BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF007G10

Length=783
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDP39134.1|  hypothetical protein JCGZ_00891                         260   2e-80   Jatropha curcas
ref|XP_002280015.1|  PREDICTED: uncharacterized protein LOC100253742    256   6e-79   Vitis vinifera
ref|XP_009797126.1|  PREDICTED: uncharacterized protein LOC104243609    256   1e-78   Nicotiana sylvestris
ref|XP_006452374.1|  hypothetical protein CICLE_v10008353mg             254   4e-78   Citrus clementina [clementine]
ref|XP_002532562.1|  conserved hypothetical protein                     253   2e-77   Ricinus communis
ref|XP_011095401.1|  PREDICTED: uncharacterized protein LOC105174869    253   2e-77   Sesamum indicum [beniseed]
ref|XP_010063011.1|  PREDICTED: uncharacterized protein LOC104450241    252   3e-77   Eucalyptus grandis [rose gum]
ref|XP_002316767.2|  hypothetical protein POPTR_0011s09280g             250   4e-77   
ref|XP_009592787.1|  PREDICTED: uncharacterized protein LOC104089563    251   4e-77   Nicotiana tomentosiformis
ref|XP_011012481.1|  PREDICTED: uncharacterized protein LOC105116724    251   8e-77   Populus euphratica
gb|ABK96275.1|  unknown                                                 251   9e-77   Populus trichocarpa x Populus deltoides
ref|XP_009144940.1|  PREDICTED: uncharacterized protein LOC103868607    248   8e-76   
ref|XP_009147810.1|  PREDICTED: uncharacterized protein LOC103871323    248   1e-75   Brassica rapa
emb|CDY22815.1|  BnaA06g02620D                                          248   1e-75   Brassica napus [oilseed rape]
ref|XP_007020817.1|  HAUS augmin-like complex subunit 4 isoform 3       244   1e-75   
ref|XP_006393115.1|  hypothetical protein EUTSA_v10011513mg             248   1e-75   Eutrema salsugineum [saltwater cress]
emb|CDY37107.1|  BnaC06g03920D                                          248   1e-75   Brassica napus [oilseed rape]
gb|KJB62820.1|  hypothetical protein B456_009G438400                    246   1e-75   Gossypium raimondii
gb|EYU27337.1|  hypothetical protein MIMGU_mgv1a006702mg                247   2e-75   Erythranthe guttata [common monkey flower]
ref|XP_004302887.1|  PREDICTED: uncharacterized protein LOC101313133    247   2e-75   Fragaria vesca subsp. vesca
ref|XP_008342667.1|  PREDICTED: uncharacterized protein LOC103405443    246   3e-75   Malus domestica [apple tree]
ref|XP_010545512.1|  PREDICTED: uncharacterized protein LOC104817858    246   3e-75   Tarenaya hassleriana [spider flower]
gb|KJB62818.1|  hypothetical protein B456_009G438400                    246   4e-75   Gossypium raimondii
ref|XP_009353598.1|  PREDICTED: uncharacterized protein LOC103944...    245   6e-75   Pyrus x bretschneideri [bai li]
ref|XP_009353594.1|  PREDICTED: uncharacterized protein LOC103944...    246   6e-75   Pyrus x bretschneideri [bai li]
ref|XP_004500070.1|  PREDICTED: uncharacterized protein LOC101512734    245   1e-74   Cicer arietinum [garbanzo]
ref|XP_007146480.1|  hypothetical protein PHAVU_006G044000g             245   1e-74   Phaseolus vulgaris [French bean]
ref|XP_009353597.1|  PREDICTED: uncharacterized protein LOC103944...    244   1e-74   
ref|XP_009338054.1|  PREDICTED: uncharacterized protein LOC103930437    245   1e-74   Pyrus x bretschneideri [bai li]
ref|XP_007020815.1|  HAUS augmin-like complex subunit 4 isoform 1       243   5e-74   Theobroma cacao [chocolate]
ref|XP_006365955.1|  PREDICTED: uncharacterized protein LOC102604282    243   6e-74   Solanum tuberosum [potatoes]
gb|KHM99560.1|  HAUS augmin-like complex subunit 4                      242   1e-73   Glycine soja [wild soybean]
ref|XP_003551881.1|  PREDICTED: uncharacterized protein LOC100790889    242   2e-73   Glycine max [soybeans]
ref|NP_001242486.1|  uncharacterized protein LOC100786070               241   4e-73   Glycine max [soybeans]
ref|XP_004251462.1|  PREDICTED: uncharacterized protein LOC101257536    241   5e-73   Solanum lycopersicum
ref|XP_008447737.1|  PREDICTED: uncharacterized protein LOC103490141    240   9e-73   Cucumis melo [Oriental melon]
ref|NP_175486.2|  uncharacterized protein                               240   1e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006305844.1|  hypothetical protein CARUB_v10010894mg             240   1e-72   Capsella rubella
ref|XP_004139788.1|  PREDICTED: uncharacterized protein LOC101203307    240   1e-72   
gb|KGN44163.1|  hypothetical protein Csa_7G210080                       240   1e-72   Cucumis sativus [cucumbers]
ref|XP_002894271.1|  hypothetical protein ARALYDRAFT_474203             239   2e-72   
ref|XP_006858187.1|  hypothetical protein AMTR_s00062p00162950          239   3e-72   Amborella trichopoda
ref|XP_010479537.1|  PREDICTED: uncharacterized protein LOC104758377    239   3e-72   Camelina sativa [gold-of-pleasure]
ref|XP_010500647.1|  PREDICTED: uncharacterized protein LOC104777995    238   4e-72   Camelina sativa [gold-of-pleasure]
ref|XP_010461924.1|  PREDICTED: uncharacterized protein LOC104742601    238   5e-72   Camelina sativa [gold-of-pleasure]
ref|XP_007215411.1|  hypothetical protein PRUPE_ppa005986mg             234   3e-70   Prunus persica
ref|XP_008228485.1|  PREDICTED: uncharacterized protein LOC103327892    231   3e-69   Prunus mume [ume]
gb|KFK35913.1|  hypothetical protein AALP_AA4G052600                    230   7e-69   Arabis alpina [alpine rockcress]
ref|XP_003600108.1|  HAUS augmin-like complex subunit                   228   4e-68   Medicago truncatula
ref|XP_009420825.1|  PREDICTED: uncharacterized protein LOC104000482    228   8e-68   Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH27912.1|  SKIP interacting protein                                224   8e-67   Medicago truncatula
ref|XP_009360993.1|  PREDICTED: uncharacterized protein LOC103951...    222   1e-66   
ref|XP_010670158.1|  PREDICTED: uncharacterized protein LOC104887254    223   5e-66   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010935259.1|  PREDICTED: uncharacterized protein LOC105055...    222   1e-65   Elaeis guineensis
ref|XP_009360992.1|  PREDICTED: uncharacterized protein LOC103951...    221   1e-65   Pyrus x bretschneideri [bai li]
ref|XP_010935260.1|  PREDICTED: uncharacterized protein LOC105055...    222   1e-65   Elaeis guineensis
ref|XP_008781274.1|  PREDICTED: uncharacterized protein LOC103701...    222   1e-65   Phoenix dactylifera
ref|XP_008781277.1|  PREDICTED: uncharacterized protein LOC103701...    221   2e-65   Phoenix dactylifera
ref|XP_010278680.1|  PREDICTED: uncharacterized protein LOC104612800    220   5e-65   Nelumbo nucifera [Indian lotus]
gb|KJB62821.1|  hypothetical protein B456_009G438500                    219   7e-65   Gossypium raimondii
ref|XP_008365005.1|  PREDICTED: HAUS augmin-like complex subunit 4      219   7e-65   
ref|XP_008226896.1|  PREDICTED: HAUS augmin-like complex subunit ...    216   9e-64   Prunus mume [ume]
ref|XP_008226895.1|  PREDICTED: HAUS augmin-like complex subunit ...    216   1e-63   Prunus mume [ume]
ref|XP_008226894.1|  PREDICTED: HAUS augmin-like complex subunit ...    216   1e-63   Prunus mume [ume]
emb|CDP04568.1|  unnamed protein product                                216   2e-63   Coffea canephora [robusta coffee]
ref|XP_010276096.1|  PREDICTED: uncharacterized protein LOC104610933    215   4e-63   Nelumbo nucifera [Indian lotus]
ref|XP_007213462.1|  hypothetical protein PRUPE_ppa024388mg             214   8e-63   Prunus persica
emb|CDP05762.1|  unnamed protein product                                212   6e-62   Coffea canephora [robusta coffee]
dbj|BAJ90177.1|  predicted protein                                      211   3e-61   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EPS65378.1|  hypothetical protein M569_09399                         198   4e-60   Genlisea aurea
gb|AAG51195.1|AC079279_16  unknown protein                              207   5e-60   Arabidopsis thaliana [mouse-ear cress]
gb|ACG37880.1|  hypothetical protein                                    200   9e-60   Zea mays [maize]
ref|XP_004952114.1|  PREDICTED: uncharacterized protein LOC101756520    206   2e-59   Setaria italica
ref|XP_002453194.1|  hypothetical protein SORBIDRAFT_04g001450          204   4e-59   Sorghum bicolor [broomcorn]
gb|AFW69843.2|  hypothetical protein ZEAMMB73_576256                    200   4e-58   
gb|ACN31535.1|  unknown                                                 201   1e-57   Zea mays [maize]
ref|XP_003573417.1|  PREDICTED: uncharacterized protein LOC100821831    199   4e-57   
gb|KJB62817.1|  hypothetical protein B456_009G438400                    198   5e-57   Gossypium raimondii
ref|XP_004295822.1|  PREDICTED: uncharacterized protein LOC101299752    198   8e-57   Fragaria vesca subsp. vesca
ref|XP_010097813.1|  hypothetical protein L484_000961                   198   1e-56   
ref|NP_001045698.1|  Os02g0119100                                       191   3e-56   
gb|EAZ21518.1|  hypothetical protein OsJ_05142                          192   2e-54   Oryza sativa Japonica Group [Japonica rice]
gb|EAY84227.1|  hypothetical protein OsI_05607                          192   2e-54   Oryza sativa Indica Group [Indian rice]
ref|XP_006646792.1|  PREDICTED: uncharacterized protein LOC102709140    191   2e-54   
ref|XP_001768748.1|  predicted protein                                  192   3e-54   
ref|XP_002990133.1|  hypothetical protein SELMODRAFT_235950             190   1e-53   
ref|XP_002989789.1|  hypothetical protein SELMODRAFT_235871             186   2e-52   
ref|XP_006452375.1|  hypothetical protein CICLE_v10008353mg             168   2e-45   
gb|AFK46724.1|  unknown                                                 162   3e-45   Medicago truncatula
gb|ACJ84282.1|  unknown                                                 163   9e-44   Medicago truncatula
gb|KJB62819.1|  hypothetical protein B456_009G438400                    159   4e-42   Gossypium raimondii
gb|EMS60102.1|  hypothetical protein TRIUR3_07799                       158   3e-41   Triticum urartu
ref|XP_008380933.1|  PREDICTED: uncharacterized protein LOC103443814    155   4e-40   
gb|KHG14666.1|  HAUS augmin-like complex subunit 4                      144   9e-37   Gossypium arboreum [tree cotton]
ref|NP_001130646.1|  uncharacterized protein LOC100191747             81.6    6e-15   
ref|XP_001637987.1|  predicted protein                                73.6    1e-11   Nematostella vectensis
ref|XP_002111568.1|  hypothetical protein TRIADDRAFT_55725            67.8    1e-09   Trichoplax adhaerens
ref|XP_009050923.1|  hypothetical protein LOTGIDRAFT_187302           64.7    1e-08   Lottia gigantea
ref|XP_004208947.1|  PREDICTED: HAUS augmin-like complex subunit ...  63.2    2e-08   Hydra vulgaris
ref|XP_004337868.1|  hypothetical protein ACA1_187410                 63.5    3e-08   Acanthamoeba castellanii str. Neff
ref|XP_004345396.2|  hypothetical protein CAOG_05806                  60.1    5e-07   Capsaspora owczarzaki ATCC 30864
ref|XP_005108792.1|  PREDICTED: HAUS augmin-like complex subunit ...  58.5    1e-06   
ref|XP_781249.1|  PREDICTED: HAUS augmin-like complex subunit 4-like  57.0    4e-06   Strongylocentrotus purpuratus [purple urchin]
ref|XP_009022094.1|  hypothetical protein HELRODRAFT_192765           54.7    3e-05   Helobdella robusta
gb|EFX86383.1|  hypothetical protein DAPPUDRAFT_308473                54.3    4e-05   Daphnia pulex
gb|EPS64103.1|  hypothetical protein M569_10678                       48.9    9e-05   Genlisea aurea
ref|XP_007020816.1|  HAUS augmin-like complex subunit 4 isoform 2     52.0    1e-04   
ref|XP_008172740.1|  PREDICTED: HAUS augmin-like complex subunit 4    50.8    5e-04   Chrysemys picta bellii
ref|XP_010201610.1|  PREDICTED: HAUS augmin-like complex subunit 4    48.5    5e-04   Colius striatus



>gb|KDP39134.1| hypothetical protein JCGZ_00891 [Jatropha curcas]
Length=435

 Score =   260 bits (664),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 151/184 (82%), Positives = 164/184 (89%), Gaps = 9/184 (5%)
 Frame = -3

Query  718  SASNQIPTARXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkd  539
            S+++Q   AR PERVKLIIEEIEREEA LREDLYS+DRKFAEYYNVL QIL VLIKLV+D
Sbjct  256  SSTSQNSIARLPERVKLIIEEIEREEAALREDLYSADRKFAEYYNVLEQILAVLIKLVRD  315

Query  538  iklKHQHKYDELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKI  359
            +KL+HQHKYDELQKTWL KRC+TMSAKLR         VLEH+LLLETYT D+IPALHKI
Sbjct  316  LKLQHQHKYDELQKTWLCKRCETMSAKLR---------VLEHVLLLETYTKDSIPALHKI  366

Query  358  RKYLVESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDL  179
            RKYLVE+TEEAS+AYNKAATRLREYQGVDPHFD IARQYHDIVKKLENM+WTI QVEMDL
Sbjct  367  RKYLVEATEEASMAYNKAATRLREYQGVDPHFDTIARQYHDIVKKLENMQWTIHQVEMDL  426

Query  178  KRLP  167
            KRLP
Sbjct  427  KRLP  430



>ref|XP_002280015.1| PREDICTED: uncharacterized protein LOC100253742 [Vitis vinifera]
 emb|CBI26640.3| unnamed protein product [Vitis vinifera]
Length=437

 Score =   256 bits (655),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 152/188 (81%), Positives = 165/188 (88%), Gaps = 9/188 (5%)
 Frame = -3

Query  718  SASNQIPTARXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkd  539
            S+  Q  +AR PERVKLIIEEIEREEA LREDLYS+DRKFAEYYNVL QILGVLIKLVKD
Sbjct  258  SSRTQNSSARLPERVKLIIEEIEREEAALREDLYSADRKFAEYYNVLEQILGVLIKLVKD  317

Query  538  iklKHQHKYDELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKI  359
            +KL+HQHKYDELQKTWL KRC+TMSAKLR         VLEHILLLETYT D+IPALHKI
Sbjct  318  LKLQHQHKYDELQKTWLCKRCETMSAKLR---------VLEHILLLETYTQDSIPALHKI  368

Query  358  RKYLVESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDL  179
            RKYL+E+TEEAS+AYNKA TRLREYQGVDPHFD IARQYH+IVKKLENM+WTI QVEMDL
Sbjct  369  RKYLLEATEEASIAYNKAVTRLREYQGVDPHFDTIARQYHEIVKKLENMQWTIHQVEMDL  428

Query  178  KRLPAYPG  155
            KRLP +P 
Sbjct  429  KRLPDHPS  436



>ref|XP_009797126.1| PREDICTED: uncharacterized protein LOC104243609 [Nicotiana sylvestris]
Length=433

 Score =   256 bits (653),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 154/189 (81%), Positives = 162/189 (86%), Gaps = 9/189 (5%)
 Frame = -3

Query  718  SASNQIPTARXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkd  539
            SA NQ   AR PERVKLIIEEIEREE   REDLYSS+RKFAEYYNVL QILGVLIKLVKD
Sbjct  254  SAGNQSSAARLPERVKLIIEEIEREETAWREDLYSSNRKFAEYYNVLEQILGVLIKLVKD  313

Query  538  iklKHQHKYDELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKI  359
            IKL HQHKYDELQKTWL KRC+TM AKLR         VLEHILLLETYTP+TIPALHKI
Sbjct  314  IKLDHQHKYDELQKTWLCKRCETMRAKLR---------VLEHILLLETYTPETIPALHKI  364

Query  358  RKYLVESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDL  179
            RKYL+E+TEEASLAY KAA RLREYQGVDPHFD IARQYHDIVKKLE+M+WTI QVEMDL
Sbjct  365  RKYLIEATEEASLAYEKAAARLREYQGVDPHFDEIARQYHDIVKKLESMQWTINQVEMDL  424

Query  178  KRLPAYPGA  152
              LPA+PGA
Sbjct  425  NPLPAHPGA  433



>ref|XP_006452374.1| hypothetical protein CICLE_v10008353mg [Citrus clementina]
 ref|XP_006475067.1| PREDICTED: uncharacterized protein LOC102629463 [Citrus sinensis]
 gb|ESR65614.1| hypothetical protein CICLE_v10008353mg [Citrus clementina]
 gb|KDO62727.1| hypothetical protein CISIN_1g014093mg [Citrus sinensis]
Length=431

 Score =   254 bits (649),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 152/192 (79%), Positives = 167/192 (87%), Gaps = 10/192 (5%)
 Frame = -3

Query  724  IPSAS-NQIPTARXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvlikl  548
            I SAS N + TAR PERVK+IIEEIEREEA LREDLY++DRKFAEYYNVL QILGVLIKL
Sbjct  249  IDSASGNHMSTARLPERVKMIIEEIEREEAALREDLYAADRKFAEYYNVLEQILGVLIKL  308

Query  547  vkdiklKHQHKYDELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPAL  368
            VKD+KL+HQHKYDELQKTWL KRC+TMSAKLR         VLEH+LLL TYT ++IPAL
Sbjct  309  VKDLKLQHQHKYDELQKTWLCKRCETMSAKLR---------VLEHVLLLGTYTQESIPAL  359

Query  367  HKIRKYLVESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVE  188
            HKIRKYLVE+TEEAS+AYNKA TRLREYQGVDP FD IARQYHDIVKKLENM+WTI QVE
Sbjct  360  HKIRKYLVEATEEASVAYNKAVTRLREYQGVDPRFDNIARQYHDIVKKLENMQWTIHQVE  419

Query  187  MDLKRLPAYPGA  152
            MDLKRLP +P +
Sbjct  420  MDLKRLPDHPSS  431



>ref|XP_002532562.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29823.1| conserved hypothetical protein [Ricinus communis]
Length=432

 Score =   253 bits (645),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 148/187 (79%), Positives = 164/187 (88%), Gaps = 9/187 (5%)
 Frame = -3

Query  718  SASNQIPTARXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkd  539
            S++ Q   AR PERVKLIIEEIEREEA LREDLYS+DRKFAEYYNVL QIL VLIKLVKD
Sbjct  253  SSTGQNSIARLPERVKLIIEEIEREEAALREDLYSADRKFAEYYNVLEQILVVLIKLVKD  312

Query  538  iklKHQHKYDELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKI  359
            +KL+HQHKYD+LQKTWL KRC+TMSAKLR         VLEH+LLLETYT ++IPALHKI
Sbjct  313  LKLQHQHKYDDLQKTWLCKRCETMSAKLR---------VLEHVLLLETYTQESIPALHKI  363

Query  358  RKYLVESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDL  179
            RKYLVE+TEEAS+AYNKA TRLREYQGVDPHFD IARQYHDIVK+LE+M+WTI QVEMDL
Sbjct  364  RKYLVEATEEASMAYNKAVTRLREYQGVDPHFDTIARQYHDIVKRLESMQWTIHQVEMDL  423

Query  178  KRLPAYP  158
            KRLP +P
Sbjct  424  KRLPDHP  430



>ref|XP_011095401.1| PREDICTED: uncharacterized protein LOC105174869 [Sesamum indicum]
Length=433

 Score =   253 bits (645),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 154/188 (82%), Positives = 163/188 (87%), Gaps = 9/188 (5%)
 Frame = -3

Query  718  SASNQIPTARXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkd  539
            S+ +Q  T+R PERVKLIIEEIEREE   REDLYSSDRKFAEYYNVL QILGVLIKLVKD
Sbjct  254  SSVHQNLTSRLPERVKLIIEEIEREELAWREDLYSSDRKFAEYYNVLEQILGVLIKLVKD  313

Query  538  iklKHQHKYDELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKI  359
            +KL+HQHKYDELQKTWL KRC+TMSAKLR         VLEHILLLETYT +TIPALHKI
Sbjct  314  VKLRHQHKYDELQKTWLCKRCETMSAKLR---------VLEHILLLETYTTETIPALHKI  364

Query  358  RKYLVESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDL  179
            RKYLVESTEEASLAYNKA TRLREYQGVD HFD IARQYHDIVKKLENM+WTI QVEMDL
Sbjct  365  RKYLVESTEEASLAYNKAVTRLREYQGVDAHFDTIARQYHDIVKKLENMQWTIHQVEMDL  424

Query  178  KRLPAYPG  155
            KRLP +P 
Sbjct  425  KRLPDHPS  432



>ref|XP_010063011.1| PREDICTED: uncharacterized protein LOC104450241 [Eucalyptus grandis]
 gb|KCW70186.1| hypothetical protein EUGRSUZ_F03470 [Eucalyptus grandis]
Length=436

 Score =   252 bits (643),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 150/188 (80%), Positives = 164/188 (87%), Gaps = 9/188 (5%)
 Frame = -3

Query  718  SASNQIPTARXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkd  539
            S+ NQ  +AR PERVK IIEEIEREEA LREDLYS+DRKFAEYYNVL QILGVLIKLVKD
Sbjct  257  SSGNQNLSARLPERVKSIIEEIEREEAALREDLYSADRKFAEYYNVLEQILGVLIKLVKD  316

Query  538  iklKHQHKYDELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKI  359
            +KL+HQHKYDELQKTWL KRC+TMSAKLR         VL+HILL ETYT ++IPALHKI
Sbjct  317  LKLQHQHKYDELQKTWLCKRCETMSAKLR---------VLKHILLYETYTQESIPALHKI  367

Query  358  RKYLVESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDL  179
            RKYLVE+TEEAS+AYNKA TRLREYQGVDPHFD IARQYHDIVKKLENM+WTI QVEMDL
Sbjct  368  RKYLVEATEEASIAYNKAVTRLREYQGVDPHFDTIARQYHDIVKKLENMQWTIHQVEMDL  427

Query  178  KRLPAYPG  155
            KR+P +P 
Sbjct  428  KRMPDHPN  435



>ref|XP_002316767.2| hypothetical protein POPTR_0011s09280g [Populus trichocarpa]
 gb|EEE97379.2| hypothetical protein POPTR_0011s09280g [Populus trichocarpa]
Length=376

 Score =   250 bits (638),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 153/186 (82%), Positives = 165/186 (89%), Gaps = 9/186 (5%)
 Frame = -3

Query  709  NQIPTARXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkdikl  530
            NQ  TAR PERVKLIIEEIE+EEA LREDLYS+DRKFAEYYNVL QILGVLIKLVKD+KL
Sbjct  200  NQNSTARLPERVKLIIEEIEKEEAALREDLYSADRKFAEYYNVLEQILGVLIKLVKDLKL  259

Query  529  KHQHKYDELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKIRKY  350
            +HQHKYDELQKTWL KRC+TMSAKLR         VLEH+LLLETYT ++IPALHKIRKY
Sbjct  260  QHQHKYDELQKTWLCKRCETMSAKLR---------VLEHVLLLETYTQESIPALHKIRKY  310

Query  349  LVESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRL  170
            LVE+TEEAS+AYNKA TRLREYQGVDPHFD IARQYHDIVKKLENM+WTI QVEMDLKRL
Sbjct  311  LVEATEEASIAYNKAVTRLREYQGVDPHFDTIARQYHDIVKKLENMQWTIHQVEMDLKRL  370

Query  169  PAYPGA  152
            P +P A
Sbjct  371  PDHPRA  376



>ref|XP_009592787.1| PREDICTED: uncharacterized protein LOC104089563 [Nicotiana tomentosiformis]
Length=433

 Score =   251 bits (642),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 161/189 (85%), Gaps = 9/189 (5%)
 Frame = -3

Query  718  SASNQIPTARXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkd  539
            SA NQ   AR PERVKLIIEEIEREE   REDLYSS+RKFAEYYNVL QILGVLIKLVKD
Sbjct  254  SAGNQSSAARLPERVKLIIEEIEREETAWREDLYSSNRKFAEYYNVLEQILGVLIKLVKD  313

Query  538  iklKHQHKYDELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKI  359
            IKL HQHKYDELQKTWL KRC+TM AKLR         VLEHILLLETYTP+TIPALHKI
Sbjct  314  IKLDHQHKYDELQKTWLCKRCETMRAKLR---------VLEHILLLETYTPETIPALHKI  364

Query  358  RKYLVESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDL  179
            RKYL+E+TEEASLAY KAA RLREYQGVDPHFD IARQYHDIVKKLE+M+WTI QVEMDL
Sbjct  365  RKYLIEATEEASLAYEKAAARLREYQGVDPHFDEIARQYHDIVKKLESMQWTINQVEMDL  424

Query  178  KRLPAYPGA  152
              LPA+P A
Sbjct  425  NPLPAHPRA  433



>ref|XP_011012481.1| PREDICTED: uncharacterized protein LOC105116724 [Populus euphratica]
Length=430

 Score =   251 bits (640),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 153/186 (82%), Positives = 165/186 (89%), Gaps = 9/186 (5%)
 Frame = -3

Query  709  NQIPTARXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkdikl  530
            NQ  TAR PERVKLIIEEIE+EEA LREDLYS+DRKFAEYYNVL QILGVLIKLVKD+KL
Sbjct  254  NQNSTARLPERVKLIIEEIEKEEAALREDLYSADRKFAEYYNVLEQILGVLIKLVKDLKL  313

Query  529  KHQHKYDELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKIRKY  350
            +HQHKYDELQKTWL KRC+TMSAKLR         VLEH+LLLETYT ++IPALHKIRKY
Sbjct  314  QHQHKYDELQKTWLCKRCETMSAKLR---------VLEHVLLLETYTQESIPALHKIRKY  364

Query  349  LVESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRL  170
            LVE+TEEAS+AYNKA TRLREYQGVDPHFD IARQYHDIVKKLENM+WTI QVEMDLKRL
Sbjct  365  LVEATEEASIAYNKAVTRLREYQGVDPHFDTIARQYHDIVKKLENMQWTIHQVEMDLKRL  424

Query  169  PAYPGA  152
            P +P A
Sbjct  425  PDHPRA  430



>gb|ABK96275.1| unknown [Populus trichocarpa x Populus deltoides]
Length=429

 Score =   251 bits (640),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 153/186 (82%), Positives = 165/186 (89%), Gaps = 9/186 (5%)
 Frame = -3

Query  709  NQIPTARXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkdikl  530
            NQ  TAR PERVKLIIEEIE+EEA LREDLYS+DRKFAEYYNVL QILGVLIKLVKD+KL
Sbjct  253  NQNSTARLPERVKLIIEEIEKEEAALREDLYSADRKFAEYYNVLEQILGVLIKLVKDLKL  312

Query  529  KHQHKYDELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKIRKY  350
            +HQHKYDELQKTWL KRC+TMSAKLR         VLEH+LLLETYT ++IPALHKIRKY
Sbjct  313  QHQHKYDELQKTWLCKRCETMSAKLR---------VLEHVLLLETYTQESIPALHKIRKY  363

Query  349  LVESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRL  170
            LVE+TEEAS+AYNKA TRLREYQGVDPHFD IARQYHDIVKKLENM+WTI QVEMDLKRL
Sbjct  364  LVEATEEASIAYNKAVTRLREYQGVDPHFDTIARQYHDIVKKLENMQWTIHQVEMDLKRL  423

Query  169  PAYPGA  152
            P +P A
Sbjct  424  PDHPRA  429



>ref|XP_009144940.1| PREDICTED: uncharacterized protein LOC103868607 [Brassica rapa]
 emb|CDY29600.1| BnaA05g15700D [Brassica napus]
Length=406

 Score =   248 bits (632),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 157/181 (87%), Gaps = 9/181 (5%)
 Frame = -3

Query  718  SASNQIPTARXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkd  539
            S  NQ  +AR PERVK IIEEIEREEA LREDLYS+DRKFAEYYNVL QILGVLIKLVKD
Sbjct  232  STGNQNSSARLPERVKFIIEEIEREEAALREDLYSADRKFAEYYNVLEQILGVLIKLVKD  291

Query  538  iklKHQHKYDELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKI  359
            +KL+HQHKYDE+QKTWL KRC+TM+AKLR         VLEHILLLETYTP++IPALH I
Sbjct  292  LKLEHQHKYDEMQKTWLCKRCETMNAKLR---------VLEHILLLETYTPESIPALHSI  342

Query  358  RKYLVESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDL  179
            R YLVE+TEEAS AYNKA TRLREYQGVDPHFD IARQYHDIVKKLENM+WTI QVEMDL
Sbjct  343  RNYLVEATEEASAAYNKAVTRLREYQGVDPHFDTIARQYHDIVKKLENMQWTIHQVEMDL  402

Query  178  K  176
            K
Sbjct  403  K  403



>ref|XP_009147810.1| PREDICTED: uncharacterized protein LOC103871323 [Brassica rapa]
Length=419

 Score =   248 bits (632),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 157/181 (87%), Gaps = 9/181 (5%)
 Frame = -3

Query  718  SASNQIPTARXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkd  539
            S  NQ  +AR PERVK IIEEIEREEA LREDLYS+DRKFAEYYNVL QILGVLIKLVKD
Sbjct  245  STGNQNSSARLPERVKFIIEEIEREEAALREDLYSADRKFAEYYNVLEQILGVLIKLVKD  304

Query  538  iklKHQHKYDELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKI  359
            +KL+HQHKYDE+QKTWL KRC+TM+AKLR         VLEHILLLETYTP++IPALH I
Sbjct  305  LKLEHQHKYDEMQKTWLCKRCETMNAKLR---------VLEHILLLETYTPESIPALHSI  355

Query  358  RKYLVESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDL  179
            R YLVE+TEEAS AYNKA TRLREYQGVDPHFD IARQYHDIVKKLENM+WTI QVEMDL
Sbjct  356  RNYLVEATEEASAAYNKAVTRLREYQGVDPHFDTIARQYHDIVKKLENMQWTIHQVEMDL  415

Query  178  K  176
            K
Sbjct  416  K  416



>emb|CDY22815.1| BnaA06g02620D [Brassica napus]
Length=419

 Score =   248 bits (632),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 157/181 (87%), Gaps = 9/181 (5%)
 Frame = -3

Query  718  SASNQIPTARXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkd  539
            S  NQ  +AR PERVK IIEEIEREEA LREDLYS+DRKFAEYYNVL QILGVLIKLVKD
Sbjct  245  STGNQNSSARLPERVKFIIEEIEREEAALREDLYSADRKFAEYYNVLEQILGVLIKLVKD  304

Query  538  iklKHQHKYDELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKI  359
            +KL+HQHKYDE+QKTWL KRC+TM+AKLR         VLEHILLLETYTP++IPALH I
Sbjct  305  LKLEHQHKYDEMQKTWLCKRCETMNAKLR---------VLEHILLLETYTPESIPALHSI  355

Query  358  RKYLVESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDL  179
            R YLVE+TEEAS AYNKA TRLREYQGVDPHFD IARQYHDIVKKLENM+WTI QVEMDL
Sbjct  356  RNYLVEATEEASAAYNKAVTRLREYQGVDPHFDTIARQYHDIVKKLENMQWTIHQVEMDL  415

Query  178  K  176
            K
Sbjct  416  K  416



>ref|XP_007020817.1| HAUS augmin-like complex subunit 4 isoform 3 [Theobroma cacao]
 gb|EOY12342.1| HAUS augmin-like complex subunit 4 isoform 3 [Theobroma cacao]
Length=313

 Score =   244 bits (623),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 144/175 (82%), Positives = 156/175 (89%), Gaps = 9/175 (5%)
 Frame = -3

Query  691  RXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkdiklKHQHKY  512
            R PERVKLI EEIEREEA LREDLYS+DRKFAEYYNVL QILGVLIKLVKD+KL+HQHKY
Sbjct  143  RLPERVKLITEEIEREEAALREDLYSADRKFAEYYNVLEQILGVLIKLVKDLKLQHQHKY  202

Query  511  DELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKIRKYLVESTE  332
            DELQKTWL KRC+TM+AKLR         VLEH+LLLETYT ++IPALHKIRKYL+E+TE
Sbjct  203  DELQKTWLCKRCETMNAKLR---------VLEHVLLLETYTQESIPALHKIRKYLLEATE  253

Query  331  EASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRLP  167
            EAS AYNKA TRLREYQGVDPHFD IARQYH+IVKKLENM+WTI QVEMDLKRLP
Sbjct  254  EASAAYNKAVTRLREYQGVDPHFDTIARQYHEIVKKLENMQWTIHQVEMDLKRLP  308



>ref|XP_006393115.1| hypothetical protein EUTSA_v10011513mg [Eutrema salsugineum]
 gb|ESQ30401.1| hypothetical protein EUTSA_v10011513mg [Eutrema salsugineum]
Length=423

 Score =   248 bits (632),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 157/181 (87%), Gaps = 9/181 (5%)
 Frame = -3

Query  718  SASNQIPTARXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkd  539
            S  NQ  +AR PERVK IIEEIEREEA LREDLYS+DRKFAEYYNVL QILGVLIKLVKD
Sbjct  249  STGNQNSSARLPERVKFIIEEIEREEAALREDLYSADRKFAEYYNVLEQILGVLIKLVKD  308

Query  538  iklKHQHKYDELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKI  359
            +KL+HQHKYDE+QKTWL KRC+TM+AKLR         VLEHILLLETYTP++IPALH I
Sbjct  309  LKLEHQHKYDEMQKTWLCKRCETMNAKLR---------VLEHILLLETYTPESIPALHSI  359

Query  358  RKYLVESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDL  179
            R YLVE+TEEAS AYNKA TRLREYQGVDPHFD IARQYHDIVKKLENM+WTI QVEMDL
Sbjct  360  RNYLVEATEEASAAYNKAVTRLREYQGVDPHFDTIARQYHDIVKKLENMQWTIHQVEMDL  419

Query  178  K  176
            K
Sbjct  420  K  420



>emb|CDY37107.1| BnaC06g03920D [Brassica napus]
Length=419

 Score =   248 bits (632),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 157/181 (87%), Gaps = 9/181 (5%)
 Frame = -3

Query  718  SASNQIPTARXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkd  539
            S  NQ  +AR PERVK IIEEIEREEA LREDLYS+DRKFAEYYNVL QILGVLIKLVKD
Sbjct  245  STGNQNSSARLPERVKFIIEEIEREEAALREDLYSADRKFAEYYNVLEQILGVLIKLVKD  304

Query  538  iklKHQHKYDELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKI  359
            +KL+HQHKYDE+QKTWL KRC+TM+AKLR         VLEHILLLETYTP++IPALH I
Sbjct  305  LKLEHQHKYDEMQKTWLCKRCETMNAKLR---------VLEHILLLETYTPESIPALHSI  355

Query  358  RKYLVESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDL  179
            R YLVE+TEEAS AYNKA TRLREYQGVDPHFD IARQYHDIVKKLENM+WTI QVEMDL
Sbjct  356  RNYLVEATEEASAAYNKAVTRLREYQGVDPHFDTIARQYHDIVKKLENMQWTIHQVEMDL  415

Query  178  K  176
            K
Sbjct  416  K  416



>gb|KJB62820.1| hypothetical protein B456_009G438400 [Gossypium raimondii]
Length=380

 Score =   246 bits (628),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 146/175 (83%), Positives = 157/175 (90%), Gaps = 9/175 (5%)
 Frame = -3

Query  691  RXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkdiklKHQHKY  512
            R PERVKLIIEEIEREEA LREDLYS+DRKFAEYYNVL QILGVLIKLVKD+KL+HQH+Y
Sbjct  210  RLPERVKLIIEEIEREEAALREDLYSADRKFAEYYNVLEQILGVLIKLVKDLKLQHQHQY  269

Query  511  DELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKIRKYLVESTE  332
            DELQKTWL KRC+TMSAKLR         VLEH+LLLETYT ++IPALHKIRKYLVE+TE
Sbjct  270  DELQKTWLCKRCETMSAKLR---------VLEHVLLLETYTQESIPALHKIRKYLVEATE  320

Query  331  EASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRLP  167
            EAS AYNKA TRLREYQGVDPHFD IARQYHD+VKKLENM+WTI QVEMDLKRLP
Sbjct  321  EASAAYNKAVTRLREYQGVDPHFDTIARQYHDVVKKLENMQWTIHQVEMDLKRLP  375



>gb|EYU27337.1| hypothetical protein MIMGU_mgv1a006702mg [Erythranthe guttata]
Length=434

 Score =   247 bits (631),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 148/187 (79%), Positives = 162/187 (87%), Gaps = 9/187 (5%)
 Frame = -3

Query  718  SASNQIPTARXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkd  539
            S  +Q  T+R PERVK+IIEEIEREE   REDLYSSDRKFAEYYNVL QIL VLIKLVKD
Sbjct  255  STGHQNMTSRLPERVKVIIEEIEREELAWREDLYSSDRKFAEYYNVLEQILAVLIKLVKD  314

Query  538  iklKHQHKYDELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKI  359
            +KL+HQHKYDELQKTWL KRC+TMSAKLR+         LEHILLLETYT +TIPALH+I
Sbjct  315  VKLRHQHKYDELQKTWLCKRCETMSAKLRA---------LEHILLLETYTRETIPALHEI  365

Query  358  RKYLVESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDL  179
            RK+LVESTEEASL+YNKA TRLREYQGVDPHFD IARQYH+IVKKLENM+WTI QVEMDL
Sbjct  366  RKFLVESTEEASLSYNKAVTRLREYQGVDPHFDTIARQYHEIVKKLENMQWTIHQVEMDL  425

Query  178  KRLPAYP  158
            KRLP +P
Sbjct  426  KRLPDHP  432



>ref|XP_004302887.1| PREDICTED: uncharacterized protein LOC101313133 [Fragaria vesca 
subsp. vesca]
Length=434

 Score =   247 bits (631),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 143/189 (76%), Positives = 165/189 (87%), Gaps = 9/189 (5%)
 Frame = -3

Query  718  SASNQIPTARXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkd  539
            S+ +Q   AR PERVKLIIEE+ER+EA L++DLYS+DRKFAEYYNVL QIL VLIKLVKD
Sbjct  255  SSGHQNLNARLPERVKLIIEEMERDEAALQDDLYSADRKFAEYYNVLEQILAVLIKLVKD  314

Query  538  iklKHQHKYDELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKI  359
            +KL+HQHKY++L+KTWL KRC+TMSAKLR         VLE++LLLETYT ++IPALHKI
Sbjct  315  LKLQHQHKYEDLRKTWLCKRCETMSAKLR---------VLENVLLLETYTNESIPALHKI  365

Query  358  RKYLVESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDL  179
            RKYL+E+TEEAS+AYNKA TRLREYQGVDPHFD IARQYHDIVKKLENM+WTIQQVEMDL
Sbjct  366  RKYLLEATEEASMAYNKAVTRLREYQGVDPHFDNIARQYHDIVKKLENMQWTIQQVEMDL  425

Query  178  KRLPAYPGA  152
            KRLP +  A
Sbjct  426  KRLPDHANA  434



>ref|XP_008342667.1| PREDICTED: uncharacterized protein LOC103405443 [Malus domestica]
Length=430

 Score =   246 bits (629),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 143/180 (79%), Positives = 158/180 (88%), Gaps = 9/180 (5%)
 Frame = -3

Query  691  RXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkdiklKHQHKY  512
            R PERVKLIIEE+EREE  LREDLYS+DRKFAEYYNVL QILGVLIKLV+D+KL+HQHKY
Sbjct  260  RLPERVKLIIEEMEREETALREDLYSADRKFAEYYNVLEQILGVLIKLVRDLKLQHQHKY  319

Query  511  DELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKIRKYLVESTE  332
            D LQKTWL KRC+TMSAKLR         VLEH+LLLETYT ++IPALHKIRKYL+E+TE
Sbjct  320  DGLQKTWLCKRCETMSAKLR---------VLEHVLLLETYTKESIPALHKIRKYLLEATE  370

Query  331  EASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRLPAYPGA  152
            EAS+AYNKA TRLREYQGVDPHFD IARQYHDI+KKLENM+WTI QVEMDLKRLP +  A
Sbjct  371  EASIAYNKAVTRLREYQGVDPHFDTIARQYHDIIKKLENMQWTIHQVEMDLKRLPDHANA  430



>ref|XP_010545512.1| PREDICTED: uncharacterized protein LOC104817858 [Tarenaya hassleriana]
Length=427

 Score =   246 bits (629),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 147/184 (80%), Positives = 160/184 (87%), Gaps = 9/184 (5%)
 Frame = -3

Query  718  SASNQIPTARXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkd  539
            S+ NQ  +AR PERVKLIIEEIEREEA LREDLYS+DRKF EYYNVL QILGVLIKLVKD
Sbjct  251  SSGNQNSSARLPERVKLIIEEIEREEADLREDLYSADRKFTEYYNVLEQILGVLIKLVKD  310

Query  538  iklKHQHKYDELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKI  359
            +KL+ QH+YDELQKTWL KRC+TMSAKLR         VLEH+LLLETYT ++IPALHKI
Sbjct  311  LKLQRQHEYDELQKTWLCKRCETMSAKLR---------VLEHVLLLETYTRESIPALHKI  361

Query  358  RKYLVESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDL  179
            R YLVE+TEEAS AYNKA TRLREYQGVDPHFD IARQYHDIV+KLENM+WTI QVEMDL
Sbjct  362  RSYLVEATEEASAAYNKAVTRLREYQGVDPHFDTIARQYHDIVQKLENMQWTIHQVEMDL  421

Query  178  KRLP  167
            KRLP
Sbjct  422  KRLP  425



>gb|KJB62818.1| hypothetical protein B456_009G438400 [Gossypium raimondii]
Length=425

 Score =   246 bits (629),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 146/175 (83%), Positives = 157/175 (90%), Gaps = 9/175 (5%)
 Frame = -3

Query  691  RXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkdiklKHQHKY  512
            R PERVKLIIEEIEREEA LREDLYS+DRKFAEYYNVL QILGVLIKLVKD+KL+HQH+Y
Sbjct  255  RLPERVKLIIEEIEREEAALREDLYSADRKFAEYYNVLEQILGVLIKLVKDLKLQHQHQY  314

Query  511  DELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKIRKYLVESTE  332
            DELQKTWL KRC+TMSAKLR         VLEH+LLLETYT ++IPALHKIRKYLVE+TE
Sbjct  315  DELQKTWLCKRCETMSAKLR---------VLEHVLLLETYTQESIPALHKIRKYLVEATE  365

Query  331  EASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRLP  167
            EAS AYNKA TRLREYQGVDPHFD IARQYHD+VKKLENM+WTI QVEMDLKRLP
Sbjct  366  EASAAYNKAVTRLREYQGVDPHFDTIARQYHDVVKKLENMQWTIHQVEMDLKRLP  420



>ref|XP_009353598.1| PREDICTED: uncharacterized protein LOC103944849 isoform X3 [Pyrus 
x bretschneideri]
Length=400

 Score =   245 bits (625),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 142/180 (79%), Positives = 158/180 (88%), Gaps = 9/180 (5%)
 Frame = -3

Query  691  RXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkdiklKHQHKY  512
            R PERVKLIIE++EREE  LREDLYS+DRKFAEYYNVL QILGVLIKLV+D+KL+HQHKY
Sbjct  230  RLPERVKLIIEDMEREETALREDLYSADRKFAEYYNVLEQILGVLIKLVRDLKLQHQHKY  289

Query  511  DELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKIRKYLVESTE  332
            D LQKTWL KRC+TMSAKLR         VLEH+LLLETYT ++IPALHKIRKYL+E+TE
Sbjct  290  DGLQKTWLCKRCETMSAKLR---------VLEHVLLLETYTKESIPALHKIRKYLLEATE  340

Query  331  EASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRLPAYPGA  152
            EAS+AYNKA TRLREYQGVDPHFD IARQYHDI+KKLENM+WTI QVEMDLKRLP +  A
Sbjct  341  EASIAYNKAVTRLREYQGVDPHFDTIARQYHDIIKKLENMQWTIHQVEMDLKRLPDHANA  400



>ref|XP_009353594.1| PREDICTED: uncharacterized protein LOC103944849 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009353595.1| PREDICTED: uncharacterized protein LOC103944849 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009353596.1| PREDICTED: uncharacterized protein LOC103944849 isoform X1 [Pyrus 
x bretschneideri]
Length=435

 Score =   246 bits (628),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 142/180 (79%), Positives = 158/180 (88%), Gaps = 9/180 (5%)
 Frame = -3

Query  691  RXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkdiklKHQHKY  512
            R PERVKLIIE++EREE  LREDLYS+DRKFAEYYNVL QILGVLIKLV+D+KL+HQHKY
Sbjct  265  RLPERVKLIIEDMEREETALREDLYSADRKFAEYYNVLEQILGVLIKLVRDLKLQHQHKY  324

Query  511  DELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKIRKYLVESTE  332
            D LQKTWL KRC+TMSAKLR         VLEH+LLLETYT ++IPALHKIRKYL+E+TE
Sbjct  325  DGLQKTWLCKRCETMSAKLR---------VLEHVLLLETYTKESIPALHKIRKYLLEATE  375

Query  331  EASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRLPAYPGA  152
            EAS+AYNKA TRLREYQGVDPHFD IARQYHDI+KKLENM+WTI QVEMDLKRLP +  A
Sbjct  376  EASIAYNKAVTRLREYQGVDPHFDTIARQYHDIIKKLENMQWTIHQVEMDLKRLPDHANA  435



>ref|XP_004500070.1| PREDICTED: uncharacterized protein LOC101512734 [Cicer arietinum]
Length=431

 Score =   245 bits (626),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 145/175 (83%), Positives = 159/175 (91%), Gaps = 9/175 (5%)
 Frame = -3

Query  691  RXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkdiklKHQHKY  512
            R PERVKL+IEEIEREEA+LR+DLYS+DRKFAEYYNVL QILGVLIKLVKD+KL+HQHKY
Sbjct  261  RLPERVKLLIEEIEREEASLRDDLYSADRKFAEYYNVLEQILGVLIKLVKDLKLEHQHKY  320

Query  511  DELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKIRKYLVESTE  332
            D+LQKTWL KRC+TMSAKLR         VLEH+LLLETYT ++IPALHKIRKYLVE+TE
Sbjct  321  DDLQKTWLCKRCETMSAKLR---------VLEHVLLLETYTKESIPALHKIRKYLVEATE  371

Query  331  EASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRLP  167
            EAS+AYNKA TRLREYQGVDPHFD IARQYHDIVKKLENM+WTI QVEMDLKRLP
Sbjct  372  EASIAYNKAVTRLREYQGVDPHFDNIARQYHDIVKKLENMQWTIDQVEMDLKRLP  426



>ref|XP_007146480.1| hypothetical protein PHAVU_006G044000g [Phaseolus vulgaris]
 gb|ESW18474.1| hypothetical protein PHAVU_006G044000g [Phaseolus vulgaris]
Length=425

 Score =   245 bits (626),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 144/178 (81%), Positives = 157/178 (88%), Gaps = 9/178 (5%)
 Frame = -3

Query  691  RXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkdiklKHQHKY  512
            R PERVKL+IEEIEREE  LR+DLYS+DRKFAEYYNVL QIL VLIKLVKD+KL+HQHKY
Sbjct  255  RLPERVKLLIEEIEREETALRDDLYSADRKFAEYYNVLEQILAVLIKLVKDLKLEHQHKY  314

Query  511  DELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKIRKYLVESTE  332
            D+LQKTWL KRC+TMSAKLR         VLEH+LLLETYT D+IPALHKIRKYLVE+TE
Sbjct  315  DDLQKTWLCKRCETMSAKLR---------VLEHVLLLETYTKDSIPALHKIRKYLVEATE  365

Query  331  EASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRLPAYP  158
            EAS+AYNKA TRLREYQGVDPHFD IARQYHDIV+KLENM+WTI QVEMDLKRLP  P
Sbjct  366  EASIAYNKAVTRLREYQGVDPHFDNIARQYHDIVQKLENMQWTIHQVEMDLKRLPDKP  423



>ref|XP_009353597.1| PREDICTED: uncharacterized protein LOC103944849 isoform X2 [Pyrus 
x bretschneideri]
Length=407

 Score =   244 bits (624),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 142/180 (79%), Positives = 158/180 (88%), Gaps = 9/180 (5%)
 Frame = -3

Query  691  RXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkdiklKHQHKY  512
            R PERVKLIIE++EREE  LREDLYS+DRKFAEYYNVL QILGVLIKLV+D+KL+HQHKY
Sbjct  237  RLPERVKLIIEDMEREETALREDLYSADRKFAEYYNVLEQILGVLIKLVRDLKLQHQHKY  296

Query  511  DELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKIRKYLVESTE  332
            D LQKTWL KRC+TMSAKLR         VLEH+LLLETYT ++IPALHKIRKYL+E+TE
Sbjct  297  DGLQKTWLCKRCETMSAKLR---------VLEHVLLLETYTKESIPALHKIRKYLLEATE  347

Query  331  EASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRLPAYPGA  152
            EAS+AYNKA TRLREYQGVDPHFD IARQYHDI+KKLENM+WTI QVEMDLKRLP +  A
Sbjct  348  EASIAYNKAVTRLREYQGVDPHFDTIARQYHDIIKKLENMQWTIHQVEMDLKRLPDHANA  407



>ref|XP_009338054.1| PREDICTED: uncharacterized protein LOC103930437 [Pyrus x bretschneideri]
 ref|XP_009338055.1| PREDICTED: uncharacterized protein LOC103930438 [Pyrus x bretschneideri]
Length=430

 Score =   245 bits (626),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 142/175 (81%), Positives = 156/175 (89%), Gaps = 9/175 (5%)
 Frame = -3

Query  691  RXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkdiklKHQHKY  512
            R PERVKLIIEE+EREE  LREDLYS+DRKFAEYYNVL QILGVLIKLV+D+KL+HQHKY
Sbjct  260  RLPERVKLIIEEMEREETALREDLYSADRKFAEYYNVLEQILGVLIKLVRDLKLQHQHKY  319

Query  511  DELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKIRKYLVESTE  332
            D LQKTWL KRC+TMSAKLR         VLEH+LLLETYT ++IPALHKIRKYL+E+TE
Sbjct  320  DGLQKTWLCKRCETMSAKLR---------VLEHVLLLETYTKESIPALHKIRKYLLEATE  370

Query  331  EASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRLP  167
            EAS+AYNKA TRLREYQGVDPHFD IARQYHDI+KKLENM+WTI QVEMDLKRLP
Sbjct  371  EASIAYNKAVTRLREYQGVDPHFDTIARQYHDIIKKLENMQWTIHQVEMDLKRLP  425



>ref|XP_007020815.1| HAUS augmin-like complex subunit 4 isoform 1 [Theobroma cacao]
 gb|EOY12340.1| HAUS augmin-like complex subunit 4 isoform 1 [Theobroma cacao]
Length=420

 Score =   243 bits (620),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 144/175 (82%), Positives = 156/175 (89%), Gaps = 9/175 (5%)
 Frame = -3

Query  691  RXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkdiklKHQHKY  512
            R PERVKLI EEIEREEA LREDLYS+DRKFAEYYNVL QILGVLIKLVKD+KL+HQHKY
Sbjct  250  RLPERVKLITEEIEREEAALREDLYSADRKFAEYYNVLEQILGVLIKLVKDLKLQHQHKY  309

Query  511  DELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKIRKYLVESTE  332
            DELQKTWL KRC+TM+AKLR         VLEH+LLLETYT ++IPALHKIRKYL+E+TE
Sbjct  310  DELQKTWLCKRCETMNAKLR---------VLEHVLLLETYTQESIPALHKIRKYLLEATE  360

Query  331  EASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRLP  167
            EAS AYNKA TRLREYQGVDPHFD IARQYH+IVKKLENM+WTI QVEMDLKRLP
Sbjct  361  EASAAYNKAVTRLREYQGVDPHFDTIARQYHEIVKKLENMQWTIHQVEMDLKRLP  415



>ref|XP_006365955.1| PREDICTED: uncharacterized protein LOC102604282 [Solanum tuberosum]
Length=433

 Score =   243 bits (621),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 146/186 (78%), Positives = 160/186 (86%), Gaps = 9/186 (5%)
 Frame = -3

Query  718  SASNQIPTARXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkd  539
            SA++Q   AR PERVKLI EEIEREE   R+DLYSS+RKFAEYYNVL QILGVLIKLVKD
Sbjct  254  SAASQNSAARLPERVKLITEEIEREEEAWRDDLYSSNRKFAEYYNVLEQILGVLIKLVKD  313

Query  538  iklKHQHKYDELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKI  359
            IKL HQHKYDELQKTWL KRC+TM AKLR         VLEH+LLL+TYTP+TIPALHKI
Sbjct  314  IKLDHQHKYDELQKTWLCKRCETMRAKLR---------VLEHVLLLDTYTPETIPALHKI  364

Query  358  RKYLVESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDL  179
            RKYL+E+TEEASLAY KAA+RLREYQGVDPHFD IARQYHDIVKKLE+M+WTI QVEMDL
Sbjct  365  RKYLIEATEEASLAYEKAASRLREYQGVDPHFDEIARQYHDIVKKLESMQWTINQVEMDL  424

Query  178  KRLPAY  161
              LPA+
Sbjct  425  NPLPAH  430



>gb|KHM99560.1| HAUS augmin-like complex subunit 4 [Glycine soja]
Length=425

 Score =   242 bits (618),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 155/178 (87%), Gaps = 9/178 (5%)
 Frame = -3

Query  691  RXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkdiklKHQHKY  512
            R PERVKL+IEEIEREE  LR+DLYS+DRKFAEYYNVL QIL VLIKLVKD+KL+HQHKY
Sbjct  255  RLPERVKLLIEEIEREETALRDDLYSADRKFAEYYNVLEQILAVLIKLVKDLKLEHQHKY  314

Query  511  DELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKIRKYLVESTE  332
            DE+QKTWL KRC+TMS KL          VLEH+LLLETYT D+IPALHKIRKYLVE+TE
Sbjct  315  DEMQKTWLCKRCETMSVKLS---------VLEHVLLLETYTKDSIPALHKIRKYLVEATE  365

Query  331  EASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRLPAYP  158
            EAS+AYNKA TRLREYQGVDPHFD IARQYHDIV+KLENM+WTI QVEMDLKRLP  P
Sbjct  366  EASIAYNKAVTRLREYQGVDPHFDNIARQYHDIVQKLENMQWTIHQVEMDLKRLPDKP  423



>ref|XP_003551881.1| PREDICTED: uncharacterized protein LOC100790889 [Glycine max]
 gb|KHN02840.1| HAUS augmin-like complex subunit 4 [Glycine soja]
Length=425

 Score =   242 bits (617),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 143/179 (80%), Positives = 155/179 (87%), Gaps = 9/179 (5%)
 Frame = -3

Query  691  RXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkdiklKHQHKY  512
            R PERVKL+IEEIEREE  LR+DLYS+DRKFAEYYNVL QIL VLIKLVKD+KL+HQHKY
Sbjct  255  RFPERVKLLIEEIEREETALRDDLYSADRKFAEYYNVLEQILAVLIKLVKDLKLEHQHKY  314

Query  511  DELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKIRKYLVESTE  332
            DE QKTWL KRC+TMSAKL          VLEH+LLLETYT D+IPALHKIRKYLVE+TE
Sbjct  315  DETQKTWLCKRCETMSAKLS---------VLEHVLLLETYTKDSIPALHKIRKYLVEATE  365

Query  331  EASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRLPAYPG  155
            EAS+AYNKA TRLREYQGVDPHFD IARQYHDIV+KLENM+WTI QVEMDLKRLP  P 
Sbjct  366  EASIAYNKAVTRLREYQGVDPHFDNIARQYHDIVQKLENMQWTIHQVEMDLKRLPDKPN  424



>ref|NP_001242486.1| uncharacterized protein LOC100786070 [Glycine max]
 gb|ACU20702.1| unknown [Glycine max]
Length=425

 Score =   241 bits (615),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 155/178 (87%), Gaps = 9/178 (5%)
 Frame = -3

Query  691  RXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkdiklKHQHKY  512
            R PERVKL+IEEIEREE  LR+DLYS+DRKFAEYYNVL QIL VLIKLVKD+KL+HQHK 
Sbjct  255  RLPERVKLLIEEIEREETALRDDLYSADRKFAEYYNVLEQILAVLIKLVKDLKLEHQHKC  314

Query  511  DELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKIRKYLVESTE  332
            DE+QKTWL KRC+TMSAKL          VLEH+LLLETYT D+IPALHKIRKYLVE+TE
Sbjct  315  DEMQKTWLCKRCETMSAKLS---------VLEHVLLLETYTKDSIPALHKIRKYLVEATE  365

Query  331  EASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRLPAYP  158
            EAS+AYNKA TRLREYQGVDPHFD IARQYHDIV+KLENM+WTI QVEMDLKRLP  P
Sbjct  366  EASIAYNKAVTRLREYQGVDPHFDNIARQYHDIVQKLENMQWTIHQVEMDLKRLPDKP  423



>ref|XP_004251462.1| PREDICTED: uncharacterized protein LOC101257536 [Solanum lycopersicum]
Length=427

 Score =   241 bits (614),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 147/186 (79%), Positives = 160/186 (86%), Gaps = 9/186 (5%)
 Frame = -3

Query  718  SASNQIPTARXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkd  539
            SA++Q   AR PERVKLI EEIEREE   REDLYSS+RKFAEYYNVL QILGVLIKLVKD
Sbjct  248  SAASQNSAARLPERVKLITEEIEREEEAWREDLYSSNRKFAEYYNVLEQILGVLIKLVKD  307

Query  538  iklKHQHKYDELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKI  359
            IKL HQHKYDELQKTWL KRC+TM AKLR         VLEH+LLL+TYTP+TIPALHKI
Sbjct  308  IKLDHQHKYDELQKTWLCKRCETMRAKLR---------VLEHVLLLDTYTPETIPALHKI  358

Query  358  RKYLVESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDL  179
            RKYL+E+TEEASLAY KAA+RLREYQGVDPHFD IARQYHDIVKKLE+M+WTI QVEMDL
Sbjct  359  RKYLIEATEEASLAYEKAASRLREYQGVDPHFDEIARQYHDIVKKLESMQWTINQVEMDL  418

Query  178  KRLPAY  161
              LPA+
Sbjct  419  NPLPAH  424



>ref|XP_008447737.1| PREDICTED: uncharacterized protein LOC103490141 [Cucumis melo]
Length=430

 Score =   240 bits (613),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 142/176 (81%), Positives = 157/176 (89%), Gaps = 9/176 (5%)
 Frame = -3

Query  694  ARXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkdiklKHQHK  515
            AR PERVKLIIEEIEREEA LR++LYS+DRKFAEYYNVL QILGVLIKLVKD+KL+HQHK
Sbjct  259  ARLPERVKLIIEEIEREEAALRQELYSADRKFAEYYNVLEQILGVLIKLVKDLKLQHQHK  318

Query  514  YDELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKIRKYLVEST  335
            YD+LQKTWL KRC+TM+AKL          VLEH+LLLETYT ++IPALHKIRKYLVE+T
Sbjct  319  YDDLQKTWLCKRCETMNAKLS---------VLEHVLLLETYTQESIPALHKIRKYLVEAT  369

Query  334  EEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRLP  167
            EEAS++YNKA TRLREYQGVDPHFD IARQYHDIV KLENM+WTI QVEMDLKRLP
Sbjct  370  EEASISYNKAVTRLREYQGVDPHFDNIARQYHDIVMKLENMQWTIHQVEMDLKRLP  425



>ref|NP_175486.2| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAC42179.1| unknown protein [Arabidopsis thaliana]
 gb|AAO63929.1| unknown protein [Arabidopsis thaliana]
 gb|AEE32582.1| uncharacterized protein AT1G50710 [Arabidopsis thaliana]
Length=423

 Score =   240 bits (612),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 141/181 (78%), Positives = 156/181 (86%), Gaps = 9/181 (5%)
 Frame = -3

Query  718  SASNQIPTARXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkd  539
            S  N+  +AR PERVK IIEEIER+EA LREDLYS+DRKFAEYYNVL QILGVLIKLVKD
Sbjct  249  STGNRNSSARLPERVKFIIEEIERDEAALREDLYSADRKFAEYYNVLEQILGVLIKLVKD  308

Query  538  iklKHQHKYDELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKI  359
            +KL+HQHKY+E+QKTWL KRC+TM+AKLR         VLE++LLLETYTPD+I ALH I
Sbjct  309  LKLEHQHKYNEMQKTWLCKRCETMNAKLR---------VLENVLLLETYTPDSISALHNI  359

Query  358  RKYLVESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDL  179
            R YLVE+TEEAS AYNKA TRLREYQGVDPHFD IARQYHDIVKKLENM+WTI QVEMDL
Sbjct  360  RNYLVEATEEASAAYNKAVTRLREYQGVDPHFDTIARQYHDIVKKLENMQWTIHQVEMDL  419

Query  178  K  176
            K
Sbjct  420  K  420



>ref|XP_006305844.1| hypothetical protein CARUB_v10010894mg [Capsella rubella]
 gb|EOA38742.1| hypothetical protein CARUB_v10010894mg [Capsella rubella]
Length=423

 Score =   240 bits (612),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 141/181 (78%), Positives = 156/181 (86%), Gaps = 9/181 (5%)
 Frame = -3

Query  718  SASNQIPTARXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkd  539
            S  N+  +AR PERVK IIEEIER+EA LREDLYS+DRKFAEYYNVL QILGVLIKLVKD
Sbjct  249  STGNRNSSARLPERVKFIIEEIERDEAALREDLYSADRKFAEYYNVLEQILGVLIKLVKD  308

Query  538  iklKHQHKYDELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKI  359
            +KL+HQHKY+E+QKTWL KRC+TM+AKLR         VLE++LLLETYTPD+I ALH I
Sbjct  309  LKLEHQHKYNEMQKTWLCKRCETMNAKLR---------VLENVLLLETYTPDSISALHNI  359

Query  358  RKYLVESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDL  179
            R YLVE+TEEAS AYNKA TRLREYQGVDPHFD IARQYHDIVKKLENM+WTI QVEMDL
Sbjct  360  RNYLVEATEEASAAYNKAVTRLREYQGVDPHFDTIARQYHDIVKKLENMQWTIHQVEMDL  419

Query  178  K  176
            K
Sbjct  420  K  420



>ref|XP_004139788.1| PREDICTED: uncharacterized protein LOC101203307 [Cucumis sativus]
 ref|XP_004166476.1| PREDICTED: uncharacterized LOC101203307 [Cucumis sativus]
Length=438

 Score =   240 bits (613),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 141/176 (80%), Positives = 157/176 (89%), Gaps = 9/176 (5%)
 Frame = -3

Query  694  ARXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkdiklKHQHK  515
            AR PERVKLIIEEIEREEA LR++LYS+DRKFAEYYNVL QILGVLIKLVKD+KL+HQHK
Sbjct  259  ARLPERVKLIIEEIEREEAALRQELYSADRKFAEYYNVLEQILGVLIKLVKDLKLQHQHK  318

Query  514  YDELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKIRKYLVEST  335
            YD+LQKTWL KRC+TM+AKL          VLEH+LLLETYT ++IPALHKIRKYLVE+T
Sbjct  319  YDDLQKTWLCKRCETMNAKLS---------VLEHVLLLETYTQESIPALHKIRKYLVEAT  369

Query  334  EEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRLP  167
            EEAS++YNKA TRLREYQGVDPHFD IARQYHDIV KL+NM+WTI QVEMDLKRLP
Sbjct  370  EEASISYNKAVTRLREYQGVDPHFDTIARQYHDIVMKLDNMQWTIHQVEMDLKRLP  425



>gb|KGN44163.1| hypothetical protein Csa_7G210080 [Cucumis sativus]
Length=430

 Score =   240 bits (612),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 141/176 (80%), Positives = 157/176 (89%), Gaps = 9/176 (5%)
 Frame = -3

Query  694  ARXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkdiklKHQHK  515
            AR PERVKLIIEEIEREEA LR++LYS+DRKFAEYYNVL QILGVLIKLVKD+KL+HQHK
Sbjct  259  ARLPERVKLIIEEIEREEAALRQELYSADRKFAEYYNVLEQILGVLIKLVKDLKLQHQHK  318

Query  514  YDELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKIRKYLVEST  335
            YD+LQKTWL KRC+TM+AKL          VLEH+LLLETYT ++IPALHKIRKYLVE+T
Sbjct  319  YDDLQKTWLCKRCETMNAKLS---------VLEHVLLLETYTQESIPALHKIRKYLVEAT  369

Query  334  EEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRLP  167
            EEAS++YNKA TRLREYQGVDPHFD IARQYHDIV KL+NM+WTI QVEMDLKRLP
Sbjct  370  EEASISYNKAVTRLREYQGVDPHFDTIARQYHDIVMKLDNMQWTIHQVEMDLKRLP  425



>ref|XP_002894271.1| hypothetical protein ARALYDRAFT_474203 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70530.1| hypothetical protein ARALYDRAFT_474203 [Arabidopsis lyrata subsp. 
lyrata]
Length=423

 Score =   239 bits (611),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 141/181 (78%), Positives = 156/181 (86%), Gaps = 9/181 (5%)
 Frame = -3

Query  718  SASNQIPTARXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkd  539
            S  N+  +AR PERVK IIEEIER+EA LREDLYS+DRKFAEYYNVL QILGVLIKLVKD
Sbjct  249  STGNRNSSARLPERVKFIIEEIERDEAALREDLYSADRKFAEYYNVLEQILGVLIKLVKD  308

Query  538  iklKHQHKYDELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKI  359
            +KL+HQHKY+E+QKTWL KRC+TM+AKLR         VLE++LLLETYTPD+I ALH I
Sbjct  309  LKLEHQHKYNEMQKTWLCKRCETMNAKLR---------VLENVLLLETYTPDSISALHNI  359

Query  358  RKYLVESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDL  179
            R YLVE+TEEAS AYNKA TRLREYQGVDPHFD IARQYHDIVKKLENM+WTI QVEMDL
Sbjct  360  RNYLVEATEEASAAYNKAVTRLREYQGVDPHFDTIARQYHDIVKKLENMQWTIHQVEMDL  419

Query  178  K  176
            K
Sbjct  420  K  420



>ref|XP_006858187.1| hypothetical protein AMTR_s00062p00162950 [Amborella trichopoda]
 gb|ERN19654.1| hypothetical protein AMTR_s00062p00162950 [Amborella trichopoda]
Length=435

 Score =   239 bits (610),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 138/187 (74%), Positives = 161/187 (86%), Gaps = 9/187 (5%)
 Frame = -3

Query  718  SASNQIPTARXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkd  539
            SA +Q  +AR PERVKLI+++IEREEA LREDL S+DRKFAEYYNVL QIL VLIKLVKD
Sbjct  256  SAISQFQSARLPERVKLIVDKIEREEAALREDLCSADRKFAEYYNVLEQILAVLIKLVKD  315

Query  538  iklKHQHKYDELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKI  359
            +KL+HQH+YDEL+KTWL KRC+TM+AKLR         VLEH+LL +TYT D+IPALHKI
Sbjct  316  LKLQHQHQYDELRKTWLCKRCETMNAKLR---------VLEHLLLRDTYTQDSIPALHKI  366

Query  358  RKYLVESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDL  179
            RKYL+E+TEEAS+AYNKA TRLREYQGVDPHFD IARQYHDI++KLE M+WTI+QVEMDL
Sbjct  367  RKYLMEATEEASIAYNKAVTRLREYQGVDPHFDTIARQYHDILQKLEEMQWTIRQVEMDL  426

Query  178  KRLPAYP  158
            KR   +P
Sbjct  427  KRTMEHP  433



>ref|XP_010479537.1| PREDICTED: uncharacterized protein LOC104758377 [Camelina sativa]
Length=423

 Score =   239 bits (609),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 141/184 (77%), Positives = 157/184 (85%), Gaps = 9/184 (5%)
 Frame = -3

Query  727  SIPSASNQIPTARXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvlikl  548
            S  S  N+  +AR PERVK IIEEIER+EA LREDLYS+DRKFAEYYNVL QILGVLIKL
Sbjct  246  SDSSTGNRNSSARLPERVKFIIEEIERDEAALREDLYSADRKFAEYYNVLEQILGVLIKL  305

Query  547  vkdiklKHQHKYDELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPAL  368
            VKD+KL+HQHKY+++QKTWL KRC+TM+AKLR         VLE++LLLETYTPD+I AL
Sbjct  306  VKDLKLEHQHKYNDMQKTWLCKRCETMNAKLR---------VLENVLLLETYTPDSISAL  356

Query  367  HKIRKYLVESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVE  188
            H IR YLVE+TEEAS AYNKA TRLREYQGVDPHFD IARQYHDIVKKLENM+WTI QVE
Sbjct  357  HNIRNYLVEATEEASAAYNKAVTRLREYQGVDPHFDTIARQYHDIVKKLENMQWTIHQVE  416

Query  187  MDLK  176
            MDLK
Sbjct  417  MDLK  420



>ref|XP_010500647.1| PREDICTED: uncharacterized protein LOC104777995 [Camelina sativa]
Length=423

 Score =   238 bits (608),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 140/181 (77%), Positives = 156/181 (86%), Gaps = 9/181 (5%)
 Frame = -3

Query  718  SASNQIPTARXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkd  539
            S  N+  +AR PERVK IIEEIER+EA LREDLYS+DRKFAEYYNVL QILGVLIKLVKD
Sbjct  249  STGNRNSSARLPERVKFIIEEIERDEAALREDLYSADRKFAEYYNVLEQILGVLIKLVKD  308

Query  538  iklKHQHKYDELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKI  359
            +KL+HQHKY+++QKTWL KRC+TM+AKLR         VLE++LLLETYTPD+I ALH I
Sbjct  309  LKLEHQHKYNDMQKTWLCKRCETMNAKLR---------VLENVLLLETYTPDSISALHNI  359

Query  358  RKYLVESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDL  179
            R YLVE+TEEAS AYNKA TRLREYQGVDPHFD IARQYHDIVKKLENM+WTI QVEMDL
Sbjct  360  RNYLVEATEEASAAYNKAVTRLREYQGVDPHFDTIARQYHDIVKKLENMQWTIHQVEMDL  419

Query  178  K  176
            K
Sbjct  420  K  420



>ref|XP_010461924.1| PREDICTED: uncharacterized protein LOC104742601 [Camelina sativa]
Length=423

 Score =   238 bits (607),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 140/181 (77%), Positives = 156/181 (86%), Gaps = 9/181 (5%)
 Frame = -3

Query  718  SASNQIPTARXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkd  539
            S  N+  +AR PERVK IIEEIER+EA LREDLYS+DRKFAEYYNVL QILGVLIKLVKD
Sbjct  249  STGNRNSSARLPERVKFIIEEIERDEAALREDLYSADRKFAEYYNVLEQILGVLIKLVKD  308

Query  538  iklKHQHKYDELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKI  359
            +KL+HQHKY+E+QKTWL KRC+TM+AKLR         VLE++LLLETYTPD+I ALH I
Sbjct  309  LKLEHQHKYNEMQKTWLCKRCETMNAKLR---------VLENVLLLETYTPDSISALHNI  359

Query  358  RKYLVESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDL  179
            R YLVE+TEEAS AYNKA TRLREYQGVDPHFD IARQYH+IVKKLENM+WTI QVEMDL
Sbjct  360  RNYLVEATEEASAAYNKAVTRLREYQGVDPHFDTIARQYHEIVKKLENMQWTIHQVEMDL  419

Query  178  K  176
            K
Sbjct  420  K  420



>ref|XP_007215411.1| hypothetical protein PRUPE_ppa005986mg [Prunus persica]
 gb|EMJ16610.1| hypothetical protein PRUPE_ppa005986mg [Prunus persica]
Length=433

 Score =   234 bits (596),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 136/169 (80%), Positives = 152/169 (90%), Gaps = 9/169 (5%)
 Frame = -3

Query  685  PERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkdiklKHQHKYDE  506
            PERVKLIIEE+EREEA LREDLYS+DRKFAEYYNVL QILGVLIKLV+D+KL+HQH+YD 
Sbjct  266  PERVKLIIEEMEREEAALREDLYSADRKFAEYYNVLEQILGVLIKLVRDLKLQHQHQYDG  325

Query  505  LQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKIRKYLVESTEEA  326
            LQKTWL KRC+TMSAKLR         VLEH+LLLETYT ++IPALHKIRKYL+E+T+EA
Sbjct  326  LQKTWLCKRCETMSAKLR---------VLEHVLLLETYTKESIPALHKIRKYLLEATDEA  376

Query  325  SLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDL  179
            S+AYNKA TRLREYQGVDPHFD IARQYHDIVKKLENM+WTI Q+EMDL
Sbjct  377  SIAYNKAVTRLREYQGVDPHFDSIARQYHDIVKKLENMQWTIDQIEMDL  425



>ref|XP_008228485.1| PREDICTED: uncharacterized protein LOC103327892 [Prunus mume]
Length=433

 Score =   231 bits (590),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 135/169 (80%), Positives = 151/169 (89%), Gaps = 9/169 (5%)
 Frame = -3

Query  685  PERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkdiklKHQHKYDE  506
            PERVKLIIEE+EREE  L+EDLYS+DRKFAEYYNVL QILGVLIKLV+D+KL+HQHKYD 
Sbjct  266  PERVKLIIEEMEREETALQEDLYSADRKFAEYYNVLEQILGVLIKLVRDLKLQHQHKYDG  325

Query  505  LQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKIRKYLVESTEEA  326
            LQKTWL KRC+TMSAKLR         VLEH+LLLETYT ++IPALHKIRKYL+E+T+EA
Sbjct  326  LQKTWLCKRCETMSAKLR---------VLEHVLLLETYTKESIPALHKIRKYLLEATDEA  376

Query  325  SLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDL  179
            S+AYNKA TRLREYQGVDPHFD IARQYHDIVKKLENM+WTI Q+EMDL
Sbjct  377  SIAYNKAVTRLREYQGVDPHFDSIARQYHDIVKKLENMQWTIDQIEMDL  425



>gb|KFK35913.1| hypothetical protein AALP_AA4G052600 [Arabis alpina]
Length=421

 Score =   230 bits (586),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 138/182 (76%), Positives = 152/182 (84%), Gaps = 9/182 (5%)
 Frame = -3

Query  718  SASNQIPTARXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkd  539
            S  NQ  +AR PERVK IIEEIEREEA LREDLYS+DRKFAEYYNVL QILGVLIKLVKD
Sbjct  249  STGNQNSSARLPERVKFIIEEIEREEAALREDLYSADRKFAEYYNVLEQILGVLIKLVKD  308

Query  538  iklKHQHKYDELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKI  359
            +KL+HQHKYD++QKTWL KRC+TM+AKLR         VLE ILLLETYT ++IPALH I
Sbjct  309  LKLEHQHKYDDMQKTWLCKRCETMNAKLR---------VLEQILLLETYTHESIPALHSI  359

Query  358  RKYLVESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDL  179
            R YLVE+TEEAS AYNKA TRLREYQGVDPHFD IARQY DIVKKL NM+WTI Q+E DL
Sbjct  360  RNYLVEATEEASAAYNKAVTRLREYQGVDPHFDAIARQYQDIVKKLANMQWTIDQLESDL  419

Query  178  KR  173
             +
Sbjct  420  NK  421



>ref|XP_003600108.1| HAUS augmin-like complex subunit [Medicago truncatula]
 gb|AES70359.1| SKIP interacting protein [Medicago truncatula]
Length=424

 Score =   228 bits (581),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 137/174 (79%), Positives = 152/174 (87%), Gaps = 9/174 (5%)
 Frame = -3

Query  691  RXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkdiklKHQHKY  512
            R PERVKL+IE+IEREEA LR+DLYS+DRKFAEYYNVL QILGVLIKLVKD+KL HQHKY
Sbjct  260  RLPERVKLLIEDIEREEAALRDDLYSADRKFAEYYNVLEQILGVLIKLVKDLKLDHQHKY  319

Query  511  DELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKIRKYLVESTE  332
            DELQKTWL KRCDTMS KLR+         LE+ LL  TYT ++IPALHKIR+YLVE+TE
Sbjct  320  DELQKTWLCKRCDTMSLKLRA---------LEYQLLHGTYTNESIPALHKIRRYLVEATE  370

Query  331  EASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRL  170
            EAS+AYNKAATRLREYQGVDPHFD IARQYHD+VKKLENM+WTI QVE DLKR+
Sbjct  371  EASIAYNKAATRLREYQGVDPHFDDIARQYHDVVKKLENMQWTINQVEDDLKRM  424



>ref|XP_009420825.1| PREDICTED: uncharacterized protein LOC104000482 [Musa acuminata 
subsp. malaccensis]
Length=434

 Score =   228 bits (580),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 135/182 (74%), Positives = 153/182 (84%), Gaps = 9/182 (5%)
 Frame = -3

Query  718  SASNQIPTARXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkd  539
            S+  QI +AR PERVKLIIEE+E+EEA L EDLYS DRKFAE+YNVL QILGVLIK VKD
Sbjct  255  SSITQISSARLPERVKLIIEEVEKEEAVLLEDLYSMDRKFAEHYNVLEQILGVLIKFVKD  314

Query  538  iklKHQHKYDELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKI  359
            +KL+HQH+YDEL+KTWL KRC TM+AKL          VLEH+LL +TYT D++PAL KI
Sbjct  315  LKLQHQHQYDELRKTWLCKRCQTMNAKLS---------VLEHLLLRDTYTKDSVPALRKI  365

Query  358  RKYLVESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDL  179
            R YL+E+TEEAS+AYNKA TRLREYQGVDPHFD IARQYHDIVKKLE M+WTI QVEMDL
Sbjct  366  RNYLIEATEEASIAYNKAVTRLREYQGVDPHFDTIARQYHDIVKKLEGMQWTIHQVEMDL  425

Query  178  KR  173
            KR
Sbjct  426  KR  427



>gb|KEH27912.1| SKIP interacting protein [Medicago truncatula]
Length=424

 Score =   224 bits (572),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 136/174 (78%), Positives = 151/174 (87%), Gaps = 9/174 (5%)
 Frame = -3

Query  691  RXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkdiklKHQHKY  512
            R PERVKL+IE+IEREEA LR+DLYS+DRKFAEYYNVL QILGVLIKLVKD+KL  QHKY
Sbjct  260  RLPERVKLLIEDIEREEAALRDDLYSADRKFAEYYNVLEQILGVLIKLVKDLKLDCQHKY  319

Query  511  DELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKIRKYLVESTE  332
            DELQKTWL KRCDTMS KLR+         LE+ LL  TYT ++IPALHKIR+YLVE+TE
Sbjct  320  DELQKTWLCKRCDTMSLKLRA---------LEYQLLHGTYTNESIPALHKIRRYLVEATE  370

Query  331  EASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRL  170
            EAS+AYNKAATRLREYQGVDPHFD IARQYHD+VKKLENM+WTI QVE DLKR+
Sbjct  371  EASIAYNKAATRLREYQGVDPHFDDIARQYHDVVKKLENMQWTINQVEDDLKRM  424



>ref|XP_009360993.1| PREDICTED: uncharacterized protein LOC103951362 isoform X2 [Pyrus 
x bretschneideri]
Length=339

 Score =   222 bits (565),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 130/186 (70%), Positives = 152/186 (82%), Gaps = 9/186 (5%)
 Frame = -3

Query  709  NQIPTARXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkdikl  530
            ++  +++ PERVKLI EEIEREE  L+EDLYS+DRKF+EYYNVL QILGVL+KL+KD+KL
Sbjct  163  HETSSSQLPERVKLITEEIEREEEALQEDLYSADRKFSEYYNVLEQILGVLVKLIKDLKL  222

Query  529  KHQHKYDELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKIRKY  350
             HQH YDELQKTWL KRC TMSAKLR          LE+ ++ +TYT +++PALHKIRKY
Sbjct  223  HHQHNYDELQKTWLCKRCVTMSAKLRK---------LEYAIVGQTYTKESVPALHKIRKY  273

Query  349  LVESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRL  170
            L ++TEEAS+ YNKA TRL EYQGVDPHFD IARQY DIVKKLENM WTI QVEMDLKRL
Sbjct  274  LTDATEEASVTYNKAVTRLHEYQGVDPHFDQIARQYRDIVKKLENMNWTIHQVEMDLKRL  333

Query  169  PAYPGA  152
            P +P A
Sbjct  334  PDHPNA  339



>ref|XP_010670158.1| PREDICTED: uncharacterized protein LOC104887254 [Beta vulgaris 
subsp. vulgaris]
Length=430

 Score =   223 bits (567),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 136/184 (74%), Positives = 155/184 (84%), Gaps = 9/184 (5%)
 Frame = -3

Query  718  SASNQIPTARXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkd  539
            SA +Q  ++R P+RVK++IEEIEREE  L+EDLYS+DRKFAEYYNVL QILGVLIKLVKD
Sbjct  251  SAGHQNLSSRLPQRVKIMIEEIEREEEALKEDLYSADRKFAEYYNVLEQILGVLIKLVKD  310

Query  538  iklKHQHKYDELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKI  359
            +KL++QH YDELQKTW  KR + M AKLR         VLEHILL+ TYT +TIPALHKI
Sbjct  311  LKLQNQHNYDELQKTWQIKRHEAMGAKLR---------VLEHILLVATYTQETIPALHKI  361

Query  358  RKYLVESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDL  179
            R+YLVE+TEE+S AYNKA TRLREYQGVDPHFD IARQYHDIVKKLENM+WTIQ+VEMDL
Sbjct  362  RRYLVEATEESSTAYNKAVTRLREYQGVDPHFDSIARQYHDIVKKLENMQWTIQEVEMDL  421

Query  178  KRLP  167
              LP
Sbjct  422  NYLP  425



>ref|XP_010935259.1| PREDICTED: uncharacterized protein LOC105055203 isoform X1 [Elaeis 
guineensis]
Length=436

 Score =   222 bits (565),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 132/173 (76%), Positives = 149/173 (86%), Gaps = 9/173 (5%)
 Frame = -3

Query  691  RXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkdiklKHQHKY  512
            R PERVKLIIEEIEREEA L EDLYS DRKFAE+YNVL QILGVL+K VKD+KL+HQH+Y
Sbjct  266  RLPERVKLIIEEIEREEAVLLEDLYSMDRKFAEHYNVLEQILGVLVKFVKDLKLQHQHQY  325

Query  511  DELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKIRKYLVESTE  332
            DEL+KTWL KRC TM+AKL          VLEH+LL +TYT +++PALH+IRKYL+E+TE
Sbjct  326  DELRKTWLCKRCQTMNAKLS---------VLEHLLLRDTYTKESVPALHRIRKYLLEATE  376

Query  331  EASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKR  173
            EAS+AYNKA TRLREYQGVDPHFD IARQYHDIVKKLE M+WTI QVEMDLKR
Sbjct  377  EASIAYNKAVTRLREYQGVDPHFDTIARQYHDIVKKLEGMQWTIHQVEMDLKR  429



>ref|XP_009360992.1| PREDICTED: uncharacterized protein LOC103951362 isoform X1 [Pyrus 
x bretschneideri]
Length=409

 Score =   221 bits (563),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 130/186 (70%), Positives = 152/186 (82%), Gaps = 9/186 (5%)
 Frame = -3

Query  709  NQIPTARXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkdikl  530
            ++  +++ PERVKLI EEIEREE  L+EDLYS+DRKF+EYYNVL QILGVL+KL+KD+KL
Sbjct  233  HETSSSQLPERVKLITEEIEREEEALQEDLYSADRKFSEYYNVLEQILGVLVKLIKDLKL  292

Query  529  KHQHKYDELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKIRKY  350
             HQH YDELQKTWL KRC TMSAKLR          LE+ ++ +TYT +++PALHKIRKY
Sbjct  293  HHQHNYDELQKTWLCKRCVTMSAKLRK---------LEYAIVGQTYTKESVPALHKIRKY  343

Query  349  LVESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRL  170
            L ++TEEAS+ YNKA TRL EYQGVDPHFD IARQY DIVKKLENM WTI QVEMDLKRL
Sbjct  344  LTDATEEASVTYNKAVTRLHEYQGVDPHFDQIARQYRDIVKKLENMNWTIHQVEMDLKRL  403

Query  169  PAYPGA  152
            P +P A
Sbjct  404  PDHPNA  409



>ref|XP_010935260.1| PREDICTED: uncharacterized protein LOC105055203 isoform X2 [Elaeis 
guineensis]
Length=435

 Score =   222 bits (565),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 132/173 (76%), Positives = 149/173 (86%), Gaps = 9/173 (5%)
 Frame = -3

Query  691  RXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkdiklKHQHKY  512
            R PERVKLIIEEIEREEA L EDLYS DRKFAE+YNVL QILGVL+K VKD+KL+HQH+Y
Sbjct  265  RLPERVKLIIEEIEREEAVLLEDLYSMDRKFAEHYNVLEQILGVLVKFVKDLKLQHQHQY  324

Query  511  DELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKIRKYLVESTE  332
            DEL+KTWL KRC TM+AKL          VLEH+LL +TYT +++PALH+IRKYL+E+TE
Sbjct  325  DELRKTWLCKRCQTMNAKLS---------VLEHLLLRDTYTKESVPALHRIRKYLLEATE  375

Query  331  EASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKR  173
            EAS+AYNKA TRLREYQGVDPHFD IARQYHDIVKKLE M+WTI QVEMDLKR
Sbjct  376  EASIAYNKAVTRLREYQGVDPHFDTIARQYHDIVKKLEGMQWTIHQVEMDLKR  428



>ref|XP_008781274.1| PREDICTED: uncharacterized protein LOC103701092 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008781275.1| PREDICTED: uncharacterized protein LOC103701092 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008781276.1| PREDICTED: uncharacterized protein LOC103701092 isoform X1 [Phoenix 
dactylifera]
Length=434

 Score =   222 bits (565),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 131/173 (76%), Positives = 149/173 (86%), Gaps = 9/173 (5%)
 Frame = -3

Query  691  RXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkdiklKHQHKY  512
            R PERVKLIIEEIEREEA L EDLYS DRKFAE+YNVL QILGVL+K V+D+KL+HQH+Y
Sbjct  264  RLPERVKLIIEEIEREEAVLLEDLYSMDRKFAEHYNVLEQILGVLVKFVRDLKLQHQHQY  323

Query  511  DELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKIRKYLVESTE  332
            DEL+KTWL KRC TM+AKL          VLEH+LL +TYT +++PALH+IRKYL+E+TE
Sbjct  324  DELRKTWLCKRCQTMNAKLS---------VLEHLLLRDTYTKESVPALHRIRKYLLEATE  374

Query  331  EASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKR  173
            EAS+AYNKA TRLREYQGVDPHFD IARQYHDIVKKLE M+WTI QVEMDLKR
Sbjct  375  EASIAYNKAVTRLREYQGVDPHFDTIARQYHDIVKKLEGMQWTIHQVEMDLKR  427



>ref|XP_008781277.1| PREDICTED: uncharacterized protein LOC103701092 isoform X2 [Phoenix 
dactylifera]
Length=433

 Score =   221 bits (564),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 131/173 (76%), Positives = 149/173 (86%), Gaps = 9/173 (5%)
 Frame = -3

Query  691  RXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkdiklKHQHKY  512
            R PERVKLIIEEIEREEA L EDLYS DRKFAE+YNVL QILGVL+K V+D+KL+HQH+Y
Sbjct  263  RLPERVKLIIEEIEREEAVLLEDLYSMDRKFAEHYNVLEQILGVLVKFVRDLKLQHQHQY  322

Query  511  DELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKIRKYLVESTE  332
            DEL+KTWL KRC TM+AKL          VLEH+LL +TYT +++PALH+IRKYL+E+TE
Sbjct  323  DELRKTWLCKRCQTMNAKLS---------VLEHLLLRDTYTKESVPALHRIRKYLLEATE  373

Query  331  EASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKR  173
            EAS+AYNKA TRLREYQGVDPHFD IARQYHDIVKKLE M+WTI QVEMDLKR
Sbjct  374  EASIAYNKAVTRLREYQGVDPHFDTIARQYHDIVKKLEGMQWTIHQVEMDLKR  426



>ref|XP_010278680.1| PREDICTED: uncharacterized protein LOC104612800 [Nelumbo nucifera]
 ref|XP_010278681.1| PREDICTED: uncharacterized protein LOC104612800 [Nelumbo nucifera]
Length=434

 Score =   220 bits (561),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 132/174 (76%), Positives = 150/174 (86%), Gaps = 9/174 (5%)
 Frame = -3

Query  694  ARXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkdiklKHQHK  515
            AR PERVKLIIEEIEREEA LREDLYS+DRKFAEYYNVL QIL VLIKLVKD+KL+HQH+
Sbjct  263  ARLPERVKLIIEEIEREEAALREDLYSADRKFAEYYNVLEQILAVLIKLVKDLKLQHQHQ  322

Query  514  YDELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKIRKYLVEST  335
            YDEL+KT L K C+TM+AKLR+         LEH++L +TYT D+IPALHKIRKYL+E+T
Sbjct  323  YDELRKTRLCKMCETMNAKLRA---------LEHLILRDTYTQDSIPALHKIRKYLLEAT  373

Query  334  EEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKR  173
            +EAS+AY+K  TRLREYQGVDPHFD IARQYHDIVKKLE M+W I QVEMDLKR
Sbjct  374  KEASIAYSKVVTRLREYQGVDPHFDTIARQYHDIVKKLEGMQWAIHQVEMDLKR  427



>gb|KJB62821.1| hypothetical protein B456_009G438500 [Gossypium raimondii]
Length=418

 Score =   219 bits (559),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 135/173 (78%), Positives = 147/173 (85%), Gaps = 16/173 (9%)
 Frame = -3

Query  685  PERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkdiklKHQHKYDE  506
            PERVK IIEEIEREEA LREDLYS+DRKFAEYYNVL QILGVLIKLV D+KL+HQH+Y  
Sbjct  257  PERVKFIIEEIEREEAALREDLYSADRKFAEYYNVLEQILGVLIKLVNDLKLQHQHQY--  314

Query  505  LQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKIRKYLVESTEEA  326
                 + KRC+TMSAKLR         VLEH+LLLETYT ++IPALHKIRKYLVE+TEEA
Sbjct  315  -----ICKRCETMSAKLR---------VLEHVLLLETYTQESIPALHKIRKYLVEATEEA  360

Query  325  SLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRLP  167
            S AYNKA TRLREYQGVDPHFD IARQYHD+VKKLENM+WTI QVEMDLKRLP
Sbjct  361  SPAYNKAVTRLREYQGVDPHFDTIARQYHDVVKKLENMQWTIHQVEMDLKRLP  413



>ref|XP_008365005.1| PREDICTED: HAUS augmin-like complex subunit 4 [Malus domestica]
Length=409

 Score =   219 bits (558),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 150/182 (82%), Gaps = 9/182 (5%)
 Frame = -3

Query  697  TARXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkdiklKHQH  518
            +++ PERVKLI EEIEREE  L+EDLYS+DRKF+EYYNVL QILGVL+KL+KD+KL HQH
Sbjct  237  SSQLPERVKLITEEIEREEEALQEDLYSADRKFSEYYNVLEQILGVLVKLIKDLKLHHQH  296

Query  517  KYDELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKIRKYLVES  338
             YDELQKTWL KRC TMSAKLR          LE+ ++ +TYT +++PALHKIRKYL ++
Sbjct  297  NYDELQKTWLCKRCVTMSAKLRK---------LEYAIVGQTYTKESVPALHKIRKYLTDA  347

Query  337  TEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRLPAYP  158
            TEEAS+ YNKA TRL EYQGVDPHFD IAR+Y DIVKKLENM WTI QVEMDLKRLP +P
Sbjct  348  TEEASVTYNKAVTRLHEYQGVDPHFDQIARRYRDIVKKLENMNWTIHQVEMDLKRLPDHP  407

Query  157  GA  152
             A
Sbjct  408  NA  409



>ref|XP_008226896.1| PREDICTED: HAUS augmin-like complex subunit 4 isoform X3 [Prunus 
mume]
Length=380

 Score =   216 bits (549),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 128/189 (68%), Positives = 155/189 (82%), Gaps = 9/189 (5%)
 Frame = -3

Query  718  SASNQIPTARXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkd  539
            S  +QI +A  PER+KLIIEE+E+EEA L+EDLYS+DRKF+EYYNVL QI+GVL+KLVKD
Sbjct  201  SPGHQISSAPLPERIKLIIEEMEKEEAALQEDLYSADRKFSEYYNVLEQIVGVLMKLVKD  260

Query  538  iklKHQHKYDELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKI  359
            +KL+HQHKYDE QK WL KRC+TMSAKLR          L++ +L +TYT D++PAL+KI
Sbjct  261  LKLQHQHKYDEQQKIWLCKRCETMSAKLRK---------LKYSVLGQTYTKDSVPALYKI  311

Query  358  RKYLVESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDL  179
            RKYL+++T+EA   Y+KA TRLREYQ VDPHFD IARQYHDIVK+LENM+WTI QVEMDL
Sbjct  312  RKYLLDATKEADATYDKAITRLREYQDVDPHFDKIARQYHDIVKELENMQWTIHQVEMDL  371

Query  178  KRLPAYPGA  152
            K LP  P A
Sbjct  372  KHLPDQPNA  380



>ref|XP_008226895.1| PREDICTED: HAUS augmin-like complex subunit 4 isoform X2 [Prunus 
mume]
Length=414

 Score =   216 bits (550),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 128/189 (68%), Positives = 155/189 (82%), Gaps = 9/189 (5%)
 Frame = -3

Query  718  SASNQIPTARXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkd  539
            S  +QI +A  PER+KLIIEE+E+EEA L+EDLYS+DRKF+EYYNVL QI+GVL+KLVKD
Sbjct  235  SPGHQISSAPLPERIKLIIEEMEKEEAALQEDLYSADRKFSEYYNVLEQIVGVLMKLVKD  294

Query  538  iklKHQHKYDELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKI  359
            +KL+HQHKYDE QK WL KRC+TMSAKLR          L++ +L +TYT D++PAL+KI
Sbjct  295  LKLQHQHKYDEQQKIWLCKRCETMSAKLRK---------LKYSVLGQTYTKDSVPALYKI  345

Query  358  RKYLVESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDL  179
            RKYL+++T+EA   Y+KA TRLREYQ VDPHFD IARQYHDIVK+LENM+WTI QVEMDL
Sbjct  346  RKYLLDATKEADATYDKAITRLREYQDVDPHFDKIARQYHDIVKELENMQWTIHQVEMDL  405

Query  178  KRLPAYPGA  152
            K LP  P A
Sbjct  406  KHLPDQPNA  414



>ref|XP_008226894.1| PREDICTED: HAUS augmin-like complex subunit 4 isoform X1 [Prunus 
mume]
Length=415

 Score =   216 bits (550),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 128/189 (68%), Positives = 155/189 (82%), Gaps = 9/189 (5%)
 Frame = -3

Query  718  SASNQIPTARXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkd  539
            S  +QI +A  PER+KLIIEE+E+EEA L+EDLYS+DRKF+EYYNVL QI+GVL+KLVKD
Sbjct  236  SPGHQISSAPLPERIKLIIEEMEKEEAALQEDLYSADRKFSEYYNVLEQIVGVLMKLVKD  295

Query  538  iklKHQHKYDELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKI  359
            +KL+HQHKYDE QK WL KRC+TMSAKLR          L++ +L +TYT D++PAL+KI
Sbjct  296  LKLQHQHKYDEQQKIWLCKRCETMSAKLRK---------LKYSVLGQTYTKDSVPALYKI  346

Query  358  RKYLVESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDL  179
            RKYL+++T+EA   Y+KA TRLREYQ VDPHFD IARQYHDIVK+LENM+WTI QVEMDL
Sbjct  347  RKYLLDATKEADATYDKAITRLREYQDVDPHFDKIARQYHDIVKELENMQWTIHQVEMDL  406

Query  178  KRLPAYPGA  152
            K LP  P A
Sbjct  407  KHLPDQPNA  415



>emb|CDP04568.1| unnamed protein product [Coffea canephora]
Length=427

 Score =   216 bits (549),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 142/186 (76%), Positives = 156/186 (84%), Gaps = 16/186 (9%)
 Frame = -3

Query  730  TSIPSASNQIPTARXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvlik  551
            TS P++     TAR PER+KLIIEEIEREE   REDLYSSDRKFAEYYNVL QILGVLIK
Sbjct  256  TSGPNS-----TARLPERIKLIIEEIEREETAWREDLYSSDRKFAEYYNVLEQILGVLIK  310

Query  550  lvkdiklKHQHKYDELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPA  371
            LVK+IKL+HQHKYDEL KTWL KRC+TM+AKLR         VLEH+LL +TYTP+TI A
Sbjct  311  LVKEIKLQHQHKYDELHKTWLCKRCETMNAKLR---------VLEHVLLYDTYTPETIGA  361

Query  370  LHKIRKYLVESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQV  191
            LHKIRKYLV+ST+EASLAYNKA TRLREYQGVDPHFD IARQYH+I  KLEN+RWTI QV
Sbjct  362  LHKIRKYLVDSTDEASLAYNKAVTRLREYQGVDPHFDSIARQYHEI--KLENLRWTIHQV  419

Query  190  EMDLKR  173
            EMDL R
Sbjct  420  EMDLNR  425



>ref|XP_010276096.1| PREDICTED: uncharacterized protein LOC104610933 [Nelumbo nucifera]
Length=430

 Score =   215 bits (548),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 126/184 (68%), Positives = 149/184 (81%), Gaps = 10/184 (5%)
 Frame = -3

Query  718  SASNQIPTARXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkd  539
            S  +QI +A  P+RVKL+IEEIE EE  LREDLYS+DRKFAEYYNVL QIL  LIK VKD
Sbjct  255  SFGSQISSA-LPDRVKLLIEEIESEETALREDLYSADRKFAEYYNVLEQILTALIKFVKD  313

Query  538  iklKHQHKYDELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKI  359
            +KL+HQH+YDEL+KTWL +RC+ M+AKLR+         LEH++L  TYT D+ PALH I
Sbjct  314  LKLQHQHQYDELRKTWLCRRCEAMNAKLRA---------LEHLILCNTYTEDSTPALHMI  364

Query  358  RKYLVESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDL  179
            RKYL+E+T+EA++AYNKA TRLREYQGVDPHFD IA+QY DIVKKLE M+WTI QVEMDL
Sbjct  365  RKYLLEATKEATIAYNKAVTRLREYQGVDPHFDTIAKQYQDIVKKLEGMQWTIHQVEMDL  424

Query  178  KRLP  167
             R P
Sbjct  425  NRSP  428



>ref|XP_007213462.1| hypothetical protein PRUPE_ppa024388mg [Prunus persica]
 gb|EMJ14661.1| hypothetical protein PRUPE_ppa024388mg [Prunus persica]
Length=414

 Score =   214 bits (545),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 129/189 (68%), Positives = 154/189 (81%), Gaps = 9/189 (5%)
 Frame = -3

Query  718  SASNQIPTARXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkd  539
            S  +QI +A  PER+KLIIEE EREEA L+EDLYS+DRKF+EYYNVL QI+GVL+KLVKD
Sbjct  235  SPRHQISSAPLPERIKLIIEETEREEAALQEDLYSADRKFSEYYNVLEQIVGVLMKLVKD  294

Query  538  iklKHQHKYDELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKI  359
            +KL+HQHKYDE QK WL KRC+TMSAKLR          L++ +L +TYT D++PAL+KI
Sbjct  295  LKLQHQHKYDEQQKIWLCKRCETMSAKLRK---------LKYSVLGQTYTRDSVPALYKI  345

Query  358  RKYLVESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDL  179
            RKYL+++T+EA   Y+KA TRLREYQ VDPHFD IARQYHDIVK+LENM+WTI QVEMDL
Sbjct  346  RKYLLDATKEADATYDKAITRLREYQDVDPHFDKIARQYHDIVKELENMQWTIHQVEMDL  405

Query  178  KRLPAYPGA  152
            K LP  P A
Sbjct  406  KHLPDQPNA  414



>emb|CDP05762.1| unnamed protein product [Coffea canephora]
Length=427

 Score =   212 bits (540),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 140/186 (75%), Positives = 154/186 (83%), Gaps = 16/186 (9%)
 Frame = -3

Query  730  TSIPSASNQIPTARXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvlik  551
            TS P++     TAR PER+KLIIEEIEREE   REDLYSSDRKFAEYYNVL QILGVLIK
Sbjct  256  TSGPNS-----TARLPERIKLIIEEIEREETAWREDLYSSDRKFAEYYNVLEQILGVLIK  310

Query  550  lvkdiklKHQHKYDELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPA  371
            LVK+IKL+HQHKYDEL KTWL KRC+TM+AKLR         VLEH+LL +TYTP+ I A
Sbjct  311  LVKEIKLQHQHKYDELHKTWLCKRCETMNAKLR---------VLEHVLLYDTYTPEAIGA  361

Query  370  LHKIRKYLVESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQV  191
            LHKIRKYLV+S +EASLAYNKA TRLREYQGVDPHFD IARQYH+I  KLEN+RWTI QV
Sbjct  362  LHKIRKYLVDSADEASLAYNKAVTRLREYQGVDPHFDSIARQYHEI--KLENLRWTIHQV  419

Query  190  EMDLKR  173
            EMDL R
Sbjct  420  EMDLNR  425



>dbj|BAJ90177.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91025.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86731.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=429

 Score =   211 bits (536),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 149/181 (82%), Gaps = 9/181 (5%)
 Frame = -3

Query  718  SASNQIPTARXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkd  539
            S+ NQI +AR PERVKLIIE IE+EE+ L EDL S DRKFAE+YNVL QIL VLI+ VKD
Sbjct  254  SSMNQISSARLPERVKLIIEGIEKEESLLLEDLASMDRKFAEHYNVLEQILAVLIQFVKD  313

Query  538  iklKHQHKYDELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKI  359
             KL+HQH+YD+++KTWL KRC TM+AKL           LEH LL +TYT +T+PALH+I
Sbjct  314  KKLEHQHQYDDVKKTWLIKRCRTMNAKLS---------YLEHHLLRDTYTKETVPALHRI  364

Query  358  RKYLVESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDL  179
            RKYLVE+T+EAS +YN+A +RLREYQGVDPHFD+IARQYH+IVKKLE M+WTI QVEMDL
Sbjct  365  RKYLVEATKEASNSYNEAVSRLREYQGVDPHFDVIARQYHEIVKKLEGMQWTIHQVEMDL  424

Query  178  K  176
            K
Sbjct  425  K  425



>gb|EPS65378.1| hypothetical protein M569_09399, partial [Genlisea aurea]
Length=131

 Score =   198 bits (503),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 98/120 (82%), Positives = 102/120 (85%), Gaps = 9/120 (8%)
 Frame = -3

Query  526  HQHKYDELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKIRKYL  347
            HQH YDELQKTWL +RC+TMSAKLR         VLEHILLL TYT DTIPAL KIRKYL
Sbjct  20   HQHTYDELQKTWLCRRCETMSAKLR---------VLEHILLLGTYTKDTIPALQKIRKYL  70

Query  346  VESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRLP  167
            VESTEEASLAYNKA TRLREYQGVDPHFD IA+QYHDIVKKLENM+WTIQQVEMDL R P
Sbjct  71   VESTEEASLAYNKAVTRLREYQGVDPHFDSIAKQYHDIVKKLENMQWTIQQVEMDLNRSP  130



>gb|AAG51195.1|AC079279_16 unknown protein [Arabidopsis thaliana]
Length=420

 Score =   207 bits (526),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 128/168 (76%), Gaps = 15/168 (9%)
 Frame = -3

Query  679  RVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkdiklKHQHKYDELQ  500
            RVK IIEEIER+EA LREDLYS+DRKFAEYYNV            +      +   +E+Q
Sbjct  265  RVKFIIEEIERDEAALREDLYSADRKFAEYYNV------GPGTNTRGTYKACEGSKNEMQ  318

Query  499  KTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKIRKYLVESTEEASL  320
            KTWL KRC+TM+AKLR         VLE++LLLETYTPD+I ALH IR YLVE+TEEAS 
Sbjct  319  KTWLCKRCETMNAKLR---------VLENVLLLETYTPDSISALHNIRNYLVEATEEASA  369

Query  319  AYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLK  176
            AYNKA TRLREYQGVDPHFD IARQYHDIVKKLENM+WTI QVEMDLK
Sbjct  370  AYNKAVTRLREYQGVDPHFDTIARQYHDIVKKLENMQWTIHQVEMDLK  417



>gb|ACG37880.1| hypothetical protein [Zea mays]
Length=218

 Score =   200 bits (509),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 123/173 (71%), Positives = 143/173 (83%), Gaps = 9/173 (5%)
 Frame = -3

Query  694  ARXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkdiklKHQHK  515
            AR PERVKLIIEEIE+EEA L EDL S DRKFAE+YNVL QIL VLI+ VKD KL+HQH+
Sbjct  47   ARLPERVKLIIEEIEKEEAHLLEDLASMDRKFAEHYNVLEQILAVLIQFVKDKKLEHQHQ  106

Query  514  YDELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKIRKYLVEST  335
            +D+L+KTWL KRC TM+AKL           LEH LL +TYT DT+PALH+IRKYLVE+T
Sbjct  107  FDDLKKTWLIKRCRTMNAKLS---------YLEHHLLRDTYTKDTVPALHRIRKYLVEAT  157

Query  334  EEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLK  176
            +EAS +YN+A +RLREYQGVDP FD+IARQYH+IVKKLE M+WTI QVEMDLK
Sbjct  158  KEASNSYNEAVSRLREYQGVDPRFDVIARQYHEIVKKLEGMQWTIHQVEMDLK  210



>ref|XP_004952114.1| PREDICTED: uncharacterized protein LOC101756520 [Setaria italica]
Length=425

 Score =   206 bits (523),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 125/173 (72%), Positives = 144/173 (83%), Gaps = 9/173 (5%)
 Frame = -3

Query  694  ARXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkdiklKHQHK  515
            AR PERVKLIIEEIE+EEA L EDL S DRKFAE+YNVL QIL VLI+ VKD KL+HQH+
Sbjct  254  ARLPERVKLIIEEIEKEEAHLLEDLASMDRKFAEHYNVLEQILAVLIQFVKDKKLEHQHQ  313

Query  514  YDELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKIRKYLVEST  335
            YD+L+KTWL KRC TM+AKL           LEH LL +TYT DT+PALH+IRKYLVE+T
Sbjct  314  YDDLKKTWLIKRCRTMNAKLS---------YLEHHLLRDTYTKDTVPALHRIRKYLVEAT  364

Query  334  EEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLK  176
            +EAS +YN+A +RLREYQGVDPHFD+IARQYH+IVKKLE M+WTI QVEMDLK
Sbjct  365  KEASNSYNEAISRLREYQGVDPHFDVIARQYHEIVKKLEGMQWTIHQVEMDLK  417



>ref|XP_002453194.1| hypothetical protein SORBIDRAFT_04g001450 [Sorghum bicolor]
 gb|EES06170.1| hypothetical protein SORBIDRAFT_04g001450 [Sorghum bicolor]
Length=424

 Score =   204 bits (520),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 124/173 (72%), Positives = 144/173 (83%), Gaps = 9/173 (5%)
 Frame = -3

Query  694  ARXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkdiklKHQHK  515
            AR PERVKLIIEEIE+EEA L EDL S DRKFAE+YNVL QIL VLI+ VKD KL+HQH+
Sbjct  253  ARLPERVKLIIEEIEKEEAHLLEDLASMDRKFAEHYNVLEQILAVLIQFVKDKKLEHQHQ  312

Query  514  YDELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKIRKYLVEST  335
            +D+L+KTWL KRC TM+AKL           LEH LL +TYT DT+PALH+IRKYLVE+T
Sbjct  313  FDDLKKTWLIKRCRTMNAKLS---------YLEHHLLRDTYTKDTVPALHRIRKYLVEAT  363

Query  334  EEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLK  176
            +EAS +YN+A +RLREYQGVDPHFD+IARQYH+IVKKLE M+WTI QVEMDLK
Sbjct  364  KEASNSYNEAVSRLREYQGVDPHFDVIARQYHEIVKKLEGMQWTIHQVEMDLK  416



>gb|AFW69843.2| hypothetical protein ZEAMMB73_576256 [Zea mays]
Length=353

 Score =   200 bits (509),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 123/173 (71%), Positives = 143/173 (83%), Gaps = 9/173 (5%)
 Frame = -3

Query  694  ARXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkdiklKHQHK  515
            AR PERVKLIIEEIE+EEA L EDL S DRKFAE+YNVL QIL VLI+ VKD KL+HQH+
Sbjct  182  ARLPERVKLIIEEIEKEEAHLLEDLASMDRKFAEHYNVLEQILAVLIQFVKDKKLEHQHQ  241

Query  514  YDELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKIRKYLVEST  335
            +D+L+KTWL KRC TM+AKL           LEH LL +TYT DT+PALH+IRKYLVE+T
Sbjct  242  FDDLKKTWLIKRCRTMNAKLS---------YLEHHLLRDTYTKDTVPALHRIRKYLVEAT  292

Query  334  EEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLK  176
            +EAS +YN+A +RLREYQGVDP FD+IARQYH+IVKKLE M+WTI QVEMDLK
Sbjct  293  KEASNSYNEAVSRLREYQGVDPRFDVIARQYHEIVKKLEGMQWTIHQVEMDLK  345



>gb|ACN31535.1| unknown [Zea mays]
Length=422

 Score =   201 bits (510),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 123/173 (71%), Positives = 143/173 (83%), Gaps = 9/173 (5%)
 Frame = -3

Query  694  ARXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkdiklKHQHK  515
            AR PERVKLIIEEIE+EEA L EDL S DRKFAE+YNVL QIL VLI+ VKD KL+HQH+
Sbjct  251  ARLPERVKLIIEEIEKEEAHLLEDLASMDRKFAEHYNVLEQILAVLIQFVKDKKLEHQHQ  310

Query  514  YDELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKIRKYLVEST  335
            +D+L+KTWL KRC TM+AKL           LEH LL +TYT DT+PALH+IRKYLVE+T
Sbjct  311  FDDLKKTWLIKRCRTMNAKLS---------YLEHHLLRDTYTKDTVPALHRIRKYLVEAT  361

Query  334  EEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLK  176
            +EAS +YN+A +RLREYQGVDP FD+IARQYH+IVKKLE M+WTI QVEMDLK
Sbjct  362  KEASNSYNEAVSRLREYQGVDPRFDVIARQYHEIVKKLEGMQWTIHQVEMDLK  414



>ref|XP_003573417.1| PREDICTED: uncharacterized protein LOC100821831 [Brachypodium 
distachyon]
Length=419

 Score =   199 bits (506),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 150/181 (83%), Gaps = 9/181 (5%)
 Frame = -3

Query  718  SASNQIPTARXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkd  539
            S+ NQI +AR PERVKLIIEEIE+EE+ L EDL S DRKFAE+YNVL QIL VLI+ VKD
Sbjct  244  SSINQISSARLPERVKLIIEEIEKEESLLLEDLASMDRKFAEHYNVLEQILAVLIQFVKD  303

Query  538  iklKHQHKYDELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKI  359
             KL+HQH+YD+++KTWL KRC TM+AKL           LEH LL +TYT +T+PALH+I
Sbjct  304  KKLEHQHQYDDVKKTWLIKRCRTMNAKLS---------YLEHHLLRDTYTKETVPALHRI  354

Query  358  RKYLVESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDL  179
            RKYLVE+T+EAS +YN+A +RLREYQGVDPHFD+IARQYH+IVKKLE M+WTI QVEMDL
Sbjct  355  RKYLVEATKEASNSYNEAVSRLREYQGVDPHFDVIARQYHEIVKKLEGMQWTIHQVEMDL  414

Query  178  K  176
            K
Sbjct  415  K  415



>gb|KJB62817.1| hypothetical protein B456_009G438400 [Gossypium raimondii]
Length=402

 Score =   198 bits (504),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 135/175 (77%), Gaps = 32/175 (18%)
 Frame = -3

Query  691  RXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkdiklKHQHKY  512
            R PERVKLIIEEIEREEA LREDLYS+DRKFAEYYNVL QILGVLIKLVKD+KL+HQH+Y
Sbjct  255  RLPERVKLIIEEIEREEAALREDLYSADRKFAEYYNVLEQILGVLIKLVKDLKLQHQHQY  314

Query  511  DELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKIRKYLVESTE  332
            DELQKTWL KRC+TMSAKL                                RKYLVE+TE
Sbjct  315  DELQKTWLCKRCETMSAKL--------------------------------RKYLVEATE  342

Query  331  EASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRLP  167
            EAS AYNKA TRLREYQGVDPHFD IARQYHD+VKKLENM+WTI QVEMDLKRLP
Sbjct  343  EASAAYNKAVTRLREYQGVDPHFDTIARQYHDVVKKLENMQWTIHQVEMDLKRLP  397



>ref|XP_004295822.1| PREDICTED: uncharacterized protein LOC101299752 [Fragaria vesca 
subsp. vesca]
Length=409

 Score =   198 bits (504),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 117/172 (68%), Positives = 144/172 (84%), Gaps = 9/172 (5%)
 Frame = -3

Query  682  ERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkdiklKHQHKYDEL  503
            ERV+LI E++E +EA L+EDLYS+DR+F EYYNVL QILGVLIKLV+++KL+HQHKYDEL
Sbjct  246  ERVRLITEDLEGKEAALKEDLYSADRRFTEYYNVLEQILGVLIKLVRNLKLQHQHKYDEL  305

Query  502  QKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKIRKYLVESTEEAS  323
            QK +L KRC+T+ AKLRS         LE++L   TY+ D++PALHKIRKYLVE+T+EAS
Sbjct  306  QKGFLCKRCETIDAKLRS---------LEYVLQHATYSKDSVPALHKIRKYLVEATKEAS  356

Query  322  LAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRLP  167
            + ++KA TRLREYQ VD  F+ IARQYHDIV+KLENM+WTIQQVEMDLKR P
Sbjct  357  ITHDKAVTRLREYQSVDADFNKIARQYHDIVQKLENMQWTIQQVEMDLKRPP  408



>ref|XP_010097813.1| hypothetical protein L484_000961 [Morus notabilis]
 gb|EXB72071.1| hypothetical protein L484_000961 [Morus notabilis]
Length=408

 Score =   198 bits (503),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 126/189 (67%), Positives = 141/189 (75%), Gaps = 32/189 (17%)
 Frame = -3

Query  718  SASNQIPTARXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkd  539
            S+ +Q  +AR PERVK IIEEIER+EA LREDLY++DRKFAEYYNVL QILGVLIKLVKD
Sbjct  252  SSGHQNSSARIPERVKFIIEEIERDEAALREDLYAADRKFAEYYNVLEQILGVLIKLVKD  311

Query  538  iklKHQHKYDELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKI  359
            +KL+HQHKYD+LQKTWL KRC+TMSAKLR                               
Sbjct  312  LKLQHQHKYDDLQKTWLCKRCETMSAKLR-------------------------------  340

Query  358  RKYLVESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDL  179
             KYL E+TEEAS+AYNKA TRLREYQGVDPHFD IA+QY DIVKKLE M+WTI QVEMDL
Sbjct  341  -KYLGEATEEASIAYNKAVTRLREYQGVDPHFDNIAKQYRDIVKKLETMQWTIHQVEMDL  399

Query  178  KRLPAYPGA  152
            KRLP +P A
Sbjct  400  KRLPDHPNA  408



>ref|NP_001045698.1| Os02g0119100 [Oryza sativa Japonica Group]
 dbj|BAF07612.1| Os02g0119100, partial [Oryza sativa Japonica Group]
Length=227

 Score =   191 bits (486),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 122/173 (71%), Positives = 143/173 (83%), Gaps = 9/173 (5%)
 Frame = -3

Query  694  ARXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkdiklKHQHK  515
            AR PERVKLIIEEIE+EEA L +DL S DRKFAE+YNVL QIL VLI+ VKD KL+HQH+
Sbjct  56   ARLPERVKLIIEEIEKEEALLLDDLASMDRKFAEHYNVLEQILAVLIQFVKDKKLEHQHQ  115

Query  514  YDELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKIRKYLVEST  335
            YD+L+KTWL KRC TM+AKL           LEH LL +TYT +T+PALH+IRKYLVE+T
Sbjct  116  YDDLKKTWLIKRCRTMNAKLS---------YLEHHLLRDTYTKETVPALHRIRKYLVEAT  166

Query  334  EEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLK  176
            +EAS +Y +A +RLREYQGVDPHFD+IARQYH+IVKKLE M+WTI QVEMDLK
Sbjct  167  KEASNSYTEAVSRLREYQGVDPHFDVIARQYHEIVKKLEGMQWTIHQVEMDLK  219



>gb|EAZ21518.1| hypothetical protein OsJ_05142 [Oryza sativa Japonica Group]
Length=428

 Score =   192 bits (489),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 122/173 (71%), Positives = 143/173 (83%), Gaps = 9/173 (5%)
 Frame = -3

Query  694  ARXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkdiklKHQHK  515
            AR PERVKLIIEEIE+EEA L +DL S DRKFAE+YNVL QIL VLI+ VKD KL+HQH+
Sbjct  257  ARLPERVKLIIEEIEKEEALLLDDLASMDRKFAEHYNVLEQILAVLIQFVKDKKLEHQHQ  316

Query  514  YDELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKIRKYLVEST  335
            YD+L+KTWL KRC TM+AKL           LEH LL +TYT +T+PALH+IRKYLVE+T
Sbjct  317  YDDLKKTWLIKRCRTMNAKLS---------YLEHHLLRDTYTKETVPALHRIRKYLVEAT  367

Query  334  EEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLK  176
            +EAS +Y +A +RLREYQGVDPHFD+IARQYH+IVKKLE M+WTI QVEMDLK
Sbjct  368  KEASNSYTEAVSRLREYQGVDPHFDVIARQYHEIVKKLEGMQWTIHQVEMDLK  420



>gb|EAY84227.1| hypothetical protein OsI_05607 [Oryza sativa Indica Group]
 gb|ACA64829.1| SKIP interacting protein 9 [Oryza sativa]
Length=428

 Score =   192 bits (489),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 122/173 (71%), Positives = 143/173 (83%), Gaps = 9/173 (5%)
 Frame = -3

Query  694  ARXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkdiklKHQHK  515
            AR PERVKLIIEEIE+EEA L +DL S DRKFAE+YNVL QIL VLI+ VKD KL+HQH+
Sbjct  257  ARLPERVKLIIEEIEKEEALLLDDLASMDRKFAEHYNVLEQILAVLIQFVKDKKLEHQHQ  316

Query  514  YDELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKIRKYLVEST  335
            YD+L+KTWL KRC TM+AKL           LEH LL +TYT +T+PALH+IRKYLVE+T
Sbjct  317  YDDLKKTWLIKRCRTMNAKLS---------YLEHHLLRDTYTKETVPALHRIRKYLVEAT  367

Query  334  EEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLK  176
            +EAS +Y +A +RLREYQGVDPHFD+IARQYH+IVKKLE M+WTI QVEMDLK
Sbjct  368  KEASNSYTEAVSRLREYQGVDPHFDVIARQYHEIVKKLEGMQWTIHQVEMDLK  420



>ref|XP_006646792.1| PREDICTED: uncharacterized protein LOC102709140 [Oryza brachyantha]
Length=360

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 121/173 (70%), Positives = 143/173 (83%), Gaps = 9/173 (5%)
 Frame = -3

Query  694  ARXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkdiklKHQHK  515
            AR PERVKLIIEEIE+EEA L +DL S DRKFAE+Y+VL QIL VLI+ VKD KL+HQH+
Sbjct  189  ARLPERVKLIIEEIEKEEALLLDDLASMDRKFAEHYSVLEQILAVLIQFVKDKKLEHQHQ  248

Query  514  YDELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKIRKYLVEST  335
            YD+L+KTWL KRC TM+AKL           LEH LL +TYT +T+PALH+IRKYLVE+T
Sbjct  249  YDDLKKTWLIKRCRTMNAKLS---------YLEHHLLRDTYTKETVPALHRIRKYLVEAT  299

Query  334  EEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLK  176
            +EAS +Y +A +RLREYQGVDPHFD+IARQYH+IVKKLE M+WTI QVEMDLK
Sbjct  300  KEASNSYTEAVSRLREYQGVDPHFDVIARQYHEIVKKLEGMQWTIHQVEMDLK  352



>ref|XP_001768748.1| predicted protein [Physcomitrella patens]
 gb|EDQ66480.1| predicted protein [Physcomitrella patens]
Length=433

 Score =   192 bits (487),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 114/192 (59%), Positives = 144/192 (75%), Gaps = 9/192 (5%)
 Frame = -3

Query  733  TTSIPSASNQIPTARXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvli  554
            T     A +  PT R PERVK+ +E+IE EEA L EDLY++DRKF+EYYNVL QIL VL+
Sbjct  249  TDETGVADSAGPTLRLPERVKIAVEDIEAEEAALLEDLYAADRKFSEYYNVLEQILAVLL  308

Query  553  klvkdiklKHQHKYDELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIP  374
            +LVK+ KL+HQH YD ++K WL KRC TM+AKLR         VLEH+LL +TYT ++IP
Sbjct  309  RLVKEFKLQHQHDYDGMRKQWLCKRCQTMNAKLR---------VLEHLLLRDTYTQESIP  359

Query  373  ALHKIRKYLVESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQ  194
            ALHKIR++LVE+ EEA+ AYN+A TRLREYQGVD  FD IAR+YHD+V KL  ++WTI++
Sbjct  360  ALHKIRQHLVEANEEATAAYNRAVTRLREYQGVDQDFDEIARRYHDLVTKLVGIQWTIRE  419

Query  193  VEMDLKRLPAYP  158
            VE DL     +P
Sbjct  420  VEKDLSNPHEHP  431



>ref|XP_002990133.1| hypothetical protein SELMODRAFT_235950 [Selaginella moellendorffii]
 gb|EFJ08850.1| hypothetical protein SELMODRAFT_235950 [Selaginella moellendorffii]
Length=401

 Score =   190 bits (482),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 113/180 (63%), Positives = 140/180 (78%), Gaps = 9/180 (5%)
 Frame = -3

Query  715  ASNQIPTARXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkdi  536
             S+   + R  ERVK  +E  E EEA L  DLYS+DRKF+EYYNVL QILGVLIKLVKD 
Sbjct  226  GSHGTKSYRLAERVKAAVESNESEEAALLSDLYSADRKFSEYYNVLEQILGVLIKLVKDY  285

Query  535  klKHQHKYDELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKIR  356
            KL+HQH+YDE++K WL KRC+TM+AKLR         VLEH++L +TYT ++I ALHKIR
Sbjct  286  KLQHQHEYDEMRKAWLCKRCETMNAKLR---------VLEHLVLRDTYTEESIAALHKIR  336

Query  355  KYLVESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLK  176
             YL+E+ +EA+  YN+A TRLREYQGVD +FD IAR+YHD+VKKLE ++WTI+QVEMDL 
Sbjct  337  NYLLEADDEATAGYNRAVTRLREYQGVDQYFDDIARRYHDVVKKLEGIQWTIRQVEMDLN  396



>ref|XP_002989789.1| hypothetical protein SELMODRAFT_235871 [Selaginella moellendorffii]
 gb|EFJ09056.1| hypothetical protein SELMODRAFT_235871 [Selaginella moellendorffii]
Length=392

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 110/168 (65%), Positives = 135/168 (80%), Gaps = 9/168 (5%)
 Frame = -3

Query  679  RVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkdiklKHQHKYDELQ  500
            RVK  +E  E EEA L  DLYS+DRKF+EYYNVL QILGVLIKLVKD KL+HQH+YDE++
Sbjct  229  RVKAAVESNESEEAALLSDLYSADRKFSEYYNVLEQILGVLIKLVKDYKLQHQHEYDEMR  288

Query  499  KTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKIRKYLVESTEEASL  320
            K WL KRC+TM+AKLR         VLEH++L +TYT ++I ALHKIR YL+E+ +EA+ 
Sbjct  289  KAWLCKRCETMNAKLR---------VLEHLVLRDTYTEESIAALHKIRNYLLEADDEATA  339

Query  319  AYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLK  176
             YN+A TRLREYQGVD +FD IAR+YHD+VKKLE ++WTI+QVEMDL 
Sbjct  340  GYNRAVTRLREYQGVDQYFDDIARRYHDVVKKLEGIQWTIRQVEMDLN  387



>ref|XP_006452375.1| hypothetical protein CICLE_v10008353mg [Citrus clementina]
 gb|ESR65615.1| hypothetical protein CICLE_v10008353mg [Citrus clementina]
Length=406

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 126/152 (83%), Gaps = 10/152 (7%)
 Frame = -3

Query  724  IPSAS-NQIPTARXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvlikl  548
            I SAS N + TAR PERVK+IIEEIEREEA LREDLY++DRKFAEYYNVL QILGVLIKL
Sbjct  249  IDSASGNHMSTARLPERVKMIIEEIEREEAALREDLYAADRKFAEYYNVLEQILGVLIKL  308

Query  547  vkdiklKHQHKYDELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPAL  368
            VKD+KL+HQHKYDELQKTWL KRC+TMSAKL         RVLEH+LLL TYT ++IPAL
Sbjct  309  VKDLKLQHQHKYDELQKTWLCKRCETMSAKL---------RVLEHVLLLGTYTQESIPAL  359

Query  367  HKIRKYLVESTEEASLAYNKAATRLREYQGVD  272
            HKIRKYLVE+TEEAS+AYNKA      +Q V+
Sbjct  360  HKIRKYLVEATEEASVAYNKAVCSASCFQCVN  391



>gb|AFK46724.1| unknown [Medicago truncatula]
Length=214

 Score =   162 bits (410),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 119/139 (86%), Gaps = 9/139 (6%)
 Frame = -3

Query  691  RXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkdiklKHQHKY  512
            R PERVKL+IE+IEREEA LR+DLYS+DRKFAEYYNVL QILGVLIKLVKD+KL HQHKY
Sbjct  81   RLPERVKLLIEDIEREEAALRDDLYSADRKFAEYYNVLEQILGVLIKLVKDLKLDHQHKY  140

Query  511  DELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKIRKYLVESTE  332
            DELQKTWL KRCDTMS KLR+         LE+ LL  TYT ++IPALHKIR+YLVE+TE
Sbjct  141  DELQKTWLCKRCDTMSLKLRA---------LEYQLLHGTYTNESIPALHKIRRYLVEATE  191

Query  331  EASLAYNKAATRLREYQGV  275
            EAS+AYNKAATRLREYQG 
Sbjct  192  EASIAYNKAATRLREYQGC  210



>gb|ACJ84282.1| unknown [Medicago truncatula]
Length=393

 Score =   163 bits (413),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 119/139 (86%), Gaps = 9/139 (6%)
 Frame = -3

Query  691  RXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkdiklKHQHKY  512
            R PERVKL+IE+IEREEA LR+DLYS+DRKFAEYYNVL QILGVLIKLVKD+KL HQHKY
Sbjct  260  RLPERVKLLIEDIEREEAALRDDLYSADRKFAEYYNVLEQILGVLIKLVKDLKLDHQHKY  319

Query  511  DELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKIRKYLVESTE  332
            DELQKTWL KRCDTMS KLR+         LE+ LL  TYT ++IPALHKIR+YLVE+TE
Sbjct  320  DELQKTWLCKRCDTMSLKLRA---------LEYQLLHGTYTNESIPALHKIRRYLVEATE  370

Query  331  EASLAYNKAATRLREYQGV  275
            EAS+AYNKAATRLREYQG 
Sbjct  371  EASIAYNKAATRLREYQGC  389



>gb|KJB62819.1| hypothetical protein B456_009G438400 [Gossypium raimondii]
Length=389

 Score =   159 bits (402),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 116/133 (87%), Gaps = 9/133 (7%)
 Frame = -3

Query  691  RXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkdiklKHQHKY  512
            R PERVKLIIEEIEREEA LREDLYS+DRKFAEYYNVL QILGVLIKLVKD+KL+HQH+Y
Sbjct  255  RLPERVKLIIEEIEREEAALREDLYSADRKFAEYYNVLEQILGVLIKLVKDLKLQHQHQY  314

Query  511  DELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKIRKYLVESTE  332
            DELQKTWL KRC+TMSAKL         RVLEH+LLLETYT ++IPALHKIRKYLVE+TE
Sbjct  315  DELQKTWLCKRCETMSAKL---------RVLEHVLLLETYTQESIPALHKIRKYLVEATE  365

Query  331  EASLAYNKAATRL  293
            EAS AYNKA  ++
Sbjct  366  EASAAYNKAVCKI  378



>gb|EMS60102.1| hypothetical protein TRIUR3_07799 [Triticum urartu]
Length=487

 Score =   158 bits (400),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 114/164 (70%), Gaps = 33/164 (20%)
 Frame = -3

Query  718  SASNQIPTARXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkd  539
            S+ NQI +AR PERVKLIIE IE+EE+ L EDL S DRKFAE+YN               
Sbjct  181  SSINQISSARLPERVKLIIEGIEKEESLLLEDLASMDRKFAEHYN---------------  225

Query  538  iklKHQHKYDELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKI  359
                     D+++KTWL KRC TM+AKL           LEH LL +TYT +T+PALH+I
Sbjct  226  ---------DDVKKTWLIKRCRTMNAKLS---------YLEHHLLRDTYTKETVPALHRI  267

Query  358  RKYLVESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVK  227
            RKYLVE+T+EAS +YN+A +RLREYQGVDPHFD+IARQYH+IVK
Sbjct  268  RKYLVEATKEASNSYNEAVSRLREYQGVDPHFDVIARQYHEIVK  311



>ref|XP_008380933.1| PREDICTED: uncharacterized protein LOC103443814 [Malus domestica]
Length=455

 Score =   155 bits (391),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 99/129 (77%), Positives = 113/129 (88%), Gaps = 9/129 (7%)
 Frame = -3

Query  691  RXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkdiklKHQHKY  512
            R PERVKLII+++EREE  LREDLYS+DRKFAEYYNVL QILGVLIKLV+D+KL+HQHKY
Sbjct  265  RLPERVKLIIDDMEREETALREDLYSADRKFAEYYNVLEQILGVLIKLVRDLKLQHQHKY  324

Query  511  DELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKIRKYLVESTE  332
            D LQKTWL KRC+TMSAKL         RVLEH+LLLETYT ++IPALHKIRKYL+E+TE
Sbjct  325  DGLQKTWLCKRCETMSAKL---------RVLEHVLLLETYTKESIPALHKIRKYLLEATE  375

Query  331  EASLAYNKA  305
            EAS+AYNKA
Sbjct  376  EASIAYNKA  384



>gb|KHG14666.1| HAUS augmin-like complex subunit 4 [Gossypium arboreum]
Length=360

 Score =   144 bits (363),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 77/90 (86%), Gaps = 9/90 (10%)
 Frame = -3

Query  526  HQHKYDELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKIRKYL  347
            HQH+YDELQKTWL KRC+TMSAKLR         VLEH+LLLETYT +++PALHKIRKYL
Sbjct  270  HQHQYDELQKTWLCKRCETMSAKLR---------VLEHVLLLETYTQESVPALHKIRKYL  320

Query  346  VESTEEASLAYNKAATRLREYQGVDPHFDM  257
            VE+TEEAS AYNKA TRLREYQGVDPHF++
Sbjct  321  VEATEEASAAYNKAVTRLREYQGVDPHFEL  350



>ref|NP_001130646.1| uncharacterized protein LOC100191747 [Zea mays]
 gb|ACF78950.1| unknown [Zea mays]
 gb|AFW69844.2| hypothetical protein ZEAMMB73_576256 [Zea mays]
Length=271

 Score = 81.6 bits (200),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -3

Query  694  ARXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkdiklKHQHK  515
            AR PERVKLIIEEIE+EEA L EDL S DRKFAE+YNVL QIL VLI+ VKD KL+HQH+
Sbjct  182  ARLPERVKLIIEEIEKEEAHLLEDLASMDRKFAEHYNVLEQILAVLIQFVKDKKLEHQHQ  241

Query  514  YDELQKTWLSKRCDTMSAKLR  452
            +D+L+KTWL KRC TM+AKLR
Sbjct  242  FDDLKKTWLIKRCRTMNAKLR  262



>ref|XP_001637987.1| predicted protein [Nematostella vectensis]
 gb|EDO45924.1| predicted protein [Nematostella vectensis]
Length=367

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/148 (32%), Positives = 82/148 (55%), Gaps = 9/148 (6%)
 Frame = -3

Query  634  LREDLYSSDRKFAEYYNVLGQilgvliklvkdiklKHQHKYDELQKTWLSKRCDTMSAKL  455
            L +D    DR+F +YY  L Q L  L KL+   +L+ Q +YD++   WL+ +C+ M    
Sbjct  215  LGQDRLMRDRQFRQYYQTLLQSLESLEKLITKHRLQSQVRYDKVTTDWLAAKCEAMC---  271

Query  454  RSWYFLLHFRVLEHILLLETYTPDTIPALHKIRKYLVESTEEASLAYNKAATRLREYQGV  275
                  L  RVL++ L+ +TYTP+T+ AL KIR  L  + EE      +A   L+ Y+ V
Sbjct  272  ------LKIRVLQNQLIRDTYTPETVAALKKIRGLLEVAKEEEERELQRAREALQAYESV  325

Query  274  DPHFDMIARQYHDIVKKLENMRWTIQQV  191
               F+ + R+Y  ++ +++N +W + ++
Sbjct  326  GMGFEALVREYSALMIEIDNKKWALSEL  353



>ref|XP_002111568.1| hypothetical protein TRIADDRAFT_55725 [Trichoplax adhaerens]
 gb|EDV25535.1| hypothetical protein TRIADDRAFT_55725 [Trichoplax adhaerens]
Length=359

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 75/139 (54%), Gaps = 9/139 (6%)
 Frame = -3

Query  607  RKFAEYYNVLGQilgvliklvkdiklKHQHKYDELQKTWLSKRCDTMSAKLRSWYFLLHF  428
            RKF +YY  + + + +L ++++  +LK+Q  +D +   W + +CD M  KL         
Sbjct  223  RKFWQYYQEIQKCIEILDEIIRKYRLKYQADHDTITCNWFAAKCDAMCNKLS--------  274

Query  427  RVLEHILLLETYTPDTIPALHKIRKYLVESTEEASLAYNKAATRLREYQGVDPHFDMIAR  248
             VL + LL ++YT +T+ AL++I+ +LV +  E        +  LR Y+ +   FD I  
Sbjct  275  -VLANHLLKDSYTNETVSALNQIKHHLVTAQAEVENELTTISESLRSYEAIGMGFDKIVL  333

Query  247  QYHDIVKKLENMRWTIQQV  191
            QY +I K ++  RW + Q+
Sbjct  334  QYAEIAKSIDEKRWALSQI  352



>ref|XP_009050923.1| hypothetical protein LOTGIDRAFT_187302 [Lottia gigantea]
 gb|ESO98216.1| hypothetical protein LOTGIDRAFT_187302 [Lottia gigantea]
Length=362

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 93/169 (55%), Gaps = 9/169 (5%)
 Frame = -3

Query  697  TARXPERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgvliklvkdiklKHQH  518
            +++ P +++++ +++E EE  L++D    +++F  YY  L   L +L KL+ + +L+ Q 
Sbjct  198  SSQLPAKIEILKKKLENEERLLKQDRVKREKQFWVYYQSLVDCLSLLEKLIVEFRLQGQT  257

Query  517  KYDELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKIRKYLVES  338
            + D +   WL  RCD MS K+R    L   +VL      +TY+ +T+ AL  IR +L E+
Sbjct  258  ESDTITTKWLKSRCDAMSLKIR----LNQLQVL-----CDTYSAETVKALQVIRGHLDEA  308

Query  337  TEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQV  191
            TEE++    +    L  Y  V   F+ +  +Y  +  +LEN RW + ++
Sbjct  309  TEESNKDLVRITQALSAYDSVGMGFESLVDEYSQLRSELENKRWAMTEL  357



>ref|XP_004208947.1| PREDICTED: HAUS augmin-like complex subunit 4-like [Hydra vulgaris]
Length=283

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 56/102 (55%), Gaps = 10/102 (10%)
 Frame = -3

Query  493  WLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKIRKYLVESTEEASLAY  314
            WL+ +CD         Y +L  +V+ + L  ETYTP+T+ AL KIRK++ E   +     
Sbjct  187  WLATKCD---------YIILKIKVMTNHLYKETYTPETVEALMKIRKFIEEKITKTKDKI  237

Query  313  NKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVE  188
             K  + L  YQ VD  F+ +  +Y ++  ++EN +W + +++
Sbjct  238  QKTKSALSMYQSVDI-FNQLLNEYSNLTMEIENKKWALNELQ  278



>ref|XP_004337868.1| hypothetical protein ACA1_187410 [Acanthamoeba castellanii str. 
Neff]
 gb|ELR15855.1| hypothetical protein ACA1_187410 [Acanthamoeba castellanii str. 
Neff]
Length=373

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/147 (27%), Positives = 80/147 (54%), Gaps = 9/147 (6%)
 Frame = -3

Query  625  DLYSSDRKFAEYYNVLGQilgvliklvkdiklKHQHKYDELQKTWLSKRCDTMSAKLRSW  446
            D  ++   FAEY  VL +   V+ ++++D KL  Q   D++   WL   C          
Sbjct  236  DGLTAALSFAEYCQVLDKTFQVVSEILRDFKLSQQFNQDQVYSKWLQANCQ---------  286

Query  445  YFLLHFRVLEHILLLETYTPDTIPALHKIRKYLVESTEEASLAYNKAATRLREYQGVDPH  266
            + +   ++L+  +L +TYTP  + AL K+R++L  + EE    + +AA +++ Y+     
Sbjct  287  HLINRLKLLQSQVLRDTYTPSKVAALTKVRQHLECAIEETMAQHEEAAEQIQRYERAGAG  346

Query  265  FDMIARQYHDIVKKLENMRWTIQQVEM  185
            FD + R+Y  ++++L   +WTI+++++
Sbjct  347  FDGLVREYASLLEELAQKKWTIERIKV  373



>ref|XP_004345396.2| hypothetical protein CAOG_05806 [Capsaspora owczarzaki ATCC 30864]
 gb|KJE95351.1| hypothetical protein CAOG_005806 [Capsaspora owczarzaki ATCC 
30864]
Length=396

 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 33/114 (29%), Positives = 60/114 (53%), Gaps = 9/114 (8%)
 Frame = -3

Query  523  QHKYDELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKIRKYLV  344
            Q ++D     W + +C+ M  KL     +L  + LEH    +TYTP T+PAL  +R Y+ 
Sbjct  286  QAQFDAATSKWAAAKCEAMGLKLS----VLAMQ-LEH----DTYTPATLPALALLRDYVS  336

Query  343  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMD  182
             +  E+    + +   L  YQ +   F  + R+Y  +++++EN RW ++++  D
Sbjct  337  TAFVESRTERDASNRMLVAYQSIGSKFTELVREYGSVLEEIENRRWALEELRRD  390



>ref|XP_005108792.1| PREDICTED: HAUS augmin-like complex subunit 4-like [Aplysia californica]
Length=381

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 95/183 (52%), Gaps = 12/183 (7%)
 Frame = -3

Query  730  TSIPSASNQIPTARX---PERVKLiieeiereEATLREDLYSSDRKFAEYYNVLGQilgv  560
            T + S S Q+  A+    P  V+  ++E+E+ + +L +D  S +++F  YY  L + L +
Sbjct  186  TDVESRSEQLMIAKSRSLPAVVEQKLQELEQCKDSLAQDRLSREKQFWLYYQKLLEGLSL  245

Query  559  liklvkdiklKHQHKYDELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDT  380
            + +++++ KL  Q + D +   WL  +CD          F L FR+ +  +L ETY  +T
Sbjct  246  MERMLREHKLTSQAEVDVVTAGWLEAQCDA---------FCLKFRLTKMQILCETYDTET  296

Query  379  IPALHKIRKYLVESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTI  200
            + AL KI  +L ++ ++           L+ YQ +   F  +  ++  + K++++ RW +
Sbjct  297  LKALKKISGHLDKALKQTQQELAATQHSLQGYQAIGEEFKSLVAEFTQLQKEVDSRRWGL  356

Query  199  QQV  191
            QQ+
Sbjct  357  QQL  359



>ref|XP_781249.1| PREDICTED: HAUS augmin-like complex subunit 4-like [Strongylocentrotus 
purpuratus]
Length=305

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/115 (27%), Positives = 55/115 (48%), Gaps = 9/115 (8%)
 Frame = -3

Query  523  QHKYDELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKIRKYLV  344
            Q   D +   WL  RC  MS K+R         V E  LL  TYTP+ + A+   R+ L 
Sbjct  192  QADSDSITTDWLDARCHAMSLKIR---------VFEAKLLCSTYTPEVLQAMKTARQQLE  242

Query  343  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDL  179
             + +E      +    L+ Y+ +   F+ I R+Y ++   ++N +W +++++  L
Sbjct  243  GAVQEREKDLMRHDQALKNYKAIGSDFEEIVREYQELTAAIDNKKWALRELKQAL  297



>ref|XP_009022094.1| hypothetical protein HELRODRAFT_192765 [Helobdella robusta]
 gb|ESN99728.1| hypothetical protein HELRODRAFT_192765 [Helobdella robusta]
Length=321

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 52/103 (50%), Gaps = 9/103 (9%)
 Frame = -3

Query  496  TWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKIRKYLVESTEEASLA  317
             WL   C+ ++ K++         + E+ LL E YT D+I AL+ IR  L++   + S+ 
Sbjct  224  NWLLSHCEALNFKIK---------MQEYQLLAEIYTKDSIKALNVIRNELLKQDAQTSVE  274

Query  316  YNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVE  188
              + +  L  Y+ V P F  I  +Y  I  ++EN +W + + E
Sbjct  275  LARMSDLLTTYEAVGPEFKRIVHEYSRIRDEIENKKWALDEFE  317



>gb|EFX86383.1| hypothetical protein DAPPUDRAFT_308473 [Daphnia pulex]
Length=332

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/112 (29%), Positives = 58/112 (52%), Gaps = 9/112 (8%)
 Frame = -3

Query  523  QHKYDELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKIRKYLV  344
            Q++ +  Q   L  +CD +  K++S    LH  +L      ETYT +T+PAL KI K L 
Sbjct  225  QNEQNVSQSESLEVQCDALYLKIKS----LHLEIL-----CETYTKETVPALKKISKELE  275

Query  343  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVE  188
              +E+       +  RL  Y+ V   F+ I  +Y  + + ++  +WT+++++
Sbjct  276  AKSEQTENEIRASRLRLNRYESVGHDFNCIVNEYGKLRETIKQKKWTLEKLQ  327



>gb|EPS64103.1| hypothetical protein M569_10678, partial [Genlisea aurea]
Length=298

 Score = 48.9 bits (115),  Expect(2) = 9e-05, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = -3

Query  718  SASNQIPTARXPERVKLiieeiereEATLREDLYSSDRKFAEYYNV  581
            S   Q  T+R PERVKLIIEEIEREE   R+DLYSSDRKFAEYYNV
Sbjct  253  STGYQNMTSRLPERVKLIIEEIEREEFAWRDDLYSSDRKFAEYYNV  298


 Score = 24.6 bits (52),  Expect(2) = 9e-05, Method: Compositional matrix adjust.
 Identities = 10/14 (71%), Positives = 12/14 (86%), Gaps = 0/14 (0%)
 Frame = -2

Query  782  SRLDAKCDKLANVV  741
            SRLDAKC KLA+ +
Sbjct  231  SRLDAKCKKLADAI  244



>ref|XP_007020816.1| HAUS augmin-like complex subunit 4 isoform 2 [Theobroma cacao]
 gb|EOY12341.1| HAUS augmin-like complex subunit 4 isoform 2 [Theobroma cacao]
Length=296

 Score = 52.0 bits (123),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/37 (89%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -3

Query  691  RXPERVKLiieeiereEATLREDLYSSDRKFAEYYNV  581
            R PERVKLI EEIEREEA LREDLYS+DRKFAEYYNV
Sbjct  250  RLPERVKLITEEIEREEAALREDLYSADRKFAEYYNV  286


 Score = 20.8 bits (42),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 8/11 (73%), Positives = 10/11 (91%), Gaps = 0/11 (0%)
 Frame = -2

Query  779  RLDAKCDKLAN  747
            RL +KCDKLA+
Sbjct  222  RLKSKCDKLAD  232



>ref|XP_008172740.1| PREDICTED: HAUS augmin-like complex subunit 4 [Chrysemys picta 
bellii]
Length=280

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 51/110 (46%), Gaps = 9/110 (8%)
 Frame = -3

Query  523  QHKYDELQKTWLSKRCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKIRKYLV  344
            Q + D L   +L  +C  M          L  R+ E  +LL+TY+P+ + A   IR  L 
Sbjct  174  QAQLDRLNTHYLEVKCSAM---------FLKIRLEELSVLLDTYSPEKVEAHRAIRAGLQ  224

Query  343  ESTEEASLAYNKAATRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQ  194
             + ++       A   L  Y+ + P F+ + ++Y  +   +EN RW +Q+
Sbjct  225  GAVQQQEQELATAQKILATYESLGPEFEELVQEYAQLCGGIENKRWALQE  274



>ref|XP_010201610.1| PREDICTED: HAUS augmin-like complex subunit 4, partial [Colius 
striatus]
Length=130

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/105 (28%), Positives = 52/105 (50%), Gaps = 0/105 (0%)
 Frame = -3

Query  481  RCDTMSAKLRSWYFLLHFRVLEHILLLETYTPDTIPALHKIRKYLVESTEEASLAYNKAA  302
            R ++   ++ S   LL  R  E  +LL TY   T+ A   IR+ L E+ ++      +  
Sbjct  26   RAESQYLEVHSTALLLKTRWEEVSILLSTYPAPTVEAHRSIRRGLEEALKQTRARAERVK  85

Query  301  TRLREYQGVDPHFDMIARQYHDIVKKLENMRWTIQQVEMDLKRLP  167
             +L  +Q + P F  + ++Y  + ++L N RWT+Q++      LP
Sbjct  86   AQLAAFQELGPEFRALVKEYQGLKEELSNRRWTLQRLRDQEPALP  130



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1534440539150