIKMYFPMVYDIK  193

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLT+CTFRKL+D FFSGS E+Y+GV
Sbjct  194  HLMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTSCTFRKLRDTFFSGSTEKYAGV  253

Query  208  LYGLGVENGQ  179
            LYGLGVE+GQ
Sbjct  254  LYGLGVESGQ  263



>ref|XP_008344039.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Malus 
domestica]
Length=274

 Score =   312 bits (800),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 143/189 (76%), Positives = 167/189 (88%), Gaps = 0/189 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDEKGNLPTCGTDK+C+WQFNFR+F+PNEDV+ASDSIELL Q G+DF KN E G++A +F
Sbjct  82   SDEKGNLPTCGTDKHCVWQFNFRDFNPNEDVYASDSIELLSQSGMDFVKNNEKGVDASKF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
             ELLM+SG+VL+D+V WVTFHSGYDFGYLLK+LT Q LP TQ GFF +I MYFP V+DIK
Sbjct  142  TELLMTSGVVLSDNVVWVTFHSGYDFGYLLKLLTGQSLPNTQAGFFKMIKMYFPTVYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLMRFCNSLHGGLNKLAELL+VER+G+ HQAGSDSLLT  TF KLK+ +F GS ++Y+GV
Sbjct  202  HLMRFCNSLHGGLNKLAELLDVERIGISHQAGSDSLLTCSTFMKLKETYFDGSPDKYAGV  261

Query  208  LYGLGVENG  182
            LYGLGVENG
Sbjct  262  LYGLGVENG  270



>ref|XP_009366159.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Pyrus 
x bretschneideri]
Length=295

 Score =   313 bits (801),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 168/191 (88%), Gaps = 0/191 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDEKGNLPTCGTDK+C+WQFNFR+F+PNEDV+ASDSIELL Q G+DF KN E G++A +F
Sbjct  103  SDEKGNLPTCGTDKHCVWQFNFRDFNPNEDVYASDSIELLSQSGMDFVKNNEKGVDASKF  162

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
             ELLM+SG+VL+D+V WVTFHSGYDFGYLLK+LT Q LP TQ GFF +I MYFP V+DIK
Sbjct  163  TELLMTSGVVLSDNVVWVTFHSGYDFGYLLKLLTGQSLPNTQAGFFKMIKMYFPTVYDIK  222

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLMRFCNSLHGGLNKLAELL+VER+G+ HQAGSDSLLT  TF KLK+ +F GS ++Y+GV
Sbjct  223  HLMRFCNSLHGGLNKLAELLDVERIGISHQAGSDSLLTCSTFMKLKETYFDGSPDKYAGV  282

Query  208  LYGLGVENGQN  176
            LYGLGVENG N
Sbjct  283  LYGLGVENGPN  293



>ref|XP_008336906.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Malus 
domestica]
Length=295

 Score =   311 bits (796),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 143/189 (76%), Positives = 168/189 (89%), Gaps = 0/189 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDEKGNLPTCGTDK+C+WQFNFR+F+PNEDV+ASDSIELL Q G+DF KN E G++A +F
Sbjct  103  SDEKGNLPTCGTDKHCVWQFNFRDFNPNEDVYASDSIELLSQSGMDFVKNNEKGVDASKF  162

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
             ELLM+SG+VL+D+V WVTFHSGYDFGYLLK+LT Q LP TQ GFF +I +YFP V+DIK
Sbjct  163  TELLMTSGVVLSDNVVWVTFHSGYDFGYLLKLLTGQSLPNTQVGFFKMIKVYFPTVYDIK  222

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLMRFCNSLHGGLNKLAELL+VER+G+ HQAGSDSLLT  TF KLK+ FF GS+++Y+GV
Sbjct  223  HLMRFCNSLHGGLNKLAELLDVERIGISHQAGSDSLLTCSTFMKLKETFFDGSIDKYAGV  282

Query  208  LYGLGVENG  182
            LYGLGVENG
Sbjct  283  LYGLGVENG  291



>ref|XP_008220692.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Prunus 
mume]
Length=274

 Score =   310 bits (793),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 165/191 (86%), Gaps = 0/191 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SD+ G LP   T    IWQFNFREF+ +ED+FASDSIELLRQCGIDF+KN E GI+ +RF
Sbjct  82   SDKNGKLPDLDTQNQYIWQFNFREFNVSEDIFASDSIELLRQCGIDFKKNNEKGIDVKRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELL+SSG+VLN  VHWVTFHSGYDFGYLLK+LT   LP++Q GFF LI  +FP V+DIK
Sbjct  142  GELLVSSGVVLNAEVHWVTFHSGYDFGYLLKLLTGVSLPDSQAGFFELIKAFFPVVYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKL+D FF G+ E+Y+GV
Sbjct  202  HLMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLRDTFFGGTAEKYAGV  261

Query  208  LYGLGVENGQN  176
            LYGLGVENGQ+
Sbjct  262  LYGLGVENGQS  272



>ref|XP_008354337.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Malus 
domestica]
Length=295

 Score =   310 bits (795),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 143/189 (76%), Positives = 167/189 (88%), Gaps = 0/189 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDEKGNLPTCGTDK+C+WQFNFR+F+PNEDV+ASDSIELL Q G+DF KN E G++A +F
Sbjct  103  SDEKGNLPTCGTDKHCVWQFNFRDFNPNEDVYASDSIELLSQSGMDFVKNNEKGVDASKF  162

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
             ELLM+SG+VL+D+V WVTFHSGYDFGYLLK+LT Q LP TQ GFF +I MYFP V+DIK
Sbjct  163  TELLMTSGVVLSDNVVWVTFHSGYDFGYLLKLLTGQSLPNTQAGFFKMIKMYFPTVYDIK  222

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLMRFCNSLHGGLNKLAELL+VER+G+ HQAGSDSLLT  TF KLK+ +F GS ++Y+GV
Sbjct  223  HLMRFCNSLHGGLNKLAELLDVERIGISHQAGSDSLLTCSTFMKLKETYFDGSPDKYAGV  282

Query  208  LYGLGVENG  182
            LYGLGVENG
Sbjct  283  LYGLGVENG  291



>ref|XP_010556071.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Tarenaya 
hassleriana]
Length=276

 Score =   309 bits (792),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 150/191 (79%), Positives = 174/191 (91%), Gaps = 0/191 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLPTCGTDK+CIWQFNFREF+ ++DV+AS+SI+LL QCGIDF KN E GI+ +RF
Sbjct  82   SDEHGNLPTCGTDKFCIWQFNFREFNLSQDVYASESIDLLHQCGIDFNKNNEKGIDVKRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSGIVLND+V WVTFHSGYDFGYLLK+LTC+ LP+ Q  FF  +N+YFP ++DIK
Sbjct  142  GELLMSSGIVLNDAVSWVTFHSGYDFGYLLKLLTCKTLPQLQAEFFNHLNIYFPVIYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            H+M+FCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLT+CTFRKLKD+FF+GS E+Y+GV
Sbjct  202  HMMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTSCTFRKLKDSFFNGSTEKYAGV  261

Query  208  LYGLGVENGQN  176
            LYGLGVENG N
Sbjct  262  LYGLGVENGHN  272



>ref|XP_007202386.1| hypothetical protein PRUPE_ppa009376mg [Prunus persica]
 gb|EMJ03585.1| hypothetical protein PRUPE_ppa009376mg [Prunus persica]
Length=295

 Score =   310 bits (793),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 171/191 (90%), Gaps = 0/191 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            +DE GNLPTC TDK+C+WQFNFR+F+PNEDV+A+DSIELL Q G+DF+KN E G++A RF
Sbjct  103  TDENGNLPTCETDKHCVWQFNFRDFNPNEDVYANDSIELLSQSGMDFKKNNEKGVDAVRF  162

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
             +LLM+SG+VLN++V WVTFHSGYDFGYLLK+L  + LP+TQ GFF +I +YFP ++DIK
Sbjct  163  SQLLMTSGVVLNENVVWVTFHSGYDFGYLLKLLKGETLPDTQMGFFDMIKVYFPTIYDIK  222

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLMRFCNSLHGGLNKLAELL+VER+G+CHQAGSDSLLT+CTF KLK+ FFSG+ ++Y+GV
Sbjct  223  HLMRFCNSLHGGLNKLAELLDVERIGICHQAGSDSLLTSCTFMKLKETFFSGNPDKYAGV  282

Query  208  LYGLGVENGQN  176
            LYGLGVENG N
Sbjct  283  LYGLGVENGYN  293



>ref|XP_009358471.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Pyrus 
x bretschneideri]
Length=295

 Score =   309 bits (792),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 142/189 (75%), Positives = 167/189 (88%), Gaps = 0/189 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDEKGNLPTCGTDK+C+WQFNFR+F+PNEDV+ASDSIELL Q G+DF KN E G++A +F
Sbjct  103  SDEKGNLPTCGTDKHCVWQFNFRDFNPNEDVYASDSIELLSQSGMDFVKNNEKGVDASKF  162

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
             ELLM+SG+VL+D+V WVTFHSGYDFGYLLK+L  Q LP TQ GFF +I +YFP V+DIK
Sbjct  163  AELLMASGVVLSDNVVWVTFHSGYDFGYLLKLLKGQSLPNTQVGFFKMIKVYFPTVYDIK  222

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLMRFCNSLHGGLNKLAELL+VER+G+ HQAGSDSLLT  TF KLK+ FF GS+++Y+GV
Sbjct  223  HLMRFCNSLHGGLNKLAELLDVERIGISHQAGSDSLLTCSTFMKLKETFFDGSIDKYAGV  282

Query  208  LYGLGVENG  182
            LYGLGVENG
Sbjct  283  LYGLGVENG  291



>ref|XP_010537879.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Tarenaya 
hassleriana]
Length=277

 Score =   308 bits (790),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 167/190 (88%), Gaps = 1/190 (1%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLPTCGTDK+CIWQFN REFDPN D+++ DSIELLRQ GIDF KN E+GI++ RF
Sbjct  82   SDENGNLPTCGTDKHCIWQFNLREFDPNSDIYSQDSIELLRQSGIDFTKNNENGIDSGRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
             ELL+SSG+VLN+ + WVTFHSGYDFG LLK+LT + LPE Q GFF LINMYFP ++DIK
Sbjct  142  AELLISSGLVLNEDIQWVTFHSGYDFG-LLKLLTNRNLPEMQSGFFKLINMYFPILYDIK  200

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLT  ++RKLK+NFF G L++YSGV
Sbjct  201  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTLRSYRKLKENFFIGCLKKYSGV  260

Query  208  LYGLGVENGQ  179
            LYGLGV+NG 
Sbjct  261  LYGLGVDNGH  270



>ref|XP_008242960.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 isoform 
X2 [Prunus mume]
Length=295

 Score =   308 bits (788),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 138/191 (72%), Positives = 170/191 (89%), Gaps = 0/191 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            +DE GNLPTC TDK+C+WQFNFR+F+PNEDV+A+DSIELL Q G+DF+KN E G++A RF
Sbjct  103  TDENGNLPTCETDKHCVWQFNFRDFNPNEDVYANDSIELLSQSGMDFKKNNEKGVDAVRF  162

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
             +LLM+SG+VLN++V WVTFHSGYDFGYLLK+L  + LP+TQ GFF +I +YFP ++DIK
Sbjct  163  SQLLMTSGVVLNENVVWVTFHSGYDFGYLLKLLKGETLPDTQMGFFDMIKVYFPTIYDIK  222

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLMRFCNSLHGGLNKLAELL+VER+G+CHQAGSDSLLT+C F KLK+ FFSG+ ++Y+GV
Sbjct  223  HLMRFCNSLHGGLNKLAELLDVERIGICHQAGSDSLLTSCAFMKLKETFFSGNPDKYAGV  282

Query  208  LYGLGVENGQN  176
            LYGLGVENG N
Sbjct  283  LYGLGVENGYN  293



>ref|XP_004287117.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Fragaria 
vesca subsp. vesca]
Length=274

 Score =   306 bits (783),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 169/190 (89%), Gaps = 0/190 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLPTCGTDKYC+WQFNF  F+ NED++A +SIELL   G+DF+KN E GI+ARRF
Sbjct  82   SDENGNLPTCGTDKYCVWQFNFCNFNLNEDMYAPESIELLTHSGMDFKKNNEKGIDARRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
             ELLM+SGIVLN++V WVTFHSGYDFGYLLK+LTC++LP++Q  FF LIN+YFP+++D+K
Sbjct  142  SELLMTSGIVLNENVVWVTFHSGYDFGYLLKLLTCKDLPDSQTKFFELINLYFPKIYDVK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLMRFCNSLHGGLNKLAELL+VERVG+ HQAGSDSLLT+ TF KLK+NFFSGS ++Y+GV
Sbjct  202  HLMRFCNSLHGGLNKLAELLDVERVGISHQAGSDSLLTSFTFMKLKNNFFSGSPKKYAGV  261

Query  208  LYGLGVENGQ  179
            LYGLG+E G 
Sbjct  262  LYGLGIEYGH  271



>emb|CDX70376.1| BnaC03g04600D [Brassica napus]
Length=276

 Score =   306 bits (783),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 141/189 (75%), Positives = 164/189 (87%), Gaps = 0/189 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLPTCGTDK+C+WQFNFREF+  ED++AS+SIELLRQCGIDF+KN ESGI+  RF
Sbjct  82   SDEDGNLPTCGTDKFCVWQFNFREFNIGEDIYASESIELLRQCGIDFKKNVESGIDVARF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GEL+MSSGIVLNDS+ WVTFH GYDFGYL+K+LTC+ELP  Q  FF L+ +YFP V+DIK
Sbjct  142  GELMMSSGIVLNDSISWVTFHGGYDFGYLVKLLTCKELPVKQADFFKLLYVYFPTVYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM FCN L GGLN+LAEL+ VERVGVCHQAGSDSLLT  +FRKLK+ +F GS E Y+GV
Sbjct  202  HLMTFCNGLFGGLNRLAELMGVERVGVCHQAGSDSLLTLGSFRKLKERYFPGSTERYTGV  261

Query  208  LYGLGVENG  182
            LYGLGVE+G
Sbjct  262  LYGLGVEDG  270



>ref|XP_008242959.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 isoform 
X1 [Prunus mume]
Length=307

 Score =   306 bits (785),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 138/191 (72%), Positives = 170/191 (89%), Gaps = 0/191 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            +DE GNLPTC TDK+C+WQFNFR+F+PNEDV+A+DSIELL Q G+DF+KN E G++A RF
Sbjct  115  TDENGNLPTCETDKHCVWQFNFRDFNPNEDVYANDSIELLSQSGMDFKKNNEKGVDAVRF  174

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
             +LLM+SG+VLN++V WVTFHSGYDFGYLLK+L  + LP+TQ GFF +I +YFP ++DIK
Sbjct  175  SQLLMTSGVVLNENVVWVTFHSGYDFGYLLKLLKGETLPDTQMGFFDMIKVYFPTIYDIK  234

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLMRFCNSLHGGLNKLAELL+VER+G+CHQAGSDSLLT+C F KLK+ FFSG+ ++Y+GV
Sbjct  235  HLMRFCNSLHGGLNKLAELLDVERIGICHQAGSDSLLTSCAFMKLKETFFSGNPDKYAGV  294

Query  208  LYGLGVENGQN  176
            LYGLGVENG N
Sbjct  295  LYGLGVENGYN  305



>gb|EYU32376.1| hypothetical protein MIMGU_mgv1a026872mg [Erythranthe guttata]
Length=272

 Score =   305 bits (781),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 142/189 (75%), Positives = 168/189 (89%), Gaps = 1/189 (1%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLPTC  +  CIWQFNFREF+ +ED+FA+DSIELLR+ GIDF+KN E+GI+A  F
Sbjct  82   SDENGNLPTC-DNTCCIWQFNFREFNVSEDIFANDSIELLRESGIDFKKNNEAGIDASHF  140

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
             ELLMSSGIVLND+V WVTFHSGYDFGYLLK+LTC+ LPE+  GFF ++N+YFP V+DIK
Sbjct  141  AELLMSSGIVLNDNVRWVTFHSGYDFGYLLKLLTCRSLPESAVGFFNMLNLYFPVVYDIK  200

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLE+ER+G+CHQAGSDSLLT+  F+KLKDNFF+G  E+Y+GV
Sbjct  201  HLMKFCNSLHGGLNKLAELLEIERIGICHQAGSDSLLTSSAFKKLKDNFFNGFTEKYAGV  260

Query  208  LYGLGVENG  182
            LYGLGVENG
Sbjct  261  LYGLGVENG  269



>gb|ACE98441.1| ribonuclease CAF1, partial [Populus tremula]
 gb|ACE98442.1| ribonuclease CAF1, partial [Populus tremula]
 gb|ACE98443.1| ribonuclease CAF1, partial [Populus tremula]
 gb|ACE98444.1| ribonuclease CAF1, partial [Populus tremula]
 gb|ACE98445.1| ribonuclease CAF1, partial [Populus tremula]
 gb|ACE98446.1| ribonuclease CAF1, partial [Populus tremula]
 gb|ACE98447.1| ribonuclease CAF1, partial [Populus tremula]
 gb|ACE98448.1| ribonuclease CAF1, partial [Populus tremula]
 gb|ACE98449.1| ribonuclease CAF1, partial [Populus tremula]
 gb|ACE98450.1| ribonuclease CAF1, partial [Populus tremula]
 gb|ACE98451.1| ribonuclease CAF1, partial [Populus tremula]
 gb|ACE98452.1| ribonuclease CAF1, partial [Populus tremula]
 gb|ACE98453.1| ribonuclease CAF1, partial [Populus tremula]
 gb|ACE98454.1| ribonuclease CAF1, partial [Populus tremula]
 gb|ACE98455.1| ribonuclease CAF1, partial [Populus tremula]
 gb|ACE98456.1| ribonuclease CAF1, partial [Populus tremula]
 gb|ACE98457.1| ribonuclease CAF1, partial [Populus tremula]
 gb|ACE98458.1| ribonuclease CAF1, partial [Populus tremula]
 gb|ACE98459.1| ribonuclease CAF1, partial [Populus tremula]
 gb|ACE98460.1| ribonuclease CAF1, partial [Populus tremula]
 gb|ACE98461.1| ribonuclease CAF1, partial [Populus tremula]
 gb|ACE98462.1| ribonuclease CAF1, partial [Populus tremula]
 gb|ACE98463.1| ribonuclease CAF1, partial [Populus tremula]
 gb|ACE98464.1| ribonuclease CAF1, partial [Populus tremula]
 gb|ACE98465.1| ribonuclease CAF1, partial [Populus tremula]
 gb|ACE98466.1| ribonuclease CAF1, partial [Populus tremula]
 gb|ACE98467.1| ribonuclease CAF1, partial [Populus tremula]
 gb|ACE98468.1| ribonuclease CAF1, partial [Populus tremula]
 gb|ACE98469.1| ribonuclease CAF1, partial [Populus tremula]
 gb|ACE98470.1| ribonuclease CAF1, partial [Populus tremula]
 gb|ACE98471.1| ribonuclease CAF1, partial [Populus tremula]
 gb|ACE98472.1| ribonuclease CAF1, partial [Populus tremula]
Length=167

 Score =   300 bits (769),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 139/167 (83%), Positives = 153/167 (92%), Gaps = 0/167 (0%)
 Frame = -3

Query  742  EKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRFGE  563
            E GNLPTCGTDK+CIWQFNFREF+  ED+FASDSIELLRQCGIDF+ N E GI+  RFGE
Sbjct  1    ENGNLPTCGTDKFCIWQFNFREFNVTEDIFASDSIELLRQCGIDFKMNNEMGIDVNRFGE  60

Query  562  LLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIKHL  383
            LLMSSGIVLND VHWVTFHSGYDFGYLLK+LTC+ LP+T  GFF LINMYFP V+DIKHL
Sbjct  61   LLMSSGIVLNDGVHWVTFHSGYDFGYLLKLLTCRSLPDTPAGFFDLINMYFPMVYDIKHL  120

Query  382  MRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNF  242
            M+FCNSLHGGLNKLAELLEVER+GVCHQAGSDSLLT+CTF+KL+DNF
Sbjct  121  MKFCNSLHGGLNKLAELLEVERIGVCHQAGSDSLLTSCTFKKLRDNF  167



>ref|XP_006399590.1| hypothetical protein EUTSA_v10014350mg [Eutrema salsugineum]
 ref|XP_006399591.1| hypothetical protein EUTSA_v10014350mg [Eutrema salsugineum]
 gb|ESQ41043.1| hypothetical protein EUTSA_v10014350mg [Eutrema salsugineum]
 gb|ESQ41044.1| hypothetical protein EUTSA_v10014350mg [Eutrema salsugineum]
Length=277

 Score =   304 bits (779),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 138/189 (73%), Positives = 164/189 (87%), Gaps = 0/189 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLPTCGTDK+CIWQFNFREF+  ED++AS+SIELLRQCGIDF+KN E GI+  RF
Sbjct  82   SDENGNLPTCGTDKFCIWQFNFREFNIGEDIYASESIELLRQCGIDFKKNVEKGIDVVRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GEL+MSSGIVLND++ WVTFH GYDFGYL+K+LTC+ LP  Q  FF L+ +YFP V+DIK
Sbjct  142  GELMMSSGIVLNDAISWVTFHGGYDFGYLVKLLTCKALPVKQADFFKLLYVYFPTVYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM FCN L GGLN+LAEL+ VERVG+CHQAGSDSLLT  +FRKLK+ +F+GS E+Y+GV
Sbjct  202  HLMTFCNGLFGGLNRLAELMGVERVGICHQAGSDSLLTLGSFRKLKERYFTGSTEKYTGV  261

Query  208  LYGLGVENG  182
            LYGLGVE+G
Sbjct  262  LYGLGVEDG  270



>ref|XP_002871445.1| hypothetical protein ARALYDRAFT_487926 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47704.1| hypothetical protein ARALYDRAFT_487926 [Arabidopsis lyrata subsp. 
lyrata]
Length=276

 Score =   304 bits (778),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 139/189 (74%), Positives = 164/189 (87%), Gaps = 0/189 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLPTCGTDK+CIWQFNFREF+  ED++AS+SIELLRQCGIDF+KN E GI+  RF
Sbjct  82   SDENGNLPTCGTDKFCIWQFNFREFNIGEDIYASESIELLRQCGIDFKKNIEKGIDVVRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GEL+MSSGIVLND++ WVTFH GYDFGYL+K+LTC+ELP  Q  FF L+ +YFP V+DIK
Sbjct  142  GELMMSSGIVLNDAISWVTFHGGYDFGYLVKLLTCKELPLKQADFFKLLYVYFPTVYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM FCN L GGLN+LAEL+ VERVG+CHQAGSDSLLT  +FRKLK+ +F GS E+Y+GV
Sbjct  202  HLMTFCNGLFGGLNRLAELMGVERVGICHQAGSDSLLTLGSFRKLKERYFPGSTEKYTGV  261

Query  208  LYGLGVENG  182
            LYGLGVE+G
Sbjct  262  LYGLGVEDG  270



>ref|NP_196657.1| polynucleotidyl transferase, ribonuclease H-like superfamily 
protein [Arabidopsis thaliana]
 sp|Q9LEU4.1|CAF1J_ARATH RecName: Full=Probable CCR4-associated factor 1 homolog 10 [Arabidopsis 
thaliana]
 emb|CAB96851.1| CCR4-ASSOCIATED FACTOR-like protein [Arabidopsis thaliana]
 gb|AAN13040.1| putative CCR4-associated factor [Arabidopsis thaliana]
 gb|AED91615.1| polynucleotidyl transferase, ribonuclease H-like superfamily 
protein [Arabidopsis thaliana]
Length=277

 Score =   304 bits (778),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 139/189 (74%), Positives = 164/189 (87%), Gaps = 0/189 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLPTCGTDK+CIWQFNFREF+  ED++AS+SIELLRQCGIDF+KN E GI+  RF
Sbjct  82   SDENGNLPTCGTDKFCIWQFNFREFNIGEDIYASESIELLRQCGIDFKKNIEKGIDVVRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GEL+MSSGIVLND++ WVTFH GYDFGYL+K+LTC+ELP  Q  FF L+ +YFP V+DIK
Sbjct  142  GELMMSSGIVLNDAISWVTFHGGYDFGYLVKLLTCKELPLKQADFFKLLYVYFPTVYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM FCN L GGLN+LAEL+ VERVG+CHQAGSDSLLT  +FRKLK+ +F GS E+Y+GV
Sbjct  202  HLMTFCNGLFGGLNRLAELMGVERVGICHQAGSDSLLTLGSFRKLKERYFPGSTEKYTGV  261

Query  208  LYGLGVENG  182
            LYGLGVE+G
Sbjct  262  LYGLGVEDG  270



>ref|XP_002309331.1| hypothetical protein POPTR_0006s20130g [Populus trichocarpa]
 gb|EEE92854.1| hypothetical protein POPTR_0006s20130g [Populus trichocarpa]
Length=269

 Score =   303 bits (776),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 142/188 (76%), Positives = 163/188 (87%), Gaps = 0/188 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDEKGNLPTCGTDKYC+WQFNF +F+PNEDV+A+DSIELL Q GIDF KN E G +A RF
Sbjct  82   SDEKGNLPTCGTDKYCVWQFNFCDFNPNEDVYANDSIELLSQSGIDFVKNAEVGADATRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
             ELLM+SGIVLND VHWVTFHSGYDFGYLLK+LT ++LP+TQ  FF LI +YFP ++DIK
Sbjct  142  TELLMTSGIVLNDDVHWVTFHSGYDFGYLLKMLTGKKLPDTQVDFFKLIKIYFPVLYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCN LHGGLNKLAE L V+R+G+ HQAGSDSLLT+ TF KLK+ FFSGS E Y+GV
Sbjct  202  HLMKFCNGLHGGLNKLAEQLGVKRIGISHQAGSDSLLTSSTFMKLKEIFFSGSPERYAGV  261

Query  208  LYGLGVEN  185
            LYGLGVEN
Sbjct  262  LYGLGVEN  269



>ref|XP_011033459.1| PREDICTED: probable CCR4-associated factor 1 homolog 6 [Populus 
euphratica]
Length=269

 Score =   301 bits (771),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 140/188 (74%), Positives = 164/188 (87%), Gaps = 0/188 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDEKGNLPTCGTDKYC+WQFNF +F+PNEDV+A+DSIELL Q GIDF KN E G +A RF
Sbjct  82   SDEKGNLPTCGTDKYCVWQFNFCDFNPNEDVYANDSIELLSQSGIDFVKNAEDGADATRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
             ELLM+SGIVLND+VHWVTFHSGYDFGYLLK+LT ++LP+TQ  FF LI +YFP ++DIK
Sbjct  142  TELLMTSGIVLNDNVHWVTFHSGYDFGYLLKMLTGKKLPDTQADFFNLIKIYFPVLYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCN LHGGLNKLAE L V+R+G+ HQAGSDSLLT+ TF +LK+ FFSGS E Y+GV
Sbjct  202  HLMKFCNGLHGGLNKLAEQLGVKRIGISHQAGSDSLLTSSTFMRLKEIFFSGSPERYAGV  261

Query  208  LYGLGVEN  185
            LYGLGV+N
Sbjct  262  LYGLGVDN  269



>ref|XP_006286536.1| hypothetical protein CARUB_v10001652mg [Capsella rubella]
 gb|EOA19434.1| hypothetical protein CARUB_v10001652mg [Capsella rubella]
Length=282

 Score =   302 bits (773),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 139/189 (74%), Positives = 164/189 (87%), Gaps = 0/189 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLPTCGTDK+CIWQFNFREF+  ED++AS+SIELLRQCGIDF+KN E GI+  RF
Sbjct  82   SDENGNLPTCGTDKFCIWQFNFREFNIGEDIYASESIELLRQCGIDFKKNIEKGIDVVRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GEL+MSSGIVLNDS+ WVTFH GYDFGYL+K+LTC+ELP  Q  FF L+ +YFP V+DIK
Sbjct  142  GELMMSSGIVLNDSISWVTFHGGYDFGYLVKLLTCKELPLKQADFFKLLFVYFPTVYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            +LM FCN L GGLN+LAEL+ VERVG+CHQAGSDSLLT  +FRKLK+ +F GS E+Y+GV
Sbjct  202  YLMTFCNGLFGGLNRLAELMGVERVGICHQAGSDSLLTLGSFRKLKERYFPGSTEKYTGV  261

Query  208  LYGLGVENG  182
            LYGLGVE+G
Sbjct  262  LYGLGVEDG  270



>ref|XP_010419649.1| PREDICTED: probable CCR4-associated factor 1 homolog 10 [Camelina 
sativa]
 ref|XP_010419650.1| PREDICTED: probable CCR4-associated factor 1 homolog 10 [Camelina 
sativa]
Length=277

 Score =   301 bits (772),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 139/189 (74%), Positives = 162/189 (86%), Gaps = 0/189 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLP CGTDK+CIWQFNFREF+  ED++AS+SIELLRQCGIDF+KN E GI+  RF
Sbjct  82   SDENGNLPKCGTDKFCIWQFNFREFNIGEDIYASESIELLRQCGIDFKKNVEKGIDVVRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSGIV+ND + WVTFH GYDFGYL+K+LTC+ELP  Q  FF L+ +YFP V+DIK
Sbjct  142  GELLMSSGIVMNDDISWVTFHGGYDFGYLVKLLTCKELPLKQADFFKLLYVYFPTVYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM FCN L GGLN+LAEL+ VERVGVCHQAGSDSLLT  +FRKLK+ +F GS E+Y+GV
Sbjct  202  HLMTFCNGLFGGLNRLAELMGVERVGVCHQAGSDSLLTLGSFRKLKERYFPGSTEKYTGV  261

Query  208  LYGLGVENG  182
            LYGLGVE+G
Sbjct  262  LYGLGVEDG  270



>gb|AEN81307.1| AT1G80780-like protein, partial [Capsella rubella]
 gb|AEN81308.1| AT1G80780-like protein, partial [Capsella rubella]
 gb|AEN81309.1| AT1G80780-like protein, partial [Capsella rubella]
 gb|AEN81310.1| AT1G80780-like protein, partial [Capsella rubella]
 gb|AEN81311.1| AT1G80780-like protein, partial [Capsella rubella]
 gb|AEN81312.1| AT1G80780-like protein, partial [Capsella rubella]
 gb|AEN81313.1| AT1G80780-like protein, partial [Capsella rubella]
 gb|AEN81314.1| AT1G80780-like protein, partial [Capsella rubella]
Length=200

 Score =   298 bits (764),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 136/170 (80%), Positives = 156/170 (92%), Gaps = 0/170 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            S+E+GNLPTCGTDKYCIWQFNF EFD + D+FA DSIELL+Q GID  KNT+ GI+++RF
Sbjct  31   SNEQGNLPTCGTDKYCIWQFNFGEFDLDSDIFAVDSIELLKQSGIDLAKNTQDGIDSKRF  90

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
             ELLMSSGIVLN++VHWVTFHSGYDFGYLLK+LTCQ LP++Q  FF LIN+YFP V+DIK
Sbjct  91   AELLMSSGIVLNENVHWVTFHSGYDFGYLLKLLTCQNLPDSQTDFFKLINVYFPTVYDIK  150

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFF  239
            HLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLT+CTFRKLK+NFF
Sbjct  151  HLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTSCTFRKLKENFF  200



>gb|AAK92792.1| putative CCR4-associated factor [Arabidopsis thaliana]
Length=277

 Score =   301 bits (771),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 138/189 (73%), Positives = 163/189 (86%), Gaps = 0/189 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLPTCGTDK+CIWQFNFREF+  ED++AS+SIELLRQCGIDF+KN E GI+  RF
Sbjct  82   SDENGNLPTCGTDKFCIWQFNFREFNIGEDIYASESIELLRQCGIDFKKNIEKGIDVVRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GEL+MSSGIVLND++ WVTFH GYDFGYL+K+LTC+ELP  Q  FF L+ +YFP V+DIK
Sbjct  142  GELMMSSGIVLNDAISWVTFHGGYDFGYLVKLLTCKELPLKQADFFKLLYVYFPTVYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM FCN L GGLN+LAEL+ VERVG+CHQAGSDSLLT  +FRK K+ +F GS E+Y+GV
Sbjct  202  HLMTFCNGLFGGLNRLAELMGVERVGICHQAGSDSLLTLGSFRKPKERYFPGSTEKYTGV  261

Query  208  LYGLGVENG  182
            LYGLGVE+G
Sbjct  262  LYGLGVEDG  270



>ref|XP_010453129.1| PREDICTED: probable CCR4-associated factor 1 homolog 10 [Camelina 
sativa]
 ref|XP_010453130.1| PREDICTED: probable CCR4-associated factor 1 homolog 10 [Camelina 
sativa]
Length=278

 Score =   301 bits (771),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 138/189 (73%), Positives = 162/189 (86%), Gaps = 0/189 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLPTCGTDK+CIWQFNFREF+  ED++AS+SIELLRQCGIDF+KN E GI+  RF
Sbjct  82   SDENGNLPTCGTDKFCIWQFNFREFNIGEDIYASESIELLRQCGIDFKKNVEKGIDVVRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSGIV+ND + WVTFH GYDFGYL+K+L C+ELP  Q  FF L+ +YFP V+DIK
Sbjct  142  GELLMSSGIVMNDDISWVTFHGGYDFGYLVKLLICKELPLKQADFFKLLYVYFPTVYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM FCN L GGLN+LAEL+ VERVG+CHQAGSDSLLT  +FRKLK+ +F GS E+Y+GV
Sbjct  202  HLMTFCNGLFGGLNRLAELMGVERVGICHQAGSDSLLTLGSFRKLKERYFPGSTEKYTGV  261

Query  208  LYGLGVENG  182
            LYGLGVE+G
Sbjct  262  LYGLGVEDG  270



>gb|ABK22659.1| unknown [Picea sitchensis]
Length=284

 Score =   301 bits (770),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 137/187 (73%), Positives = 166/187 (89%), Gaps = 0/187 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLP+CGTD+YC+WQFNFREF+  ED +ASDSIELLRQ GIDF+KN+E G+++ RF
Sbjct  82   SDEDGNLPSCGTDRYCVWQFNFREFNIWEDAYASDSIELLRQSGIDFKKNSELGVDSHRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
             ELLMSSGIVLN++V W+TFHSGYDFGYLLK++  + LP TQ GFF LI MYFP ++DIK
Sbjct  142  AELLMSSGIVLNENVRWITFHSGYDFGYLLKLVMNRRLPLTQAGFFYLIRMYFPNLYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLN+LAELLEVER G CHQAGSDSLLT+CTFRKL+++FF+G+ ++Y+GV
Sbjct  202  HLMKFCNSLHGGLNRLAELLEVERFGACHQAGSDSLLTSCTFRKLRESFFNGAADKYAGV  261

Query  208  LYGLGVE  188
            LYGLG E
Sbjct  262  LYGLGEE  268



>ref|XP_010491786.1| PREDICTED: probable CCR4-associated factor 1 homolog 10 [Camelina 
sativa]
Length=279

 Score =   300 bits (769),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 139/188 (74%), Positives = 161/188 (86%), Gaps = 0/188 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLPTCGTDK+CIWQFNFREF+  ED+FAS+SIELLRQCGIDF+KN E GI+  RF
Sbjct  82   SDENGNLPTCGTDKFCIWQFNFREFNIGEDIFASESIELLRQCGIDFKKNVEKGIDVVRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSGIV+ND + WVTFH GYDFGYL+K+L C+ELP  Q  FF L+ +YFP V+DIK
Sbjct  142  GELLMSSGIVMNDDISWVTFHGGYDFGYLVKLLICKELPLKQADFFKLLYVYFPTVYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM FCN L GGLN+LAEL+ VERVGVCHQAGSDSLLT  +FRKLK+ +F GS E+Y+GV
Sbjct  202  HLMTFCNGLFGGLNRLAELMGVERVGVCHQAGSDSLLTLGSFRKLKERYFPGSTEKYTGV  261

Query  208  LYGLGVEN  185
            LYGLGVE+
Sbjct  262  LYGLGVED  269



>ref|XP_004954218.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Setaria 
italica]
Length=287

 Score =   299 bits (766),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 138/190 (73%), Positives = 161/190 (85%), Gaps = 1/190 (1%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKY-CIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARR  572
            S  +G LP  G D+  C+WQFNFREFD   D+FASDSIELLR+ GIDF +N E G++ARR
Sbjct  94   SGPRGELPALGADRRRCVWQFNFREFDDARDIFASDSIELLRRSGIDFRRNAERGVDARR  153

Query  571  FGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDI  392
            F ELLMSSG+VLNDSV+WVTFH+GYDFGYLLKILTC  LP+TQ GFF L+ +YFP V+DI
Sbjct  154  FAELLMSSGVVLNDSVYWVTFHAGYDFGYLLKILTCNSLPDTQAGFFKLMKIYFPTVYDI  213

Query  391  KHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSG  212
            KHLM+FCNSLHGGLNKLAELL+VERVG  HQAGSDSL+T+C F KLKD+FF+GS E+Y+G
Sbjct  214  KHLMKFCNSLHGGLNKLAELLDVERVGESHQAGSDSLVTSCAFWKLKDSFFAGSTEKYAG  273

Query  211  VLYGLGVENG  182
            VLYGL  ENG
Sbjct  274  VLYGLNAENG  283



>emb|CDX69796.1| BnaA10g21450D [Brassica napus]
Length=278

 Score =   298 bits (764),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 136/188 (72%), Positives = 163/188 (87%), Gaps = 0/188 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLPTCGTDK+CIWQFNFREF+  ED++AS+SIELLRQCGIDF+KN E GI+  RF
Sbjct  82   SDEDGNLPTCGTDKFCIWQFNFREFNIGEDIYASESIELLRQCGIDFKKNVEKGIDVVRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GEL+MSSGIVLNDS+ W+TFH GYDFGYL+K+LTC+ELP  Q  FF ++ +YFP V+DIK
Sbjct  142  GELMMSSGIVLNDSISWITFHGGYDFGYLVKLLTCKELPLRQADFFKMLFVYFPTVYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            +LM FCN L GGLN+LAEL+ VERVG+CHQAGSDSLLT  +FRKLK+ +F GS E+Y+GV
Sbjct  202  YLMTFCNGLFGGLNRLAELMGVERVGICHQAGSDSLLTLGSFRKLKERYFPGSTEKYTGV  261

Query  208  LYGLGVEN  185
            LYGLGVE+
Sbjct  262  LYGLGVED  269



>ref|XP_009122009.1| PREDICTED: probable CCR4-associated factor 1 homolog 10 [Brassica 
rapa]
 ref|XP_009122010.1| PREDICTED: probable CCR4-associated factor 1 homolog 10 [Brassica 
rapa]
Length=280

 Score =   298 bits (764),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 136/188 (72%), Positives = 163/188 (87%), Gaps = 0/188 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLPTCGTDK+CIWQFNFREF+  ED++AS+SIELLRQCGIDF+KN E GI+  RF
Sbjct  82   SDEDGNLPTCGTDKFCIWQFNFREFNIGEDIYASESIELLRQCGIDFKKNVERGIDVVRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GEL+MSSGIVLNDS+ W+TFH GYDFGYL+K+LTC+ELP  Q  FF ++ +YFP V+DIK
Sbjct  142  GELMMSSGIVLNDSISWITFHGGYDFGYLVKLLTCKELPLRQADFFKMLFVYFPTVYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            +LM FCN L GGLN+LAEL+ VERVG+CHQAGSDSLLT  +FRKLK+ +F GS E+Y+GV
Sbjct  202  YLMTFCNGLFGGLNRLAELMGVERVGICHQAGSDSLLTLGSFRKLKERYFPGSTEKYTGV  261

Query  208  LYGLGVEN  185
            LYGLGVE+
Sbjct  262  LYGLGVED  269



>emb|CDX97069.1| BnaC09g45560D [Brassica napus]
Length=280

 Score =   298 bits (764),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 135/188 (72%), Positives = 163/188 (87%), Gaps = 0/188 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLPTCGTDK+C+WQFNFREF+  ED++AS+SIELLRQCGIDF+KN E GI+  RF
Sbjct  82   SDEDGNLPTCGTDKFCVWQFNFREFNIGEDIYASESIELLRQCGIDFKKNVERGIDVVRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GEL+MSSG+VLNDS+ WVTFH GYDFGYL+K+LTC+ELP  Q  FF ++ +YFP V+DIK
Sbjct  142  GELMMSSGVVLNDSISWVTFHGGYDFGYLVKLLTCKELPLKQADFFKMLFVYFPTVYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            +LM FCN L GGLN+LAEL+ VERVG+CHQAGSDSLLT  +FRKLK+ +F GS E+Y+GV
Sbjct  202  YLMTFCNGLFGGLNRLAELMGVERVGICHQAGSDSLLTLGSFRKLKERYFPGSTEKYTGV  261

Query  208  LYGLGVEN  185
            LYGLGVE+
Sbjct  262  LYGLGVED  269



>ref|XP_009131188.1| PREDICTED: probable CCR4-associated factor 1 homolog 10 [Brassica 
rapa]
 emb|CDX78405.1| BnaA03g03170D [Brassica napus]
Length=278

 Score =   297 bits (761),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 162/190 (85%), Gaps = 1/190 (1%)
 Frame = -3

Query  748  SDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARR  572
            SDE GNLPTCG D K+C+WQFNFREF+  ED++AS+SIELLRQCGIDF+KN E GI+  R
Sbjct  82   SDEDGNLPTCGADDKFCVWQFNFREFNIGEDIYASESIELLRQCGIDFKKNLERGIDVAR  141

Query  571  FGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDI  392
            FGEL+MSSGIVLNDS+ WVTFH GYDFGYL+K+LTC+ELP  Q  FF L+ +YFP V+DI
Sbjct  142  FGELMMSSGIVLNDSISWVTFHGGYDFGYLVKLLTCKELPIKQADFFKLLYVYFPTVYDI  201

Query  391  KHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSG  212
            KHLM FCN L GGLN+LAEL+ VERVGVCHQAGSDSLLT  +FRKLK+ +F GS E YSG
Sbjct  202  KHLMTFCNGLFGGLNRLAELMGVERVGVCHQAGSDSLLTLGSFRKLKERYFPGSTERYSG  261

Query  211  VLYGLGVENG  182
            VLYGLGVE+G
Sbjct  262  VLYGLGVEDG  271



>ref|NP_001148663.1| CCR4-NOT transcription complex subunit 7 [Zea mays]
 gb|ACG32425.1| CCR4-NOT transcription complex subunit 7 [Zea mays]
Length=237

 Score =   296 bits (757),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 160/190 (84%), Gaps = 1/190 (1%)
 Frame = -3

Query  748  SDEKGNLPTCGT-DKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARR  572
            S  +G LP  G   + C+WQFNFREFD   D+FASDSIELLR+ GIDF +N E G++ARR
Sbjct  44   SGPRGELPALGAGRRRCVWQFNFREFDDARDIFASDSIELLRRSGIDFRRNAERGVDARR  103

Query  571  FGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDI  392
            F ELLMSSG+VLNDSV+WVTFH+GYDFGYLLKILTC  LP+TQ GFF L+ +YFP V+DI
Sbjct  104  FAELLMSSGVVLNDSVYWVTFHAGYDFGYLLKILTCNSLPDTQAGFFKLMKIYFPTVYDI  163

Query  391  KHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSG  212
            KHLM+FCNSLHGGLNKLAELL+VERVG  HQAGSDSL+T+C F KLKD+FF+GS E+Y+G
Sbjct  164  KHLMKFCNSLHGGLNKLAELLDVERVGESHQAGSDSLVTSCAFWKLKDSFFAGSTEKYAG  223

Query  211  VLYGLGVENG  182
            VLYGL  ENG
Sbjct  224  VLYGLNAENG  233



>gb|ACL53982.1| unknown [Zea mays]
 gb|AFW73867.1| CCR4-NOT transcription complex subunit 7 [Zea mays]
Length=287

 Score =   297 bits (760),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 160/190 (84%), Gaps = 1/190 (1%)
 Frame = -3

Query  748  SDEKGNLPTCGT-DKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARR  572
            S  +G LP  G   + C+WQFNFREFD   D+FASDSIELLR+ GIDF +N E G++ARR
Sbjct  94   SGPRGELPALGAGRRRCVWQFNFREFDDARDIFASDSIELLRRSGIDFRRNAERGVDARR  153

Query  571  FGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDI  392
            F ELLMSSG+VLNDSV+WVTFH+GYDFGYLLKILTC  LP+TQ GFF L+ +YFP V+DI
Sbjct  154  FAELLMSSGVVLNDSVYWVTFHAGYDFGYLLKILTCNSLPDTQAGFFKLMKIYFPTVYDI  213

Query  391  KHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSG  212
            KHLM+FCNSLHGGLNKLAELL+VERVG  HQAGSDSL+T+C F KLKD+FF+GS E+Y+G
Sbjct  214  KHLMKFCNSLHGGLNKLAELLDVERVGESHQAGSDSLVTSCAFWKLKDSFFAGSTEKYAG  273

Query  211  VLYGLGVENG  182
            VLYGL  ENG
Sbjct  274  VLYGLNAENG  283



>ref|XP_002452981.1| hypothetical protein SORBIDRAFT_04g035960 [Sorghum bicolor]
 gb|EES05957.1| hypothetical protein SORBIDRAFT_04g035960 [Sorghum bicolor]
Length=288

 Score =   297 bits (760),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 160/190 (84%), Gaps = 1/190 (1%)
 Frame = -3

Query  748  SDEKGNLPTCGT-DKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARR  572
            S  +G LP  G   + C+WQFNFREFD   D+FASDSIELLR+ GIDF +N E G++ARR
Sbjct  95   SGPRGELPALGAGRRRCVWQFNFREFDDARDIFASDSIELLRRSGIDFRRNAERGVDARR  154

Query  571  FGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDI  392
            F ELLMSSG+VLNDSV+WVTFH+GYDFGYLLKILTC  LP+TQ GFF L+ +YFP V+DI
Sbjct  155  FAELLMSSGVVLNDSVYWVTFHAGYDFGYLLKILTCSSLPDTQAGFFKLMKIYFPTVYDI  214

Query  391  KHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSG  212
            KHLM+FCNSLHGGLNKLAELL+VERVG  HQAGSDSL+T+C F KLKD+FF+GS E+Y+G
Sbjct  215  KHLMKFCNSLHGGLNKLAELLDVERVGESHQAGSDSLVTSCAFWKLKDSFFAGSTEKYAG  274

Query  211  VLYGLGVENG  182
            VLYGL  ENG
Sbjct  275  VLYGLNAENG  284



>ref|XP_007222518.1| hypothetical protein PRUPE_ppa009848mg [Prunus persica]
 gb|EMJ23717.1| hypothetical protein PRUPE_ppa009848mg [Prunus persica]
Length=274

 Score =   296 bits (758),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 165/191 (86%), Gaps = 0/191 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SD+ G LP   T    IWQFNFREF+ +ED+FASDSIELLRQCGIDF+KN E GI+ +RF
Sbjct  82   SDKNGKLPDLDTQNQYIWQFNFREFNVSEDIFASDSIELLRQCGIDFKKNNEKGIDVKRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELL+SSG+VLN  VHWVTFHSGYDFGYLLK+LT   LP++Q GFF LI  +FP V+DIK
Sbjct  142  GELLVSSGVVLNAEVHWVTFHSGYDFGYLLKLLTGLSLPDSQAGFFELIKAFFPVVYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKL+D FF G+ E+Y+GV
Sbjct  202  HLMKFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLRDTFFGGTAEKYAGV  261

Query  208  LYGLGVENGQN  176
            LYGLGVENGQ+
Sbjct  262  LYGLGVENGQS  272



>gb|EMS46974.1| putative CCR4-associated factor 1-like protein 7 [Triticum urartu]
Length=237

 Score =   293 bits (751),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 158/190 (83%), Gaps = 1/190 (1%)
 Frame = -3

Query  748  SDEKGNLPTCGT-DKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARR  572
            S   G LP  G   + C+WQFNFREFD   D+FA+DSIELLR  GIDF +N E G++ARR
Sbjct  44   SGPTGELPALGAGRRRCVWQFNFREFDDERDIFATDSIELLRHSGIDFRRNAERGVDARR  103

Query  571  FGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDI  392
            F ELLMSSG+VLND+V+WVTFH+GYDFGYLLKILTC  LP+TQ GFF L+ +YFP V+DI
Sbjct  104  FAELLMSSGVVLNDAVYWVTFHAGYDFGYLLKILTCNSLPDTQAGFFKLMKIYFPTVYDI  163

Query  391  KHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSG  212
            KHLM+FCNSLHGGLNKLAELL+VERVG  HQAGSDSL+T+C F KLKD+FF+GS E+Y+G
Sbjct  164  KHLMKFCNSLHGGLNKLAELLDVERVGESHQAGSDSLVTSCAFWKLKDSFFAGSTEKYAG  223

Query  211  VLYGLGVENG  182
            VLYGL  ENG
Sbjct  224  VLYGLNAENG  233



>gb|EMT24915.1| Putative CCR4-associated factor 1-7-like protein [Aegilops tauschii]
Length=205

 Score =   292 bits (748),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 158/190 (83%), Gaps = 1/190 (1%)
 Frame = -3

Query  748  SDEKGNLPTCGT-DKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARR  572
            S   G LP  G   + C+WQFNFREFD   D+FA+DSIELLR  GIDF +N E G++ARR
Sbjct  12   SGPTGELPALGAGRRRCVWQFNFREFDDERDIFATDSIELLRHSGIDFRRNAERGVDARR  71

Query  571  FGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDI  392
            F ELLMSSG+VLND+V+WVTFH+GYDFGYLLKILTC  LP+TQ GFF L+ +YFP V+DI
Sbjct  72   FAELLMSSGVVLNDAVYWVTFHAGYDFGYLLKILTCNSLPDTQAGFFKLMKIYFPTVYDI  131

Query  391  KHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSG  212
            KHLM+FCNSLHGGLNKLAELL+VERVG  HQAGSDSL+T+C F KLKD+FF+GS E+Y+G
Sbjct  132  KHLMKFCNSLHGGLNKLAELLDVERVGESHQAGSDSLVTSCAFWKLKDSFFAGSTEKYAG  191

Query  211  VLYGLGVENG  182
            VLYGL  ENG
Sbjct  192  VLYGLNAENG  201



>gb|EEC74173.1| hypothetical protein OsI_09281 [Oryza sativa Indica Group]
Length=295

 Score =   295 bits (756),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 136/189 (72%), Positives = 160/189 (85%), Gaps = 1/189 (1%)
 Frame = -3

Query  748  SDEKGNLPTCGT-DKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARR  572
            S  +G LP  G   + C+WQFNFREFD   D+FASDSIELLR+ GIDF +N+E G++ARR
Sbjct  102  SSPRGELPALGPGRRRCVWQFNFREFDDARDIFASDSIELLRRSGIDFRRNSERGVDARR  161

Query  571  FGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDI  392
            F ELLMSSG+VLNDSV+WVTFH+GYDFGYLLKILTC  LP+TQ GFF L+ +YFP V+DI
Sbjct  162  FAELLMSSGVVLNDSVYWVTFHAGYDFGYLLKILTCSSLPDTQAGFFKLMKIYFPTVYDI  221

Query  391  KHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSG  212
            KHLM+FCNSLHGGLNKLAELL+VERVG  HQAGSDSL+T+C F KLKD+FF+GS E+Y+G
Sbjct  222  KHLMKFCNSLHGGLNKLAELLDVERVGESHQAGSDSLVTSCAFWKLKDSFFAGSTEKYAG  281

Query  211  VLYGLGVEN  185
            VLYGL  EN
Sbjct  282  VLYGLNAEN  290



>ref|NP_001048387.1| Os02g0796300 [Oryza sativa Japonica Group]
 dbj|BAF10301.1| Os02g0796300 [Oryza sativa Japonica Group]
 dbj|BAG88128.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93253.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99633.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57976.1| hypothetical protein OsJ_08719 [Oryza sativa Japonica Group]
Length=295

 Score =   295 bits (756),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 136/189 (72%), Positives = 160/189 (85%), Gaps = 1/189 (1%)
 Frame = -3

Query  748  SDEKGNLPTCGT-DKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARR  572
            S  +G LP  G   + C+WQFNFREFD   D+FASDSIELLR+ GIDF +N+E G++ARR
Sbjct  102  SSPRGELPALGPGRRRCVWQFNFREFDDARDIFASDSIELLRRSGIDFRRNSERGVDARR  161

Query  571  FGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDI  392
            F ELLMSSG+VLNDSV+WVTFH+GYDFGYLLKILTC  LP+TQ GFF L+ +YFP V+DI
Sbjct  162  FAELLMSSGVVLNDSVYWVTFHAGYDFGYLLKILTCSSLPDTQAGFFKLMKIYFPTVYDI  221

Query  391  KHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSG  212
            KHLM+FCNSLHGGLNKLAELL+VERVG  HQAGSDSL+T+C F KLKD+FF+GS E+Y+G
Sbjct  222  KHLMKFCNSLHGGLNKLAELLDVERVGESHQAGSDSLVTSCAFWKLKDSFFAGSTEKYAG  281

Query  211  VLYGLGVEN  185
            VLYGL  EN
Sbjct  282  VLYGLNAEN  290



>dbj|BAD19081.1| putative CCR4-NOT transcription complex subunit 7 [Oryza sativa 
Japonica Group]
 dbj|BAD19282.1| putative CCR4-NOT transcription complex subunit 7 [Oryza sativa 
Japonica Group]
Length=293

 Score =   295 bits (756),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 136/189 (72%), Positives = 160/189 (85%), Gaps = 1/189 (1%)
 Frame = -3

Query  748  SDEKGNLPTCGT-DKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARR  572
            S  +G LP  G   + C+WQFNFREFD   D+FASDSIELLR+ GIDF +N+E G++ARR
Sbjct  100  SSPRGELPALGPGRRRCVWQFNFREFDDARDIFASDSIELLRRSGIDFRRNSERGVDARR  159

Query  571  FGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDI  392
            F ELLMSSG+VLNDSV+WVTFH+GYDFGYLLKILTC  LP+TQ GFF L+ +YFP V+DI
Sbjct  160  FAELLMSSGVVLNDSVYWVTFHAGYDFGYLLKILTCSSLPDTQAGFFKLMKIYFPTVYDI  219

Query  391  KHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSG  212
            KHLM+FCNSLHGGLNKLAELL+VERVG  HQAGSDSL+T+C F KLKD+FF+GS E+Y+G
Sbjct  220  KHLMKFCNSLHGGLNKLAELLDVERVGESHQAGSDSLVTSCAFWKLKDSFFAGSTEKYAG  279

Query  211  VLYGLGVEN  185
            VLYGL  EN
Sbjct  280  VLYGLNAEN  288



>dbj|BAJ92910.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=289

 Score =   293 bits (749),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 157/190 (83%), Gaps = 1/190 (1%)
 Frame = -3

Query  748  SDEKGNLPTCGT-DKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARR  572
            S   G LP  G   + C+WQFNFREFD   D+FA+DSIELLR  GIDF +N E G++ARR
Sbjct  96   SGPTGELPALGAGRRRCVWQFNFREFDDERDIFATDSIELLRHSGIDFRRNAERGVDARR  155

Query  571  FGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDI  392
            F ELLMSSG+VLND+V+WVTFH+GYDFGYLLKILTC  LP+TQ GFF L+ +YFP V+DI
Sbjct  156  FAELLMSSGVVLNDAVYWVTFHAGYDFGYLLKILTCNSLPDTQAGFFKLMKIYFPTVYDI  215

Query  391  KHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSG  212
            KHLM+FCNSLHGGLNKLAELL+VERVG  HQAGSDSL+T C F KLKD+FF+GS E+Y+G
Sbjct  216  KHLMKFCNSLHGGLNKLAELLDVERVGESHQAGSDSLVTPCAFWKLKDSFFAGSTEKYAG  275

Query  211  VLYGLGVENG  182
            VLYGL  ENG
Sbjct  276  VLYGLNAENG  285



>ref|XP_003570299.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Brachypodium 
distachyon]
Length=295

 Score =   290 bits (741),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 157/190 (83%), Gaps = 1/190 (1%)
 Frame = -3

Query  748  SDEKGNLPTCGT-DKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARR  572
            S   G LP  G   + C+WQFNFREFD   D+FA+DSIELLR  GI+F  N E G++ARR
Sbjct  102  SGPTGELPALGAGRRRCVWQFNFREFDDARDIFATDSIELLRHSGINFRLNAERGVDARR  161

Query  571  FGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDI  392
            F ELLMSSG+VLND+V+WVTFH+GYDFGYLLKILTC  LP+TQ GFF L+ +YFP V+DI
Sbjct  162  FAELLMSSGVVLNDAVYWVTFHAGYDFGYLLKILTCNSLPDTQAGFFKLMKIYFPTVYDI  221

Query  391  KHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSG  212
            KHLM+FCNSLHGGLNKLAELL+VERVG  HQAGSDSL+T+C F KLKD+FF+GS E+Y+G
Sbjct  222  KHLMKFCNSLHGGLNKLAELLDVERVGESHQAGSDSLVTSCAFWKLKDSFFAGSTEKYAG  281

Query  211  VLYGLGVENG  182
            VLYGL  ENG
Sbjct  282  VLYGLNAENG  291



>ref|XP_006648046.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Oryza 
brachyantha]
Length=297

 Score =   290 bits (741),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 157/190 (83%), Gaps = 1/190 (1%)
 Frame = -3

Query  748  SDEKGNLPTCGT-DKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARR  572
            S  +G LP  G   + C+WQFNFREFD   D+FASDSIELLR+ GIDF +N E G++ARR
Sbjct  104  SGPRGELPVMGDGRRRCVWQFNFREFDDAHDIFASDSIELLRRSGIDFRRNAERGVDARR  163

Query  571  FGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDI  392
            F ELLMSSG+VLNDSV+WVTFH+GYDFGYLLKILTC  LP+TQ  FF L+ +YFP V+DI
Sbjct  164  FAELLMSSGVVLNDSVYWVTFHAGYDFGYLLKILTCSSLPDTQASFFKLMKIYFPTVYDI  223

Query  391  KHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSG  212
            KHLM+FCNSLHGGLNKLAELL+VERVG  HQAGSDS +T+C F KLKD+FF GS E+Y+G
Sbjct  224  KHLMKFCNSLHGGLNKLAELLDVERVGESHQAGSDSFVTSCAFWKLKDSFFGGSTEKYAG  283

Query  211  VLYGLGVENG  182
            VLYGL  +NG
Sbjct  284  VLYGLNADNG  293



>ref|XP_006368924.1| hypothetical protein POPTR_0001s14860g [Populus trichocarpa]
 gb|ERP65493.1| hypothetical protein POPTR_0001s14860g [Populus trichocarpa]
Length=242

 Score =   287 bits (735),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 154/191 (81%), Gaps = 32/191 (17%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE+GNLPTCGTDKYCIWQFNFREF+ NED                              
Sbjct  82   SDEQGNLPTCGTDKYCIWQFNFREFNVNED------------------------------  111

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
              LLMSSGIVLND+V+WVTFHSGYDFGYLLK+LTCQ LP+TQ GFF LINMYFP ++DIK
Sbjct  112  --LLMSSGIVLNDNVYWVTFHSGYDFGYLLKLLTCQNLPDTQAGFFNLINMYFPTLYDIK  169

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCNSLHGGLNKLAELLEVERVG+CHQAGSDSLLTACTFRKLK+NFFSGSLE+Y+GV
Sbjct  170  HLMKFCNSLHGGLNKLAELLEVERVGICHQAGSDSLLTACTFRKLKENFFSGSLEKYAGV  229

Query  208  LYGLGVENGQN  176
            LYGLGVENGQN
Sbjct  230  LYGLGVENGQN  240



>gb|EPS59819.1| hypothetical protein M569_14984, partial [Genlisea aurea]
Length=275

 Score =   287 bits (734),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 163/193 (84%), Gaps = 2/193 (1%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLPTCGTDK+CIWQFNFREF+P+ED FA+DS++LLRQ GIDF  N++ G+ A RF
Sbjct  82   SDEHGNLPTCGTDKHCIWQFNFREFNPSEDAFAADSVQLLRQSGIDFAANSQKGVSAARF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GEL+M+SG+VLN+ V WVTFHSGYDFGYLLK+LT + +PETQ GF+ LI ++FP V+D+K
Sbjct  142  GELIMTSGVVLNEDVSWVTFHSGYDFGYLLKVLTRRRMPETQAGFYGLIRVFFPVVYDVK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVER-VGVCHQAGSDSLLTACTFRKLKD-NFFSGSLEEYS  215
            HLM+F NSL+GGLNKLAE L +ER VG+ HQAGSDSLLT CTFR L++  +F GSLE+Y+
Sbjct  202  HLMKFSNSLYGGLNKLAEQLGIERVVGISHQAGSDSLLTCCTFRMLREKKYFRGSLEKYA  261

Query  214  GVLYGLGVENGQN  176
            GVLYGL  E+ Q 
Sbjct  262  GVLYGLDDEDAQK  274



>ref|XP_002460215.1| hypothetical protein SORBIDRAFT_02g024730 [Sorghum bicolor]
 gb|EER96736.1| hypothetical protein SORBIDRAFT_02g024730 [Sorghum bicolor]
Length=279

 Score =   287 bits (734),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 133/192 (69%), Positives = 156/192 (81%), Gaps = 1/192 (1%)
 Frame = -3

Query  748  SDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARR  572
            SDE G LP  G D + C+WQFNFR FDP  DV ASDSI+LLR+ GIDF ++   G +ARR
Sbjct  84   SDEHGGLPALGADGRPCVWQFNFRGFDPRTDVAASDSIDLLRRSGIDFSRHAADGADARR  143

Query  571  FGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDI  392
            F ELLMSSG+VLN  VHWVTFHSGYDFGYLLK+LT   LP+T  GFF LI +YFP ++DI
Sbjct  144  FAELLMSSGVVLNSDVHWVTFHSGYDFGYLLKLLTGTNLPDTMSGFFDLIKIYFPVIYDI  203

Query  391  KHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSG  212
            KHLMRFCNSLHGGLNKLAELL+V RVG+CHQAGSDSLLTA +F+KLK+ +F+G  E+Y+G
Sbjct  204  KHLMRFCNSLHGGLNKLAELLDVARVGICHQAGSDSLLTALSFKKLKEAYFNGLTEKYAG  263

Query  211  VLYGLGVENGQN  176
            VLYGLG E G+ 
Sbjct  264  VLYGLGFEGGET  275



>ref|XP_001766532.1| predicted protein [Physcomitrella patens]
 gb|EDQ68597.1| predicted protein [Physcomitrella patens]
Length=272

 Score =   285 bits (730),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 130/188 (69%), Positives = 162/188 (86%), Gaps = 0/188 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE G LP CG+   C+WQFNFREF+  EDV+A DSIELL+Q GIDF++N E GI+++RF
Sbjct  82   SDENGVLPRCGSRDSCVWQFNFREFNLREDVYAHDSIELLKQSGIDFQRNEERGIDSQRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSGIVLN++VHW+TFHSGYDFGYLLK+LTCQ LP ++  FF L+  YFP ++DIK
Sbjct  142  GELLMSSGIVLNENVHWITFHSGYDFGYLLKLLTCQNLPTSEDEFFNLMRTYFPTLYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            +LM+FC++LHGGLN+LAE L+VER+G CHQAGSDSLLT+ TFRKLKD FF+GS E+Y+GV
Sbjct  202  YLMKFCDNLHGGLNRLAETLDVERIGPCHQAGSDSLLTSRTFRKLKDGFFNGSTEKYAGV  261

Query  208  LYGLGVEN  185
            L+GLG +N
Sbjct  262  LFGLGSDN  269



>ref|NP_001136747.1| uncharacterized protein LOC100216888 [Zea mays]
 gb|ACF82526.1| unknown [Zea mays]
 gb|AFW64146.1| hypothetical protein ZEAMMB73_273082 [Zea mays]
Length=287

 Score =   286 bits (732),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 134/188 (71%), Positives = 156/188 (83%), Gaps = 1/188 (1%)
 Frame = -3

Query  748  SDEKGNLPTCGT-DKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARR  572
            S  +G LP  G   + C+WQFNFREFD   D+FASDSIELLR+ GID   N E G++ARR
Sbjct  94   SGPRGELPVLGAGRRRCVWQFNFREFDDARDIFASDSIELLRRSGIDLRLNAERGVDARR  153

Query  571  FGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDI  392
            F ELLMSSG+VLNDSV+WVTFH+GYDFGYLLKILTC  LP+TQ GFF L+ +YFP V+DI
Sbjct  154  FAELLMSSGVVLNDSVYWVTFHAGYDFGYLLKILTCNCLPDTQAGFFKLMKIYFPTVYDI  213

Query  391  KHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSG  212
            KHLM+FCNSLHGGLNKLAELL+VERVG  HQAGSDSL+T+C F KLKD+FF+GS E+Y+G
Sbjct  214  KHLMKFCNSLHGGLNKLAELLDVERVGESHQAGSDSLVTSCAFWKLKDSFFTGSTEKYAG  273

Query  211  VLYGLGVE  188
            VLYGL  E
Sbjct  274  VLYGLNAE  281



>ref|XP_001755261.1| predicted protein [Physcomitrella patens]
 gb|EDQ79741.1| predicted protein [Physcomitrella patens]
Length=272

 Score =   285 bits (729),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 130/188 (69%), Positives = 162/188 (86%), Gaps = 0/188 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE G LP CG+   C+WQFNFREF+  EDV+A DSIELL+Q GIDF++N E GI+++RF
Sbjct  82   SDENGVLPRCGSRDSCVWQFNFREFNLREDVYAHDSIELLKQSGIDFQQNEERGIDSQRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLMSSGIVLN++VHW+TFHSGYDFGYLLK+LTCQ LP ++  FF L+  YFP ++DIK
Sbjct  142  GELLMSSGIVLNENVHWITFHSGYDFGYLLKLLTCQNLPTSEDEFFNLLRTYFPTLYDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            +LM+FC++LHGGLN+LAE L+VER+G CHQAGSDSLLT+ TFRKLKD FF+GS E+Y+GV
Sbjct  202  YLMKFCDNLHGGLNRLAETLDVERIGPCHQAGSDSLLTSRTFRKLKDGFFNGSTEKYAGV  261

Query  208  LYGLGVEN  185
            L+GLG +N
Sbjct  262  LFGLGSDN  269



>dbj|BAK01540.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00477.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=279

 Score =   285 bits (729),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 131/192 (68%), Positives = 157/192 (82%), Gaps = 1/192 (1%)
 Frame = -3

Query  748  SDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARR  572
            SDE+G LP  G D + C+WQFNFR FDP  DV A+DSI+LLR+ GIDF ++   G ++RR
Sbjct  84   SDERGGLPALGPDGRPCVWQFNFRGFDPRTDVAAADSIDLLRRSGIDFARHAAEGADSRR  143

Query  571  FGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDI  392
            F ELLMSSG+VLN  +HWVTFHSGYDFGYLLK+LT   LP+T  GFF LI +YFP ++DI
Sbjct  144  FAELLMSSGVVLNAEIHWVTFHSGYDFGYLLKLLTGSNLPDTSSGFFDLIRIYFPVIYDI  203

Query  391  KHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSG  212
            KHLMRFCNSLHGGLNKLAELL+VERVG+CHQAGSDSLLTA +F KLK+++F G  E+Y+G
Sbjct  204  KHLMRFCNSLHGGLNKLAELLDVERVGICHQAGSDSLLTALSFNKLKESYFGGLTEKYAG  263

Query  211  VLYGLGVENGQN  176
            VLYGLG E G+ 
Sbjct  264  VLYGLGTEGGET  275



>ref|XP_006665053.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Oryza 
brachyantha]
Length=300

 Score =   285 bits (728),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 133/190 (70%), Positives = 157/190 (83%), Gaps = 1/190 (1%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKY-CIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARR  572
            S  +G LP  G D+  C+WQFNF EFD   D+FASDSIELLR+ G+DF +N E G++ARR
Sbjct  107  SGPRGELPALGDDRRRCVWQFNFCEFDDARDIFASDSIELLRRSGLDFRRNAECGVDARR  166

Query  571  FGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDI  392
            F ELLMSSG+VLNDSV+WVTFH+GYDFGYLLKILTC  LP+TQ GFF L+ +YFP  +DI
Sbjct  167  FAELLMSSGVVLNDSVYWVTFHAGYDFGYLLKILTCNSLPDTQVGFFKLMKIYFPTFYDI  226

Query  391  KHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSG  212
            KHL++FCNSLHGGLNKLAELL+VERVG  HQAGSDS +T+C F KLKD+FF GS E+Y+G
Sbjct  227  KHLIKFCNSLHGGLNKLAELLDVERVGESHQAGSDSFVTSCAFWKLKDSFFGGSTEKYAG  286

Query  211  VLYGLGVENG  182
            VLYGL  ENG
Sbjct  287  VLYGLNAENG  296



>ref|XP_002965900.1| hypothetical protein SELMODRAFT_84624 [Selaginella moellendorffii]
 ref|XP_002983145.1| hypothetical protein SELMODRAFT_117491 [Selaginella moellendorffii]
 gb|EFJ15954.1| hypothetical protein SELMODRAFT_117491 [Selaginella moellendorffii]
 gb|EFJ33320.1| hypothetical protein SELMODRAFT_84624 [Selaginella moellendorffii]
Length=274

 Score =   281 bits (719),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 129/189 (68%), Positives = 160/189 (85%), Gaps = 1/189 (1%)
 Frame = -3

Query  748  SDEKGNLPTCG-TDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARR  572
            SDE GNLPT G T +  +WQFNFREF+  EDV+A DSIELL+Q GIDF+KN E GI+A R
Sbjct  78   SDEDGNLPTFGSTRESYLWQFNFREFNIKEDVYAHDSIELLKQSGIDFQKNQEHGIDAER  137

Query  571  FGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDI  392
            FGELLMSSG++LN+SVHW+TFHSGYDFGYLLK+LTCQ LP ++  FF L+ +YFP ++D+
Sbjct  138  FGELLMSSGVILNESVHWITFHSGYDFGYLLKLLTCQNLPPSEADFFVLLRIYFPTIYDV  197

Query  391  KHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSG  212
            K+LM+FC++LHGGLN+LAE+LEVERVG CHQAGSDSLLT+C F+KLK     GS E+Y+G
Sbjct  198  KYLMKFCDNLHGGLNRLAEVLEVERVGPCHQAGSDSLLTSCAFQKLKKGALKGSTEKYAG  257

Query  211  VLYGLGVEN  185
            VL+GLG +N
Sbjct  258  VLFGLGADN  266



>ref|XP_006660627.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Oryza 
brachyantha]
Length=280

 Score =   281 bits (719),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 132/192 (69%), Positives = 158/192 (82%), Gaps = 1/192 (1%)
 Frame = -3

Query  748  SDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARR  572
            SDE+G LP  G + + C+WQFNFR FDP  DV ASDSIELLR+ GIDF +++  G +A R
Sbjct  84   SDERGGLPALGPEGRPCVWQFNFRGFDPRNDVAASDSIELLRRSGIDFARHSADGADACR  143

Query  571  FGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDI  392
            F ELLMSSG+VLN  V WVTFHSGYDFGYLLK++T   LP+T  GFF LI +YFP V+DI
Sbjct  144  FAELLMSSGVVLNSEVRWVTFHSGYDFGYLLKLITGTNLPDTISGFFDLIRIYFPVVYDI  203

Query  391  KHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSG  212
            KHLMRFCNSLHGGLNKLAELL+VERVG+CHQAGSDSLLTA +F+KLK+++F+G  E+Y+G
Sbjct  204  KHLMRFCNSLHGGLNKLAELLDVERVGICHQAGSDSLLTALSFKKLKESYFNGLTEKYAG  263

Query  211  VLYGLGVENGQN  176
            VLYGLG E G+ 
Sbjct  264  VLYGLGTEGGET  275



>gb|KCW80614.1| hypothetical protein EUGRSUZ_C01981 [Eucalyptus grandis]
Length=218

 Score =   278 bits (711),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 128/188 (68%), Positives = 156/188 (83%), Gaps = 0/188 (0%)
 Frame = -3

Query  745  DEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRFG  566
            D++GNLPTCGTDKYCIWQFNFR FD  +D F   SIE L + GIDF+KN E G++A RFG
Sbjct  27   DDEGNLPTCGTDKYCIWQFNFRGFDVTKDEFDGGSIEWLHERGIDFKKNNEKGVDAERFG  86

Query  565  ELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIKH  386
            ELLMSSGI LND V+WVTFH  Y+FG+LLK+LTC+ LP+T  GF+ LI MYFP V+D+KH
Sbjct  87   ELLMSSGIALNDGVNWVTFHGKYNFGFLLKLLTCRSLPDTLAGFYDLIKMYFPLVYDVKH  146

Query  385  LMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGVL  206
            +M+FC+ LH  LNKLAELL+VER+GVCHQAGSDSLL AC F+KLKD FF+GS  +Y+G L
Sbjct  147  MMKFCDGLHCNLNKLAELLDVERLGVCHQAGSDSLLVACAFQKLKDCFFNGSAVKYAGAL  206

Query  205  YGLGVENG  182
            YGLG+++G
Sbjct  207  YGLGIQDG  214



>ref|NP_001063181.1| Os09g0416800 [Oryza sativa Japonica Group]
 dbj|BAD28924.1| putative CCR4-NOT transcription complex subunit 7 [Oryza sativa 
Japonica Group]
 dbj|BAD29264.1| putative CCR4-NOT transcription complex subunit 7 [Oryza sativa 
Japonica Group]
 dbj|BAF25095.1| Os09g0416800 [Oryza sativa Japonica Group]
 gb|EAZ09108.1| hypothetical protein OsI_31373 [Oryza sativa Indica Group]
 gb|EAZ44741.1| hypothetical protein OsJ_29372 [Oryza sativa Japonica Group]
 dbj|BAG89495.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94386.1| unnamed protein product [Oryza sativa Japonica Group]
Length=280

 Score =   279 bits (714),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 130/192 (68%), Positives = 158/192 (82%), Gaps = 1/192 (1%)
 Frame = -3

Query  748  SDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARR  572
            S+E G LP+ G + + C+WQFNFR FDP  DV A+DSI+LLR+ GIDF +++  G +ARR
Sbjct  84   SNEHGGLPSLGPEGRPCVWQFNFRGFDPRTDVAAADSIDLLRRSGIDFTRHSADGADARR  143

Query  571  FGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDI  392
            F ELLMSSG+V+N  V WVTFHSGYDFGYLLK+LT   LP+T  GFF LI +YFP V+DI
Sbjct  144  FAELLMSSGVVMNSEVRWVTFHSGYDFGYLLKLLTGTYLPDTITGFFDLIRIYFPVVYDI  203

Query  391  KHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSG  212
            KHLMRFCNSLHGGLNKLAELL+VERVG+CHQAGSDSLLTA +F+KLK+ +F+G  E+Y+G
Sbjct  204  KHLMRFCNSLHGGLNKLAELLDVERVGICHQAGSDSLLTALSFKKLKEAYFNGLTEKYAG  263

Query  211  VLYGLGVENGQN  176
            VLYGLG E G+ 
Sbjct  264  VLYGLGTEGGET  275



>ref|XP_010048148.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Eucalyptus 
grandis]
 gb|KCW80311.1| hypothetical protein EUGRSUZ_C01670 [Eucalyptus grandis]
Length=281

 Score =   279 bits (713),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 129/188 (69%), Positives = 156/188 (83%), Gaps = 0/188 (0%)
 Frame = -3

Query  745  DEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRFG  566
            D++GNLPTCGTDKYCIWQFNFR FD  +D F   SIE L + GIDF+KN E G+EA RFG
Sbjct  90   DDEGNLPTCGTDKYCIWQFNFRGFDVTKDEFDGGSIEWLHERGIDFKKNNEKGVEAERFG  149

Query  565  ELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIKH  386
            ELLMSSGI LND V+WVTFH  Y+FG+LLK+LTC+ LP+T  GF+ LI MYFP V+D+KH
Sbjct  150  ELLMSSGIALNDGVNWVTFHGKYNFGFLLKLLTCRSLPDTLVGFYDLIKMYFPLVYDVKH  209

Query  385  LMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGVL  206
            +M+FC+ LH  LNKLAELL+VER+GVCHQAGSDSLL AC F+KLKD FF+GS  +Y+G L
Sbjct  210  MMKFCDGLHCNLNKLAELLDVERLGVCHQAGSDSLLVACAFQKLKDCFFNGSAVKYAGAL  269

Query  205  YGLGVENG  182
            YGLG+++G
Sbjct  270  YGLGIQDG  277



>ref|NP_001132298.1| CCR4-NOT transcription complex subunit 7 isoform 1 [Zea mays]
 gb|ACF81091.1| unknown [Zea mays]
 gb|ACG42346.1| CCR4-NOT transcription complex subunit 7 [Zea mays]
 tpg|DAA61464.1| TPA: CCR4-NOT transcription complex subunit 7 isoform 1 [Zea 
mays]
 tpg|DAA61465.1| TPA: CCR4-NOT transcription complex subunit 7 isoform 2 [Zea 
mays]
Length=279

 Score =   274 bits (701),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 128/188 (68%), Positives = 153/188 (81%), Gaps = 1/188 (1%)
 Frame = -3

Query  748  SDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARR  572
            SDE G LP  G D + C+WQFNFR FDP  DV A+DSI+LLR+ GIDF ++   G+++R 
Sbjct  84   SDEHGGLPALGPDGRPCVWQFNFRGFDPRTDVAAADSIDLLRRSGIDFSRHAADGVDSRC  143

Query  571  FGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDI  392
            F ELLMSSG+VLN  VHWVTFHSGYDFGYLLK+LT   LP+T  GFF LI +YFP ++DI
Sbjct  144  FAELLMSSGVVLNSDVHWVTFHSGYDFGYLLKLLTGTNLPDTLPGFFDLIKIYFPVIYDI  203

Query  391  KHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSG  212
            KHLMRF NSLHGGLNKLAELL+V RVG+CHQAGSDSLLTA +F+KLK+ +F+G  E+Y+G
Sbjct  204  KHLMRFSNSLHGGLNKLAELLDVARVGICHQAGSDSLLTALSFKKLKEAYFNGLTEKYAG  263

Query  211  VLYGLGVE  188
            VLYGLG E
Sbjct  264  VLYGLGFE  271



>ref|XP_003578122.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Brachypodium 
distachyon]
Length=279

 Score =   271 bits (694),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 122/178 (69%), Positives = 148/178 (83%), Gaps = 0/178 (0%)
 Frame = -3

Query  709  KYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRFGELLMSSGIVLND  530
            + C+WQFNFR FDP  DV A+DSI+LLR+ GIDF ++   G ++RRF ELLMSSG+V+N 
Sbjct  98   RPCVWQFNFRGFDPRTDVAAADSIDLLRRSGIDFARHAADGADSRRFAELLMSSGVVMNA  157

Query  529  SVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGL  350
             +HWVTFHSGYDFGYLLK+LT   LP+T  GFF LI +YFP ++DIKHLMRFCNSLHGGL
Sbjct  158  EIHWVTFHSGYDFGYLLKLLTGTNLPDTNSGFFDLIRIYFPVIYDIKHLMRFCNSLHGGL  217

Query  349  NKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            NKLAELL+VERVG+CHQAGSDSLLTA +F KLK+++F G  E+Y+GVLYGLG E G+ 
Sbjct  218  NKLAELLDVERVGICHQAGSDSLLTALSFNKLKESYFGGLTEKYAGVLYGLGTEGGET  275



>gb|KCW62735.1| hypothetical protein EUGRSUZ_G00324 [Eucalyptus grandis]
Length=213

 Score =   268 bits (686),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 132/187 (71%), Positives = 153/187 (82%), Gaps = 19/187 (10%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE+ NLPTCG+DK CI QFNFR+                   GI+F+KN + GI A RF
Sbjct  44   SDERRNLPTCGSDKCCINQFNFRD-------------------GINFKKNRDRGINAVRF  84

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLM SGIVLND+VHWVTFHSGYD GYLLK+LTCQ LP+TQ GFF LI+MYFP ++DIK
Sbjct  85   GELLMLSGIVLNDNVHWVTFHSGYDLGYLLKVLTCQTLPDTQAGFFKLIHMYFPTLYDIK  144

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FC+SLHGGLNK+AELL+VERVGVCHQAGSDSLLT+ TF+KLK++FFSGSLE+YSGV
Sbjct  145  HLMKFCDSLHGGLNKVAELLKVERVGVCHQAGSDSLLTSSTFKKLKESFFSGSLEKYSGV  204

Query  208  LYGLGVE  188
            LYGL VE
Sbjct  205  LYGLCVE  211



>ref|XP_004956826.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like [Setaria 
italica]
Length=279

 Score =   269 bits (687),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 122/178 (69%), Positives = 147/178 (83%), Gaps = 0/178 (0%)
 Frame = -3

Query  709  KYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRFGELLMSSGIVLND  530
            + C+WQFNFR FDP  DV A+DSI+LLR+ GIDF ++   G +ARRF ELLMSSG+V+N 
Sbjct  98   RPCVWQFNFRGFDPRTDVAAADSIDLLRRSGIDFARHGADGADARRFAELLMSSGVVMNS  157

Query  529  SVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIKHLMRFCNSLHGGL  350
             V WVTFHSGYDFGYLLK+LT   LP+T  GFF LI +YFP ++DIKHLMRFCNSLHGGL
Sbjct  158  DVRWVTFHSGYDFGYLLKLLTGTNLPDTMSGFFDLIKIYFPVIYDIKHLMRFCNSLHGGL  217

Query  349  NKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGVLYGLGVENGQN  176
            NKLAELL+V RVG+CHQAGSDSLLTA +F+KLK+ +F+G  E+Y+GVLYGLG E G+ 
Sbjct  218  NKLAELLDVARVGICHQAGSDSLLTALSFKKLKEAYFNGLTEKYAGVLYGLGFEGGET  275



>ref|XP_006416864.1| hypothetical protein EUTSA_v10008404mg [Eutrema salsugineum]
 gb|ESQ35217.1| hypothetical protein EUTSA_v10008404mg [Eutrema salsugineum]
Length=284

 Score =   268 bits (684),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 151/186 (81%), Gaps = 1/186 (1%)
 Frame = -3

Query  748  SDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARR  572
            SDE+GNLPTCGT+ K C+WQFNFREF+   DVFA DSIELLRQ GIDF KN   GIE+RR
Sbjct  84   SDEQGNLPTCGTNNKQCVWQFNFREFNLKTDVFAMDSIELLRQSGIDFAKNNHLGIESRR  143

Query  571  FGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDI  392
            F  LLM SG+VLND V WVTFH GYDFGYLLK+LT ++LPE Q  FF L+  +FP V+DI
Sbjct  144  FAALLMCSGVVLNDKVQWVTFHCGYDFGYLLKLLTGKDLPEDQSDFFLLVKTFFPTVYDI  203

Query  391  KHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSG  212
            K+LM FCN L GGL+K+AELL V+RVG+ HQAGSDSLLT+  FRK+K+  F+GS+ +YSG
Sbjct  204  KYLMDFCNGLWGGLSKVAELLLVKRVGISHQAGSDSLLTSRVFRKMKEKHFTGSMAKYSG  263

Query  211  VLYGLG  194
            VLYGLG
Sbjct  264  VLYGLG  269



>ref|XP_009395282.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Musa 
acuminata subsp. malaccensis]
Length=269

 Score =   264 bits (675),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 149/188 (79%), Gaps = 1/188 (1%)
 Frame = -3

Query  748  SDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARR  572
            SD +GNLP   T  +  +WQFNFREFD + D+   DSI+LLR+  IDF++N E G++A R
Sbjct  82   SDAEGNLPASATGGRPIVWQFNFREFDVDRDISNPDSIDLLRKSDIDFKRNREHGVDANR  141

Query  571  FGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDI  392
            F ELLM+SG+VLNDSV WVTFH  YDFGYLLKILTC+ LPET++GF  LI  +FP ++DI
Sbjct  142  FAELLMASGVVLNDSVRWVTFHCAYDFGYLLKILTCRRLPETREGFSELIRTFFPVMYDI  201

Query  391  KHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSG  212
            KHLMRF NSLHGGLNKLAE LEV+RVG CHQAGSDSLLTA  FRKL +  F GS++ Y+G
Sbjct  202  KHLMRFSNSLHGGLNKLAEQLEVDRVGTCHQAGSDSLLTARAFRKLMEKHFDGSIDRYAG  261

Query  211  VLYGLGVE  188
            V+YGL +E
Sbjct  262  VMYGLDIE  269



>ref|XP_009396102.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Musa 
acuminata subsp. malaccensis]
Length=269

 Score =   264 bits (674),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 122/188 (65%), Positives = 148/188 (79%), Gaps = 1/188 (1%)
 Frame = -3

Query  748  SDEKGNLPTC-GTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARR  572
            SD  GN P    + +  +WQFNFREFD + D+   DSI+LL++ GIDF +N E G++A  
Sbjct  82   SDADGNFPASPDSARPIVWQFNFREFDVDGDISNPDSIDLLQKSGIDFARNREHGVDANH  141

Query  571  FGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDI  392
            F ELLMSSG+VLNDSV WVTFH  YDFGYLLKILTC+ LP+ ++GFF L   +FP V+DI
Sbjct  142  FAELLMSSGVVLNDSVRWVTFHCAYDFGYLLKILTCRRLPDNREGFFELARTFFPVVYDI  201

Query  391  KHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSG  212
            KHLMRF NSLHGGLNK+AE LEV+RVG+CHQAGSDSLLTA TFRKL D +F GS+E Y+G
Sbjct  202  KHLMRFSNSLHGGLNKVAEQLEVDRVGICHQAGSDSLLTAQTFRKLTDKYFDGSIERYAG  261

Query  211  VLYGLGVE  188
            V+YGL +E
Sbjct  262  VMYGLDIE  269



>ref|XP_009418496.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Musa 
acuminata subsp. malaccensis]
Length=276

 Score =   263 bits (671),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 124/193 (64%), Positives = 151/193 (78%), Gaps = 2/193 (1%)
 Frame = -3

Query  748  SDEKGNLPTCGTD--KYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEAR  575
            SD  GNLPT         +WQFNFREFD + DV   DSI+LL + GID  +N E G++A 
Sbjct  82   SDADGNLPTSSAAGGHPVVWQFNFREFDVDRDVSNPDSIDLLIRSGIDLVRNREFGVDAI  141

Query  574  RFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFD  395
            RF ELLMSSG+VLNDSV WVTFH  YDFGYLLK+LTC+ LP+T++GFF L+  +FP V+D
Sbjct  142  RFAELLMSSGVVLNDSVSWVTFHCAYDFGYLLKLLTCRRLPDTREGFFELVRTFFPVVYD  201

Query  394  IKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYS  215
            IKHL++F NSLHGGLNK+AE LEVERVG+CHQAGSDSLLTA  FRKL  ++F GS+E Y+
Sbjct  202  IKHLLKFSNSLHGGLNKVAEQLEVERVGICHQAGSDSLLTARAFRKLMGSYFDGSIERYA  261

Query  214  GVLYGLGVENGQN  176
            GV+YGL +E+G N
Sbjct  262  GVMYGLDIEHGIN  274



>ref|XP_009395283.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Musa 
acuminata subsp. malaccensis]
Length=269

 Score =   262 bits (669),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 121/188 (64%), Positives = 148/188 (79%), Gaps = 1/188 (1%)
 Frame = -3

Query  748  SDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARR  572
            SD +GNLP   T  +  +WQFNFREFD + D+   DSI+LLR+  IDF++N E G++A R
Sbjct  82   SDAEGNLPATATGGRPIVWQFNFREFDVDRDISNPDSIDLLRKSDIDFKRNREHGVDANR  141

Query  571  FGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDI  392
            F EL M+SG+VLNDSV WVTFH  YDFGYLLKILTC+ LPET++GF  LI  +FP ++DI
Sbjct  142  FAELFMASGVVLNDSVRWVTFHCAYDFGYLLKILTCRRLPETREGFSELIRTFFPVMYDI  201

Query  391  KHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSG  212
            KHLMRF NSLHGGLNK+AE LEV+RVG CHQAGSDSLLTA  FRKL +  F GS++ Y+G
Sbjct  202  KHLMRFSNSLHGGLNKVAEQLEVDRVGTCHQAGSDSLLTARAFRKLMEKHFDGSIDRYAG  261

Query  211  VLYGLGVE  188
            V+YGL +E
Sbjct  262  VMYGLDIE  269



>ref|XP_002981023.1| hypothetical protein SELMODRAFT_444748 [Selaginella moellendorffii]
 gb|EFJ17724.1| hypothetical protein SELMODRAFT_444748 [Selaginella moellendorffii]
Length=285

 Score =   260 bits (664),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 119/187 (64%), Positives = 150/187 (80%), Gaps = 0/187 (0%)
 Frame = -3

Query  745  DEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRFG  566
            D  GNLP C T +YC+WQFNFREF+  EDV A DSI+LL   GIDF KN E G+++R FG
Sbjct  83   DADGNLPRCNTGEYCVWQFNFREFNIREDVCAQDSIDLLCHSGIDFAKNEEQGVDSRLFG  142

Query  565  ELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIKH  386
            ELLMSSG+VLND + W+TFHSGYDFGYLLK+LTCQ LP  +  FF L+ +YFP  FDIK+
Sbjct  143  ELLMSSGVVLNDDIQWITFHSGYDFGYLLKLLTCQPLPACEADFFNLMRLYFPVFFDIKY  202

Query  385  LMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGVL  206
            +M+F +SLHGGLN+LAEL++V R+G CHQAGSDSLLT+  +R+LKD +F  S+ +++GVL
Sbjct  203  MMKFHDSLHGGLNRLAELVDVARIGPCHQAGSDSLLTSEVYRRLKDRYFLESMAKFTGVL  262

Query  205  YGLGVEN  185
            YGLG +N
Sbjct  263  YGLGSDN  269



>ref|XP_002982500.1| hypothetical protein SELMODRAFT_179583 [Selaginella moellendorffii]
 gb|EFJ16253.1| hypothetical protein SELMODRAFT_179583 [Selaginella moellendorffii]
Length=287

 Score =   260 bits (664),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 119/187 (64%), Positives = 150/187 (80%), Gaps = 0/187 (0%)
 Frame = -3

Query  745  DEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRFG  566
            D  GNLP C T +YC+WQFNFREF+  EDV A DSI+LL   GIDF KN E G+++R FG
Sbjct  83   DADGNLPRCNTGEYCVWQFNFREFNIREDVCAQDSIDLLCHSGIDFAKNEEQGVDSRLFG  142

Query  565  ELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIKH  386
            ELLMSSG+VLND + W+TFHSGYDFGYLLK+LTCQ LP  +  FF L+ +YFP  FDIK+
Sbjct  143  ELLMSSGVVLNDDIQWITFHSGYDFGYLLKLLTCQPLPACEADFFNLMRLYFPVFFDIKY  202

Query  385  LMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGVL  206
            +M+F +SLHGGLN+LAEL++V R+G CHQAGSDSLLT+  +R+LKD +F  S+ +++GVL
Sbjct  203  MMKFHDSLHGGLNRLAELVDVARIGPCHQAGSDSLLTSEVYRRLKDRYFLESMAKFTGVL  262

Query  205  YGLGVEN  185
            YGLG +N
Sbjct  263  YGLGSDN  269



>gb|KFK43832.1| hypothetical protein AALP_AA1G179300 [Arabis alpina]
Length=272

 Score =   259 bits (661),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 151/186 (81%), Gaps = 1/186 (1%)
 Frame = -3

Query  748  SDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARR  572
            SD++GNLPTCGT+ K C+WQFNFREF+   D+FA DSIELLRQ G+DF KN + GIEA+R
Sbjct  82   SDDQGNLPTCGTNNKQCVWQFNFREFNLKTDMFAIDSIELLRQSGMDFAKNRQFGIEAKR  141

Query  571  FGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDI  392
            F +LLM SG+VLND + W+TFH GYD GYLLK+LT + LPE Q  FF+ +  +FP ++DI
Sbjct  142  FAQLLMGSGVVLNDKIQWITFHCGYDLGYLLKLLTGKNLPEKQSEFFSRVQTFFPVLYDI  201

Query  391  KHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSG  212
            KHLM FC++++GGL+K A+LLEV+RVG+ HQAGSDSLLT   FRK+K+  F+G +++YSG
Sbjct  202  KHLMDFCSAVYGGLSKAADLLEVKRVGISHQAGSDSLLTLRVFRKMKETMFTGPMDKYSG  261

Query  211  VLYGLG  194
            VLYGL 
Sbjct  262  VLYGLA  267



>ref|XP_002890137.1| hypothetical protein ARALYDRAFT_312582 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66396.1| hypothetical protein ARALYDRAFT_312582 [Arabidopsis lyrata subsp. 
lyrata]
Length=284

 Score =   258 bits (660),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 120/184 (65%), Positives = 149/184 (81%), Gaps = 0/184 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDEKGNLPTCGT+K CIWQFNFREF+   D+FA DSI+LLR+  ID EKNTE G+++RRF
Sbjct  90   SDEKGNLPTCGTNKQCIWQFNFREFNLKSDMFAMDSIQLLRESYIDLEKNTECGVDSRRF  149

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
             ELLMSSG+VLND + WVTFH GYDFGYLLK+L+ +ELP     FF  +  +FP V+D+K
Sbjct  150  AELLMSSGVVLNDKIQWVTFHCGYDFGYLLKLLSGKELPAEASKFFDQVERFFPVVYDMK  209

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            +LM FC  L+GGL ++A+LL V+RVG+CHQAGSDSLLT   F K+K+ FF+GSL++YSG 
Sbjct  210  YLMGFCAPLYGGLGRVAKLLGVKRVGICHQAGSDSLLTLRAFNKMKEIFFTGSLDKYSGF  269

Query  208  LYGL  197
            LYGL
Sbjct  270  LYGL  273



>ref|NP_173044.1| polynucleotidyl transferase, ribonuclease H-like superfamily 
protein [Arabidopsis thaliana]
 ref|NP_973838.1| polynucleotidyl transferase, ribonuclease H-like superfamily 
protein [Arabidopsis thaliana]
 sp|Q9S9P2.1|CAF1B_ARATH RecName: Full=Probable CCR4-associated factor 1 homolog 2 [Arabidopsis 
thaliana]
 gb|AAF18489.1|AC010924_2 Similar to gi|Q60809 CCR4-associated factor 1 (CAF1) from Mus 
musculus. EST gb|Z26822 comes from this gene [Arabidopsis thaliana]
 gb|AAL86000.1| putative BTG1 binding factor 1 [Arabidopsis thaliana]
 gb|AAM45088.1| putative BTG1 binding factor 1 [Arabidopsis thaliana]
 dbj|BAH19897.1| AT1G15920 [Arabidopsis thaliana]
 gb|AEE29383.1| polynucleotidyl transferase, ribonuclease H-like superfamily 
protein [Arabidopsis thaliana]
 gb|AEE29384.1| polynucleotidyl transferase, ribonuclease H-like superfamily 
protein [Arabidopsis thaliana]
Length=286

 Score =   258 bits (658),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/184 (67%), Positives = 149/184 (81%), Gaps = 0/184 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDEKGNLPTCGT+K CIWQFNFREF+   D+FA DSIELLR+  ID EKN E G++A+RF
Sbjct  92   SDEKGNLPTCGTNKQCIWQFNFREFNVISDMFALDSIELLRKSAIDLEKNNECGVDAKRF  151

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
             ELLM SG+VLND +HWVTFH GYDFGYLLK+L+ +ELPE    FF  +  +FP V+DIK
Sbjct  152  AELLMGSGVVLNDKIHWVTFHCGYDFGYLLKLLSGKELPEEISDFFDQMEKFFPVVYDIK  211

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            +LM FC +L+GGL K+AELL V+RVG+ HQAGSDSLLT  TF K+K+ FF+GSL +YSG 
Sbjct  212  YLMGFCTNLYGGLEKIAELLGVKRVGISHQAGSDSLLTLRTFIKMKEFFFTGSLLKYSGF  271

Query  208  LYGL  197
            L+GL
Sbjct  272  LFGL  275



>ref|XP_009385031.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Musa 
acuminata subsp. malaccensis]
Length=274

 Score =   257 bits (656),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 117/192 (61%), Positives = 152/192 (79%), Gaps = 1/192 (1%)
 Frame = -3

Query  748  SDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARR  572
            SD  GNLPT  +  +  +WQFNFREFD + DVF  DSI+LLR+ GIDF+KN E G++ARR
Sbjct  81   SDAAGNLPTSPSSGRPVVWQFNFREFDVDSDVFVPDSIDLLRKSGIDFKKNREDGVDARR  140

Query  571  FGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDI  392
            F EL MSSG+VLNDS+HWV FH  YDFGYL+KILTC++LPET++ F  L++++FP V+DI
Sbjct  141  FAELFMSSGVVLNDSIHWVAFHGAYDFGYLIKILTCRKLPETRKEFLDLLHVFFPVVYDI  200

Query  391  KHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSG  212
            K ++   N+L+GGLNK+AE LEVERVG CHQAGSDSLLTA  F K++ + F GS+E+Y G
Sbjct  201  KRVIHLNNNLYGGLNKVAEKLEVERVGTCHQAGSDSLLTARAFMKMRGHRFVGSMEKYVG  260

Query  211  VLYGLGVENGQN  176
            +L+GL +E+  N
Sbjct  261  LLFGLDIESAHN  272



>ref|XP_010932239.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Elaeis 
guineensis]
Length=270

 Score =   256 bits (655),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 145/186 (78%), Gaps = 2/186 (1%)
 Frame = -3

Query  748  SDEKGNLPTC--GTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEAR  575
            SD  G LP    G    C+WQFNFREFDP+ DV   DSI+LLR+ GIDF KN E GI+A 
Sbjct  83   SDASGCLPPSPSGGGLRCVWQFNFREFDPDRDVSNPDSIDLLRRSGIDFVKNREQGIDAL  142

Query  574  RFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFD  395
            RF ELLMSSG+VLNDSV W+ FH  YDF YLLKILTC+ LPE+ + FF L+  +FP V+D
Sbjct  143  RFAELLMSSGVVLNDSVQWIAFHGAYDFAYLLKILTCRRLPESLEEFFELVGAFFPIVYD  202

Query  394  IKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYS  215
            IKHLMRFCN+L+GGLNK+AE ++ ER+GVCHQAGSDSLLTA  F +LK+N+F GS+E Y+
Sbjct  203  IKHLMRFCNNLYGGLNKVAEQVDAERIGVCHQAGSDSLLTARVFWRLKENYFDGSIERYA  262

Query  214  GVLYGL  197
            G LYGL
Sbjct  263  GCLYGL  268



>ref|XP_003574542.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Brachypodium 
distachyon]
Length=294

 Score =   257 bits (657),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 123/189 (65%), Positives = 144/189 (76%), Gaps = 1/189 (1%)
 Frame = -3

Query  745  DEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            DE G LP  GT  + C WQFNFR FDP  D   +DSI+LLR+ GIDF++    G++  RF
Sbjct  96   DESGALPPRGTGGRPCAWQFNFRGFDPRSDPANADSIDLLRKSGIDFDRFLAEGVDTARF  155

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
             ELLMSSG+VLND + WVTFHSGYDFGYLLK LT Q +P+T  GFF LI +YFP V+DIK
Sbjct  156  AELLMSSGVVLNDDLQWVTFHSGYDFGYLLKALTAQNMPDTMSGFFDLIRVYFPVVYDIK  215

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLMRFC SLHGGL++L ELL VERVG CHQAGSDSLLT   F KLKD +F GS+E Y+GV
Sbjct  216  HLMRFCGSLHGGLSRLGELLAVERVGTCHQAGSDSLLTLQCFNKLKDAYFRGSVENYAGV  275

Query  208  LYGLGVENG  182
            LYGL  ++G
Sbjct  276  LYGLVSDSG  284



>ref|XP_008796886.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Phoenix 
dactylifera]
Length=270

 Score =   254 bits (649),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 144/186 (77%), Gaps = 2/186 (1%)
 Frame = -3

Query  748  SDEKGNLP--TCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEAR  575
            SD  G LP    G  + C+WQFNFREFD + DV   DSI+LLR+ GIDF+KN E G++A 
Sbjct  83   SDAAGRLPLSPSGGGRRCVWQFNFREFDVDHDVANPDSIDLLRRSGIDFKKNRECGVDAL  142

Query  574  RFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFD  395
            RF ELLMSSG+VLNDSV W+ FH  YDF YLLKILTC+ LPET + F  L++ +FP V+D
Sbjct  143  RFAELLMSSGVVLNDSVQWIAFHGAYDFAYLLKILTCRRLPETSEAFSDLVSTFFPTVYD  202

Query  394  IKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYS  215
            IKHLMRFCN+L+GGLNK+AE L+ ER+G CHQAGSDSLLT   F +LK+ +F GS+E Y+
Sbjct  203  IKHLMRFCNNLYGGLNKVAEQLDAERIGFCHQAGSDSLLTVRVFWRLKEKYFDGSIESYA  262

Query  214  GVLYGL  197
            G+LYGL
Sbjct  263  GLLYGL  268



>gb|ABY89387.1| chromatin assembly factor 1, partial [Pinus taeda]
 gb|ABY89388.1| chromatin assembly factor 1, partial [Pinus taeda]
 gb|ABY89389.1| chromatin assembly factor 1, partial [Pinus taeda]
 gb|ABY89390.1| chromatin assembly factor 1, partial [Pinus taeda]
 gb|ABY89391.1| chromatin assembly factor 1, partial [Pinus taeda]
 gb|ABY89392.1| chromatin assembly factor 1, partial [Pinus taeda]
 gb|ABY89393.1| chromatin assembly factor 1, partial [Pinus taeda]
 gb|ABY89394.1| chromatin assembly factor 1, partial [Pinus taeda]
 gb|ABY89395.1| chromatin assembly factor 1, partial [Pinus taeda]
 gb|ABY89396.1| chromatin assembly factor 1, partial [Pinus taeda]
 gb|ABY89397.1| chromatin assembly factor 1, partial [Pinus taeda]
 gb|ABY89398.1| chromatin assembly factor 1, partial [Pinus taeda]
 gb|ABY89399.1| chromatin assembly factor 1, partial [Pinus taeda]
 gb|ABY89400.1| chromatin assembly factor 1, partial [Pinus taeda]
 gb|ABY89401.1| chromatin assembly factor 1, partial [Pinus taeda]
 gb|ABY89402.1| chromatin assembly factor 1, partial [Pinus taeda]
 gb|ABY89403.1| chromatin assembly factor 1, partial [Pinus taeda]
 gb|ABY89404.1| chromatin assembly factor 1, partial [Pinus taeda]
 gb|ABY89405.1| chromatin assembly factor 1, partial [Pinus taeda]
 gb|ABY89406.1| chromatin assembly factor 1, partial [Pinus taeda]
 gb|ABY89407.1| chromatin assembly factor 1, partial [Pinus taeda]
 gb|ABY89408.1| chromatin assembly factor 1, partial [Pinus taeda]
 gb|ABY89409.1| chromatin assembly factor 1, partial [Pinus taeda]
 gb|ABY89410.1| chromatin assembly factor 1, partial [Pinus taeda]
 gb|ABY89411.1| chromatin assembly factor 1, partial [Pinus taeda]
 gb|ABY89412.1| chromatin assembly factor 1, partial [Pinus taeda]
 gb|ABY89413.1| chromatin assembly factor 1, partial [Pinus taeda]
 gb|ABY89414.1| chromatin assembly factor 1, partial [Pinus taeda]
 gb|ABY89415.1| chromatin assembly factor 1, partial [Pinus taeda]
 gb|ABY89416.1| chromatin assembly factor 1, partial [Pinus taeda]
Length=193

 Score =   250 bits (639),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 134/155 (86%), Gaps = 0/155 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLP CGTD+YC+WQFNFREF+  ED +ASDSIELLRQ GIDF+KN+E G+++  F
Sbjct  39   SDEDGNLPNCGTDRYCVWQFNFREFNIWEDAYASDSIELLRQSGIDFKKNSERGVDSHLF  98

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
             ELLMSSGIVLN++V W+TFHSGYDFGYLLK++  + LP TQ GFF LI MYFP ++DIK
Sbjct  99   AELLMSSGIVLNENVRWITFHSGYDFGYLLKLVMNRSLPPTQGGFFYLIRMYFPNLYDIK  158

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDS  284
            HLM+FCN+LHGGLN+LAE+LEVER G CHQAGSDS
Sbjct  159  HLMKFCNNLHGGLNRLAEMLEVERFGACHQAGSDS  193



>ref|XP_006304066.1| hypothetical protein CARUB_v10009915mg [Capsella rubella]
 gb|EOA36964.1| hypothetical protein CARUB_v10009915mg [Capsella rubella]
Length=289

 Score =   253 bits (646),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/185 (65%), Positives = 146/185 (79%), Gaps = 1/185 (1%)
 Frame = -3

Query  748  SDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARR  572
            SDE+GNLPTCGT+ K CIWQFNFREF+   D+FA DSI+LLR   IDFEKN E G+++ R
Sbjct  90   SDERGNLPTCGTNNKQCIWQFNFREFNLKSDMFAMDSIQLLRDSNIDFEKNNECGVDSAR  149

Query  571  FGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDI  392
            F ELLM SG+VLND + WVTFH GYDFGYLLK+L+ ++LPE +  FF  +  YFP V+DI
Sbjct  150  FAELLMGSGVVLNDKIQWVTFHCGYDFGYLLKLLSGKDLPEEKTDFFEQVTSYFPVVYDI  209

Query  391  KHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSG  212
            K+LM FC SL+GGL ++AE+L V+RVG+ HQAGSDSLLT   F K+KD FF GSL+ YSG
Sbjct  210  KYLMGFCASLYGGLERVAEILGVKRVGISHQAGSDSLLTLRAFNKMKDIFFPGSLDRYSG  269

Query  211  VLYGL  197
             LYGL
Sbjct  270  FLYGL  274



>ref|XP_001697447.1| CCR4-associated factor [Chlamydomonas reinhardtii]
 gb|EDP00109.1| CCR4-associated factor [Chlamydomonas reinhardtii]
Length=300

 Score =   253 bits (647),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 117/189 (62%), Positives = 148/189 (78%), Gaps = 2/189 (1%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            +D KG LP     + C+WQFNF+ F  ++DV+A DSIELL+Q GIDF  +   GI+  RF
Sbjct  100  TDAKGTLPRAANGELCVWQFNFKGFKLSDDVYAQDSIELLKQSGIDFALHEARGIDVHRF  159

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLM+SGIVLND V W+TFHS YDFGYLLKILTCQ LP T+Q FF L+N+YFP +FDIK
Sbjct  160  GELLMTSGIVLNDDVRWITFHSNYDFGYLLKILTCQPLPGTEQEFFELLNIYFPNIFDIK  219

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSG--SLEEYS  215
            +LMR+C++LHGGLNKLAE+L+V+R+G  HQAGSDSLLT+ TF KL + +F G     ++ 
Sbjct  220  YLMRYCDNLHGGLNKLAEMLDVQRIGPQHQAGSDSLLTSATFIKLANKYFHGIDGASKHM  279

Query  214  GVLYGLGVE  188
            GVL+GLGV+
Sbjct  280  GVLFGLGVD  288



>ref|XP_010459127.1| PREDICTED: probable CCR4-associated factor 1 homolog 2 [Camelina 
sativa]
Length=289

 Score =   249 bits (636),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 117/185 (63%), Positives = 146/185 (79%), Gaps = 1/185 (1%)
 Frame = -3

Query  748  SDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARR  572
            SDE+GNLPTCGT+ K CIWQFNFREF+   D+FA DSI LLR   IDFEKN E G++++R
Sbjct  94   SDERGNLPTCGTNNKQCIWQFNFREFNLKSDMFAMDSINLLRGSNIDFEKNNECGVDSKR  153

Query  571  FGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDI  392
            F ELLM SG+VLND + WVTFH GYDFGYLLK+L+ ++LPE +  FF  +  YFP V+DI
Sbjct  154  FAELLMGSGVVLNDKIQWVTFHCGYDFGYLLKLLSGKDLPEEKSDFFDQVTSYFPVVYDI  213

Query  391  KHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSG  212
            K+LM FC  L+GGL ++A++L V+RVG+ HQAGSDSLLT   F K+K+ FF+GSL+ YSG
Sbjct  214  KYLMGFCAPLYGGLERVADILGVKRVGISHQAGSDSLLTLRAFNKMKERFFTGSLDRYSG  273

Query  211  VLYGL  197
             LYGL
Sbjct  274  FLYGL  278



>gb|EAZ07127.1| hypothetical protein OsI_29374 [Oryza sativa Indica Group]
Length=244

 Score =   248 bits (632),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 116/192 (60%), Positives = 148/192 (77%), Gaps = 1/192 (1%)
 Frame = -3

Query  748  SDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARR  572
            SDE G+LP  GT  + CIWQFNFR FDP  D   +DSI++LR CGIDF++    G +  R
Sbjct  44   SDEGGDLPRRGTGGRRCIWQFNFRGFDPRTDPSNADSIQMLRTCGIDFDRFAAEGADPIR  103

Query  571  FGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDI  392
            F ELLMSSG+VLN  V W+TFHSGYDFGYLL++LT + LP+    FF LI +YFP ++DI
Sbjct  104  FAELLMSSGVVLNADVQWITFHSGYDFGYLLRLLTGRNLPDNMPAFFDLIRIYFPVLYDI  163

Query  391  KHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSG  212
            KHLMRFC++LHGGL++L ELL+V+RVG CHQAGSDSLLT   + K+K+ +F GS E+++G
Sbjct  164  KHLMRFCSNLHGGLSRLGELLDVKRVGTCHQAGSDSLLTLGCYNKIKEVYFKGSTEKHAG  223

Query  211  VLYGLGVENGQN  176
            VLYGL +E+G N
Sbjct  224  VLYGLVIEDGVN  235



>ref|XP_010927524.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Elaeis 
guineensis]
Length=270

 Score =   248 bits (634),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 143/186 (77%), Gaps = 2/186 (1%)
 Frame = -3

Query  748  SDEKGNLPTC--GTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEAR  575
            SD  G LP    G  + CIWQFNFREFD + DV   DS+ELLR+ GIDF+KN E G++A 
Sbjct  83   SDAAGILPPSPSGGGRGCIWQFNFREFDVDRDVCNPDSVELLRRSGIDFKKNRERGVDAL  142

Query  574  RFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFD  395
            RF ELLMSSG+VLNDSV W+ FH  YDF YLLKILTC+ LPET  GF  L+ ++FP V+D
Sbjct  143  RFAELLMSSGVVLNDSVQWIAFHGAYDFAYLLKILTCRRLPETMGGFLELVRIFFPVVYD  202

Query  394  IKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYS  215
            IK+L+R+C+ L+GGLN +AE L+V R+GVCHQAGSDSLLTA  F +LK+  F GS+E YS
Sbjct  203  IKYLLRYCDHLYGGLNNVAEQLDVVRIGVCHQAGSDSLLTARVFWRLKEKHFDGSIERYS  262

Query  214  GVLYGL  197
            G+LYGL
Sbjct  263  GLLYGL  268



>ref|XP_010476692.1| PREDICTED: probable CCR4-associated factor 1 homolog 2 [Camelina 
sativa]
Length=289

 Score =   249 bits (635),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 117/185 (63%), Positives = 146/185 (79%), Gaps = 1/185 (1%)
 Frame = -3

Query  748  SDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARR  572
            SDE+GNLPTCGT+ K CIWQFNFREF+   D+FA DSI LLR   IDFEKN E G++++R
Sbjct  93   SDERGNLPTCGTNNKQCIWQFNFREFNLKSDMFAMDSINLLRGSNIDFEKNNECGVDSKR  152

Query  571  FGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDI  392
            F ELLM SG+VLND + WVTFH GYDFGYLLK+L+ ++LPE +  FF  +  YFP V+DI
Sbjct  153  FAELLMGSGVVLNDKIQWVTFHCGYDFGYLLKLLSGKDLPEEKSEFFDQVTSYFPVVYDI  212

Query  391  KHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSG  212
            K+LM FC  L+GGL ++A++L V+RVG+ HQAGSDSLLT   F K+K+ FF+GSL+ YSG
Sbjct  213  KYLMGFCAPLYGGLERVADILGVKRVGISHQAGSDSLLTLRAFNKMKEMFFTGSLDRYSG  272

Query  211  VLYGL  197
             LYGL
Sbjct  273  FLYGL  277



>ref|XP_010497514.1| PREDICTED: probable CCR4-associated factor 1 homolog 2 [Camelina 
sativa]
Length=287

 Score =   248 bits (634),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 117/185 (63%), Positives = 146/185 (79%), Gaps = 1/185 (1%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKY-CIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARR  572
            SDE+GNLPTCGT+K  CIWQFNFREF+   D+FA DSI LLR   IDFEKN E G++++R
Sbjct  92   SDERGNLPTCGTNKRQCIWQFNFREFNLKSDMFAMDSINLLRGSNIDFEKNKECGVDSKR  151

Query  571  FGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDI  392
            F ELLM SG+VLND + WVTFH GYDFGYLLK+L+ ++LPE +  FF  +  YFP V+DI
Sbjct  152  FAELLMGSGVVLNDKIQWVTFHCGYDFGYLLKLLSGKDLPEEKSEFFDQVTSYFPVVYDI  211

Query  391  KHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSG  212
            K+LM FC  L+GGL ++A++L V+RVG+ HQAGSDSLLT   F K+K+ FF+GSL+ YSG
Sbjct  212  KYLMGFCAPLYGGLERVADILGVKRVGISHQAGSDSLLTLRAFNKMKEMFFTGSLDRYSG  271

Query  211  VLYGL  197
             LYGL
Sbjct  272  FLYGL  276



>ref|XP_002950174.1| hypothetical protein VOLCADRAFT_80930 [Volvox carteri f. nagariensis]
 gb|EFJ48842.1| hypothetical protein VOLCADRAFT_80930 [Volvox carteri f. nagariensis]
Length=320

 Score =   249 bits (636),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/187 (63%), Positives = 147/187 (79%), Gaps = 3/187 (2%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            +D KGNLP    +  C+WQFNF+ F   +DV+A DSIELL+Q GIDF  +   GI+  RF
Sbjct  85   TDAKGNLPRANGE-LCVWQFNFKGFRLADDVYAQDSIELLKQSGIDFATHEAKGIDVHRF  143

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLM+SGIVLND V W+TFHS YDFGYLLKILTCQ LP+++Q FF L+N+YFP +FDIK
Sbjct  144  GELLMTSGIVLNDDVRWITFHSNYDFGYLLKILTCQPLPQSEQEFFELLNIYFPNIFDIK  203

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSG--SLEEYS  215
            +LMR+C++LHGGLNKLAE+LEV+R+G  HQAGSDSLLT+ TF KL + FF G     ++ 
Sbjct  204  YLMRYCDNLHGGLNKLAEMLEVQRIGPQHQAGSDSLLTSFTFIKLANKFFQGIEGASKHM  263

Query  214  GVLYGLG  194
            GVL+GLG
Sbjct  264  GVLFGLG  270



>dbj|BAD09890.1| putative CCR4-NOT transcription complex, subunit 7 [Oryza sativa 
Japonica Group]
 dbj|BAD09904.1| putative CCR4-NOT transcription complex, subunit 7 [Oryza sativa 
Japonica Group]
 gb|EAZ42877.1| hypothetical protein OsJ_27470 [Oryza sativa Japonica Group]
 dbj|BAG96259.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97485.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG98767.1| unnamed protein product [Oryza sativa Japonica Group]
Length=288

 Score =   248 bits (632),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 116/192 (60%), Positives = 148/192 (77%), Gaps = 1/192 (1%)
 Frame = -3

Query  748  SDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARR  572
            SDE G+LP  GT  + CIWQFNFR FDP  D   +DSI++LR CGIDF++    G +  R
Sbjct  88   SDEGGDLPRRGTGGRRCIWQFNFRGFDPRTDPSNADSIQMLRTCGIDFDRFAAEGADPIR  147

Query  571  FGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDI  392
            F ELLMSSG+VLN  V W+TFHSGYDFGYLL++LT + LP+    FF LI +YFP ++DI
Sbjct  148  FAELLMSSGVVLNADVQWITFHSGYDFGYLLRLLTGRNLPDNMPAFFDLIRIYFPVLYDI  207

Query  391  KHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSG  212
            KHLMRFC++LHGGL++L ELL+V+RVG CHQAGSDSLLT   + K+K+ +F GS E+++G
Sbjct  208  KHLMRFCSNLHGGLSRLGELLDVKRVGTCHQAGSDSLLTLGCYNKIKEVYFKGSTEKHAG  267

Query  211  VLYGLGVENGQN  176
            VLYGL +E+G N
Sbjct  268  VLYGLVIEDGVN  279



>ref|XP_009149028.1| PREDICTED: probable CCR4-associated factor 1 homolog 2 [Brassica 
rapa]
Length=276

 Score =   247 bits (631),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/187 (63%), Positives = 149/187 (80%), Gaps = 2/187 (1%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKY-CIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARR  572
            SD++GNLPT GT+K  C+WQFNFREF+   D++A DSIELLR+ GIDF++N+  GIE++R
Sbjct  88   SDDQGNLPTFGTNKRQCVWQFNFREFNLRTDMYAPDSIELLRRSGIDFDRNSRVGIESKR  147

Query  571  FGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDI  392
            F +LLM SG+VLN+ + WVTFH GYDFGYLL++LT + LPE Q  F  L+ M+FP VFDI
Sbjct  148  FADLLMGSGVVLNEEIQWVTFHCGYDFGYLLRLLTGRNLPEKQSEFLYLVKMFFPRVFDI  207

Query  391  KHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSG-SLEEYS  215
            KH++ FC  L GGL+ +AE LEVERVG+ HQAGSDSLLTA  FR++K+  F+G SL+ Y 
Sbjct  208  KHMIGFCYDLFGGLSSVAERLEVERVGISHQAGSDSLLTARVFRRMKETRFAGRSLDMYC  267

Query  214  GVLYGLG  194
            GVLYGLG
Sbjct  268  GVLYGLG  274



>gb|EMS59499.1| putative CCR4-associated factor 1-like protein 7 [Triticum urartu]
Length=294

 Score =   248 bits (632),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/192 (62%), Positives = 145/192 (76%), Gaps = 1/192 (1%)
 Frame = -3

Query  748  SDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARR  572
            SDE G LP  GT  + C WQFNFR FDP  D   +DSI+LLR  GIDF++ T  G +   
Sbjct  94   SDENGALPARGTGGRPCAWQFNFRGFDPRSDPANADSIDLLRNSGIDFDRFTTEGADTGH  153

Query  571  FGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDI  392
            F ELLMSSG++LN  + WVTFHSGYDFGYLLK+LT + LP+T  GFF LI +YFP ++DI
Sbjct  154  FAELLMSSGVLLNAELQWVTFHSGYDFGYLLKLLTGRNLPDTMPGFFDLIRIYFPVLYDI  213

Query  391  KHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSG  212
            KHLM++C SLHGGL+KL ELL V+RVG+CHQAGSDSLLT   F+KLK+ +F GS E Y+G
Sbjct  214  KHLMKYCGSLHGGLSKLGELLGVQRVGICHQAGSDSLLTLQCFQKLKEAYFRGSTENYAG  273

Query  211  VLYGLGVENGQN  176
            VLYGL  + G+N
Sbjct  274  VLYGLISDGGEN  285



>ref|XP_003056015.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH59391.1| predicted protein [Micromonas pusilla CCMP1545]
Length=279

 Score =   247 bits (630),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 118/186 (63%), Positives = 149/186 (80%), Gaps = 2/186 (1%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            +D +GNLP  G + YC+WQFNFREF+  ED++A DSIELL+  GI+F+ N E GI+  RF
Sbjct  80   TDARGNLPLIG-NFYCLWQFNFREFNLKEDLYAQDSIELLKHSGINFQANHERGIDVHRF  138

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GE+LM SG+VL+D V W+TFHSG+DFGYLLKILTCQ LPE +  FF ++++YFP +FDIK
Sbjct  139  GEMLMVSGVVLSDKVKWLTFHSGHDFGYLLKILTCQPLPEAESDFFYVLSIYFPCIFDIK  198

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGS-LEEYSG  212
            +LM+F ++LHGGL+KLAE L+V R+G  HQAGSDSLLTAC F KLK  +F  S LE+Y G
Sbjct  199  YLMKFTDNLHGGLSKLAEQLDVARIGPQHQAGSDSLLTACAFFKLKQTYFIESGLEQYIG  258

Query  211  VLYGLG  194
            VLYGLG
Sbjct  259  VLYGLG  264



>emb|CDY35049.1| BnaA06g10590D [Brassica napus]
Length=276

 Score =   246 bits (629),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 117/187 (63%), Positives = 149/187 (80%), Gaps = 2/187 (1%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKY-CIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARR  572
            SD++GNLPT GT+K  C+WQFNFREF+   D++A DSIELLR+ GIDF++N+  GIE++R
Sbjct  88   SDDQGNLPTFGTNKRQCVWQFNFREFNLRTDMYAPDSIELLRRSGIDFDRNSRVGIESKR  147

Query  571  FGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDI  392
            F +LLM SG+VLN+ + WVTFH GYDFGYLL++LT + LPE Q  F  L+ M+FP VFDI
Sbjct  148  FADLLMGSGVVLNEEIQWVTFHCGYDFGYLLRLLTGRNLPEKQLEFLYLVKMFFPRVFDI  207

Query  391  KHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSG-SLEEYS  215
            KH++ FC  L GGL+ +AE LEVERVG+ HQAGSDSLLTA  FR++K+  F+G SL+ Y 
Sbjct  208  KHMIGFCYDLFGGLSSVAERLEVERVGISHQAGSDSLLTARVFRRMKETRFAGRSLDMYC  267

Query  214  GVLYGLG  194
            GVLYGLG
Sbjct  268  GVLYGLG  274



>ref|XP_005649974.1| CCR4-associated factor [Coccomyxa subellipsoidea C-169]
 gb|EIE25430.1| CCR4-associated factor [Coccomyxa subellipsoidea C-169]
Length=284

 Score =   247 bits (630),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 144/187 (77%), Gaps = 3/187 (2%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SD KG LP     + C+WQFNFREF  +ED+FA DSIELL+  GIDF +N   GIE  RF
Sbjct  87   SDAKGELPRW-KGELCVWQFNFREFKQSEDMFAQDSIELLKDSGIDFARNEARGIEVHRF  145

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GE+LMSSGIVLN+ + WVTFHSGYDFGYLLK+LTCQ LP  +  FF L+ +YFP V+DIK
Sbjct  146  GEVLMSSGIVLNEEIQWVTFHSGYDFGYLLKVLTCQPLPAVEAEFFELLQIYFPNVYDIK  205

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSG--SLEEYS  215
            +LM+FC +LHGGLNKLAE L+VER+G  HQAGSDSLLT+ TF KL D  F+G   + ++ 
Sbjct  206  YLMKFCGNLHGGLNKLAETLDVERIGPQHQAGSDSLLTSKTFHKLIDTLFNGIDGVLKHR  265

Query  214  GVLYGLG  194
            GVLYGLG
Sbjct  266  GVLYGLG  272



>gb|EYU24605.1| hypothetical protein MIMGU_mgv1a011876mg [Erythranthe guttata]
Length=268

 Score =   245 bits (625),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 113/187 (60%), Positives = 151/187 (81%), Gaps = 2/187 (1%)
 Frame = -3

Query  748  SDEKGNLPTCG-TDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARR  572
            ++EKG+LPTCG T  + +WQFNFR+F+P+ED++ SDSI LLR CGIDFEK+   G++A R
Sbjct  82   TNEKGDLPTCGETGLFIVWQFNFRDFNPSEDIYNSDSIHLLRGCGIDFEKHVAEGVDATR  141

Query  571  FGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDI  392
            F ELLMSSG+VLN+SV+WVTF  G+DFGYLLK+LT +ELPET++ FF  I +YFP ++DI
Sbjct  142  FAELLMSSGVVLNESVYWVTFQCGHDFGYLLKLLTGRELPETREEFFKFIKLYFPVIYDI  201

Query  391  KHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSG  212
            KH+++F   L+GGLNK+A  L+V+RVG  HQAGSDSLLT+  FR L+D     S+E Y+G
Sbjct  202  KHMIQFV-ELYGGLNKVARTLKVDRVGTSHQAGSDSLLTSSVFRTLRDTRLQESIETYAG  260

Query  211  VLYGLGV  191
            V++GLG+
Sbjct  261  VMHGLGI  267



>gb|AFK36856.1| unknown [Medicago truncatula]
Length=189

 Score =   240 bits (612),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -3

Query  610  FEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFF  431
              +    GI+  RFGELLMSSGIVLND+VHWVTFHSGYDFGYLLK+LTC+ LP+TQ GFF
Sbjct  46   LRRTASKGIDVNRFGELLMSSGIVLNDNVHWVTFHSGYDFGYLLKLLTCRALPDTQAGFF  105

Query  430  ALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLK  251
             LI +YFP V+DIKHLM+FCNSLHGGLNKLAELL+VERVGVCHQAGSDSLLTACTFRKL+
Sbjct  106  DLIGIYFPIVYDIKHLMKFCNSLHGGLNKLAELLDVERVGVCHQAGSDSLLTACTFRKLR  165

Query  250  DNFFSGSLEEYSGVLYGLGVEN  185
            + FF+G  E+YSGVLYGLGVE 
Sbjct  166  ETFFNGETEKYSGVLYGLGVEK  187



>ref|XP_006659446.1| PREDICTED: probable CCR4-associated factor 1 homolog 7-like, 
partial [Oryza brachyantha]
Length=280

 Score =   242 bits (618),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/192 (60%), Positives = 144/192 (75%), Gaps = 1/192 (1%)
 Frame = -3

Query  748  SDEKGNLPTCGTD-KYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARR  572
            SDE G LP  GT  + CIWQFNFR FDP  D    +SI+LL   GI+F++    G +  R
Sbjct  81   SDENGELPRRGTGGRPCIWQFNFRGFDPRSDPSNGESIQLLLNSGINFDRFAAEGADPIR  140

Query  571  FGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDI  392
            F ELLMSSG+VLN  V W+TFHSGYDFGYLL++LT Q LP T   FF LI ++FP V+DI
Sbjct  141  FAELLMSSGVVLNSDVQWITFHSGYDFGYLLRLLTGQNLPGTMTAFFDLIRIFFPVVYDI  200

Query  391  KHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSG  212
            KHLM+FC SLHGGL+KL ELLE++RVG+CHQAGSDSLLT   + K+K+ +F GS E+++G
Sbjct  201  KHLMKFCGSLHGGLSKLGELLEIKRVGICHQAGSDSLLTLGCYNKIKEVYFKGSTEKHAG  260

Query  211  VLYGLGVENGQN  176
            VLYGL +E+G N
Sbjct  261  VLYGLVIEDGVN  272



>emb|CDY33367.1| BnaC05g12160D [Brassica napus]
Length=454

 Score =   246 bits (628),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 118/189 (62%), Positives = 148/189 (78%), Gaps = 3/189 (2%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKY--CIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEAR  575
            SD++GNLPT GT+K   C+WQFNFREF+   D++A DSIELLR+ GIDF+ N   G+E++
Sbjct  86   SDDQGNLPTLGTNKRRQCVWQFNFREFNLRTDMYAPDSIELLRRSGIDFDWNNRLGVESK  145

Query  574  RFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFD  395
            RF +LLM SG+VLN+ + WVTFH GYDFGYLL++LT + LP+ Q  F  L+NM+FP VFD
Sbjct  146  RFADLLMGSGVVLNEEIQWVTFHCGYDFGYLLRLLTGRNLPDKQSEFLYLVNMFFPRVFD  205

Query  394  IKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSG-SLEEY  218
            IKH++ FC+ L GGL+ LAE LEVERVGV HQAGSDSLLTA  FR +K+  F+G SL+ Y
Sbjct  206  IKHMIGFCHDLFGGLSSLAERLEVERVGVSHQAGSDSLLTARVFRTMKETRFAGRSLDMY  265

Query  217  SGVLYGLGV  191
             GVLYGLG 
Sbjct  266  CGVLYGLGT  274



>gb|KCW53891.1| hypothetical protein EUGRSUZ_J03104, partial [Eucalyptus grandis]
Length=240

 Score =   239 bits (610),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 123/190 (65%), Positives = 139/190 (73%), Gaps = 34/190 (18%)
 Frame = -3

Query  745  DEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRFG  566
            DEK NLPTC TD                    +DSIELL+QCGIDF KN E G++A +FG
Sbjct  83   DEKENLPTCRTD--------------------NDSIELLKQCGIDFRKNNEKGVDAAQFG  122

Query  565  ELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIKH  386
            ELLMSSGIVLNDSV+W              +LTCQ+LP TQ  FF L +MYF  ++DIKH
Sbjct  123  ELLMSSGIVLNDSVYW--------------LLTCQDLPNTQSEFFKLTDMYFLMLYDIKH  168

Query  385  LMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGVL  206
            LM+FCNSLHGGLNKLAELLEVERVG CHQAGSDS+LT+CTFRKLKDNFF GSLE+Y+GVL
Sbjct  169  LMKFCNSLHGGLNKLAELLEVERVGNCHQAGSDSVLTSCTFRKLKDNFFRGSLEKYTGVL  228

Query  205  YGLGVENGQN  176
            Y LG ENGQN
Sbjct  229  YDLGFENGQN  238



>ref|XP_010469633.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Camelina 
sativa]
Length=252

 Score =   239 bits (611),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 137/186 (74%), Gaps = 22/186 (12%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            SDE GNLPTC TDKYC WQFN R                      +  +N ++GI+   F
Sbjct  85   SDENGNLPTCETDKYCTWQFNIR----------------------NVAENNQTGIDPEEF  122

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
              L+MSSG VLN+SVHWVTFH GYD GYLLK+LT Q LPETQ GFF +I++YFP V+D+K
Sbjct  123  ANLMMSSGTVLNESVHWVTFHGGYDVGYLLKLLTNQNLPETQSGFFEMISLYFPRVYDVK  182

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCN  +G LN LAELL+VERVG+ HQAGSDSLLT+CTFRKL++ FF GS+E+YSGV
Sbjct  183  HLMKFCNDAYGDLNYLAELLDVERVGISHQAGSDSLLTSCTFRKLQEVFFIGSIEKYSGV  242

Query  208  LYGLGV  191
            L+GLGV
Sbjct  243  LFGLGV  248



>emb|CDY12236.1| BnaC04g12660D [Brassica napus]
Length=412

 Score =   243 bits (620),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 113/184 (61%), Positives = 142/184 (77%), Gaps = 0/184 (0%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            S+E GNLPTCG+DKYCIWQFNF +FDP   +   +SI+LLR  GIDF+KN E G+ ++RF
Sbjct  82   SNESGNLPTCGSDKYCIWQFNFCDFDPVCSISNPESIKLLRDSGIDFKKNYEKGVHSKRF  141

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
             ELL++SG+VLN++VHWVTFH  YD  YLLK+L  Q+LPE  +GF  LI +YFP   DIK
Sbjct  142  AELLLTSGVVLNENVHWVTFHGVYDLAYLLKVLIIQDLPEKPKGFDELIRLYFPRFCDIK  201

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYSGV  209
            HLM+FCN L GGLNKLAELL VER+G+ HQAGSDSLLT+  F  L+D+FF+GS+E++   
Sbjct  202  HLMKFCNGLSGGLNKLAELLGVERLGISHQAGSDSLLTSRIFMILQDSFFNGSVEKFKRT  261

Query  208  LYGL  197
               L
Sbjct  262  FASL  265



>gb|ACH59934.1| ccr4-NOT transcription complex protein, partial [Pseudotsuga 
menziesii]
 gb|ACH59935.1| ccr4-NOT transcription complex protein, partial [Pseudotsuga 
menziesii]
 gb|ACH59936.1| ccr4-NOT transcription complex protein, partial [Pseudotsuga 
menziesii]
 gb|ACH59937.1| ccr4-NOT transcription complex protein, partial [Pseudotsuga 
menziesii]
 gb|ACH59938.1| ccr4-NOT transcription complex protein, partial [Pseudotsuga 
menziesii]
 gb|ACH59939.1| ccr4-NOT transcription complex protein, partial [Pseudotsuga 
menziesii]
 gb|ACH59940.1| ccr4-NOT transcription complex protein, partial [Pseudotsuga 
menziesii]
 gb|ACH59941.1| ccr4-NOT transcription complex protein, partial [Pseudotsuga 
menziesii]
 gb|ACH59942.1| ccr4-NOT transcription complex protein, partial [Pseudotsuga 
menziesii]
 gb|ACH59943.1| ccr4-NOT transcription complex protein, partial [Pseudotsuga 
menziesii]
 gb|ACH59944.1| ccr4-NOT transcription complex protein, partial [Pseudotsuga 
menziesii]
 gb|ACH59945.1| ccr4-NOT transcription complex protein, partial [Pseudotsuga 
menziesii]
 gb|ACH59946.1| ccr4-NOT transcription complex protein, partial [Pseudotsuga 
menziesii]
 gb|ACH59947.1| ccr4-NOT transcription complex protein, partial [Pseudotsuga 
menziesii]
 gb|ACH59948.1| ccr4-NOT transcription complex protein, partial [Pseudotsuga 
menziesii]
 gb|ACH59949.1| ccr4-NOT transcription complex protein, partial [Pseudotsuga 
menziesii]
 gb|ACH59950.1| ccr4-NOT transcription complex protein, partial [Pseudotsuga 
menziesii]
 gb|ACH59951.1| ccr4-NOT transcription complex protein, partial [Pseudotsuga 
menziesii]
 gb|ACH59952.1| ccr4-NOT transcription complex protein, partial [Pseudotsuga 
menziesii]
 gb|ACH59953.1| ccr4-NOT transcription complex protein, partial [Pseudotsuga 
macrocarpa]
Length=161

 Score =   234 bits (597),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 106/148 (72%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = -3

Query  628  RQCGIDFEKNTESGIEARRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPE  449
            RQ GIDF+KN+E G+++ RF ELLMSSGIVLN++V W+TFHSGYDFGYLLK++  + LP 
Sbjct  1    RQSGIDFKKNSEMGVDSHRFAELLMSSGIVLNENVRWITFHSGYDFGYLLKLVMNRSLPP  60

Query  448  TQQGFFALINMYFPEVFDIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTAC  269
            T  GFF LI MYFP ++DIKHLM+FCNSLHGGLN+LAELLEVER G CHQAGSDSLLT+C
Sbjct  61   TPGGFFYLIRMYFPNLYDIKHLMKFCNSLHGGLNRLAELLEVERFGACHQAGSDSLLTSC  120

Query  268  TFRKLKDNFFSGSLEEYSGVLYGLGVEN  185
            TFRKL+++FF G+ ++Y+GVLYGLGVE+
Sbjct  121  TFRKLRESFFKGAADKYAGVLYGLGVES  148



>ref|XP_008779663.1| PREDICTED: probable CCR4-associated factor 1 homolog 7 [Phoenix 
dactylifera]
Length=268

 Score =   235 bits (600),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 135/186 (73%), Gaps = 2/186 (1%)
 Frame = -3

Query  748  SDEKGNLPTC--GTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEAR  575
            SD  G LP    G  + C+WQFNFREFD +       SI+LLR+ GIDF++N E G+ A 
Sbjct  83   SDASGCLPPSPSGVGRPCVWQFNFREFDADRHFCNPASIDLLRRSGIDFQRNREWGVHAL  142

Query  574  RFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFD  395
            RF ELLMSSG+VLNDSV W+ FH  YDF YLLKILTC+ LPET  GF  L+  +FP V+D
Sbjct  143  RFAELLMSSGVVLNDSVQWIAFHGAYDFAYLLKILTCRRLPETTAGFMELVRTFFPTVYD  202

Query  394  IKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYS  215
            IKHLM+FCN+L+GGL  +AE L+ ER+G  HQAGSDSLLTA  F +LK+ +F  S+E Y+
Sbjct  203  IKHLMKFCNNLYGGLANVAEQLDAERIGASHQAGSDSLLTAHVFWRLKEKYFGWSIERYA  262

Query  214  GVLYGL  197
            G LYGL
Sbjct  263  GPLYGL  268



>gb|KDD75431.1| CAF1 family ribonuclease [Helicosporidium sp. ATCC 50920]
Length=241

 Score =   234 bits (596),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 116/193 (60%), Positives = 141/193 (73%), Gaps = 4/193 (2%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            ++ +G LP     + C+WQFNFREF   ED++ASDSIELLR  GID   N   GI+  RF
Sbjct  44   TNAEGTLPRI-NGELCVWQFNFREFSMREDLYASDSIELLRCSGIDLALNEARGIDVHRF  102

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELLM SG+VLN+ V W+TFH+GYDFGYLLK LTC  LP  +  FFAL+  YFP ++DIK
Sbjct  103  GELLMVSGVVLNEQVQWITFHAGYDFGYLLKTLTCAPLPLAEVEFFALLQAYFPNLYDIK  162

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSG--SLEEYS  215
            +LM+FC  LHGGLNKLAE LEVER G  HQAGSDSLLTA TF++L   FF+G     ++ 
Sbjct  163  YLMKFCQPLHGGLNKLAETLEVERFGPQHQAGSDSLLTALTFQRLAATFFNGVAGTVQHC  222

Query  214  GVLYGLGVENGQN  176
            G+LYGLG + GQN
Sbjct  223  GILYGLGTD-GQN  234



>emb|CDG58373.1| putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
flexuosum]
 emb|CDG58376.1| putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
lanigerum var. laevigatum]
 emb|CDG58382.1| putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
modestum]
 emb|CDO45613.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
diemontianum]
 emb|CDO45614.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
diemontianum]
 emb|CDO45615.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
diemontianum]
 emb|CDO45630.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
lanigerum var. laevigatum]
 emb|CDO45631.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
lanigerum var. laevigatum]
 emb|CDO45632.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
lanigerum var. laevigatum]
 emb|CDO45633.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
lanigerum var. lanigerum]
 emb|CDO45634.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
lanigerum var. lanigerum]
 emb|CDO45654.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
procerum]
 emb|CDO45663.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
salignum]
 emb|CDO45664.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
salignum]
 emb|CDO45679.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
stelligerum]
 emb|CDO45680.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
stelligerum]
 emb|CDO45681.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
stelligerum]
 emb|CDO45683.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
teretifolium]
Length=127

 Score =   229 bits (584),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -3

Query  574  RFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFD  395
            RFGELLMSSGIVLNDSVHWVTFHSGYDF YLLK+LTCQ LP+TQ GFF LI +YFP V+D
Sbjct  2    RFGELLMSSGIVLNDSVHWVTFHSGYDFAYLLKLLTCQNLPDTQAGFFNLIKLYFPTVYD  61

Query  394  IKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYS  215
            IKHLM+FCNSLHGGLNKLAELLEVER G+CHQAGSDSLLTACTFRKLK++FF+GS E+Y+
Sbjct  62   IKHLMKFCNSLHGGLNKLAELLEVERFGICHQAGSDSLLTACTFRKLKESFFNGSTEKYA  121

Query  214  GVLYGL  197
            GVLYGL
Sbjct  122  GVLYGL  127



>emb|CDO45621.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
flexuosum]
Length=127

 Score =   228 bits (582),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -3

Query  574  RFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFD  395
            RFGELLMSSGIVLNDSVHWVTFHSGYDF YLLK+LTCQ LP+TQ GFF LI +YFP V+D
Sbjct  2    RFGELLMSSGIVLNDSVHWVTFHSGYDFAYLLKLLTCQNLPDTQAGFFNLIXLYFPTVYD  61

Query  394  IKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYS  215
            IKHLM+FCNSLHGGLNKLAELLEVER G+CHQAGSDSLLTACTFRKLK++FF+GS E+Y+
Sbjct  62   IKHLMKFCNSLHGGLNKLAELLEVERFGICHQAGSDSLLTACTFRKLKESFFNGSTEKYA  121

Query  214  GVLYGL  197
            GVLYGL
Sbjct  122  GVLYGL  127



>ref|XP_002507260.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO68518.1| predicted protein [Micromonas sp. RCC299]
Length=273

 Score =   233 bits (595),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 113/187 (60%), Positives = 143/187 (76%), Gaps = 3/187 (2%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            +D  GNLP      YC+WQFNFREFD  ED++A DSIELL+  GIDF+ N   GI+  RF
Sbjct  81   TDGDGNLPLIAG-HYCVWQFNFREFDLKEDMYAQDSIELLKHSGIDFDANRNRGIDVHRF  139

Query  568  GELLMSSGIVLNDSV-HWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDI  392
            GELLM SG+VLN  V  W+TFHSGYDFGYLLK+LTC  LP+ +  FF ++ ++FP +FD+
Sbjct  140  GELLMVSGVVLNQKVVKWITFHSGYDFGYLLKLLTCTALPQNEAEFFGILGLHFPCIFDM  199

Query  391  KHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGS-LEEYS  215
            K+LMRF ++LHGGL+KLAE L+VER+G  HQAGSDSLLTACTF KL+   F    +++++
Sbjct  200  KYLMRFTDNLHGGLSKLAEQLDVERIGPQHQAGSDSLLTACTFFKLRQTHFGHDCVDKHA  259

Query  214  GVLYGLG  194
            GVLYGLG
Sbjct  260  GVLYGLG  266



>ref|XP_005843563.1| hypothetical protein CHLNCDRAFT_59811 [Chlorella variabilis]
 gb|EFN51461.1| hypothetical protein CHLNCDRAFT_59811 [Chlorella variabilis]
Length=290

 Score =   234 bits (596),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 111/192 (58%), Positives = 146/192 (76%), Gaps = 4/192 (2%)
 Frame = -3

Query  748  SDEKGNLPTCGTDKYCIWQFNFREFDPNEDVFASDSIELLRQCGIDFEKNTESGIEARRF  569
            +D +GNLP     + C+WQFNF+EF  ++D++A DSIELL+Q GIDF +N   GI+ R F
Sbjct  91   TDAEGNLPRI-NGELCVWQFNFKEFRLSDDMYAQDSIELLKQSGIDFAQNETRGIDVRHF  149

Query  568  GELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFDIK  389
            GELL  SG+VLN+ V W+TFHSGYDFGYLLK+LTC  LP  +  FF L+ ++FP++FDIK
Sbjct  150  GELLTVSGVVLNEDVRWITFHSGYDFGYLLKLLTCSSLPTNEGEFFQLLKLFFPQIFDIK  209

Query  388  HLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSG--SLEEYS  215
            +LM+FC++LHGGLNKLAE L+V R+G  HQAGSDSLLT+ TF KL    F G   + ++ 
Sbjct  210  YLMKFCDNLHGGLNKLAETLDVARIGPQHQAGSDSLLTSATFLKLAQQRFQGMDGVGQHR  269

Query  214  GVLYGLGVENGQ  179
            G+LYGLG E+G+
Sbjct  270  GILYGLG-EDGR  280



>emb|CDG58396.1| putative CCR4-associated factor 1-homolog 6, partial [Mimetes 
cucullatus]
Length=127

 Score =   227 bits (578),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = -3

Query  577  RRFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVF  398
            +RFGELLMSSGIVLND VHWVTFHSGYDF YLLK+LTCQ LP+TQ GFF LI +YFP V+
Sbjct  1    QRFGELLMSSGIVLNDCVHWVTFHSGYDFAYLLKLLTCQNLPDTQAGFFNLIKLYFPTVY  60

Query  397  DIKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEY  218
            DIKHLM+FCNSLHGGLNKLAELLEVER G+CHQAGSDSLLTACTFRKLK++FF+GS E+Y
Sbjct  61   DIKHLMKFCNSLHGGLNKLAELLEVERFGICHQAGSDSLLTACTFRKLKESFFNGSTEKY  120

Query  217  SGVLYGL  197
            +GVLYGL
Sbjct  121  AGVLYGL  127



>emb|CDG58367.1| putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
discolor]
Length=127

 Score =   227 bits (578),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = -3

Query  574  RFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFD  395
            RFGELLMSSGIVLND VHWVTFHSGYDF YLLK+LTCQ LP+TQ GFF LI +YFP V+D
Sbjct  2    RFGELLMSSGIVLNDXVHWVTFHSGYDFAYLLKLLTCQNLPDTQAGFFNLIKLYFPTVYD  61

Query  394  IKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYS  215
            IKHLM+FCNSLHGGLNKLAELLEVER G+CHQAGSDSLLTACTFRKLK++FF+GS E+Y+
Sbjct  62   IKHLMKFCNSLHGGLNKLAELLEVERFGICHQAGSDSLLTACTFRKLKESFFNGSTEKYA  121

Query  214  GVLYGL  197
            GVLYGL
Sbjct  122  GVLYGL  127



>emb|CDG58389.1| putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
sericeum]
Length=127

 Score =   226 bits (577),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = -3

Query  574  RFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFD  395
            RFGELLMSSGIVLND VHWVTFHSGYDF YLLK+LTCQ LP+TQ GFF LI +YFP V+D
Sbjct  2    RFGELLMSSGIVLNDCVHWVTFHSGYDFAYLLKLLTCQNLPDTQTGFFNLIKLYFPTVYD  61

Query  394  IKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYS  215
            IKHLM+FCNSLHGGLNKLAELLEVER G+CHQAGSDSLLTACTFRKLK++FF+GS E+Y+
Sbjct  62   IKHLMKFCNSLHGGLNKLAELLEVERFGICHQAGSDSLLTACTFRKLKESFFNGSTEKYA  121

Query  214  GVLYGL  197
            GVLYGL
Sbjct  122  GVLYGL  127



>emb|CDG58360.1| putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
album]
 emb|CDG58361.1| putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
barkerae]
 emb|CDG58362.1| putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
brunioides var. brunioides]
 emb|CDG58363.1| putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
burchellii]
 emb|CDG58364.1| putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
chamelaea]
 emb|CDG58365.1| putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
conicum]
 emb|CDG58366.1| putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
corymbosum]
 emb|CDG58368.1| putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
dregei]
 emb|CDG58369.1| putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
dubium]
 emb|CDG58370.1| putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
elimense subsp. salteri]
 emb|CDG58371.1| putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
elimense subsp. vyeboomense]
 emb|CDG58372.1| putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
ericifolium]
 emb|CDG58374.1| putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
floridum]
 emb|CDG58375.1| putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
glaberrimum subsp. glaberrimum]
 emb|CDG58378.1| putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
loeriense]
 emb|CDG58379.1| putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
loranthifolium]
 emb|CDG58380.1| putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
meridianum]
 emb|CDG58381.1| putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
microcephalum]
 emb|CDG58383.1| putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
muirii]
 emb|CDG58384.1| putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
nervosum]
 emb|CDG58385.1| putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
nitidum]
 emb|CDG58386.1| putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
osbornei]
 emb|CDG58388.1| putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
roodii]
 emb|CDG58390.1| putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
sessile]
 emb|CDG58391.1| putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
singulare]
 emb|CDG58393.1| putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
stellare]
 emb|CDG58394.1| putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
thymifolium]
 emb|CDG58395.1| putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
verticillatum]
 emb|CDG58397.1| putative CCR4-associated factor 1-homolog 6, partial [Paranomus 
spathulatus]
 emb|CDO45583.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
album]
 emb|CDO45584.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
arcuatum]
 emb|CDO45585.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
argenteum]
 emb|CDO45586.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
barkerae]
 emb|CDO45587.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
brunioides var. brunioides]
 emb|CDO45588.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
brunioides var. brunioides]
 emb|CDO45589.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
brunioides var. flumenlupimum]
 emb|CDO45590.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
burchellii]
 emb|CDO45591.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
burchellii]
 emb|CDO45592.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
chamelaea]
 emb|CDO45593.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
chamelaea]
 emb|CDO45594.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
cinereum]
 emb|CDO45595.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
cinereum]
 emb|CDO45596.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
cinereum]
 emb|CDO45597.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
cinereum]
 emb|CDO45598.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
comosum subsp. comosum]
 emb|CDO45599.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
concavum]
 emb|CDO45600.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
conicum]
 emb|CDO45601.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
cordatum]
 emb|CDO45602.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
cordatum]
 emb|CDO45603.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
cordatum]
 emb|CDO45604.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
coriaceum]
 emb|CDO45605.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
coriaceum]
 emb|CDO45606.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
coriaceum]
 emb|CDO45607.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
corymbosum]
 emb|CDO45608.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
crassulifolium]
 emb|CDO45609.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
cryptocephalum]
 emb|CDO45610.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
cryptocephalum]
 emb|CDO45611.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
cryptocephalum]
 emb|CDO45612.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
cryptocephalum]
 emb|CDO45616.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
dregei]
 emb|CDO45617.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
dubium]
 emb|CDO45618.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
dubium]
 emb|CDO45619.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
sp. JT-2014a]
 emb|CDO45620.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
elimense subsp. vyeboomense]
 emb|CDO45622.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
foedum]
 emb|CDO45623.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
foedum]
 emb|CDO45624.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
foedum]
 emb|CDO45625.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
galpinii]
 emb|CDO45626.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
glaberrimum subsp. erubescens]
 emb|CDO45627.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
glaberrimum subsp. erubescens]
 emb|CDO45628.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
gydoense]
 emb|CDO45629.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
gydoense]
 emb|CDO45635.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
levisanus]
 emb|CDO45636.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
linifolium]
 emb|CDO45637.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
meyerianum]
 emb|CDO45638.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
meyerianum]
 emb|CDO45639.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
microcephalum]
 emb|CDO45640.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
microcephalum]
 emb|CDO45641.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
microcephalum]
 emb|CDO45642.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
muirii]
 emb|CDO45643.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
nervosum]
 emb|CDO45644.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
nervosum]
 emb|CDO45645.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
nitidum]
 emb|CDO45646.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
olens]
 emb|CDO45647.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
olens]
 emb|CDO45648.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
orientale]
 emb|CDO45649.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
orientale]
 emb|CDO45650.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
orientale]
 emb|CDO45652.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
platyspermum]
 emb|CDO45653.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
pondoense]
 emb|CDO45655.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
pubescens]
 emb|CDO45656.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
pubibracteolatum]
 emb|CDO45657.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
pubibracteolatum]
 emb|CDO45658.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
pubibracteolatum]
 emb|CDO45660.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
roodii]
 emb|CDO45661.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
rourkei]
 emb|CDO45662.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
salicifolium]
 emb|CDO45666.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
sheilae]
 emb|CDO45667.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
sheilae]
 emb|CDO45668.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
sheilae]
 emb|CDO45669.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
sheilae]
 emb|CDO45670.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
singulare]
 emb|CDO45671.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
sorocephalodes]
 emb|CDO45672.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
sorocephalodes]
 emb|CDO45673.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
sorocephalodes]
 emb|CDO45674.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
spissifolium subsp. fragrans]
 emb|CDO45676.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
spissifolium subsp. philipsii]
 emb|CDO45677.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
stellare]
 emb|CDO45678.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
stellare]
 emb|CDO45682.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
strobilinum]
 emb|CDO45684.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
thymifolium]
 emb|CDO45685.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
sp. JT-2014b]
 emb|CDO45686.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
sp. JT-2014b]
 emb|CDO45688.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
uliginosum subsp. glabratum]
 emb|CDO45689.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
uliginosum subsp. uliginosum]
 emb|CDO45690.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
verticillatum]
 emb|CDO45692.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
radiatum]
 emb|CDO45693.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
radiatum]
 emb|CDO45694.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
radiatum]
 emb|CDO45695.1| Putative CCR4-associated factor 1-homolog 6, partial [Leucadendron 
radiatum]
Length=127

 Score =   226 bits (577),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = -3

Query  574  RFGELLMSSGIVLNDSVHWVTFHSGYDFGYLLKILTCQELPETQQGFFALINMYFPEVFD  395
            RFGELLMSSGIVLND VHWVTFHSGYDF YLLK+LTCQ LP+TQ GFF LI +YFP V+D
Sbjct  2    RFGELLMSSGIVLNDCVHWVTFHSGYDFAYLLKLLTCQNLPDTQAGFFNLIKLYFPTVYD  61

Query  394  IKHLMRFCNSLHGGLNKLAELLEVERVGVCHQAGSDSLLTACTFRKLKDNFFSGSLEEYS  215
            IKHLM+FCNSLHGGLNKLAELLEVER G+CHQAGSDSLLTACTFRKLK++FF+GS E+Y+
Sbjct  62   IKHLMKFCNSLHGGLNKLAELLEVERFGICHQAGSDSLLTACTFRKLKESFFNGSTEKYA  121

Query  214  GVLYGL  197
            GVLYGL
Sbjct  122  GVLYGL  127



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1387667965840