BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF007E19

Length=680
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009786522.1|  PREDICTED: NADPH--cytochrome P450 reductase        208   4e-59   Nicotiana sylvestris
gb|AAZ39648.1|  cytochrome P450 NADPH-reductase                         208   7e-59   Petunia x hybrida [garden petunia]
ref|XP_009630023.1|  PREDICTED: NADPH--cytochrome P450 reductase        206   2e-58   Nicotiana tomentosiformis
ref|XP_006338052.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    206   5e-58   Solanum tuberosum [potatoes]
gb|ACF17649.1|  putative cytochrome reductase                           205   7e-58   Capsicum annuum
gb|ADI49691.1|  cytochrome P450 reductase                               203   4e-57   Withania somnifera [ashwagandha]
gb|AAS92623.1|  NADPH:cytochrome P450-reductase                         202   6e-57   Centaurium erythraea
ref|XP_004238001.1|  PREDICTED: NADPH--cytochrome P450 reductase        201   2e-56   Solanum lycopersicum
gb|KDO81195.1|  hypothetical protein CISIN_1g005496mg                   195   5e-56   Citrus sinensis [apfelsine]
emb|CDP11509.1|  unnamed protein product                                200   6e-56   Coffea canephora [robusta coffee]
dbj|BAC41516.1|  NADPH-cytochrome P-450 reductase                       200   6e-56   Ophiorrhiza pumila
ref|XP_006433816.1|  hypothetical protein CICLE_v10000469mg             199   7e-56   Citrus clementina [clementine]
ref|XP_009791726.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    199   1e-55   Nicotiana sylvestris
ref|XP_006472452.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    199   1e-55   Citrus sinensis [apfelsine]
ref|XP_010439016.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    199   1e-55   Camelina sativa [gold-of-pleasure]
gb|KDO81193.1|  hypothetical protein CISIN_1g005496mg                   199   2e-55   Citrus sinensis [apfelsine]
ref|XP_010433757.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    199   2e-55   Camelina sativa [gold-of-pleasure]
ref|XP_010448554.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    198   3e-55   Camelina sativa [gold-of-pleasure]
gb|KDO81194.1|  hypothetical protein CISIN_1g005496mg                   194   2e-54   Citrus sinensis [apfelsine]
ref|XP_003526551.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    196   2e-54   Glycine max [soybeans]
ref|XP_009138145.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    196   2e-54   Brassica rapa
emb|CDY34288.1|  BnaA01g13910D                                          195   2e-54   Brassica napus [oilseed rape]
ref|XP_007226979.1|  hypothetical protein PRUPE_ppa002280mg             195   2e-54   Prunus persica
ref|XP_006413419.1|  hypothetical protein EUTSA_v10024568mg             195   4e-54   Eutrema salsugineum [saltwater cress]
ref|XP_008219251.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    195   4e-54   
gb|AIG15451.1|  NADPH-cytochrome P450 reductase 1                       194   6e-54   Azadirachta indica [Indian-lilac]
gb|EYU36460.1|  hypothetical protein MIMGU_mgv1a002296mg                194   6e-54   Erythranthe guttata [common monkey flower]
emb|CDY03447.1|  BnaC01g16350D                                          194   7e-54   
ref|XP_009137451.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    192   8e-54   Brassica rapa
ref|XP_002265859.2|  PREDICTED: NADPH--cytochrome P450 reductase        193   1e-53   Vitis vinifera
ref|XP_002867662.1|  hypothetical protein ARALYDRAFT_492391             193   2e-53   
ref|XP_010086660.1|  NADPH--cytochrome P450 reductase                   193   2e-53   Morus notabilis
emb|CDY11017.1|  BnaA03g46760D                                          193   2e-53   Brassica napus [oilseed rape]
ref|XP_008219252.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    192   3e-53   Prunus mume [ume]
ref|XP_009137450.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    192   3e-53   Brassica rapa
gb|KHN39959.1|  NADPH--cytochrome P450 reductase                        192   4e-53   Glycine soja [wild soybean]
ref|NP_001236742.1|  NADPH:P450 reductase                               192   4e-53   
ref|XP_003602898.1|  NADPH cytochrome P450 reductase                    192   4e-53   Medicago truncatula
ref|XP_010277515.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    192   5e-53   Nelumbo nucifera [Indian lotus]
emb|CDY34287.1|  BnaA01g13900D                                          192   5e-53   Brassica napus [oilseed rape]
gb|ACN54323.1|  NADPH:cytochrome P450 reductase                         192   5e-53   Gossypium hirsutum [American cotton]
emb|CAC27143.1|  NADPH-cytochrome P450 reductase                        180   8e-53   Picea abies
emb|CDX92639.1|  BnaC07g38970D                                          191   9e-53   
ref|XP_010277516.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    190   1e-52   
gb|AHB33949.1|  cytochrome P450 reductase                               190   2e-52   Santalum album
ref|XP_002307336.1|  NADPH-cytochrome P450 oxydoreductase isoform...    190   2e-52   
ref|XP_007141274.1|  hypothetical protein PHAVU_008G182200g             190   2e-52   Phaseolus vulgaris [French bean]
gb|KJB58865.1|  hypothetical protein B456_009G229300                    190   2e-52   Gossypium raimondii
gb|KJB58863.1|  hypothetical protein B456_009G229300                    190   2e-52   Gossypium raimondii
gb|KDP41487.1|  hypothetical protein JCGZ_15894                         190   2e-52   Jatropha curcas
ref|XP_007136327.1|  hypothetical protein PHAVU_009G036200g             190   2e-52   Phaseolus vulgaris [French bean]
ref|XP_006285937.1|  hypothetical protein CARUB_v10007449mg             189   3e-52   Capsella rubella
ref|NP_194183.1|  NADPH--cytochrome P450 reductase 1                    189   4e-52   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190823.1|  NADPH--cytochrome P450 reductase 1                 189   4e-52   Arabidopsis thaliana [mouse-ear cress]
emb|CAA46814.1|  NADPH-ferrihemoprotein reductase                       189   4e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008338958.1|  PREDICTED: NADPH--cytochrome P450 reductase        189   5e-52   Malus domestica [apple tree]
ref|XP_002514049.1|  cytochrome P450, putative                          189   5e-52   Ricinus communis
ref|XP_006386427.1|  hypothetical protein POPTR_0002s10680g             186   6e-52   
ref|XP_010254555.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    189   6e-52   Nelumbo nucifera [Indian lotus]
ref|XP_009138137.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    189   7e-52   Brassica rapa
ref|XP_003522768.1|  PREDICTED: NADPH--cytochrome P450 reductase        188   8e-52   Glycine max [soybeans]
gb|ABK92896.1|  unknown                                                 177   1e-51   Populus trichocarpa [western balsam poplar]
ref|XP_004299743.1|  PREDICTED: NADPH--cytochrome P450 reductase        188   1e-51   Fragaria vesca subsp. vesca
ref|XP_010520739.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    188   1e-51   Tarenaya hassleriana [spider flower]
ref|XP_009414761.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    188   1e-51   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG05124.1|  NADPH--cytochrome P450 reductase                        187   2e-51   Gossypium arboreum [tree cotton]
ref|XP_010530279.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    187   2e-51   Tarenaya hassleriana [spider flower]
pir||A47298  NADPH-ferrihemoprotein reductase (EC 1.6.2.4) - mung...    187   2e-51
sp|P37116.1|NCPR_VIGRR  RecName: Full=NADPH--cytochrome P450 redu...    187   3e-51   Vigna radiata var. radiata [golden gram]
ref|XP_007018235.1|  P450 reductase 1 isoform 2                         184   3e-51   
emb|CAA81211.1|  NADPH-ferrihemoprotein reductase                       186   4e-51   Vicia sativa [spring vetch]
ref|XP_009376208.1|  PREDICTED: NADPH--cytochrome P450 reductase        186   4e-51   Pyrus x bretschneideri [bai li]
ref|XP_004501654.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    185   1e-50   Cicer arietinum [garbanzo]
ref|XP_007018236.1|  NADPH--cytochrome P450 reductase isoform 3         186   1e-50   
ref|XP_010692385.1|  PREDICTED: NADPH--cytochrome P450 reductase        185   1e-50   Beta vulgaris subsp. vulgaris [field beet]
gb|AIG15452.1|  NADPH-cytochrome P450 reductase 2                       185   2e-50   Azadirachta indica [Indian-lilac]
gb|ACF35281.1|  cytochrome P450 reductase-like protein                  184   2e-50   Nothapodytes nimmoniana
ref|XP_010928663.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    184   3e-50   Elaeis guineensis
ref|XP_009385909.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    184   3e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002462826.1|  hypothetical protein SORBIDRAFT_02g032640          184   4e-50   Sorghum bicolor [broomcorn]
ref|XP_007018234.1|  P450 reductase 1 isoform 1                         183   5e-50   
ref|XP_010046982.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    182   1e-49   Eucalyptus grandis [rose gum]
dbj|BAJ97446.1|  predicted protein                                      174   1e-49   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004165700.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    179   2e-49   
gb|AEW43314.1|  NADPH cytochrome P450 reductase                         182   2e-49   Picrorhiza kurrooa
gb|AAX59902.1|  cytochrome P450 reductase                               182   2e-49   Taxus wallichiana var. chinensis [Chinese yew]
ref|XP_011015338.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    182   2e-49   Populus euphratica
ref|XP_010523339.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    176   2e-49   
gb|AAT76449.1|  NADPH:cytochrome P450 reductase                         182   2e-49   Taxus cuspidata [ichii]
gb|KJB14707.1|  hypothetical protein B456_002G138900                    181   2e-49   Gossypium raimondii
ref|XP_010048643.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    181   2e-49   Eucalyptus grandis [rose gum]
gb|AGL46979.1|  cytochrome P450 reductase                               181   2e-49   Salvia miltiorrhiza [Chinese salvia]
ref|XP_011069915.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    181   3e-49   Sesamum indicum [beniseed]
gb|ACP43317.1|  NADPH cytochrome P450 reductase                         171   3e-49   Citrus maxima [buntan]
gb|AIL29328.1|  cytochrome P450 reductase                               181   3e-49   Pinus contorta
ref|XP_011043963.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    181   4e-49   Populus euphratica
emb|CAC83301.1|  cytochrome P450 reductase                              181   5e-49   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006372089.1|  hypothetical protein POPTR_0018s09980g             178   5e-49   
ref|XP_010523336.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    175   6e-49   
ref|XP_010523337.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    175   6e-49   
gb|AAK15261.1|AF302498_1  NADPH-cytochrome P450 oxydoreductase is...    180   6e-49   Populus trichocarpa x Populus deltoides
gb|AEA86315.1|  NADPH-cytochrome P450 reductase                         168   6e-49   Solanum nigrum
gb|KJB53794.1|  hypothetical protein B456_009G005600                    180   6e-49   Gossypium raimondii
gb|KJB53797.1|  hypothetical protein B456_009G005600                    180   6e-49   Gossypium raimondii
ref|XP_008653023.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    180   7e-49   Zea mays [maize]
emb|CAN77401.1|  hypothetical protein VITISV_027794                     180   8e-49   Vitis vinifera
ref|XP_008781895.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    180   8e-49   Phoenix dactylifera
ref|NP_001131393.1|  uncharacterized protein LOC100192720               171   9e-49   
ref|XP_006381796.1|  putative NADPH-cytochrome P450 reductase fam...    179   1e-48   Populus trichocarpa [western balsam poplar]
ref|XP_010913661.1|  PREDICTED: LOW QUALITY PROTEIN: NADPH--cytoc...    179   1e-48   Elaeis guineensis
ref|XP_011079296.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    179   1e-48   Sesamum indicum [beniseed]
gb|AIC73829.1|  cytochrome P450 reductase                               179   1e-48   Panax ginseng [Asiatic ginseng]
ref|XP_010093854.1|  NADPH--cytochrome P450 reductase                   179   1e-48   Morus notabilis
gb|KHG09184.1|  NADPH--cytochrome P450 reductase                        179   1e-48   Gossypium arboreum [tree cotton]
ref|NP_001063914.1|  Os09g0558900                                       179   1e-48   
gb|ACF35280.1|  cytochrome P450 reductase-like protein                  179   2e-48   Nothapodytes nimmoniana
gb|AAS00459.1|  NADPH:cytochrome P450-reductase                         179   2e-48   Hypericum androsaemum
ref|XP_010447753.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    175   2e-48   Camelina sativa [gold-of-pleasure]
ref|XP_008453604.1|  PREDICTED: NADPH--cytochrome P450 reductase 2      179   2e-48   Cucumis melo [Oriental melon]
gb|EMT14573.1|  NADPH--cytochrome P450 reductase                        179   2e-48   
ref|XP_010523335.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    175   3e-48   
ref|XP_002324469.1|  putative NADPH-cytochrome P450 reductase fam...    179   3e-48   Populus trichocarpa [western balsam poplar]
gb|ACN54324.1|  NADPH:cytochrome P450 reductase                         178   3e-48   Gossypium hirsutum [American cotton]
ref|XP_004146317.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    178   3e-48   Cucumis sativus [cucumbers]
ref|XP_010525727.1|  PREDICTED: NADPH--cytochrome P450 reductase 2      178   4e-48   Tarenaya hassleriana [spider flower]
emb|CAA89837.3|  NADPH-cytochrome P450 reductase                        178   4e-48   Pseudotsuga menziesii
ref|XP_011010331.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    178   4e-48   Populus euphratica
emb|CAE01547.2|  OSJNBb0022F16.2                                        178   5e-48   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002270732.2|  PREDICTED: NADPH--cytochrome P450 reductase        178   5e-48   Vitis vinifera
ref|XP_010523334.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    176   5e-48   
emb|CBI17838.3|  unnamed protein product                                177   5e-48   Vitis vinifera
ref|XP_009382841.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    177   5e-48   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEE61817.1|  hypothetical protein OsJ_16444                          177   6e-48   Oryza sativa Japonica Group [Japonica rice]
emb|CCO62220.1|  putative cytochrome P450 reductase                     177   6e-48   Actaea racemosa
ref|XP_006661531.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    177   7e-48   
gb|AAK56276.1|AF367288_1  AT4g30210/F9N11_60                            172   7e-48   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ41269.1|  NADPH-P450 reductase 2                                 177   8e-48   Zingiber officinale [ginger]
ref|NP_001136741.1|  uncharacterized protein LOC100216882               169   8e-48   
ref|XP_009795589.1|  PREDICTED: NADPH--cytochrome P450 reductase        177   8e-48   Nicotiana sylvestris
ref|XP_007014268.1|  P450 reductase 2                                   177   9e-48   
ref|XP_004148333.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    177   1e-47   Cucumis sativus [cucumbers]
gb|AGC92176.1|  cytochrome P450 oxidoreductase                          177   1e-47   Ocimum basilicum [basil]
ref|XP_004168364.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    177   1e-47   
gb|EAZ10065.1|  hypothetical protein OsI_32371                          177   1e-47   Oryza sativa Indica Group [Indian rice]
ref|XP_009607226.1|  PREDICTED: NADPH--cytochrome P450 reductase        177   1e-47   Nicotiana tomentosiformis
gb|AHA50098.1|  CYP450 reductase                                        177   1e-47   Panax ginseng [Asiatic ginseng]
ref|XP_004957625.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    176   1e-47   Setaria italica
dbj|BAG68945.1|  cytochrome P450 reductase                              176   1e-47   Lotus japonicus
ref|XP_008391625.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    176   1e-47   Malus domestica [apple tree]
ref|XP_004296434.1|  PREDICTED: NADPH--cytochrome P450 reductase 2      176   2e-47   Fragaria vesca subsp. vesca
ref|XP_010914150.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    176   2e-47   Elaeis guineensis
gb|ADC94831.1|  cytochrome P450 reductase                               176   3e-47   Perilla frutescens [beefsteak-mint]
ref|XP_009384791.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    176   3e-47   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO43876.1|  hypothetical protein CISIN_1g005072mg                   174   3e-47   Citrus sinensis [apfelsine]
ref|XP_002444097.1|  hypothetical protein SORBIDRAFT_07g007640          175   3e-47   Sorghum bicolor [broomcorn]
ref|XP_004507858.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    175   3e-47   Cicer arietinum [garbanzo]
gb|AAZ39649.1|  cytochrome P450 NADPH-reductase                         175   4e-47   Petunia x hybrida [garden petunia]
gb|AGX85599.1|  NADPH:cytochrome P450 reductase                         175   4e-47   Scoparia dulcis [escobilla]
ref|NP_001159331.1|  uncharacterized protein LOC100304425               175   4e-47   Zea mays [maize]
ref|XP_006653834.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    175   4e-47   Oryza brachyantha
emb|CDY28169.1|  BnaA01g06800D                                          175   4e-47   Brassica napus [oilseed rape]
ref|XP_008789667.1|  PREDICTED: NADPH--cytochrome P450 reductase        175   5e-47   Phoenix dactylifera
gb|EMS66177.1|  NADPH--cytochrome P450 reductase                        175   5e-47   Triticum urartu
ref|XP_010265447.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    175   5e-47   Nelumbo nucifera [Indian lotus]
ref|XP_003578634.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    175   6e-47   Brachypodium distachyon [annual false brome]
emb|CDP02981.1|  unnamed protein product                                174   6e-47   Coffea canephora [robusta coffee]
ref|XP_004960247.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    174   6e-47   Setaria italica
ref|XP_003579401.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    174   6e-47   Brachypodium distachyon [annual false brome]
gb|KDO43871.1|  hypothetical protein CISIN_1g005072mg                   174   7e-47   Citrus sinensis [apfelsine]
ref|XP_007227446.1|  hypothetical protein PRUPE_ppa002142mg             174   7e-47   Prunus persica
gb|KJB22140.1|  hypothetical protein B456_004G0316002                   171   7e-47   Gossypium raimondii
gb|KDO43870.1|  hypothetical protein CISIN_1g005072mg                   174   7e-47   Citrus sinensis [apfelsine]
gb|KDO43868.1|  hypothetical protein CISIN_1g005072mg                   174   8e-47   Citrus sinensis [apfelsine]
ref|XP_009108997.1|  PREDICTED: NADPH--cytochrome P450 reductase 2      174   8e-47   Brassica rapa
ref|XP_008223694.1|  PREDICTED: NADPH--cytochrome P450 reductase 2      174   8e-47   Prunus mume [ume]
gb|KDO43869.1|  hypothetical protein CISIN_1g005072mg                   174   8e-47   Citrus sinensis [apfelsine]
ref|XP_003541616.1|  PREDICTED: NADPH--cytochrome P450 reductase        174   8e-47   Glycine max [soybeans]
ref|XP_008383106.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    174   9e-47   Malus domestica [apple tree]
ref|XP_008383105.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    174   9e-47   Malus domestica [apple tree]
emb|CDY14183.1|  BnaA08g13140D                                          174   9e-47   Brassica napus [oilseed rape]
ref|XP_002447240.1|  hypothetical protein SORBIDRAFT_06g031110          174   1e-46   Sorghum bicolor [broomcorn]
ref|XP_010259920.1|  PREDICTED: NADPH--cytochrome P450 reductase        174   1e-46   Nelumbo nucifera [Indian lotus]
gb|AFW59699.1|  hypothetical protein ZEAMMB73_961001                    172   1e-46   
ref|XP_010447751.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    174   1e-46   Camelina sativa [gold-of-pleasure]
ref|XP_010438203.1|  PREDICTED: NADPH--cytochrome P450 reductase 2      174   1e-46   Camelina sativa [gold-of-pleasure]
ref|XP_006845640.1|  hypothetical protein AMTR_s00019p00222550          174   1e-46   
emb|CAA81210.1|  NADPH-ferrihemoprotein reductase                       172   1e-46   Helianthus tuberosus [Jerusalem artichoke]
ref|XP_006453369.1|  hypothetical protein CICLE_v10007535mg             174   1e-46   
ref|XP_009130253.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    174   1e-46   Brassica rapa
ref|XP_006453370.1|  hypothetical protein CICLE_v10007535mg             174   1e-46   
gb|KHN22700.1|  NADPH--cytochrome P450 reductase                        174   1e-46   Glycine soja [wild soybean]
gb|KDO43874.1|  hypothetical protein CISIN_1g005072mg                   172   1e-46   Citrus sinensis [apfelsine]
emb|CBX24555.1|  NADPH:cytochrome P450 reductase                        174   1e-46   Salvia miltiorrhiza [Chinese salvia]
gb|KDO43875.1|  hypothetical protein CISIN_1g005072mg                   172   1e-46   Citrus sinensis [apfelsine]
ref|XP_006474186.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    173   2e-46   Citrus sinensis [apfelsine]
gb|AHB33950.1|  cytochrome P450 reductase                               173   2e-46   Santalum album
ref|XP_006474185.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    173   2e-46   Citrus sinensis [apfelsine]
emb|CDX68634.1|  BnaC01g08190D                                          173   2e-46   
ref|XP_010929254.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    173   2e-46   Elaeis guineensis
emb|CDY03543.1|  BnaC03g68020D                                          173   2e-46   
ref|XP_006283224.1|  hypothetical protein CARUB_v10004254mg             173   3e-46   Capsella rubella
ref|XP_010548619.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    173   3e-46   Tarenaya hassleriana [spider flower]
dbj|BAD05443.1|  putative cytochrome P450 reductase                     172   3e-46   Oryza sativa Japonica Group [Japonica rice]
gb|EEE70211.1|  hypothetical protein OsJ_30318                          173   3e-46   Oryza sativa Japonica Group [Japonica rice]
gb|EYU42400.1|  hypothetical protein MIMGU_mgv1a002170mg                172   3e-46   Erythranthe guttata [common monkey flower]
ref|XP_004242931.1|  PREDICTED: NADPH--cytochrome P450 reductase        172   4e-46   Solanum lycopersicum
gb|AAC05021.1|  NADPH:ferrihemoprotein oxidoreductase                   172   4e-46   Papaver somniferum
ref|XP_010433014.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    172   4e-46   Camelina sativa [gold-of-pleasure]
ref|NP_001061346.1|  Os08g0243500                                       172   5e-46   
ref|XP_008667833.1|  PREDICTED: uncharacterized protein LOC100279...    172   5e-46   Zea mays [maize]
emb|CDX72222.1|  BnaC07g42440D                                          172   6e-46   
ref|XP_008667834.1|  PREDICTED: uncharacterized protein LOC100279...    172   6e-46   
emb|CDY51656.1|  BnaAnng10960D                                          172   6e-46   Brassica napus [oilseed rape]
ref|XP_003549436.1|  PREDICTED: NADPH--cytochrome P450 reductase        172   8e-46   Glycine max [soybeans]
ref|XP_006412733.1|  hypothetical protein EUTSA_v10024546mg             171   8e-46   Eutrema salsugineum [saltwater cress]
dbj|BAJ33878.1|  unnamed protein product                                171   9e-46   Eutrema halophilum
gb|EEE68301.1|  hypothetical protein OsJ_26563                          171   9e-46   Oryza sativa Japonica Group [Japonica rice]
gb|AAC05022.1|  NADPH:ferrihemoprotein oxidoreductase                   171   1e-45   Eschscholzia californica
gb|KHN17598.1|  NADPH--cytochrome P450 reductase                        171   1e-45   Glycine soja [wild soybean]
ref|XP_008661364.1|  PREDICTED: uncharacterized protein LOC100192...    171   1e-45   
ref|XP_010688489.1|  PREDICTED: NADPH--cytochrome P450 reductase        171   1e-45   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006659239.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    170   1e-45   
ref|XP_009408053.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    171   2e-45   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABB88839.2|  NADPH cytochrome P450 reductase                         171   2e-45   Stevia rebaudiana
ref|XP_010234513.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    170   2e-45   Brachypodium distachyon [annual false brome]
ref|NP_194750.1|  NADPH--cytochrome P450 reductase 2                    170   2e-45   Arabidopsis thaliana [mouse-ear cress]
ref|NP_849472.2|  NADPH--cytochrome P450 reductase 2                    170   2e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007154761.1|  hypothetical protein PHAVU_003G145400g             170   2e-45   Phaseolus vulgaris [French bean]
gb|AAC09468.2|  putative NADPH-cytochrome P450 reductase                170   2e-45   Pisum sativum [garden pea]
emb|CAA46815.1|  NADPH-ferrihemoprotein reductase                       170   2e-45   Arabidopsis thaliana [mouse-ear cress]
gb|AAS90127.1|  NADPH cytochrome P450 reductase                         170   3e-45   Ammi majus [ameo mayor]
gb|AAB97736.1|  NADPH cytochrome P450 reductase                         169   4e-45   Petroselinum crispum
gb|EPS66345.1|  hypothetical protein M569_08425                         169   4e-45   Genlisea aurea
ref|XP_003610110.1|  NADPH cytochrome P450 reductase                    167   4e-45   
gb|ABM88789.1|  cytochrome P450 reductase                               169   5e-45   Artemisia annua [sweet Annie]
gb|ABC47946.1|  cytochrome P450 reductase                               169   5e-45   Artemisia annua [sweet Annie]
gb|EPS73891.1|  hypothetical protein M569_00858                         169   5e-45   Genlisea aurea
gb|ABI98819.1|  cytochrome P450 reductase                               169   6e-45   Artemisia annua [sweet Annie]
gb|KDP36395.1|  hypothetical protein JCGZ_08664                         169   6e-45   Jatropha curcas
emb|CAQ37789.1|  NADPH:cytochrome P450 reductase                        169   6e-45   Plectranthus scutellarioides
ref|XP_011016946.1|  PREDICTED: LOW QUALITY PROTEIN: NADPH--cytoc...    169   7e-45   Populus euphratica
gb|ABL09938.1|  cytochrome P450 reductase                               169   7e-45   Artemisia annua [sweet Annie]
ref|XP_002869386.1|  hypothetical protein ARALYDRAFT_913457             169   8e-45   Arabidopsis lyrata subsp. lyrata
sp|Q05001.1|NCPR_CATRO  RecName: Full=NADPH--cytochrome P450 redu...    169   8e-45   Catharanthus roseus [chatas]
gb|KFK29577.1|  nadph-ferrihemoprotein reductase                        169   8e-45   Arabis alpina [alpine rockcress]
gb|ACG27711.1|  NADPH--cytochrome P450 reductase                        168   9e-45   Zea mays [maize]
gb|KHG21257.1|  NADPH--cytochrome P450 reductase                        168   1e-44   Gossypium arboreum [tree cotton]
ref|XP_008676669.1|  PREDICTED: uncharacterized protein LOC100216...    168   1e-44   
ref|XP_004973052.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    168   1e-44   Setaria italica
gb|AAG17471.1|AF123610_10  NADPH-cytochrome P450 reductase              167   2e-44   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003610109.1|  NADPH cytochrome P450 reductase                    167   2e-44   Medicago truncatula
gb|AFO64618.1|  cytochrome P450 reductase                               167   2e-44   Artemisia annua [sweet Annie]
gb|AAB97737.1|  NADPH cytochrome P450 reductase                         167   3e-44   Petroselinum crispum
gb|EPS67504.1|  hypothetical protein M569_07270                         167   3e-44   Genlisea aurea
gb|ADG29353.1|  cytochrome P450 reductase                               167   3e-44   Withania somnifera [ashwagandha]
gb|EYU20907.1|  hypothetical protein MIMGU_mgv1a002097mg                167   3e-44   Erythranthe guttata [common monkey flower]
gb|AGO03799.1|  cytochrome P450-like protein                            167   4e-44   Tanacetum cinerariifolium [pyrethrum]
emb|CAA81209.1|  NADPH-ferrihemoprotein reductase                       166   5e-44   Helianthus tuberosus [Jerusalem artichoke]
dbj|BAJ99370.1|  predicted protein                                      166   7e-44   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002984697.1|  hypothetical protein SELMODRAFT_234596             165   1e-43   
gb|AIO11759.1|  cytochrome p450 reductase                               165   2e-43   Croton stellatopilosus
ref|XP_002978784.1|  hypothetical protein SELMODRAFT_152770             164   4e-43   
gb|AHM95445.1|  cytochrome P450 reductase                               164   4e-43   Matricaria chamomilla var. recutita [German chamomile]
dbj|BAJ41268.1|  NADPH-P450 reductase 1                                 160   1e-41   Zingiber officinale [ginger]
ref|XP_001770150.1|  predicted protein                                  158   3e-41   
ref|XP_010526342.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    158   5e-41   Tarenaya hassleriana [spider flower]
ref|XP_001785882.1|  predicted protein                                  157   8e-41   
ref|XP_001779575.1|  predicted protein                                  156   2e-40   
ref|XP_008451695.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    155   7e-40   
gb|EMS53484.1|  NADPH--cytochrome P450 reductase                        154   8e-40   Triticum urartu
gb|EMT19472.1|  NADPH--cytochrome P450 reductase                        154   9e-40   
gb|KDO81196.1|  hypothetical protein CISIN_1g005496mg                   150   3e-38   Citrus sinensis [apfelsine]
ref|XP_001758838.1|  predicted protein                                  144   3e-36   
gb|KJB14708.1|  hypothetical protein B456_002G138900                    142   2e-35   Gossypium raimondii
ref|XP_004501653.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    142   4e-35   
gb|KCW80968.1|  hypothetical protein EUGRSUZ_C02330                     140   1e-34   Eucalyptus grandis [rose gum]
ref|XP_008808352.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    132   3e-34   
ref|XP_004960246.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    138   8e-34   
gb|KJB22141.1|  hypothetical protein B456_004G0316002                   135   9e-34   Gossypium raimondii
ref|XP_008680517.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    129   2e-33   
ref|XP_002986144.1|  hypothetical protein SELMODRAFT_157822             135   5e-33   
ref|XP_002984958.1|  hypothetical protein SELMODRAFT_181373             135   1e-32   
ref|XP_002534464.1|  cytochrome P450, putative                          133   4e-32   
ref|XP_004507857.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    132   8e-32   
gb|AFW62956.1|  hypothetical protein ZEAMMB73_744602                    129   3e-31   
gb|ABR25415.1|  NADPH-cytochrome p450 reductase                         119   1e-30   
gb|ACF35282.1|  cytochrome P450 reductase-like protein                  125   3e-29   
ref|XP_005846436.1|  hypothetical protein CHLNCDRAFT_36035              121   6e-28   
gb|ACF83106.1|  unknown                                                 111   1e-27   
gb|KDD72489.1|  hypothetical protein H632_c3282p1                       107   1e-25   
ref|XP_002960044.1|  hypothetical protein SELMODRAFT_401997             114   1e-25   
gb|KIY99765.1|  hypothetical protein MNEG_8195                          114   3e-25   
ref|XP_002953937.1|  hypothetical protein VOLCADRAFT_76078              112   7e-25   
ref|XP_007680859.1|  hypothetical protein BAUCODRAFT_28100              112   1e-24   
ref|XP_009051974.1|  hypothetical protein LOTGIDRAFT_187717             112   1e-24   
emb|CDW58665.1|  NAD binding 1 domain containing protein                105   2e-24   
gb|ACE86176.1|  Molybdopterin oxidoreductase Fe4S4 domain family        111   5e-24   
ref|WP_041552449.1|  reductase                                          111   6e-24   
ref|WP_043986383.1|  FAD-binding protein                                108   8e-24   
ref|WP_043391935.1|  FAD-binding protein                                108   9e-24   
ref|WP_006896602.1|  putative nitrate/sulfite reductase                 110   1e-23   
ref|XP_001690130.1|  NADPH-cytochrome P450 reductase                    108   1e-23   
ref|XP_011427038.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    109   1e-23   
ref|XP_009658187.1|  NADPH-cytochrome P450 reductase                    109   2e-23   
ref|XP_007433824.1|  PREDICTED: NADPH--cytochrome P450 reductase        107   5e-23   
gb|KIZ02441.1|  NADPH-cytochrome P450 reductase                         107   6e-23   
prf||1103184A  reductase,NADPH cytochrome P450                          102   6e-23
dbj|BAN82201.1|  hypothetical protein                                   107   7e-23   
ref|XP_004343008.1|  NADPH-cytochrome P450 reductase                    107   7e-23   
emb|CEP08857.1|  hypothetical protein                                   107   8e-23   
gb|ELU16857.1|  hypothetical protein CAPTEDRAFT_153661                  105   9e-23   
ref|XP_002108516.1|  hypothetical protein TRIADDRAFT_63169              107   9e-23   
gb|EFA83496.1|  NADPH-cytochrome-P450 oxidoreductase                    107   9e-23   
gb|EKC21191.1|  NADPH--cytochrome P450 reductase                        107   1e-22   
gb|EPY30731.1|  NADPH-ferrihemoprotein reductase                        106   1e-22   
gb|EPY26135.1|  NADPH-ferrihemoprotein reductase                        105   2e-22   
gb|EUA71951.1|  oxidoreductase NAD-binding domain protein             99.8    2e-22   
ref|XP_009022160.1|  hypothetical protein HELRODRAFT_113572             105   2e-22   
gb|KJE97834.1|  NADPH-cytochrome P450 reductase, variant                105   2e-22   
gb|KIN00315.1|  hypothetical protein OIDMADRAFT_123965                  105   3e-22   
ref|XP_010852620.1|  PREDICTED: LOW QUALITY PROTEIN: NADPH--cytoc...    105   3e-22   
sp|Q3SYT8.3|NCPR_BOVIN  RecName: Full=NADPH--cytochrome P450 redu...    105   3e-22   
ref|NP_001030467.1|  NADPH--cytochrome P450 reductase                   105   3e-22   
ref|WP_040518010.1|  reductase                                          106   3e-22   
gb|EGD55572.1|  molybdopterin oxidoreductase                            106   3e-22   
ref|XP_008120878.1|  PREDICTED: NADPH--cytochrome P450 reductase        105   3e-22   
ref|XP_002612108.1|  hypothetical protein BRAFLDRAFT_288748             105   3e-22   
ref|WP_020475376.1|  hypothetical protein                               104   4e-22   
ref|XP_003849625.1|  hypothetical protein MYCGRDRAFT_75805              105   4e-22   
ref|XP_007104040.1|  PREDICTED: NADPH--cytochrome P450 reductase        104   5e-22   
ref|XP_007186623.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    104   5e-22   
gb|KFA72831.1|  hypothetical protein S40288_08553                       104   5e-22   
gb|KEY74237.1|  hypothetical protein S7711_00395                        104   5e-22   
gb|ELT87080.1|  hypothetical protein CAPTEDRAFT_173459                  104   6e-22   
ref|XP_007590680.1|  NADPH-cytochrome P450 reductase                    104   6e-22   
ref|XP_001631497.1|  predicted protein                                  104   6e-22   
emb|CCD52117.1|  hypothetical protein BofuT4_P082760.1                98.6    6e-22   
ref|WP_034723470.1|  sulfite reductase [NADPH] flavoprotein alpha...    102   6e-22   
emb|CCF32060.1|  NADPH-cytochrome P450 reductase                        104   7e-22   
ref|XP_007278117.1|  cytochrome p450 oxidoreductase                     104   7e-22   
gb|KFA61935.1|  hypothetical protein S40285_02840                       104   7e-22   
gb|ETI69776.1|  CysJ                                                    102   7e-22   
ref|WP_038542131.1|  sulfite reductase [NADPH] flavoprotein alpha...    101   8e-22   
ref|XP_006201451.1|  PREDICTED: NADPH--cytochrome P450 reductase        103   8e-22   
gb|ETE65154.1|  NADPH-cytochrome reductase                              103   9e-22   
ref|XP_008186078.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    101   9e-22   
ref|XP_007931123.1|  hypothetical protein MYCFIDRAFT_157570             103   9e-22   
ref|XP_010970634.1|  PREDICTED: LOW QUALITY PROTEIN: NADPH--cytoc...    103   9e-22   
ref|XP_010979045.1|  PREDICTED: NADPH--cytochrome P450 reductase        103   9e-22   
ref|WP_040392580.1|  reductase                                          104   9e-22   
gb|EIK44482.1|  Molybdopterin oxidoreductase Fe4S4 domain family        104   1e-21   
ref|XP_964443.1|  NADPH-cytochrome P450 reductase                       103   1e-21   
ref|XP_009218896.1|  NADPH-cytochrome P450 reductase                    103   1e-21   
ref|XP_004688336.1|  PREDICTED: NADPH--cytochrome P450 reductase        103   1e-21   
dbj|BAF49701.1|  NADPH-P450 reductase                                   103   1e-21   
ref|NP_001078953.1|  P450 (cytochrome) oxidoreductase                   103   1e-21   
ref|XP_003715306.1|  NADPH-cytochrome P450 reductase, variant           103   1e-21   
ref|XP_002130153.1|  PREDICTED: NADPH--cytochrome P450 reductase        103   1e-21   
ref|XP_009849280.1|  NADPH-cytochrome P450 reductase                    103   1e-21   
gb|ENH85424.1|  nadph-cytochrome p450 reductase                         103   1e-21   
emb|CBY19304.1|  unnamed protein product                                101   1e-21   
ref|XP_004326617.1|  PREDICTED: NADPH--cytochrome P450 reductase        103   2e-21   
gb|EQB57087.1|  hypothetical protein CGLO_02825                         103   2e-21   
ref|XP_006640872.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    103   2e-21   
ref|WP_025239425.1|  FAD-binding protein                                102   2e-21   
gb|EPY24868.1|  NADPH-ferrihemoprotein reductase                        100   2e-21   
ref|WP_017207328.1|  FAD-binding protein                                102   2e-21   
ref|WP_005079611.1|  MULTISPECIES: FAD-binding protein                  102   2e-21   
ref|WP_005088242.1|  MULTISPECIES: FAD-binding protein                  102   2e-21   
emb|CEF99664.1|  Flavoprotein pyridine nucleotide cytochrome redu...    103   2e-21   
ref|WP_016342621.1|  putative NADPH--sulfite reductase flavoprote...    102   2e-21   
ref|WP_005058322.1|  FAD-binding protein                                102   2e-21   
ref|WP_041356566.1|  sulfite reductase [NADPH] flavoprotein alpha...    102   2e-21   
emb|CAD84764.1|  Sulfite reductase flavoprotein subunit                 102   2e-21   
ref|WP_005093337.1|  FAD-binding protein                                102   2e-21   
gb|KDN70201.1|  putative FAD binding domain-containing protein          102   3e-21   
ref|WP_035445307.1|  sulfite reductase [NADPH] flavoprotein alpha...    100   3e-21   
gb|KIL92537.1|  nadph-cytochrome p450 reductase                         102   3e-21   
ref|WP_017023910.1|  sulfite reductase subunit alpha                    102   3e-21   
ref|XP_006088353.1|  PREDICTED: NADPH--cytochrome P450 reductase        102   4e-21   
gb|EFQ30590.1|  FAD binding domain-containing protein                   102   4e-21   
ref|XP_005879217.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    102   4e-21   
ref|XP_003082028.1|  NADPH-ferrihemoprotein reductase (ISS)             102   4e-21   
ref|XP_008139684.1|  PREDICTED: NADPH--cytochrome P450 reductase        102   4e-21   
ref|XP_005879216.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    102   4e-21   
ref|XP_010891864.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    101   4e-21   
ref|WP_012800660.1|  FAD-binding domain-containing protein              102   4e-21   
gb|EPQ15742.1|  NADPH--cytochrome P450 reductase                        102   4e-21   
ref|XP_003378184.1|  NADPH--cytochrome P450 reductase                   102   4e-21   
gb|EEX38010.1|  sulfite reductase [NADPH] flavoprotein alpha-comp...    101   4e-21   
ref|XP_007776209.1|  NADPH-cytochrome P450 reductase                    102   4e-21   
ref|NP_001123431.1|  NADPH--cytochrome P450 reductase                   102   4e-21   
gb|ABQ22774.1|  NADPH-cytochrome P450 reductase-like protein          95.5    5e-21   
ref|WP_040904718.1|  sulfite reductase subunit alpha                    101   5e-21   
ref|XP_006918626.1|  PREDICTED: NADPH--cytochrome P450 reductase        102   5e-21   
ref|XP_002484207.1|  NADPH cytochrome P450 reductase (CprA), puta...    102   5e-21   
sp|P04175.2|NCPR_PIG  RecName: Full=NADPH--cytochrome P450 reduct...    102   5e-21   
gb|ELK06871.1|  NADPH--cytochrome P450 reductase                        101   5e-21   
gb|EPS33038.1|  hypothetical protein PDE_07999                          102   5e-21   
emb|CDQ65983.1|  unnamed protein product                                102   5e-21   
gb|EFA80409.1|  NADPH-cytochrome-P450 oxidoreductase                    101   5e-21   
ref|XP_008493329.1|  PREDICTED: NADPH--cytochrome P450 reductase        101   5e-21   
ref|XP_010891863.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    101   6e-21   
ref|XP_008947241.1|  PREDICTED: NADPH--cytochrome P450 reductase        100   6e-21   
ref|XP_007518012.1|  PREDICTED: LOW QUALITY PROTEIN: NADPH--cytoc...    101   6e-21   
ref|XP_005109645.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    101   6e-21   
gb|KFQ23534.1|  NADPH--cytochrome P450 reductase                        100   6e-21   
sp|Q00141.2|NCPR_ASPNG  RecName: Full=NADPH--cytochrome P450 redu...    101   7e-21   
ref|WP_007922873.1|  NADPH--cytochrome P450 reductase                   102   7e-21   
ref|XP_006962366.1|  NADPH cytochrome P450 oxidoreductase               101   8e-21   
ref|XP_011115941.1|  hypothetical protein H072_10480                    101   8e-21   
ref|XP_011369842.1|  PREDICTED: NADPH--cytochrome P450 reductase        101   8e-21   
ref|XP_004268859.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    101   8e-21   
ref|XP_004761691.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    101   9e-21   
ref|WP_005099611.1|  FAD-binding protein                                100   9e-21   
ref|XP_007639858.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  95.5    9e-21   
gb|EKM34013.1|  oxidoreductase NAD-binding domain protein             97.4    9e-21   
ref|XP_001945312.1|  PREDICTED: NADPH--cytochrome P450 reductase        101   9e-21   
gb|KFU95881.1|  NADPH--cytochrome P450 reductase                        100   9e-21   
ref|WP_005068206.1|  FAD-binding protein                                100   1e-20   
ref|XP_010004324.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    100   1e-20   
ref|XP_009252252.1|  hypothetical protein FPSE_00857                    100   1e-20   
ref|XP_010004325.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    100   1e-20   
gb|EHK43307.1|  hypothetical protein TRIATDRAFT_33220                   100   1e-20   
ref|WP_008950490.1|  sulfite reductase subunit alpha                    100   1e-20   
ref|NP_001030154.1|  NADPH--cytochrome P450 reductase                   100   1e-20   
ref|WP_035424746.1|  sulfite reductase [NADPH] flavoprotein alpha...  98.6    1e-20   
ref|WP_008984901.1|  sulfite reductase subunit alpha                    100   1e-20   
ref|XP_005172735.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    100   1e-20   
ref|WP_008606384.1|  sulfite reductase subunit alpha                    100   1e-20   
ref|XP_011327904.1|  NADPH-cytochrome P450 reductase                    100   1e-20   
ref|XP_002150062.1|  NADPH cytochrome P450 reductase (CprA), puta...    100   1e-20   
ref|WP_016891937.1|  FAD-binding protein                                100   1e-20   
dbj|GAD97695.1|  NADPH cytochrome P450 reductase                        100   1e-20   
ref|XP_001558194.1|  hypothetical protein BC1G_03226                    100   1e-20   
ref|WP_008684148.1|  sulfite reductase subunit alpha                    100   1e-20   
gb|AAG23833.1|AF290425_1  NADPH cytochrome P450 oxidoreductase is...    100   1e-20   
gb|KFV90097.1|  NADPH--cytochrome P450 reductase                      99.4    1e-20   
ref|XP_007468859.1|  PREDICTED: NADPH--cytochrome P450 reductase        100   1e-20   
gb|KFQ51301.1|  NADPH--cytochrome P450 reductase                        100   1e-20   
emb|CCE28101.1|  probable NCP1-NADPH-cytochrome P450 reductase          100   1e-20   
ref|XP_010152032.1|  PREDICTED: NADPH--cytochrome P450 reductase      99.0    1e-20   
ref|WP_036389919.1|  FAD-binding protein                              99.8    2e-20   
ref|WP_028046553.1|  reductase                                          101   2e-20   
ref|XP_006773443.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    100   2e-20   
ref|XP_006773444.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    100   2e-20   
emb|CEG74525.1|  Putative NADPH--cytochrome P450 reductase              100   2e-20   
ref|XP_003074517.1|  NADPH-cytochrome P-450 reductase (ISS)             100   2e-20   
emb|CEI90083.1|  Putative NADPH--cytochrome P450 reductase              100   2e-20   
ref|XP_001420330.1|  predicted protein                                98.2    2e-20   
ref|XP_001415936.1|  predicted protein                                99.8    2e-20   
gb|EPY33847.1|  NADPH-ferrihemoprotein reductase                        100   2e-20   
ref|WP_016886874.1|  FAD-binding protein                              99.8    2e-20   
gb|EKV15852.1|  NADPH--cytochrome P450 reductase                        100   2e-20   
ref|XP_628906.1|  NADPH-cytochrome-P450 oxidoreductase                  100   2e-20   
gb|KEZ41267.1|  NADPH--cytochrome P450 reductase                        100   2e-20   
emb|CCT64101.1|  probable NCP1-NADPH-cytochrome P450 reductase          100   2e-20   
ref|XP_003283983.1|  NADPH-cytochrome-P450 oxidoreductase               100   2e-20   
gb|KFQ20093.1|  NADPH--cytochrome P450 reductase                        100   2e-20   
ref|XP_004911688.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    100   2e-20   
emb|CEF96794.1|  Flavoprotein pyridine nucleotide cytochrome redu...    100   2e-20   
ref|WP_041580955.1|  sulfite reductase [NADPH] flavoprotein alpha...  97.8    2e-20   
gb|EXL87323.1|  NADPH-cytochrome P450 reductase                         100   2e-20   
ref|XP_002933864.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    100   2e-20   
emb|CCD15772.1|  unnamed protein product                              96.3    2e-20   
ref|XP_010191751.1|  PREDICTED: LOW QUALITY PROTEIN: NADPH--cytoc...    100   2e-20   
ref|XP_004620908.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  99.8    2e-20   
gb|EHK22188.1|  hypothetical protein TRIVIDRAFT_71556                   100   2e-20   
dbj|GAN10969.1|  NADPh-cytochrome p450 reductase protein                100   2e-20   
ref|XP_007938439.1|  PREDICTED: NADPH--cytochrome P450 reductase        100   2e-20   
gb|AGK53189.1|  protein CysJ                                          97.8    2e-20   
gb|KDB15590.1|  cytochrome P450 oxidoreductase                          100   2e-20   
gb|EPB88240.1|  hypothetical protein HMPREF1544_04948                   100   2e-20   
ref|XP_808628.1|  P450 reductase                                      96.3    2e-20   
gb|EWG45709.1|  NADPH-cytochrome P450 reductase                         100   2e-20   
ref|XP_004620907.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    100   2e-20   
dbj|GAN06318.1|  cytochrome P450 oxidoreductase                         100   2e-20   
gb|EPB87224.1|  hypothetical protein HMPREF1544_05946                   100   2e-20   
gb|EKG13469.1|  Flavodoxin                                              100   2e-20   
gb|ABQ22697.1|  NADPH-cytochrome P450 reductase-like protein          93.6    2e-20   
ref|NP_001153762.1|  NADPH--cytochrome P450 reductase                 99.8    3e-20   
gb|AAX37331.1|  NADPH-cytochrome P450 oxidoreductase                  99.8    3e-20   
ref|XP_002836851.1|  hypothetical protein                             99.8    3e-20   
ref|WP_036260452.1|  sulfite reductase                                99.0    3e-20   
ref|WP_021023513.1|  sulfite reductase subunit alpha                  99.4    3e-20   
ref|XP_007587627.1|  putative nadph-cytochrome p450 reductase pro...  99.8    3e-20   
ref|XP_005620963.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  99.4    3e-20   
ref|WP_040891227.1|  sulfite reductase subunit alpha                  99.4    3e-20   
gb|ADM18969.1|  NADPH-cytochrome P450 oxidoreductase                  99.8    3e-20   
ref|NP_001182725.1|  NADPH--cytochrome P450 reductase                 99.8    3e-20   
dbj|GAD81345.1|  NADPH--sulfite reductase flavoprotein alpha-comp...  99.4    3e-20   
ref|NP_001171276.1|  NADPH--cytochrome P450 reductase                 99.4    3e-20   
ref|XP_005620955.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  99.8    3e-20   
ref|XP_005620956.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  99.8    3e-20   
gb|KEQ60063.1|  cytochrome P450 reductase 1                           99.4    3e-20   
emb|CAA81550.1|  NADPH cytochrome P450 oxidoreductase                 99.4    3e-20   
ref|XP_005620957.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  99.4    3e-20   
emb|CCC11787.1|  unnamed protein product                              99.4    4e-20   
gb|KFP52012.1|  NADPH--cytochrome P450 reductase                      99.0    4e-20   
ref|XP_009505171.1|  PREDICTED: NADPH--cytochrome P450 reductase      99.4    4e-20   



>ref|XP_009786522.1| PREDICTED: NADPH--cytochrome P450 reductase [Nicotiana sylvestris]
Length=686

 Score =   208 bits (530),  Expect = 4e-59, Method: Composition-based stats.
 Identities = 95/108 (88%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYEEEL++F DQG+ISELI+AFSREGPQK+YVQHK+ E+AS VWSLISQEGYLYV
Sbjct  579  RRMDFIYEEELQSFVDQGVISELIIAFSREGPQKEYVQHKMLEKASHVWSLISQEGYLYV  638

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIVQEQ+KVDS+KAEAIVKKLQM+GRYLRDVW
Sbjct  639  CGDAKGMARDVHRTLHTIVQEQDKVDSTKAEAIVKKLQMDGRYLRDVW  686



>gb|AAZ39648.1| cytochrome P450 NADPH-reductase [Petunia x hybrida]
Length=687

 Score =   208 bits (529),  Expect = 7e-59, Method: Composition-based stats.
 Identities = 95/108 (88%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYEEEL++F DQG+ISELI+AFSREGPQK+YVQHK+ E+AS VWSLISQEGYLYV
Sbjct  580  RRMDFIYEEELQSFVDQGVISELIIAFSREGPQKEYVQHKMMEKASHVWSLISQEGYLYV  639

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIVQEQEK DSSKAEA VKKLQM+GRYLRDVW
Sbjct  640  CGDAKGMARDVHRTLHTIVQEQEKADSSKAEATVKKLQMDGRYLRDVW  687



>ref|XP_009630023.1| PREDICTED: NADPH--cytochrome P450 reductase [Nicotiana tomentosiformis]
Length=686

 Score =   206 bits (525),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/108 (87%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYEEEL++F DQG+ISELI+AFSREGPQK+YVQHK+ E+AS VWSLISQEGYLYV
Sbjct  579  RRMDFIYEEELQSFVDQGVISELIIAFSREGPQKEYVQHKMLEKASHVWSLISQEGYLYV  638

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTI+QEQ+KVDS+KAEAIVKKLQM+GRYLRDVW
Sbjct  639  CGDAKGMARDVHRTLHTIIQEQDKVDSTKAEAIVKKLQMDGRYLRDVW  686



>ref|XP_006338052.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Solanum tuberosum]
Length=686

 Score =   206 bits (523),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 94/108 (87%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYEEEL++F DQG+ISELI+AFSREGPQK+YVQHK+ E+AS VWSLISQEGYLYV
Sbjct  579  RRMDFIYEEELQSFVDQGVISELIIAFSREGPQKEYVQHKMMEKASHVWSLISQEGYLYV  638

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIVQEQE  DSSKAEA+VKKLQM+GRYLRDVW
Sbjct  639  CGDAKGMARDVHRTLHTIVQEQENADSSKAEAVVKKLQMDGRYLRDVW  686



>gb|ACF17649.1| putative cytochrome reductase [Capsicum annuum]
 gb|AFV95075.1| cytochrome P450 reductase [Capsicum annuum]
Length=686

 Score =   205 bits (522),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 94/108 (87%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYEEELK+F DQG+ISELI+AFSREGPQK+YVQHK+ E+AS+VWSLISQ+GYLYV
Sbjct  579  RRMDFIYEEELKSFVDQGVISELIIAFSREGPQKEYVQHKMMEKASEVWSLISQDGYLYV  638

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIVQEQE  +SSKAEAIVKKLQM+GRYLRDVW
Sbjct  639  CGDAKGMARDVHRTLHTIVQEQENANSSKAEAIVKKLQMDGRYLRDVW  686



>gb|ADI49691.1| cytochrome P450 reductase [Withania somnifera]
Length=686

 Score =   203 bits (516),  Expect = 4e-57, Method: Composition-based stats.
 Identities = 93/108 (86%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYEEEL+ F DQG++SELIVAFSREGPQK+YVQHK+ E+AS VWSLISQEGYLYV
Sbjct  579  RRMDFIYEEELQRFVDQGVLSELIVAFSREGPQKEYVQHKMMEKASHVWSLISQEGYLYV  638

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHR LHTIVQEQE  DSSKAEA VKKLQM+GRYLRDVW
Sbjct  639  CGDAKGMARDVHRALHTIVQEQENADSSKAEATVKKLQMDGRYLRDVW  686



>gb|AAS92623.1| NADPH:cytochrome P450-reductase [Centaurium erythraea]
Length=692

 Score =   202 bits (515),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 91/108 (84%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYE ELK +ED+G++SELIVAFSREGPQK+YVQHK+ E+A+++WSL+SQEGYLYV
Sbjct  585  RRMDFIYESELKKYEDEGVVSELIVAFSREGPQKEYVQHKMMEKAAEIWSLLSQEGYLYV  644

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHR LHTIVQEQEK DSSKAEAIVK+LQMNGRYLRDVW
Sbjct  645  CGDAKGMARDVHRALHTIVQEQEKTDSSKAEAIVKQLQMNGRYLRDVW  692



>ref|XP_004238001.1| PREDICTED: NADPH--cytochrome P450 reductase [Solanum lycopersicum]
Length=686

 Score =   201 bits (512),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/108 (86%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYEEEL++F DQG+ISELI+AFSREG QK+YVQHK+ E+AS VWSLISQEGYLYV
Sbjct  579  RRMDFIYEEELQSFVDQGVISELIIAFSREGSQKEYVQHKMMEKASDVWSLISQEGYLYV  638

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIVQEQE  DSSKAEA+VKKLQM+GRYLRDVW
Sbjct  639  CGDAKGMARDVHRTLHTIVQEQENADSSKAEAVVKKLQMDGRYLRDVW  686



>gb|KDO81195.1| hypothetical protein CISIN_1g005496mg [Citrus sinensis]
Length=429

 Score =   195 bits (496),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 88/108 (81%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYE+EL NFE++G+ISELI+AFSREG QK+YVQHK+ ++A+Q+WSL+S+EGYLYV
Sbjct  322  RRMDFIYEDELNNFEEEGVISELILAFSREGSQKEYVQHKMMDKAAQLWSLLSKEGYLYV  381

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIVQEQE VDSSKAE+IVKK QM GRYLRDVW
Sbjct  382  CGDAKGMARDVHRTLHTIVQEQENVDSSKAESIVKKFQMEGRYLRDVW  429



>emb|CDP11509.1| unnamed protein product [Coffea canephora]
Length=691

 Score =   200 bits (508),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 91/108 (84%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYE+EL NF DQG+IS+LIVAFSREGPQKDYVQHK+ E+A++ WSLISQ+G+LYV
Sbjct  584  RRMDFIYEDELNNFVDQGVISKLIVAFSREGPQKDYVQHKMIEKAAEFWSLISQKGHLYV  643

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIVQEQEKVDS++AEA+VKKLQM+GRYLRDVW
Sbjct  644  CGDAKGMARDVHRTLHTIVQEQEKVDSTEAEAMVKKLQMDGRYLRDVW  691



>dbj|BAC41516.1| NADPH-cytochrome P-450 reductase [Ophiorrhiza pumila]
Length=690

 Score =   200 bits (508),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 93/108 (86%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYE+EL  F +QG+ISELIVAFSREGPQK+YVQHK+TE+A+Q WSLISQ GYLYV
Sbjct  583  RRMDFIYEDELSGFVNQGVISELIVAFSREGPQKEYVQHKMTEKAAQFWSLISQVGYLYV  642

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIVQEQE VDSSKAEAIVKKLQ +GRYLRDVW
Sbjct  643  CGDAKGMARDVHRTLHTIVQEQENVDSSKAEAIVKKLQTDGRYLRDVW  690



>ref|XP_006433816.1| hypothetical protein CICLE_v10000469mg [Citrus clementina]
 gb|ESR47056.1| hypothetical protein CICLE_v10000469mg [Citrus clementina]
Length=694

 Score =   199 bits (507),  Expect = 7e-56, Method: Composition-based stats.
 Identities = 88/108 (81%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYE+EL NF ++G+ISELI+AFSREGPQK+YVQHK+ ++A+Q+WSL+S+EGYLYV
Sbjct  587  RRMDFIYEDELNNFVEEGVISELILAFSREGPQKEYVQHKMMDKAAQLWSLLSKEGYLYV  646

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIVQEQE VDSSKAE+IVKK QM GRYLRDVW
Sbjct  647  CGDAKGMARDVHRTLHTIVQEQENVDSSKAESIVKKFQMEGRYLRDVW  694



>ref|XP_009791726.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Nicotiana sylvestris]
Length=686

 Score =   199 bits (506),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/108 (85%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYEEEL  F DQG+ISELI+AFSREGPQK+YVQHK+ E+AS VWSLISQEGYLYV
Sbjct  579  RRMDFIYEEELLGFVDQGVISELIIAFSREGPQKEYVQHKMLEKASHVWSLISQEGYLYV  638

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAK MARDVHRTLHTIVQEQ+KVDS+KAEAI+KKLQM+GRYLRD+W
Sbjct  639  CGDAKEMARDVHRTLHTIVQEQDKVDSTKAEAIMKKLQMDGRYLRDMW  686



>ref|XP_006472452.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Citrus sinensis]
Length=694

 Score =   199 bits (505),  Expect = 1e-55, Method: Composition-based stats.
 Identities = 88/108 (81%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYE+EL NFE++G+ISELI+AFSREG QK+YVQHK+ ++A+Q+WSL+S+EGYLYV
Sbjct  587  RRMDFIYEDELNNFEEEGVISELILAFSREGSQKEYVQHKMMDKAAQLWSLLSKEGYLYV  646

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIVQEQE VDSSKAE+IVKK QM GRYLRDVW
Sbjct  647  CGDAKGMARDVHRTLHTIVQEQENVDSSKAESIVKKFQMEGRYLRDVW  694



>ref|XP_010439016.1| PREDICTED: NADPH--cytochrome P450 reductase 1-like [Camelina 
sativa]
Length=691

 Score =   199 bits (505),  Expect = 1e-55, Method: Composition-based stats.
 Identities = 92/108 (85%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYE+ELKNF DQG+ISELIVAFSREG QK+YVQHKITE+A+QVW+LI +EGYLYV
Sbjct  584  RRMDFIYEDELKNFVDQGVISELIVAFSREGAQKEYVQHKITEKAAQVWNLIKEEGYLYV  643

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMA+DVHRTLHTIVQEQE V SS+AEAIVKKLQ  GRYLRDVW
Sbjct  644  CGDAKGMAKDVHRTLHTIVQEQEGVSSSEAEAIVKKLQTEGRYLRDVW  691



>gb|KDO81193.1| hypothetical protein CISIN_1g005496mg [Citrus sinensis]
Length=694

 Score =   199 bits (505),  Expect = 2e-55, Method: Composition-based stats.
 Identities = 88/108 (81%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYE+EL NFE++G+ISELI+AFSREG QK+YVQHK+ ++A+Q+WSL+S+EGYLYV
Sbjct  587  RRMDFIYEDELNNFEEEGVISELILAFSREGSQKEYVQHKMMDKAAQLWSLLSKEGYLYV  646

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIVQEQE VDSSKAE+IVKK QM GRYLRDVW
Sbjct  647  CGDAKGMARDVHRTLHTIVQEQENVDSSKAESIVKKFQMEGRYLRDVW  694



>ref|XP_010433757.1| PREDICTED: NADPH--cytochrome P450 reductase 1 isoform X1 [Camelina 
sativa]
 ref|XP_010433758.1| PREDICTED: NADPH--cytochrome P450 reductase 1 isoform X2 [Camelina 
sativa]
 ref|XP_010433759.1| PREDICTED: NADPH--cytochrome P450 reductase 1 isoform X3 [Camelina 
sativa]
Length=691

 Score =   199 bits (505),  Expect = 2e-55, Method: Composition-based stats.
 Identities = 92/108 (85%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYE+ELKNF DQG+ISELIVAFSREG QK+YVQHKITE+A+QVW+LI +EGYLYV
Sbjct  584  RRMDFIYEDELKNFVDQGVISELIVAFSREGAQKEYVQHKITEKAAQVWNLIKEEGYLYV  643

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMA+DVHRTLHTIVQEQE V SS+AEAIVKKLQ  GRYLRDVW
Sbjct  644  CGDAKGMAKDVHRTLHTIVQEQEGVSSSEAEAIVKKLQTEGRYLRDVW  691



>ref|XP_010448554.1| PREDICTED: NADPH--cytochrome P450 reductase 1-like [Camelina 
sativa]
Length=691

 Score =   198 bits (503),  Expect = 3e-55, Method: Composition-based stats.
 Identities = 92/108 (85%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYE+ELKNF DQG+ISELIVAFSREG QK+YVQHKITE+A+QVW+LI  EGYLYV
Sbjct  584  RRMDFIYEDELKNFVDQGVISELIVAFSREGAQKEYVQHKITEKAAQVWNLIKDEGYLYV  643

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMA+DVHRTLHTIVQEQE V SS+AEAIVKKLQ  GRYLRDVW
Sbjct  644  CGDAKGMAKDVHRTLHTIVQEQEGVSSSEAEAIVKKLQTEGRYLRDVW  691



>gb|KDO81194.1| hypothetical protein CISIN_1g005496mg [Citrus sinensis]
Length=558

 Score =   194 bits (493),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/108 (81%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYE+EL NFE++G+ISELI+AFSREG QK+YVQHK+ ++A+Q+WSL+S+EGYLYV
Sbjct  451  RRMDFIYEDELNNFEEEGVISELILAFSREGSQKEYVQHKMMDKAAQLWSLLSKEGYLYV  510

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIVQEQE VDSSKAE+IVKK QM GRYLRDVW
Sbjct  511  CGDAKGMARDVHRTLHTIVQEQENVDSSKAESIVKKFQMEGRYLRDVW  558



>ref|XP_003526551.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Glycine max]
 gb|KHN08988.1| NADPH--cytochrome P450 reductase [Glycine soja]
Length=691

 Score =   196 bits (497),  Expect = 2e-54, Method: Composition-based stats.
 Identities = 89/108 (82%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RR+DFIYEEELKNF +QG +SELIVAFSREG +K+YVQHK+ ++A+Q+WSLISQ GYLYV
Sbjct  584  RRLDFIYEEELKNFVEQGSLSELIVAFSREGAEKEYVQHKMMDQAAQLWSLISQGGYLYV  643

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIVQ+QE VDS+KAEAIVKKLQM+GRYLRDVW
Sbjct  644  CGDAKGMARDVHRTLHTIVQQQENVDSTKAEAIVKKLQMDGRYLRDVW  691



>ref|XP_009138145.1| PREDICTED: NADPH--cytochrome P450 reductase 1-like [Brassica 
rapa]
Length=695

 Score =   196 bits (497),  Expect = 2e-54, Method: Composition-based stats.
 Identities = 90/108 (83%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYE+EL N+ DQG+ISELIVAFSREG QK+YVQHKI E+A+QVW+LI +EGYLYV
Sbjct  588  RRMDFIYEDELNNYADQGVISELIVAFSREGAQKEYVQHKIIEKATQVWNLIKEEGYLYV  647

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIVQEQE V SS+AEAIVKKLQ  GRYLRDVW
Sbjct  648  CGDAKGMARDVHRTLHTIVQEQEGVSSSEAEAIVKKLQTEGRYLRDVW  695



>emb|CDY34288.1| BnaA01g13910D [Brassica napus]
Length=695

 Score =   195 bits (496),  Expect = 2e-54, Method: Composition-based stats.
 Identities = 90/108 (83%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYE+EL N+ DQG+ISELIVAFSREG QK+YVQHKI E+A+QVW+LI +EGYLYV
Sbjct  588  RRMDFIYEDELNNYADQGVISELIVAFSREGAQKEYVQHKIIEKATQVWNLIKEEGYLYV  647

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIVQEQE V SS+AEAIVKKLQ  GRYLRDVW
Sbjct  648  CGDAKGMARDVHRTLHTIVQEQEGVSSSEAEAIVKKLQTEGRYLRDVW  695



>ref|XP_007226979.1| hypothetical protein PRUPE_ppa002280mg [Prunus persica]
 gb|EMJ28178.1| hypothetical protein PRUPE_ppa002280mg [Prunus persica]
Length=692

 Score =   195 bits (496),  Expect = 2e-54, Method: Composition-based stats.
 Identities = 88/108 (81%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYE+EL NF D+G++SELIVAFSREGP K+YVQHK+ +RA+ +W LISQ GY YV
Sbjct  585  RRMDFIYEDELNNFVDEGVLSELIVAFSREGPTKEYVQHKMMDRAAHMWDLISQGGYFYV  644

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIVQEQEKVDS+KAEAIVK+LQM+GRYLRDVW
Sbjct  645  CGDAKGMARDVHRTLHTIVQEQEKVDSTKAEAIVKQLQMDGRYLRDVW  692



>ref|XP_006413419.1| hypothetical protein EUTSA_v10024568mg [Eutrema salsugineum]
 gb|ESQ54872.1| hypothetical protein EUTSA_v10024568mg [Eutrema salsugineum]
Length=694

 Score =   195 bits (495),  Expect = 4e-54, Method: Composition-based stats.
 Identities = 89/108 (82%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYE+EL NF DQG+ISELIVAFSREG QK+YVQHK+ E+A+QVW+LI +EGYLYV
Sbjct  587  RRMDFIYEDELNNFVDQGVISELIVAFSREGAQKEYVQHKMIEKAAQVWNLIKEEGYLYV  646

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIVQEQE V SS+AEA+VKKLQ  GRYLRDVW
Sbjct  647  CGDAKGMARDVHRTLHTIVQEQEGVSSSEAEAVVKKLQTEGRYLRDVW  694



>ref|XP_008219251.1| PREDICTED: NADPH--cytochrome P450 reductase isoform X1 [Prunus 
mume]
Length=728

 Score =   195 bits (496),  Expect = 4e-54, Method: Composition-based stats.
 Identities = 87/108 (81%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYE+EL +F D+G++SELIVAFSREGP K+YVQHK+ +RA+ +W LISQ GY YV
Sbjct  621  RRMDFIYEDELNDFVDEGVLSELIVAFSREGPTKEYVQHKMMDRAAHMWDLISQGGYFYV  680

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIVQEQEKVDS+KAEAIVK+LQM+GRYLRDVW
Sbjct  681  CGDAKGMARDVHRTLHTIVQEQEKVDSTKAEAIVKQLQMDGRYLRDVW  728



>gb|AIG15451.1| NADPH-cytochrome P450 reductase 1 [Azadirachta indica]
Length=695

 Score =   194 bits (494),  Expect = 6e-54, Method: Composition-based stats.
 Identities = 87/108 (81%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIY++EL NF DQG+ISELIVAFSREGPQK+YVQHK+ ++A+ +WSL+S++GYLYV
Sbjct  588  RRMDFIYKDELYNFVDQGVISELIVAFSREGPQKEYVQHKMMDKAAYLWSLLSKDGYLYV  647

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTI+QEQE VDSS AEA VKKLQM GRYLRDVW
Sbjct  648  CGDAKGMARDVHRTLHTIIQEQENVDSSTAEATVKKLQMEGRYLRDVW  695



>gb|EYU36460.1| hypothetical protein MIMGU_mgv1a002296mg [Erythranthe guttata]
Length=690

 Score =   194 bits (493),  Expect = 6e-54, Method: Composition-based stats.
 Identities = 90/108 (83%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYE EL +F DQG+ISELIVAFSREG QKDYVQHK+ E+A+QVWSLIS  GYLYV
Sbjct  583  RRMDFIYENELNDFVDQGVISELIVAFSREGSQKDYVQHKMMEKAAQVWSLISGGGYLYV  642

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHR+LHTIVQ QE VDS+KAEA VKKLQM+GRYLRDVW
Sbjct  643  CGDAKGMARDVHRSLHTIVQTQENVDSTKAEATVKKLQMDGRYLRDVW  690



>emb|CDY03447.1| BnaC01g16350D [Brassica napus]
Length=695

 Score =   194 bits (493),  Expect = 7e-54, Method: Composition-based stats.
 Identities = 90/108 (83%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYE+EL NF D+G+ISELIVAFSREG QK+YVQHKI E+A+QVW+LI +EGYLYV
Sbjct  588  RRMDFIYEDELNNFVDKGVISELIVAFSREGAQKEYVQHKIVEKAAQVWNLIKEEGYLYV  647

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIVQEQE V SS+AEAIVKKLQ  GRYLRDVW
Sbjct  648  CGDAKGMARDVHRTLHTIVQEQEGVSSSEAEAIVKKLQTEGRYLRDVW  695



>ref|XP_009137451.1| PREDICTED: NADPH--cytochrome P450 reductase 1 isoform X2 [Brassica 
rapa]
Length=556

 Score =   192 bits (488),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 90/108 (83%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYE+EL NF D+G+ISELIVAFSREG QK+YVQHK+ E+ASQVW+LI +EGYLYV
Sbjct  449  RRMDFIYEDELNNFVDKGVISELIVAFSREGAQKEYVQHKMIEKASQVWNLIKEEGYLYV  508

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIVQEQE V SS+AEAIVKKLQ  GRYLRDVW
Sbjct  509  CGDAKGMARDVHRTLHTIVQEQEGVSSSEAEAIVKKLQTEGRYLRDVW  556



>ref|XP_002265859.2| PREDICTED: NADPH--cytochrome P450 reductase [Vitis vinifera]
 emb|CBI19275.3| unnamed protein product [Vitis vinifera]
Length=688

 Score =   193 bits (491),  Expect = 1e-53, Method: Composition-based stats.
 Identities = 87/108 (81%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYE+EL NF +QGI+SELI+AFSREGPQK+YVQHK+ +RAS +W++ISQ GYLYV
Sbjct  581  RRMDFIYEDELNNFVEQGILSELILAFSREGPQKEYVQHKMMDRASYIWNIISQGGYLYV  640

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMA+DVHRTLHTIVQEQE V+SSKAEAIVKKL   GRYLRDVW
Sbjct  641  CGDAKGMAKDVHRTLHTIVQEQENVESSKAEAIVKKLHTEGRYLRDVW  688



>ref|XP_002867662.1| hypothetical protein ARALYDRAFT_492391 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43921.1| hypothetical protein ARALYDRAFT_492391 [Arabidopsis lyrata subsp. 
lyrata]
Length=692

 Score =   193 bits (490),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/108 (83%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYE+EL NF DQG+ISELIVAFSREG QK+YVQHK+ E+A+QVW+LI +EGYLYV
Sbjct  585  RRMDFIYEDELNNFVDQGVISELIVAFSREGAQKEYVQHKMMEKAAQVWNLIKEEGYLYV  644

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIVQEQE V SS+AEAIVKKLQ  GRYLRDVW
Sbjct  645  CGDAKGMARDVHRTLHTIVQEQEGVSSSEAEAIVKKLQTEGRYLRDVW  692



>ref|XP_010086660.1| NADPH--cytochrome P450 reductase [Morus notabilis]
 gb|EXB22547.1| NADPH--cytochrome P450 reductase [Morus notabilis]
Length=687

 Score =   193 bits (490),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/108 (81%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYE+EL NF +QG +SELIVAFSREGP+K+YVQHK+ ++AS +WSLISQ GY YV
Sbjct  580  RRMDFIYEDELNNFVEQGAMSELIVAFSREGPEKEYVQHKMMDKASCIWSLISQGGYFYV  639

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIVQ+QE VDSSKAE+IVKKLQM+GRYLRDVW
Sbjct  640  CGDAKGMARDVHRTLHTIVQQQENVDSSKAESIVKKLQMDGRYLRDVW  687



>emb|CDY11017.1| BnaA03g46760D [Brassica napus]
Length=695

 Score =   193 bits (490),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/108 (83%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYE+EL NF DQG+ISELIVAFSREG QK+YVQHK+ E+A+QVW+LI +EGYLYV
Sbjct  588  RRMDFIYEDELNNFVDQGVISELIVAFSREGAQKEYVQHKMIEKAAQVWNLIKEEGYLYV  647

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIVQEQE V SS+AEAIVKKLQ  GRYLRDVW
Sbjct  648  CGDAKGMARDVHRTLHTIVQEQEGVSSSEAEAIVKKLQTEGRYLRDVW  695



>ref|XP_008219252.1| PREDICTED: NADPH--cytochrome P450 reductase isoform X2 [Prunus 
mume]
Length=692

 Score =   192 bits (489),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/108 (81%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYE+EL +F D+G++SELIVAFSREGP K+YVQHK+ +RA+ +W LISQ GY YV
Sbjct  585  RRMDFIYEDELNDFVDEGVLSELIVAFSREGPTKEYVQHKMMDRAAHMWDLISQGGYFYV  644

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIVQEQEKVDS+KAEAIVK+LQM+GRYLRDVW
Sbjct  645  CGDAKGMARDVHRTLHTIVQEQEKVDSTKAEAIVKQLQMDGRYLRDVW  692



>ref|XP_009137450.1| PREDICTED: NADPH--cytochrome P450 reductase 1 isoform X1 [Brassica 
rapa]
Length=695

 Score =   192 bits (488),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 90/108 (83%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYE+EL NF D+G+ISELIVAFSREG QK+YVQHK+ E+ASQVW+LI +EGYLYV
Sbjct  588  RRMDFIYEDELNNFVDKGVISELIVAFSREGAQKEYVQHKMIEKASQVWNLIKEEGYLYV  647

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIVQEQE V SS+AEAIVKKLQ  GRYLRDVW
Sbjct  648  CGDAKGMARDVHRTLHTIVQEQEGVSSSEAEAIVKKLQTEGRYLRDVW  695



>gb|KHN39959.1| NADPH--cytochrome P450 reductase [Glycine soja]
Length=689

 Score =   192 bits (488),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 87/108 (81%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MDFIYE+ELKNF +QG +SELIV FSREGP+K+YVQHK+ ++A+ +W+LISQ GYLYV
Sbjct  582  RQMDFIYEDELKNFMEQGALSELIVTFSREGPEKEYVQHKMMDKAANLWNLISQGGYLYV  641

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIVQ+QE VDSSKAEAIVKKLQM+GRYLRDVW
Sbjct  642  CGDAKGMARDVHRTLHTIVQQQENVDSSKAEAIVKKLQMDGRYLRDVW  689



>ref|NP_001236742.1| NADPH:P450 reductase [Glycine max]
 gb|AAN85869.1| NADPH:P450 reductase [Glycine max]
Length=689

 Score =   192 bits (487),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 87/108 (81%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MDFIYE+ELKNF +QG +SELIV FSREGP+K+YVQHK+ ++A+ +W+LISQ GYLYV
Sbjct  582  RQMDFIYEDELKNFMEQGALSELIVTFSREGPEKEYVQHKMMDKAANLWNLISQGGYLYV  641

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIVQ+QE VDSSKAEAIVKKLQM+GRYLRDVW
Sbjct  642  CGDAKGMARDVHRTLHTIVQQQENVDSSKAEAIVKKLQMDGRYLRDVW  689



>ref|XP_003602898.1| NADPH cytochrome P450 reductase [Medicago truncatula]
 gb|AES73149.1| NADPH-cytochrome P450 family 2 reductase [Medicago truncatula]
Length=692

 Score =   192 bits (487),  Expect = 4e-53, Method: Composition-based stats.
 Identities = 88/108 (81%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MDFIYEEEL NF +QG +SELIVAFSREGP+K+YVQHK+ ++AS  WSLISQ GYLYV
Sbjct  585  RQMDFIYEEELNNFVEQGSLSELIVAFSREGPEKEYVQHKMMDKASYFWSLISQGGYLYV  644

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIVQ+QE  DSSKAEA VKKLQM+GRYLRDVW
Sbjct  645  CGDAKGMARDVHRTLHTIVQQQENADSSKAEATVKKLQMDGRYLRDVW  692



>ref|XP_010277515.1| PREDICTED: NADPH--cytochrome P450 reductase-like isoform X1 [Nelumbo 
nucifera]
Length=691

 Score =   192 bits (487),  Expect = 5e-53, Method: Composition-based stats.
 Identities = 85/108 (79%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MDFIYE+EL +F +QG++SELIVAFSREGP K+YVQHK+ ++A++VW+LIS+ GYLYV
Sbjct  584  RKMDFIYEDELNSFVEQGVLSELIVAFSREGPNKEYVQHKMMDKATEVWNLISRNGYLYV  643

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLH+IVQEQE  DSSKAEAIVKKLQM GRYLRDVW
Sbjct  644  CGDAKGMARDVHRTLHSIVQEQESTDSSKAEAIVKKLQMEGRYLRDVW  691



>emb|CDY34287.1| BnaA01g13900D [Brassica napus]
Length=694

 Score =   192 bits (487),  Expect = 5e-53, Method: Composition-based stats.
 Identities = 88/108 (81%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYE+EL NF D+G+ISELIVAFSREG QK+YVQHKI ++A+Q W+LI +EGYLYV
Sbjct  587  RRMDFIYEDELNNFVDKGVISELIVAFSREGAQKEYVQHKIVQKAAQFWNLIKEEGYLYV  646

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIVQEQE V SS+AEAIVKKLQ  GRYLRDVW
Sbjct  647  CGDAKGMARDVHRTLHTIVQEQEGVSSSEAEAIVKKLQTEGRYLRDVW  694



>gb|ACN54323.1| NADPH:cytochrome P450 reductase [Gossypium hirsutum]
Length=693

 Score =   192 bits (487),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYE+EL NF +QG +SEL+VAFSREGPQK+YVQHK+ ++A+ +W+LIS+ GYLYV
Sbjct  586  RRMDFIYEDELNNFVEQGALSELVVAFSREGPQKEYVQHKMMDKAADIWNLISKGGYLYV  645

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTI+QEQE VDSSKAE++VKKLQM+GRYLRDVW
Sbjct  646  CGDAKGMARDVHRTLHTIIQEQENVDSSKAESMVKKLQMDGRYLRDVW  693



>emb|CAC27143.1| NADPH-cytochrome P450 reductase [Picea abies]
Length=196

 Score =   180 bits (457),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 82/108 (76%), Positives = 96/108 (89%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MD+IYE+ELKN+ D G++S+L++AFSREG  K+YVQHKITE+AS +W+LISQ GYLYV
Sbjct  89   RQMDYIYEDELKNYVDNGVLSDLVLAFSREGTTKEYVQHKITEKASYIWNLISQGGYLYV  148

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLH IVQEQE VDS+ AEA VKKLQ  GRYLRDVW
Sbjct  149  CGDAKGMARDVHRTLHNIVQEQESVDSTSAEATVKKLQTEGRYLRDVW  196



>emb|CDX92639.1| BnaC07g38970D [Brassica napus]
Length=695

 Score =   191 bits (485),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYE+EL NF DQG+ISELIVAFSREG QK+YVQHK+ E+A+QVW+LI ++GYLYV
Sbjct  588  RRMDFIYEDELNNFVDQGVISELIVAFSREGAQKEYVQHKMIEKAAQVWNLIKEKGYLYV  647

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIVQEQE V SS+AEAIVKKLQ  GRYLRDVW
Sbjct  648  CGDAKGMARDVHRTLHTIVQEQEGVSSSEAEAIVKKLQTEGRYLRDVW  695



>ref|XP_010277516.1| PREDICTED: NADPH--cytochrome P450 reductase-like isoform X2 [Nelumbo 
nucifera]
Length=651

 Score =   190 bits (483),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MDFIYE+EL +F +QG++SELIVAFSREGP K+YVQHK+ ++A++VW+LIS+ GYLYV
Sbjct  544  RKMDFIYEDELNSFVEQGVLSELIVAFSREGPNKEYVQHKMMDKATEVWNLISRNGYLYV  603

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLH+IVQEQE  DSSKAEAIVKKLQM GRYLRDVW
Sbjct  604  CGDAKGMARDVHRTLHSIVQEQESTDSSKAEAIVKKLQMEGRYLRDVW  651



>gb|AHB33949.1| cytochrome P450 reductase [Santalum album]
Length=692

 Score =   190 bits (483),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYE+EL NF +QG+ISELIVAFSR+GP K+YVQHK+ ++A+ +WSLISQ  YLYV
Sbjct  585  RRMDFIYEDELNNFVEQGVISELIVAFSRDGPTKEYVQHKMMDKAAYIWSLISQGAYLYV  644

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHT+VQ+QE VDSSKAE+IVKKLQM+GRYLRDVW
Sbjct  645  CGDAKGMARDVHRTLHTLVQQQESVDSSKAESIVKKLQMDGRYLRDVW  692



>ref|XP_002307336.1| NADPH-cytochrome P450 oxydoreductase isoform 1 family protein 
[Populus trichocarpa]
 gb|AAK15259.1|AF302496_1 NADPH-cytochrome P450 oxydoreductase isoform 1 [Populus trichocarpa 
x Populus deltoides]
 gb|EEE94332.1| NADPH-cytochrome P450 oxydoreductase isoform 1 family protein 
[Populus trichocarpa]
Length=692

 Score =   190 bits (483),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYE+EL NF +QG+ISELIVAFSREGPQK+YVQHK+ +RA+++W++ISQ GY YV
Sbjct  585  RRMDFIYEDELNNFVEQGVISELIVAFSREGPQKEYVQHKMVDRAAEIWTIISQGGYFYV  644

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIVQEQ  +DSSK E++VKKLQM GRYLRDVW
Sbjct  645  CGDAKGMARDVHRTLHTIVQEQGGLDSSKTESMVKKLQMEGRYLRDVW  692



>ref|XP_007141274.1| hypothetical protein PHAVU_008G182200g [Phaseolus vulgaris]
 gb|ESW13268.1| hypothetical protein PHAVU_008G182200g [Phaseolus vulgaris]
Length=685

 Score =   190 bits (483),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/108 (81%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MDFIYE+EL  F +QG +SELIVAFSREGP+K+YVQHK+ ++A+ +W+LISQ GYLYV
Sbjct  578  RQMDFIYEDELNKFVEQGALSELIVAFSREGPEKEYVQHKMIDKAANLWNLISQGGYLYV  637

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIVQ+QEKVDSSKAEAIVKKLQM+GRYLRDVW
Sbjct  638  CGDAKGMARDVHRTLHTIVQQQEKVDSSKAEAIVKKLQMDGRYLRDVW  685



>gb|KJB58865.1| hypothetical protein B456_009G229300 [Gossypium raimondii]
Length=694

 Score =   190 bits (483),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/108 (78%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYE+EL NF +QG +S+L+VAFSREGPQK+YVQHK+ ++A+ +W+LIS+ GYLYV
Sbjct  587  RRMDFIYEDELNNFVEQGALSDLLVAFSREGPQKEYVQHKMMDKAADIWNLISKGGYLYV  646

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTI+QEQE VDSSKAE++VKKLQM+GRYLRDVW
Sbjct  647  CGDAKGMARDVHRTLHTIIQEQENVDSSKAESMVKKLQMDGRYLRDVW  694



>gb|KJB58863.1| hypothetical protein B456_009G229300 [Gossypium raimondii]
Length=693

 Score =   190 bits (483),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/108 (78%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYE+EL NF +QG +S+L+VAFSREGPQK+YVQHK+ ++A+ +W+LIS+ GYLYV
Sbjct  586  RRMDFIYEDELNNFVEQGALSDLLVAFSREGPQKEYVQHKMMDKAADIWNLISKGGYLYV  645

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTI+QEQE VDSSKAE++VKKLQM+GRYLRDVW
Sbjct  646  CGDAKGMARDVHRTLHTIIQEQENVDSSKAESMVKKLQMDGRYLRDVW  693



>gb|KDP41487.1| hypothetical protein JCGZ_15894 [Jatropha curcas]
Length=689

 Score =   190 bits (482),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/108 (78%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYE+EL NF +QG+ISELIVAFSREGPQK+YVQHK+ ++A+Q+W++ISQ GYLYV
Sbjct  582  RRMDFIYEDELNNFVEQGVISELIVAFSREGPQKEYVQHKMVQKAAQIWAIISQGGYLYV  641

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLH IVQEQ  +D+SK E++VKKLQM+GRYLRDVW
Sbjct  642  CGDAKGMARDVHRTLHNIVQEQGNLDASKTESMVKKLQMDGRYLRDVW  689



>ref|XP_007136327.1| hypothetical protein PHAVU_009G036200g [Phaseolus vulgaris]
 gb|ESW08321.1| hypothetical protein PHAVU_009G036200g [Phaseolus vulgaris]
Length=692

 Score =   190 bits (482),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/108 (81%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MDFIYE+ELKNF +QG +SELIVAFSREGP+K+YVQHKI ++A+ VWSLISQ GYLYV
Sbjct  585  RQMDFIYEDELKNFVEQGSLSELIVAFSREGPEKEYVQHKIMDQAAHVWSLISQGGYLYV  644

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAK MARDVHRTLH+IVQ+QE VDS+KAEAIVKKLQM+GRYLRDVW
Sbjct  645  CGDAKCMARDVHRTLHSIVQQQENVDSTKAEAIVKKLQMDGRYLRDVW  692



>ref|XP_006285937.1| hypothetical protein CARUB_v10007449mg [Capsella rubella]
 gb|EOA18835.1| hypothetical protein CARUB_v10007449mg [Capsella rubella]
Length=692

 Score =   189 bits (481),  Expect = 3e-52, Method: Composition-based stats.
 Identities = 88/108 (81%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYE+ELKNF DQG+ISELIVAFSREG QK+YVQHK+ E+A+QVW+LI + GYLYV
Sbjct  585  RRMDFIYEDELKNFVDQGVISELIVAFSREGAQKEYVQHKMMEKAAQVWNLIQEGGYLYV  644

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMA+DVHRTLHTIV EQE V SS+AEAIVKKLQ  GRYLRDVW
Sbjct  645  CGDAKGMAKDVHRTLHTIVIEQEGVSSSEAEAIVKKLQTEGRYLRDVW  692



>ref|NP_194183.1| NADPH--cytochrome P450 reductase 1 [Arabidopsis thaliana]
 sp|Q9SB48.1|NCPR1_ARATH RecName: Full=NADPH--cytochrome P450 reductase 1 [Arabidopsis 
thaliana]
 emb|CAA23011.1| NADPH-ferrihemoprotein reductase ATR1 [Arabidopsis thaliana]
 emb|CAB79362.1| NADPH-ferrihemoprotein reductase ATR1 [Arabidopsis thaliana]
 gb|AAK96879.1| NADPH-ferrihemoprotein reductase ATR1 [Arabidopsis thaliana]
 gb|AAP37785.1| At4g24520 [Arabidopsis thaliana]
 gb|AEE84919.1| NADPH--cytochrome P450 reductase 1 [Arabidopsis thaliana]
 gb|AGA15807.1| CPR1 [Expression vector pUDE172]
Length=692

 Score =   189 bits (481),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 88/108 (81%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MDFIYE+EL NF DQG+ISELI+AFSREG QK+YVQHK+ E+A+QVW LI +EGYLYV
Sbjct  585  RQMDFIYEDELNNFVDQGVISELIMAFSREGAQKEYVQHKMMEKAAQVWDLIKEEGYLYV  644

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIVQEQE V SS+AEAIVKKLQ  GRYLRDVW
Sbjct  645  CGDAKGMARDVHRTLHTIVQEQEGVSSSEAEAIVKKLQTEGRYLRDVW  692



>ref|NP_001190823.1| NADPH--cytochrome P450 reductase 1 [Arabidopsis thaliana]
 gb|AEE84920.1| NADPH--cytochrome P450 reductase 1 [Arabidopsis thaliana]
Length=688

 Score =   189 bits (480),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 88/108 (81%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MDFIYE+EL NF DQG+ISELI+AFSREG QK+YVQHK+ E+A+QVW LI +EGYLYV
Sbjct  581  RQMDFIYEDELNNFVDQGVISELIMAFSREGAQKEYVQHKMMEKAAQVWDLIKEEGYLYV  640

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIVQEQE V SS+AEAIVKKLQ  GRYLRDVW
Sbjct  641  CGDAKGMARDVHRTLHTIVQEQEGVSSSEAEAIVKKLQTEGRYLRDVW  688



>emb|CAA46814.1| NADPH-ferrihemoprotein reductase [Arabidopsis thaliana]
Length=692

 Score =   189 bits (480),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 88/108 (81%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MDFIYE+EL NF DQG+ISELI+AFSREG QK+YVQHK+ E+A+QVW LI +EGYLYV
Sbjct  585  RQMDFIYEDELNNFVDQGVISELIMAFSREGAQKEYVQHKMMEKAAQVWDLIKEEGYLYV  644

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIVQEQE V SS+AEAIVKKLQ  GRYLRDVW
Sbjct  645  CGDAKGMARDVHRTLHTIVQEQEGVSSSEAEAIVKKLQTEGRYLRDVW  692



>ref|XP_008338958.1| PREDICTED: NADPH--cytochrome P450 reductase [Malus domestica]
Length=692

 Score =   189 bits (480),  Expect = 5e-52, Method: Composition-based stats.
 Identities = 84/108 (78%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYE+EL NF ++G++SELIVAFSREGP K+YVQHK+ ++A+ VW L+SQ GY YV
Sbjct  585  RRMDFIYEDELNNFVEEGVLSELIVAFSREGPTKEYVQHKLMDKAAYVWDLVSQGGYFYV  644

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIVQ+QEKVDS+KAEA VK+LQM+GRYLRDVW
Sbjct  645  CGDAKGMARDVHRTLHTIVQQQEKVDSTKAEATVKRLQMDGRYLRDVW  692



>ref|XP_002514049.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF48632.1| cytochrome P450, putative [Ricinus communis]
Length=692

 Score =   189 bits (480),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYE+EL  F +QG+ISELIVAFSREGPQK+YVQHK+ ++A+Q+WSLIS+ GY+YV
Sbjct  585  RRMDFIYEDELNYFVEQGVISELIVAFSREGPQKEYVQHKMMDKAAQIWSLISERGYIYV  644

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIVQEQ  +DSSK E++VKKLQM+GRYLRDVW
Sbjct  645  CGDAKGMARDVHRTLHTIVQEQGNLDSSKTESMVKKLQMDGRYLRDVW  692



>ref|XP_006386427.1| hypothetical protein POPTR_0002s10680g [Populus trichocarpa]
 gb|ERP64224.1| hypothetical protein POPTR_0002s10680g [Populus trichocarpa]
Length=521

 Score =   186 bits (473),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 84/108 (78%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MDFIYE+EL NF  QG+ISEL+VAFSREGPQK+YVQHK+ ++A+++WS+ISQ GYLYV
Sbjct  414  RQMDFIYEDELNNFVAQGVISELLVAFSREGPQKEYVQHKMVDKAAEIWSIISQGGYLYV  473

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIVQEQ  +DSSK E++VKKLQM GRYLRDVW
Sbjct  474  CGDAKGMARDVHRTLHTIVQEQGGLDSSKTESMVKKLQMEGRYLRDVW  521



>ref|XP_010254555.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Nelumbo nucifera]
Length=692

 Score =   189 bits (479),  Expect = 6e-52, Method: Composition-based stats.
 Identities = 83/108 (77%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYE+EL +F +QG++SELIVAFSREGP K YVQHK+ ++A+ +W++IS+ GYLYV
Sbjct  585  RRMDFIYEDELNSFVEQGVLSELIVAFSREGPNKQYVQHKMMDKAADIWNIISKNGYLYV  644

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIVQEQ  +DSSKAEA VKKLQM+GRYLRDVW
Sbjct  645  CGDAKGMARDVHRTLHTIVQEQGSMDSSKAEATVKKLQMDGRYLRDVW  692



>ref|XP_009138137.1| PREDICTED: NADPH--cytochrome P450 reductase 1-like [Brassica 
rapa]
Length=694

 Score =   189 bits (479),  Expect = 7e-52, Method: Composition-based stats.
 Identities = 87/108 (81%), Positives = 97/108 (90%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYE+EL N+ DQ +ISELIVAFSREG QK+YVQHKI ++A+Q W+LI +EGYLYV
Sbjct  587  RRMDFIYEDELNNYVDQRVISELIVAFSREGAQKEYVQHKIVQKAAQFWNLIKEEGYLYV  646

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIVQEQE V SS+AEAIVKKLQ  GRYLRDVW
Sbjct  647  CGDAKGMARDVHRTLHTIVQEQEGVSSSEAEAIVKKLQTEGRYLRDVW  694



>ref|XP_003522768.1| PREDICTED: NADPH--cytochrome P450 reductase [Glycine max]
 gb|KHN08276.1| NADPH--cytochrome P450 reductase [Glycine soja]
Length=691

 Score =   188 bits (478),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 87/108 (81%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYE+ELKNF +QG +SELIVAFSREG +K+YVQHK+ ++A+ +WSLISQ GYLYV
Sbjct  584  RRMDFIYEDELKNFVEQGSLSELIVAFSREGAEKEYVQHKMMDQAAHLWSLISQGGYLYV  643

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHR LHTIVQ+QE VDS+KAEAIVKKLQM+GRYLRDVW
Sbjct  644  CGDAKGMARDVHRILHTIVQQQENVDSTKAEAIVKKLQMDGRYLRDVW  691



>gb|ABK92896.1| unknown [Populus trichocarpa]
Length=183

 Score =   177 bits (449),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MDFIYE+EL NF + G +SEL VAFSREGP K+YVQHK+ ++AS +W++ISQ GYLYV
Sbjct  76   RQMDFIYEDELNNFVESGALSELSVAFSREGPTKEYVQHKMMQKASDIWNMISQGGYLYV  135

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMA+DVHRTLHTIVQEQ  +D+SK E+ VK LQMNGRYLRDVW
Sbjct  136  CGDAKGMAKDVHRTLHTIVQEQGSLDNSKTESFVKGLQMNGRYLRDVW  183



>ref|XP_004299743.1| PREDICTED: NADPH--cytochrome P450 reductase [Fragaria vesca subsp. 
vesca]
Length=689

 Score =   188 bits (477),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MDFIYE+EL NF +QG +SELIVAFSREGP K+YVQHK+ E+A+ +W+LISQ GY YV
Sbjct  582  RQMDFIYEDELNNFVEQGALSELIVAFSREGPSKEYVQHKMMEKAAYMWNLISQGGYFYV  641

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIVQ+++KVDS+KAEAIVKKLQM+GRYLRDVW
Sbjct  642  CGDAKGMARDVHRTLHTIVQQEDKVDSTKAEAIVKKLQMDGRYLRDVW  689



>ref|XP_010520739.1| PREDICTED: NADPH--cytochrome P450 reductase 1-like [Tarenaya 
hassleriana]
Length=694

 Score =   188 bits (477),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 88/108 (81%), Positives = 98/108 (91%), Gaps = 1/108 (1%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYE+EL NF DQG +SE +VAFSREGPQK+YVQHK+TE+A++VW LI +EGYLYV
Sbjct  588  RRMDFIYEDELYNFVDQGTLSEFVVAFSREGPQKEYVQHKMTEKAAEVWKLI-KEGYLYV  646

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIVQEQE V SS+AEAIVKKLQ  GRYLRDVW
Sbjct  647  CGDAKGMARDVHRTLHTIVQEQEGVSSSEAEAIVKKLQNEGRYLRDVW  694



>ref|XP_009414761.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Musa acuminata 
subsp. malaccensis]
Length=700

 Score =   188 bits (477),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 83/108 (77%), Positives = 97/108 (90%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MDFIYE+EL NF D+G++SELIVAFSREGP K+YVQHK+TE+AS VW++ISQ GY+YV
Sbjct  593  RKMDFIYEDELHNFVDRGVLSELIVAFSREGPTKEYVQHKMTEKASSVWNIISQGGYVYV  652

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHR LHTIVQEQ  +DSSK E++VK LQM GRYLRDVW
Sbjct  653  CGDAKGMARDVHRVLHTIVQEQGSLDSSKTESLVKSLQMEGRYLRDVW  700



>gb|KHG05124.1| NADPH--cytochrome P450 reductase [Gossypium arboreum]
Length=693

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/108 (77%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYE+EL NF +QG +S L++AFSREGPQK+YVQHK+ ++A+ +W+LIS+ GYLYV
Sbjct  586  RRMDFIYEDELNNFVEQGALSVLVLAFSREGPQKEYVQHKMMDKAADIWNLISKGGYLYV  645

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTI+QEQE VDSSKAE++VKKLQM+GRYLRDVW
Sbjct  646  CGDAKGMARDVHRTLHTIIQEQENVDSSKAESMVKKLQMDGRYLRDVW  693



>ref|XP_010530279.1| PREDICTED: NADPH--cytochrome P450 reductase 1-like [Tarenaya 
hassleriana]
Length=694

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/108 (81%), Positives = 100/108 (93%), Gaps = 1/108 (1%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MDFIYE+EL N+ DQG++SELIVAFSREGPQK+YVQHK+ E+A++VW LI +EGYLYV
Sbjct  588  RKMDFIYEDELYNYVDQGVLSELIVAFSREGPQKEYVQHKMMEKAAEVWKLI-KEGYLYV  646

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIVQEQE V SS+AEA+VKKLQM GRYLRDVW
Sbjct  647  CGDAKGMARDVHRTLHTIVQEQEGVSSSEAEAVVKKLQMEGRYLRDVW  694



>pir||A47298 NADPH-ferrihemoprotein reductase (EC 1.6.2.4) - mung bean
Length=690

 Score =   187 bits (475),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MDFIYE+ELK+F +QG +SELIVAFSREG +K+YVQHK+ ++A+ +WSLISQ GYLYV
Sbjct  583  RQMDFIYEDELKSFVEQGSLSELIVAFSREGAEKEYVQHKMMDKAAHLWSLISQGGYLYV  642

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLH+IVQEQE VDS+KAEAIVKKLQM+GRYLRDVW
Sbjct  643  CGDAKGMARDVHRTLHSIVQEQENVDSTKAEAIVKKLQMDGRYLRDVW  690



>sp|P37116.1|NCPR_VIGRR RecName: Full=NADPH--cytochrome P450 reductase; Short=CPR; Short=P450R 
[Vigna radiata var. radiata]
 gb|AAA34240.1| NADPH cytochrome P450 [Vigna radiata]
Length=690

 Score =   187 bits (474),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MDFIYE+ELK+F +QG +SELIVAFSREG +K+YVQHK+ ++A+ +WSLISQ GYLYV
Sbjct  583  RQMDFIYEDELKSFVEQGSLSELIVAFSREGAEKEYVQHKMMDKAAHLWSLISQGGYLYV  642

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLH+IVQEQE VDS+KAEAIVKKLQM+GRYLRDVW
Sbjct  643  CGDAKGMARDVHRTLHSIVQEQENVDSTKAEAIVKKLQMDGRYLRDVW  690



>ref|XP_007018235.1| P450 reductase 1 isoform 2 [Theobroma cacao]
 gb|EOY15460.1| P450 reductase 1 isoform 2 [Theobroma cacao]
Length=495

 Score =   184 bits (467),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 97/108 (90%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYE+EL NF  QG +SELIVAFSRE PQK+YVQHK+ ++A+ +WSL+S+ GYLYV
Sbjct  388  RRMDFIYEDELNNFVAQGALSELIVAFSRERPQKEYVQHKMMDKAAYMWSLLSKGGYLYV  447

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIV EQE VDSSKAE++VKKLQM GRYLRDVW
Sbjct  448  CGDAKGMARDVHRTLHTIVLEQESVDSSKAESMVKKLQMEGRYLRDVW  495



>emb|CAA81211.1| NADPH-ferrihemoprotein reductase [Vicia sativa]
Length=692

 Score =   186 bits (473),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 97/108 (90%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MDFIYE+EL NF  QG ISELIVAFSREGP+K+YVQHK+ ++A  +WSLISQ GYLYV
Sbjct  585  RQMDFIYEDELNNFVQQGAISELIVAFSREGPEKEYVQHKMMDKAEYLWSLISQGGYLYV  644

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHR+LHTIVQ+QE  DSSKAEA VKKLQM+GRYLRDVW
Sbjct  645  CGDAKGMARDVHRSLHTIVQQQENADSSKAEATVKKLQMDGRYLRDVW  692



>ref|XP_009376208.1| PREDICTED: NADPH--cytochrome P450 reductase [Pyrus x bretschneideri]
Length=692

 Score =   186 bits (473),  Expect = 4e-51, Method: Composition-based stats.
 Identities = 83/108 (77%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIY++EL NF ++G++SELIVAFSREGP K+YVQHK+ E+A+  W L+SQ GY YV
Sbjct  585  RRMDFIYQDELNNFVEEGVLSELIVAFSREGPTKEYVQHKLMEKAAYTWDLVSQGGYFYV  644

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIVQEQE+VDS+KAEA VK+LQM+GRYLRDVW
Sbjct  645  CGDAKGMARDVHRTLHTIVQEQERVDSTKAEARVKQLQMDGRYLRDVW  692



>ref|XP_004501654.1| PREDICTED: NADPH--cytochrome P450 reductase-like isoform X2 [Cicer 
arietinum]
Length=692

 Score =   185 bits (470),  Expect = 1e-50, Method: Composition-based stats.
 Identities = 84/108 (78%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MDFIYE+EL NF +QG +SELIVAFSREG +K+YVQHK+ ++A+ +WSLISQ GYLYV
Sbjct  585  RQMDFIYEDELNNFVEQGSLSELIVAFSREGSEKEYVQHKMMDKAAYLWSLISQGGYLYV  644

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIVQ+QE  DS+KAEA VKKLQM+GRYLRDVW
Sbjct  645  CGDAKGMARDVHRTLHTIVQQQENADSTKAEATVKKLQMDGRYLRDVW  692



>ref|XP_007018236.1| NADPH--cytochrome P450 reductase isoform 3 [Theobroma cacao]
 gb|EOY15461.1| NADPH--cytochrome P450 reductase isoform 3 [Theobroma cacao]
Length=736

 Score =   186 bits (471),  Expect = 1e-50, Method: Composition-based stats.
 Identities = 85/108 (79%), Positives = 97/108 (90%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYE+EL NF  QG +SELIVAFSRE PQK+YVQHK+ ++A+ +WSL+S+ GYLYV
Sbjct  629  RRMDFIYEDELNNFVAQGALSELIVAFSRERPQKEYVQHKMMDKAAYMWSLLSKGGYLYV  688

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIV EQE VDSSKAE++VKKLQM GRYLRDVW
Sbjct  689  CGDAKGMARDVHRTLHTIVLEQESVDSSKAESMVKKLQMEGRYLRDVW  736



>ref|XP_010692385.1| PREDICTED: NADPH--cytochrome P450 reductase [Beta vulgaris subsp. 
vulgaris]
Length=693

 Score =   185 bits (470),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYEEEL  F ++G +SEL+VAFSREG QK+YVQHK+ ++AS +W+LIS  GYLYV
Sbjct  586  RRMDFIYEEELHKFVEEGAVSELVVAFSREGTQKEYVQHKMVDKASYLWNLISSGGYLYV  645

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLH IVQEQEKV+SSKAEAIVKKLQM+GRYLRDVW
Sbjct  646  CGDAKGMARDVHRTLHNIVQEQEKVESSKAEAIVKKLQMDGRYLRDVW  693



>gb|AIG15452.1| NADPH-cytochrome P450 reductase 2 [Azadirachta indica]
Length=715

 Score =   185 bits (469),  Expect = 2e-50, Method: Composition-based stats.
 Identities = 82/108 (76%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MD+IYE+EL NF   G +SEL+VAFSR+GP K+YVQHK+ E+AS +W++ISQ GYLYV
Sbjct  608  RQMDYIYEDELNNFVQSGALSELVVAFSRQGPTKEYVQHKMMEKASDIWNMISQGGYLYV  667

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIVQEQ  VDSSKAE+IVK LQM GRYLRDVW
Sbjct  668  CGDAKGMARDVHRTLHTIVQEQGSVDSSKAESIVKNLQMTGRYLRDVW  715



>gb|ACF35281.1| cytochrome P450 reductase-like protein [Nothapodytes nimmoniana]
Length=692

 Score =   184 bits (468),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYE+EL NF D G+ISELI+AFSREG +K+YVQHK+ E+A Q+W+LIS+EGY+YV
Sbjct  585  RRMDFIYEDELNNFMDSGVISELILAFSREGLKKEYVQHKMMEKAVQLWNLISKEGYIYV  644

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIVQEQE V SS+AEA+VKKLQ  GRYLRDVW
Sbjct  645  CGDAKGMARDVHRTLHTIVQEQENVRSSEAEAVVKKLQTEGRYLRDVW  692



>ref|XP_010928663.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Elaeis guineensis]
Length=706

 Score =   184 bits (467),  Expect = 3e-50, Method: Composition-based stats.
 Identities = 82/108 (76%), Positives = 96/108 (89%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R++DFIYE+ELKNF + G +SELIVAFSREGP K+YVQHK+ E+AS +WS+ISQ GY+YV
Sbjct  599  RKLDFIYEDELKNFVETGALSELIVAFSREGPTKEYVQHKMAEKASDIWSVISQGGYIYV  658

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIVQEQ  +DSSK E++VK LQM GRYLRDVW
Sbjct  659  CGDAKGMARDVHRTLHTIVQEQGSLDSSKTESMVKSLQMEGRYLRDVW  706



>ref|XP_009385909.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Musa acuminata 
subsp. malaccensis]
Length=703

 Score =   184 bits (467),  Expect = 3e-50, Method: Composition-based stats.
 Identities = 82/108 (76%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MDFIYE+EL NF + G +SELIVAFSREGP K+YVQHK+TE+AS VW++ISQ GY+YV
Sbjct  596  RKMDFIYEDELNNFVETGALSELIVAFSREGPTKEYVQHKMTEKASDVWNIISQGGYVYV  655

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHR LHTIVQEQ  +DSSK E+ VK LQM GRYLRDVW
Sbjct  656  CGDAKGMARDVHRVLHTIVQEQGSLDSSKTESFVKSLQMEGRYLRDVW  703



>ref|XP_002462826.1| hypothetical protein SORBIDRAFT_02g032640 [Sorghum bicolor]
 gb|EER99347.1| hypothetical protein SORBIDRAFT_02g032640 [Sorghum bicolor]
Length=706

 Score =   184 bits (466),  Expect = 4e-50, Method: Composition-based stats.
 Identities = 79/108 (73%), Positives = 96/108 (89%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MDFIYE+EL NF D G++SELI+AFSREGP K+YVQHK+ ++A+++WS+ISQ GY+YV
Sbjct  599  RKMDFIYEDELNNFVDGGVLSELIIAFSREGPTKEYVQHKMAQKAAELWSIISQGGYIYV  658

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIVQEQ  +D+SK E+ VK LQM GRYLRDVW
Sbjct  659  CGDAKGMARDVHRTLHTIVQEQGSMDNSKTESYVKSLQMEGRYLRDVW  706



>ref|XP_007018234.1| P450 reductase 1 isoform 1 [Theobroma cacao]
 gb|EOY15459.1| P450 reductase 1 isoform 1 [Theobroma cacao]
Length=693

 Score =   183 bits (465),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 97/108 (90%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYE+EL NF  QG +SELIVAFSRE PQK+YVQHK+ ++A+ +WSL+S+ GYLYV
Sbjct  586  RRMDFIYEDELNNFVAQGALSELIVAFSRERPQKEYVQHKMMDKAAYMWSLLSKGGYLYV  645

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIV EQE VDSSKAE++VKKLQM GRYLRDVW
Sbjct  646  CGDAKGMARDVHRTLHTIVLEQESVDSSKAESMVKKLQMEGRYLRDVW  693



>ref|XP_010046982.1| PREDICTED: NADPH--cytochrome P450 reductase 2-like [Eucalyptus 
grandis]
 gb|KCW78706.1| hypothetical protein EUGRSUZ_C00154 [Eucalyptus grandis]
Length=683

 Score =   182 bits (462),  Expect = 1e-49, Method: Composition-based stats.
 Identities = 81/108 (75%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYE+EL NF + G +SEL+VAFSREGP K+YVQHK+ E+AS +W +IS+ GY+YV
Sbjct  576  RRMDFIYEDELNNFVNAGALSELLVAFSREGPTKEYVQHKMLEKASDIWKIISEGGYVYV  635

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIVQEQ  +DSSK E++VK LQMNGRYLRDVW
Sbjct  636  CGDAKGMARDVHRTLHTIVQEQGSLDSSKTESLVKNLQMNGRYLRDVW  683



>dbj|BAJ97446.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=255

 Score =   174 bits (440),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 77/108 (71%), Positives = 91/108 (84%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MDFIYE+EL NF + G +SEL+VAFSREGP K+YVQHK+ E+A+ +WS++SQ GY+YV
Sbjct  148  RQMDFIYEDELNNFTESGALSELVVAFSREGPTKEYVQHKMAEKAADLWSIVSQGGYVYV  207

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHR LHTIVQEQ  +DSSK E  VK LQ  GRYLRDVW
Sbjct  208  CGDAKGMARDVHRALHTIVQEQGSLDSSKTEGYVKNLQTEGRYLRDVW  255



>ref|XP_004165700.1| PREDICTED: NADPH--cytochrome P450 reductase-like, partial [Cucumis 
sativus]
Length=503

 Score =   179 bits (455),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/108 (74%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R MD+IYE+EL NF + G +SEL++AFSREGP K+YVQHK+TE+AS +W+LISQ  YLYV
Sbjct  396  RAMDYIYEDELNNFVETGALSELVIAFSREGPTKEYVQHKMTEKASDIWNLISQGAYLYV  455

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIVQEQ  +DSSKAE++VK LQ +GRYLRDVW
Sbjct  456  CGDAKGMARDVHRTLHTIVQEQGSLDSSKAESMVKNLQTSGRYLRDVW  503



>gb|AEW43314.1| NADPH cytochrome P450 reductase [Picrorhiza kurrooa]
Length=710

 Score =   182 bits (461),  Expect = 2e-49, Method: Composition-based stats.
 Identities = 78/108 (72%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MDFIYE+EL NF   G+ISEL++AFSR+GP K+YVQHK+ ++AS +W++IS+ GY+YV
Sbjct  603  RQMDFIYEDELNNFVKAGVISELVLAFSRQGPTKEYVQHKMAQKASDIWNMISEGGYVYV  662

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIVQEQ  +DSSK EA+VK LQM GRYLRDVW
Sbjct  663  CGDAKGMARDVHRTLHTIVQEQGSLDSSKTEALVKNLQMTGRYLRDVW  710



>gb|AAX59902.1| cytochrome P450 reductase [Taxus wallichiana var. chinensis]
Length=717

 Score =   182 bits (461),  Expect = 2e-49, Method: Composition-based stats.
 Identities = 81/108 (75%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MD+IYE+ELK + ++G++++LIVAFSREG  K+YVQHK+ E+AS  WSLI+Q GYLYV
Sbjct  610  RQMDYIYEDELKGYVEKGVLTDLIVAFSREGATKEYVQHKMLEKASDTWSLIAQGGYLYV  669

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIVQEQE VDSSKAE +VKKLQM+GRYLRD+W
Sbjct  670  CGDAKGMARDVHRTLHTIVQEQESVDSSKAEFLVKKLQMDGRYLRDIW  717



>ref|XP_011015338.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Populus euphratica]
 ref|XP_011015339.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Populus euphratica]
Length=692

 Score =   182 bits (461),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/108 (75%), Positives = 97/108 (90%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYE+EL NF +Q +ISELIVAFSREGP+K+YVQHK+ +RA+++W++ISQ GY YV
Sbjct  585  RRMDFIYEDELNNFVEQVVISELIVAFSREGPRKEYVQHKMVDRAAEIWTIISQGGYFYV  644

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLH IVQEQ  +D+SK E++VKKLQM GRYLRDVW
Sbjct  645  CGDAKGMARDVHRTLHAIVQEQGGLDASKTESMVKKLQMEGRYLRDVW  692



>ref|XP_010523339.1| PREDICTED: NADPH--cytochrome P450 reductase 1-like isoform X5 
[Tarenaya hassleriana]
 ref|XP_010523341.1| PREDICTED: NADPH--cytochrome P450 reductase 1-like isoform X5 
[Tarenaya hassleriana]
Length=339

 Score =   176 bits (445),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 93/104 (89%), Gaps = 1/104 (1%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYE+EL NF DQG +SELIVAFSREGP K+YVQHK+ E+A++VW L ++EGYLYV
Sbjct  216  RRMDFIYEDELYNFADQGALSELIVAFSREGPHKEYVQHKMVEKAAEVWKL-TKEGYLYV  274

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYL  367
            CGDAKGMARDVHRT+HTIVQEQE V SS+AEAIVKKLQ  GRYL
Sbjct  275  CGDAKGMARDVHRTMHTIVQEQEGVSSSEAEAIVKKLQTEGRYL  318



>gb|AAT76449.1| NADPH:cytochrome P450 reductase [Taxus cuspidata]
Length=717

 Score =   182 bits (461),  Expect = 2e-49, Method: Composition-based stats.
 Identities = 82/108 (76%), Positives = 97/108 (90%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MD+IYE+ELK + ++GI++ LIVAFSREG  K+YVQHK+ E+AS  WSLI+Q GYLYV
Sbjct  610  RQMDYIYEDELKGYVEKGILTNLIVAFSREGATKEYVQHKMLEKASDTWSLIAQGGYLYV  669

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIVQEQE VDSSKAE +VKKLQM+GRYLRD+W
Sbjct  670  CGDAKGMARDVHRTLHTIVQEQESVDSSKAEFLVKKLQMDGRYLRDIW  717



>gb|KJB14707.1| hypothetical protein B456_002G138900 [Gossypium raimondii]
Length=693

 Score =   181 bits (460),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/108 (76%), Positives = 97/108 (90%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MDFIYE+EL N  +QG +SELIVA SREGPQK+YVQHK+ ++A+ +WSLIS+ GYLYV
Sbjct  586  RKMDFIYEDELNNLVEQGALSELIVALSREGPQKEYVQHKMMDKAAHIWSLISKGGYLYV  645

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIVQEQ  ++SSKAE++VKKLQM GRYLRDVW
Sbjct  646  CGDAKGMARDVHRTLHTIVQEQGNMESSKAESMVKKLQMEGRYLRDVW  693



>ref|XP_010048643.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Eucalyptus 
grandis]
 gb|KCW80967.1| hypothetical protein EUGRSUZ_C02330 [Eucalyptus grandis]
Length=711

 Score =   181 bits (460),  Expect = 2e-49, Method: Composition-based stats.
 Identities = 79/108 (73%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMD+IYEEEL NF + G +SEL+VAFSREGP K+YVQHK+ E+AS +W+++SQ  Y+YV
Sbjct  604  RRMDYIYEEELNNFVESGALSELVVAFSREGPTKEYVQHKMMEKASDIWNMLSQGAYIYV  663

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHR LHTIVQEQ  +DSSKAE++VK LQM+GRYLRDVW
Sbjct  664  CGDAKGMARDVHRALHTIVQEQGSLDSSKAESMVKNLQMSGRYLRDVW  711



>gb|AGL46979.1| cytochrome P450 reductase [Salvia miltiorrhiza]
Length=712

 Score =   181 bits (460),  Expect = 2e-49, Method: Composition-based stats.
 Identities = 77/108 (71%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MDFIYEEEL NF   G++SEL++AFSR+GP K+YVQHK+ ++AS++W++IS+ GY+YV
Sbjct  605  RKMDFIYEEELNNFVKDGVVSELVLAFSRDGPTKEYVQHKMAQKASELWNMISEGGYVYV  664

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIVQEQ  +DSSK E+ VK LQM GRYLRDVW
Sbjct  665  CGDAKGMARDVHRTLHTIVQEQGSLDSSKTESFVKNLQMTGRYLRDVW  712



>ref|XP_011069915.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Sesamum indicum]
Length=712

 Score =   181 bits (460),  Expect = 3e-49, Method: Composition-based stats.
 Identities = 78/107 (73%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = -3

Query  675  RMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYVC  496
            +MDFIY++EL NF   G+ISEL++AFSREGP K+YVQHK+ ++AS+VW++IS+ GY+YVC
Sbjct  606  KMDFIYQDELNNFVKAGVISELVLAFSREGPTKEYVQHKMAQKASEVWNMISEGGYVYVC  665

Query  495  GDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            GDAKGMARDVHRTLHTIVQEQ  +DSSKAE++VK LQM+GRYLRDVW
Sbjct  666  GDAKGMARDVHRTLHTIVQEQGSLDSSKAESMVKNLQMSGRYLRDVW  712



>gb|ACP43317.1| NADPH cytochrome P450 reductase [Citrus maxima]
Length=209

 Score =   171 bits (434),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 76/108 (70%), Positives = 92/108 (85%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MD+IYE+EL NF   G +S+LIVAFSREGP K+YVQHK+ E++S +W++ S+  YLYV
Sbjct  102  RKMDYIYEDELNNFVQSGALSQLIVAFSREGPTKEYVQHKMMEKSSDIWNMFSEGAYLYV  161

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAK MARDVHRTLHTIVQEQ  +DSSKAE++VK LQM GRYLRDVW
Sbjct  162  CGDAKSMARDVHRTLHTIVQEQGSLDSSKAESMVKNLQMTGRYLRDVW  209



>gb|AIL29328.1| cytochrome P450 reductase [Pinus contorta]
Length=718

 Score =   181 bits (459),  Expect = 3e-49, Method: Composition-based stats.
 Identities = 79/108 (73%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MD+IYE+ELKN+ D G++++L++AFSREG  K+YVQHKI E+AS +W+LISQ GYLYV
Sbjct  611  RQMDYIYEDELKNYVDTGVLTDLVLAFSREGATKEYVQHKIAEKASYIWNLISQGGYLYV  670

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLH I+QEQE VDS+ AEA VKKLQ  GRYLRDVW
Sbjct  671  CGDAKGMARDVHRTLHNIIQEQESVDSTSAEATVKKLQTEGRYLRDVW  718



>ref|XP_011043963.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Populus euphratica]
Length=712

 Score =   181 bits (458),  Expect = 4e-49, Method: Composition-based stats.
 Identities = 78/108 (72%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MDFIYE+EL NF + G +SEL+VAFSREGP K+YVQHK+ ++AS +W++ISQ GYLYV
Sbjct  605  RKMDFIYEDELNNFVESGALSELVVAFSREGPTKEYVQHKMMQKASDIWNMISQGGYLYV  664

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMA+DVHR LHTIVQEQ  +D+SK E+ VK LQMNGRYLRDVW
Sbjct  665  CGDAKGMAKDVHRALHTIVQEQGSLDNSKTESFVKSLQMNGRYLRDVW  712



>emb|CAC83301.1| cytochrome P450 reductase [Triticum aestivum]
Length=703

 Score =   181 bits (458),  Expect = 5e-49, Method: Composition-based stats.
 Identities = 79/108 (73%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MDFIYE+EL NF + G +SEL+VAFSREGP K+YVQHK+ E+A+++WS++SQ GY+YV
Sbjct  596  RQMDFIYEDELNNFAESGALSELVVAFSREGPTKEYVQHKMAEKAAELWSIVSQGGYVYV  655

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHR LHTIVQEQ  +DSSKAE  VK LQM GRYLRDVW
Sbjct  656  CGDAKGMARDVHRALHTIVQEQGSLDSSKAEGYVKNLQMEGRYLRDVW  703



>ref|XP_006372089.1| hypothetical protein POPTR_0018s09980g [Populus trichocarpa]
 gb|ERP49886.1| hypothetical protein POPTR_0018s09980g [Populus trichocarpa]
Length=471

 Score =   178 bits (451),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 77/108 (71%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MDFIYE+EL NF + G +SEL+VAFSREGP K+YVQHK+ ++AS +W++ISQ GYLYV
Sbjct  364  RKMDFIYEDELNNFVESGALSELVVAFSREGPTKEYVQHKMMQKASDIWNMISQGGYLYV  423

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMA+DVHR LHTIVQEQ   D+S+ E+ VK LQMNGRYLRDVW
Sbjct  424  CGDAKGMAKDVHRALHTIVQEQGSFDNSRTESFVKSLQMNGRYLRDVW  471



>ref|XP_010523336.1| PREDICTED: NADPH--cytochrome P450 reductase 1-like isoform X3 
[Tarenaya hassleriana]
Length=374

 Score =   175 bits (444),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 93/104 (89%), Gaps = 1/104 (1%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYE+EL NF DQG +SELIVAFSREGP K+YVQHK+ E+A++VW L ++EGYLYV
Sbjct  216  RRMDFIYEDELYNFADQGALSELIVAFSREGPHKEYVQHKMVEKAAEVWKL-TKEGYLYV  274

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYL  367
            CGDAKGMARDVHRT+HTIVQEQE V SS+AEAIVKKLQ  GRYL
Sbjct  275  CGDAKGMARDVHRTMHTIVQEQEGVSSSEAEAIVKKLQTEGRYL  318



>ref|XP_010523337.1| PREDICTED: NADPH--cytochrome P450 reductase 1-like isoform X4 
[Tarenaya hassleriana]
 ref|XP_010523338.1| PREDICTED: NADPH--cytochrome P450 reductase 1-like isoform X4 
[Tarenaya hassleriana]
Length=370

 Score =   175 bits (444),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 93/104 (89%), Gaps = 1/104 (1%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYE+EL NF DQG +SELIVAFSREGP K+YVQHK+ E+A++VW L ++EGYLYV
Sbjct  216  RRMDFIYEDELYNFADQGALSELIVAFSREGPHKEYVQHKMVEKAAEVWKL-TKEGYLYV  274

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYL  367
            CGDAKGMARDVHRT+HTIVQEQE V SS+AEAIVKKLQ  GRYL
Sbjct  275  CGDAKGMARDVHRTMHTIVQEQEGVSSSEAEAIVKKLQTEGRYL  318



>gb|AAK15261.1|AF302498_1 NADPH-cytochrome P450 oxydoreductase isoform 3 [Populus trichocarpa 
x Populus deltoides]
Length=712

 Score =   180 bits (457),  Expect = 6e-49, Method: Composition-based stats.
 Identities = 78/108 (72%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MDFIYE+EL NF + G +SEL+VAFSREGP K+YVQHK+ ++AS +W++ISQ GYLYV
Sbjct  605  RKMDFIYEDELNNFVESGALSELVVAFSREGPTKEYVQHKMMQKASDIWNMISQGGYLYV  664

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMA+DVHR LHTIVQEQ  +D+SK E+ VK LQMNGRYLRDVW
Sbjct  665  CGDAKGMAKDVHRALHTIVQEQGSLDNSKTESFVKSLQMNGRYLRDVW  712



>gb|AEA86315.1| NADPH-cytochrome P450 reductase [Solanum nigrum]
Length=141

 Score =   168 bits (426),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MD+IY++EL NF + G +SEL+VAFSREGP K+YVQHK+TE+A+ +W++ISQ GY+YV
Sbjct  34   RQMDYIYQDELDNFLEAGALSELVVAFSREGPNKEYVQHKMTEKAADIWNMISQGGYVYV  93

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKG+ARDVHRTLHTI Q+Q  +D+SK E+ VK LQ  GRYLRDVW
Sbjct  94   CGDAKGVARDVHRTLHTIAQDQGSLDNSKTESFVKNLQTTGRYLRDVW  141



>gb|KJB53794.1| hypothetical protein B456_009G005600 [Gossypium raimondii]
Length=710

 Score =   180 bits (457),  Expect = 6e-49, Method: Composition-based stats.
 Identities = 79/108 (73%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MDFIYE+EL NF + G +SEL+VAFSREGP K+YVQHK+ E+A  +W +ISQ GYLYV
Sbjct  603  RKMDFIYEDELNNFVNSGALSELVVAFSREGPTKEYVQHKMMEKAKDIWDMISQGGYLYV  662

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHR LHTI+QEQ  +DSSKAE++VK LQM+GRYLRDVW
Sbjct  663  CGDAKGMARDVHRALHTILQEQGSLDSSKAESMVKNLQMSGRYLRDVW  710



>gb|KJB53797.1| hypothetical protein B456_009G005600 [Gossypium raimondii]
Length=711

 Score =   180 bits (457),  Expect = 6e-49, Method: Composition-based stats.
 Identities = 79/108 (73%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MDFIYE+EL NF + G +SEL+VAFSREGP K+YVQHK+ E+A  +W +ISQ GYLYV
Sbjct  604  RKMDFIYEDELNNFVNSGALSELVVAFSREGPTKEYVQHKMMEKAKDIWDMISQGGYLYV  663

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHR LHTI+QEQ  +DSSKAE++VK LQM+GRYLRDVW
Sbjct  664  CGDAKGMARDVHRALHTILQEQGSLDSSKAESMVKNLQMSGRYLRDVW  711



>ref|XP_008653023.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Zea mays]
 tpg|DAA62574.1| TPA: hypothetical protein ZEAMMB73_030302 [Zea mays]
Length=709

 Score =   180 bits (457),  Expect = 7e-49, Method: Composition-based stats.
 Identities = 81/109 (74%), Positives = 96/109 (88%), Gaps = 1/109 (1%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MDFIYE+EL NF D G +SELIVAFSREGP K+YVQHK+ ++A+++WS+ISQ GY+YV
Sbjct  601  RKMDFIYEDELNNFVDAGALSELIVAFSREGPTKEYVQHKMAQKAAELWSIISQGGYIYV  660

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVD-SSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIVQEQ  +D +SKAE+ VK LQM GRYLRDVW
Sbjct  661  CGDAKGMARDVHRTLHTIVQEQGSMDNNSKAESYVKSLQMEGRYLRDVW  709



>emb|CAN77401.1| hypothetical protein VITISV_027794 [Vitis vinifera]
Length=745

 Score =   180 bits (457),  Expect = 8e-49, Method: Composition-based stats.
 Identities = 79/108 (73%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MD+IYE+EL  F + G +SELIVAFSREGP K+YVQHK+ E+AS +W++ISQ GY+YV
Sbjct  638  RKMDYIYEDELNGFVESGALSELIVAFSREGPTKEYVQHKMMEKASDIWNVISQGGYIYV  697

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTI+QEQ  +DSSKAE++VK LQM GRYLRDVW
Sbjct  698  CGDAKGMARDVHRTLHTILQEQGSLDSSKAESMVKNLQMTGRYLRDVW  745



>ref|XP_008781895.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Phoenix dactylifera]
Length=706

 Score =   180 bits (457),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 81/108 (75%), Positives = 97/108 (90%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MDFIYE+ELK F ++G +SELIVAFSREGP K+YVQHK+TE+AS +W++ISQ GY+YV
Sbjct  599  RKMDFIYEDELKIFVERGALSELIVAFSREGPTKEYVQHKMTEKASDIWNIISQGGYIYV  658

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLH IVQEQ  +DSSK E++VK LQM+GRYLRDVW
Sbjct  659  CGDAKGMARDVHRTLHAIVQEQGSLDSSKTESMVKSLQMDGRYLRDVW  706



>ref|NP_001131393.1| uncharacterized protein LOC100192720 [Zea mays]
 gb|ACF79787.1| unknown [Zea mays]
Length=248

 Score =   171 bits (434),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 75/106 (71%), Positives = 91/106 (86%), Gaps = 0/106 (0%)
 Frame = -3

Query  672  MDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYVCG  493
            MDFIYE+EL NF +QG + EL++AFSR+GP K+YVQHK+ ++AS++W +ISQ  Y+YVCG
Sbjct  143  MDFIYEDELSNFLEQGALFELVLAFSRQGPTKEYVQHKMAQKASEIWDMISQGAYIYVCG  202

Query  492  DAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            DAKGMARDVHR LHTIVQEQ  +DSSKAE+ VK LQM GRYLRDVW
Sbjct  203  DAKGMARDVHRVLHTIVQEQGSLDSSKAESFVKNLQMEGRYLRDVW  248



>ref|XP_006381796.1| putative NADPH-cytochrome P450 reductase family protein [Populus 
trichocarpa]
 gb|AAK15260.1|AF302497_1 NADPH-cytochrome P450 oxydoreductase isoform 2 [Populus trichocarpa 
x Populus deltoides]
 gb|ERP59593.1| putative NADPH-cytochrome P450 reductase family protein [Populus 
trichocarpa]
Length=712

 Score =   179 bits (455),  Expect = 1e-48, Method: Composition-based stats.
 Identities = 79/108 (73%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MDFIYE+EL NF + G +SEL VAFSREGP K+YVQHK+ ++AS +W++ISQ GYLYV
Sbjct  605  RQMDFIYEDELNNFVESGALSELSVAFSREGPTKEYVQHKMMQKASDIWNMISQGGYLYV  664

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMA+DVHRTLHTIVQEQ  +D+SK E+ VK LQMNGRYLRDVW
Sbjct  665  CGDAKGMAKDVHRTLHTIVQEQGSLDNSKTESFVKGLQMNGRYLRDVW  712



>ref|XP_010913661.1| PREDICTED: LOW QUALITY PROTEIN: NADPH--cytochrome P450 reductase-like 
[Elaeis guineensis]
Length=706

 Score =   179 bits (455),  Expect = 1e-48, Method: Composition-based stats.
 Identities = 79/108 (73%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MDFIYE+ELKNF ++G +SELIVAFSREGP K+YVQHK+ E+AS +W++ISQ GY+YV
Sbjct  599  RKMDFIYEDELKNFVERGALSELIVAFSREGPTKEYVQHKMAEKASDIWNVISQGGYIYV  658

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHR LHTIVQEQ  +D S+ E++VK LQM GRYLRDVW
Sbjct  659  CGDAKGMARDVHRALHTIVQEQGSLDGSRTESMVKSLQMEGRYLRDVW  706



>ref|XP_011079296.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Sesamum indicum]
Length=705

 Score =   179 bits (455),  Expect = 1e-48, Method: Composition-based stats.
 Identities = 80/108 (74%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MDFIYE+EL NF   G+ISELIVAFSREGP K+YVQHK+T++AS +W++IS+ GY+YV
Sbjct  598  RQMDFIYEDELNNFVKAGVISELIVAFSREGPTKEYVQHKMTQKASDIWNIISEGGYVYV  657

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIVQEQ    SS+AE +VK LQM GRYLRDVW
Sbjct  658  CGDAKGMARDVHRTLHTIVQEQGSRSSSEAEGMVKNLQMTGRYLRDVW  705



>gb|AIC73829.1| cytochrome P450 reductase [Panax ginseng]
Length=678

 Score =   179 bits (455),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R++DFIYEEEL NF D G ISEL+VAFSREGP K+YVQHK++++AS+VW++IS+  Y+YV
Sbjct  571  RKLDFIYEEELNNFVDSGAISELVVAFSREGPTKEYVQHKMSQKASEVWNMISEGAYIYV  630

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHR LHTI QEQ  +DSSKAE++VK LQM GRYLRDVW
Sbjct  631  CGDAKGMARDVHRMLHTIAQEQGALDSSKAESLVKNLQMTGRYLRDVW  678



>ref|XP_010093854.1| NADPH--cytochrome P450 reductase [Morus notabilis]
 gb|EXB54742.1| NADPH--cytochrome P450 reductase [Morus notabilis]
Length=715

 Score =   179 bits (455),  Expect = 1e-48, Method: Composition-based stats.
 Identities = 78/108 (72%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMD+IYEEEL NF + G +SEL+VAFSREGP K+YVQHK+ ++A+ +W +ISQ  Y+YV
Sbjct  608  RRMDYIYEEELANFVETGALSELVVAFSREGPTKEYVQHKMMQKAADIWDMISQGAYIYV  667

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMA+DVHRTLHTI QEQ  +DSSKAE++VK LQMNGRYLRDVW
Sbjct  668  CGDAKGMAKDVHRTLHTIAQEQGSLDSSKAESMVKNLQMNGRYLRDVW  715



>gb|KHG09184.1| NADPH--cytochrome P450 reductase [Gossypium arboreum]
Length=710

 Score =   179 bits (455),  Expect = 1e-48, Method: Composition-based stats.
 Identities = 79/108 (73%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MDFIYE+EL NF + G +SEL+VAFSREGP K+YVQHK+ E+A  +W +ISQ GYLYV
Sbjct  603  RKMDFIYEDELNNFVNSGALSELVVAFSREGPTKEYVQHKMMEKAKDIWDMISQGGYLYV  662

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHR LHTI QEQ  +DSSKAE++VK LQM+GRYLRDVW
Sbjct  663  CGDAKGMARDVHRALHTIFQEQGSLDSSKAESMVKNLQMSGRYLRDVW  710



>ref|NP_001063914.1| Os09g0558900 [Oryza sativa Japonica Group]
 dbj|BAD45947.1| putative NADPH-cytochrome P450 oxydoreductase isoform 3 [Oryza 
sativa Japonica Group]
 dbj|BAF25828.1| Os09g0558900 [Oryza sativa Japonica Group]
Length=714

 Score =   179 bits (455),  Expect = 1e-48, Method: Composition-based stats.
 Identities = 79/108 (73%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MDFIYE+EL NF + G +SELIVAFSREGP K+YVQHK+ E+A ++WS+ISQ GY+YV
Sbjct  607  RKMDFIYEDELNNFVETGALSELIVAFSREGPSKEYVQHKMAEKAPEIWSIISQGGYIYV  666

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIVQEQ  +D+S  E+ VK LQM GRYLRDVW
Sbjct  667  CGDAKGMARDVHRTLHTIVQEQGSLDNSNTESYVKSLQMEGRYLRDVW  714



>gb|ACF35280.1| cytochrome P450 reductase-like protein [Nothapodytes nimmoniana]
Length=709

 Score =   179 bits (454),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 81/108 (75%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MD+IYE+EL NF + G +SELIVAFSREGP K+YVQHK+ E+AS  WS+ISQ  Y+YV
Sbjct  602  RKMDYIYEDELNNFVNTGALSELIVAFSREGPTKEYVQHKMAEKASDFWSMISQGAYIYV  661

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIVQEQ  +DSSKAE++VK LQM GRYLRDVW
Sbjct  662  CGDAKGMARDVHRTLHTIVQEQGCLDSSKAESMVKNLQMTGRYLRDVW  709



>gb|AAS00459.1| NADPH:cytochrome P450-reductase [Hypericum androsaemum]
Length=685

 Score =   179 bits (454),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 79/108 (73%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MD+IYEEEL NF +QG +SELIVAFSREGPQKDYVQHK+ ++A+ +W ++SQ  ++YV
Sbjct  578  RQMDYIYEEELNNFVEQGALSELIVAFSREGPQKDYVQHKMMDKAAYIWEVLSQGAHIYV  637

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIVQEQ  +DSSK E  VKKLQM+GRYLR+VW
Sbjct  638  CGDAKGMARDVHRTLHTIVQEQGNLDSSKTELFVKKLQMDGRYLRNVW  685



>ref|XP_010447753.1| PREDICTED: NADPH--cytochrome P450 reductase 2-like [Camelina 
sativa]
Length=414

 Score =   175 bits (444),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 77/108 (71%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYEEEL+ F + G ++ELIVAFSREGP K+YVQHK+ ++AS +W++ISQ  Y+YV
Sbjct  307  RRMDFIYEEELQRFVESGALAELIVAFSREGPTKEYVQHKMMDKASDIWNMISQGAYVYV  366

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHR+LHTI QEQ  +DS+KAE  VK LQM+GRYLRDVW
Sbjct  367  CGDAKGMARDVHRSLHTIAQEQGSMDSTKAEGFVKNLQMSGRYLRDVW  414



>ref|XP_008453604.1| PREDICTED: NADPH--cytochrome P450 reductase 2 [Cucumis melo]
Length=708

 Score =   179 bits (454),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 80/108 (74%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R MD+IYE+EL NF + G +SEL++AFSREGP K+YVQHK+TE+AS +W+LISQ  YLYV
Sbjct  601  RAMDYIYEDELNNFVEAGALSELVIAFSREGPTKEYVQHKMTEKASDIWNLISQGAYLYV  660

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIVQEQ  +DSSKAE++VK LQ +GRYLRDVW
Sbjct  661  CGDAKGMARDVHRTLHTIVQEQGSLDSSKAESMVKSLQTSGRYLRDVW  708



>gb|EMT14573.1| NADPH--cytochrome P450 reductase [Aegilops tauschii]
Length=696

 Score =   179 bits (453),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 78/108 (72%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MDFIYE+EL NF + G +SEL+VAFSREGP K+YVQHK+ E+A+++WS++SQ GY+YV
Sbjct  589  RQMDFIYEDELNNFAESGALSELVVAFSREGPTKEYVQHKMAEKAAELWSIVSQGGYVYV  648

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHR LHTIVQEQ  +DSSK E  VK LQM GRYLRDVW
Sbjct  649  CGDAKGMARDVHRMLHTIVQEQGSLDSSKTEGYVKNLQMEGRYLRDVW  696



>ref|XP_010523335.1| PREDICTED: NADPH--cytochrome P450 reductase 1-like isoform X2 
[Tarenaya hassleriana]
Length=445

 Score =   175 bits (444),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 93/104 (89%), Gaps = 1/104 (1%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYE+EL NF DQG +SELIVAFSREGP K+YVQHK+ E+A++VW L ++EGYLYV
Sbjct  216  RRMDFIYEDELYNFADQGALSELIVAFSREGPHKEYVQHKMVEKAAEVWKL-TKEGYLYV  274

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYL  367
            CGDAKGMARDVHRT+HTIVQEQE V SS+AEAIVKKLQ  GRYL
Sbjct  275  CGDAKGMARDVHRTMHTIVQEQEGVSSSEAEAIVKKLQTEGRYL  318



>ref|XP_002324469.1| putative NADPH-cytochrome P450 reductase family protein [Populus 
trichocarpa]
 gb|EEF03034.1| putative NADPH-cytochrome P450 reductase family protein [Populus 
trichocarpa]
Length=712

 Score =   179 bits (453),  Expect = 3e-48, Method: Composition-based stats.
 Identities = 77/108 (71%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MDFIYE+EL NF + G +SEL+VAFSREGP K+YVQHK+ ++AS +W++ISQ GYLYV
Sbjct  605  RKMDFIYEDELNNFVESGALSELVVAFSREGPTKEYVQHKMMQKASDIWNMISQGGYLYV  664

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMA+DVHR LHTIVQEQ   D+S+ E+ VK LQMNGRYLRDVW
Sbjct  665  CGDAKGMAKDVHRALHTIVQEQGSFDNSRTESFVKSLQMNGRYLRDVW  712



>gb|ACN54324.1| NADPH:cytochrome P450 reductase [Gossypium hirsutum]
Length=710

 Score =   178 bits (452),  Expect = 3e-48, Method: Composition-based stats.
 Identities = 79/108 (73%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MDFIYE+EL NF + G +SEL+VAFSREGP K+YVQHK+ E+A  +W +ISQ GYLYV
Sbjct  603  RKMDFIYEDELNNFVNSGALSELVVAFSREGPTKEYVQHKMMEKAKDIWDMISQGGYLYV  662

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHR LHTI QEQ  +DSSKAE++VK LQM+GRYLRDVW
Sbjct  663  CGDAKGMARDVHRALHTIFQEQGSLDSSKAESMVKNLQMSGRYLRDVW  710



>ref|XP_004146317.1| PREDICTED: NADPH--cytochrome P450 reductase 2-like [Cucumis sativus]
 gb|AIT72028.1| cytochrome P450 reductase [Cucumis sativus]
 gb|KGN65457.1| hypothetical protein Csa_1G423150 [Cucumis sativus]
Length=708

 Score =   178 bits (452),  Expect = 3e-48, Method: Composition-based stats.
 Identities = 80/108 (74%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R MD+IYE+EL NF + G +SEL++AFSREGP K+YVQHK+TE+AS +W+LISQ  YLYV
Sbjct  601  RAMDYIYEDELNNFVETGALSELVIAFSREGPTKEYVQHKMTEKASDIWNLISQGAYLYV  660

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIVQEQ  +DSSKAE++VK LQ +GRYLRDVW
Sbjct  661  CGDAKGMARDVHRTLHTIVQEQGSLDSSKAESMVKNLQTSGRYLRDVW  708



>ref|XP_010525727.1| PREDICTED: NADPH--cytochrome P450 reductase 2 [Tarenaya hassleriana]
Length=713

 Score =   178 bits (452),  Expect = 4e-48, Method: Composition-based stats.
 Identities = 80/108 (74%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYE+EL+ F ++G +SEL+VAFSREGP K+YVQHK+ ++AS++W  ISQ GYLYV
Sbjct  606  RRMDFIYEDELQRFVERGALSELVVAFSREGPTKEYVQHKMMDKASEMWKTISQGGYLYV  665

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHR LHTIVQEQ  +DSSKAE+ VK LQM+GRYLRDVW
Sbjct  666  CGDAKGMARDVHRALHTIVQEQGSMDSSKAESFVKNLQMSGRYLRDVW  713



>emb|CAA89837.3| NADPH-cytochrome P450 reductase [Pseudotsuga menziesii]
Length=719

 Score =   178 bits (452),  Expect = 4e-48, Method: Composition-based stats.
 Identities = 78/108 (72%), Positives = 96/108 (89%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MD+IYE+ELK++ + G+++EL++AFSREG  K+YVQHKITE+ S +W+LI+Q GYLYV
Sbjct  612  RQMDYIYEDELKSYVENGVLTELVLAFSREGATKEYVQHKITEKGSYIWNLIAQGGYLYV  671

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLH+IVQEQE VDS+ AEA VKKLQ  GRYLRDVW
Sbjct  672  CGDAKGMARDVHRTLHSIVQEQESVDSTSAEATVKKLQTEGRYLRDVW  719



>ref|XP_011010331.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Populus euphratica]
Length=712

 Score =   178 bits (451),  Expect = 4e-48, Method: Composition-based stats.
 Identities = 78/108 (72%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MDFIYE+EL NF + G +SEL VAFSREGP K+YVQHK+ ++AS +W++ISQ GYLYV
Sbjct  605  RQMDFIYEDELNNFVESGALSELFVAFSREGPTKEYVQHKMMQKASDIWNMISQGGYLYV  664

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMA+DVHRTLH IVQEQ  +D+SK E+ VK LQMNGRYLRDVW
Sbjct  665  CGDAKGMAKDVHRTLHAIVQEQGSLDNSKTESFVKGLQMNGRYLRDVW  712



>emb|CAE01547.2| OSJNBb0022F16.2 [Oryza sativa Japonica Group]
 emb|CAE03554.2| OSJNBa0060D06.20 [Oryza sativa Japonica Group]
Length=695

 Score =   178 bits (451),  Expect = 5e-48, Method: Composition-based stats.
 Identities = 78/108 (72%), Positives = 96/108 (89%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R MD+IYE+EL+NF  +G +SELIVAFSREGP K+YVQHK+TE+A+++W+++SQ GY+YV
Sbjct  588  RNMDYIYEDELQNFIQEGALSELIVAFSREGPAKEYVQHKMTEKATEIWNIVSQGGYIYV  647

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHR LHTIVQEQ  +DSSK E+ VK LQM+GRYLRDVW
Sbjct  648  CGDAKGMARDVHRALHTIVQEQGSLDSSKTESYVKSLQMDGRYLRDVW  695



>ref|XP_002270732.2| PREDICTED: NADPH--cytochrome P450 reductase [Vitis vinifera]
Length=705

 Score =   178 bits (451),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MD+IYE+EL  F + G +SELIVAFSREGP K+YVQHK+ E+AS +W++ISQ GY+YV
Sbjct  598  RKMDYIYEDELNGFVESGALSELIVAFSREGPTKEYVQHKMMEKASDIWNVISQGGYIYV  657

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTI+QEQ  +DSSKAE++VK LQM GRYLRDVW
Sbjct  658  CGDAKGMARDVHRTLHTILQEQGSLDSSKAESMVKNLQMTGRYLRDVW  705



>ref|XP_010523334.1| PREDICTED: NADPH--cytochrome P450 reductase 1-like isoform X1 
[Tarenaya hassleriana]
Length=496

 Score =   176 bits (445),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 93/104 (89%), Gaps = 1/104 (1%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYE+EL NF DQG +SELIVAFSREGP K+YVQHK+ E+A++VW L ++EGYLYV
Sbjct  216  RRMDFIYEDELYNFADQGALSELIVAFSREGPHKEYVQHKMVEKAAEVWKL-TKEGYLYV  274

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYL  367
            CGDAKGMARDVHRT+HTIVQEQE V SS+AEAIVKKLQ  GRYL
Sbjct  275  CGDAKGMARDVHRTMHTIVQEQEGVSSSEAEAIVKKLQTEGRYL  318



>emb|CBI17838.3| unnamed protein product [Vitis vinifera]
Length=660

 Score =   177 bits (450),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MD+IYE+EL  F + G +SELIVAFSREGP K+YVQHK+ E+AS +W++ISQ GY+YV
Sbjct  553  RKMDYIYEDELNGFVESGALSELIVAFSREGPTKEYVQHKMMEKASDIWNVISQGGYIYV  612

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTI+QEQ  +DSSKAE++VK LQM GRYLRDVW
Sbjct  613  CGDAKGMARDVHRTLHTILQEQGSLDSSKAESMVKNLQMTGRYLRDVW  660



>ref|XP_009382841.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Musa acuminata 
subsp. malaccensis]
Length=694

 Score =   177 bits (450),  Expect = 5e-48, Method: Composition-based stats.
 Identities = 78/108 (72%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MDFIYE+ELKNF + G +SELI+AFSREGP K+YVQHK+ E+A  +W++I Q GY+YV
Sbjct  587  RKMDFIYEDELKNFVETGALSELILAFSREGPTKEYVQHKMAEKALDIWNIIEQGGYIYV  646

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHR LHTIVQEQ  +DSSK E++VK LQM+GRYLRDVW
Sbjct  647  CGDAKGMARDVHRVLHTIVQEQGSLDSSKTESMVKSLQMDGRYLRDVW  694



>gb|EEE61817.1| hypothetical protein OsJ_16444 [Oryza sativa Japonica Group]
Length=646

 Score =   177 bits (449),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 96/108 (89%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R MD+IYE+EL+NF  +G +SELIVAFSREGP K+YVQHK+TE+A+++W+++SQ GY+YV
Sbjct  539  RNMDYIYEDELQNFIQEGALSELIVAFSREGPAKEYVQHKMTEKATEIWNIVSQGGYIYV  598

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHR LHTIVQEQ  +DSSK E+ VK LQM+GRYLRDVW
Sbjct  599  CGDAKGMARDVHRALHTIVQEQGSLDSSKTESYVKSLQMDGRYLRDVW  646



>emb|CCO62220.1| putative cytochrome P450 reductase [Actaea racemosa]
Length=699

 Score =   177 bits (450),  Expect = 6e-48, Method: Composition-based stats.
 Identities = 77/108 (71%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R MD+IYE+EL  F + G ++EL+VAFSREGP K YVQHK+TERAS +W++ISQ GYLYV
Sbjct  592  RNMDYIYEDELNGFVEAGALTELVVAFSREGPNKQYVQHKMTERASDIWNMISQGGYLYV  651

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMA+DVHRTLHTIVQEQ  +D+SK E +VK +QM+GRYLRDVW
Sbjct  652  CGDAKGMAKDVHRTLHTIVQEQGSLDNSKTEMMVKNMQMDGRYLRDVW  699



>ref|XP_006661531.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Oryza brachyantha]
Length=642

 Score =   177 bits (449),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MDFIYE+EL NF D G +S+L +AFSREGP K+YVQHK+TE+A ++WS+ISQ GY+YV
Sbjct  535  RKMDFIYEDELNNFVDAGALSKLSIAFSREGPTKEYVQHKMTEKAPEIWSIISQGGYIYV  594

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIVQEQ  +D+S  E+ VK LQM GRYLRDVW
Sbjct  595  CGDAKGMARDVHRTLHTIVQEQGSLDNSNTESYVKSLQMEGRYLRDVW  642



>gb|AAK56276.1|AF367288_1 AT4g30210/F9N11_60 [Arabidopsis thaliana]
 gb|AAL15387.1| AT4g30210/F9N11_60 [Arabidopsis thaliana]
Length=340

 Score =   172 bits (435),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 76/108 (70%), Positives = 91/108 (84%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYEEEL+ F + G ++EL VAFSREGP K+YVQHK+ ++AS +W++ISQ  YLYV
Sbjct  233  RRMDFIYEEELQRFVESGALAELSVAFSREGPTKEYVQHKMMDKASDIWNMISQGAYLYV  292

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHR+LHTI QEQ  +DS+KAE  VK LQ +GRYLRDVW
Sbjct  293  CGDAKGMARDVHRSLHTIAQEQGSMDSTKAEGFVKNLQTSGRYLRDVW  340



>dbj|BAJ41269.1| NADPH-P450 reductase 2 [Zingiber officinale]
Length=701

 Score =   177 bits (449),  Expect = 8e-48, Method: Composition-based stats.
 Identities = 78/108 (72%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MDFIYE+EL NF + G +SELIVAFSREGP K YVQHK+TE+A+++W++ISQ GY+YV
Sbjct  594  RKMDFIYEDELNNFVETGALSELIVAFSREGPTKQYVQHKMTEKATELWNIISQGGYVYV  653

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHR LHTI QEQ  +DSSK E+ +K LQM GRYLRDVW
Sbjct  654  CGDAKGMARDVHRVLHTIAQEQGGMDSSKTESFIKSLQMEGRYLRDVW  701



>ref|NP_001136741.1| uncharacterized protein LOC100216882 [Zea mays]
 gb|ACF82516.1| unknown [Zea mays]
 gb|ACR38551.1| unknown [Zea mays]
Length=247

 Score =   169 bits (428),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = -3

Query  675  RMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYVC  496
            +MDFIYE EL NF +QG +SEL++AFSR+G  K+YVQHK+ ++AS++W +ISQ  Y+YVC
Sbjct  141  KMDFIYEGELNNFVEQGALSELVLAFSRQGLAKEYVQHKMAQKASEIWDMISQGAYIYVC  200

Query  495  GDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            GDAKGMARDVHR LHTIVQEQ  +DSSKAE+ VK LQM GRYLRDVW
Sbjct  201  GDAKGMARDVHRVLHTIVQEQGSLDSSKAESFVKNLQMEGRYLRDVW  247



>ref|XP_009795589.1| PREDICTED: NADPH--cytochrome P450 reductase [Nicotiana sylvestris]
Length=713

 Score =   177 bits (449),  Expect = 8e-48, Method: Composition-based stats.
 Identities = 76/108 (70%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MD+IY+EEL NF + G +SEL+VAFSREGP K+YVQHK++E+A+ +W++ISQ GY+YV
Sbjct  606  RQMDYIYQEELDNFLEAGALSELVVAFSREGPNKEYVQHKMSEKAADIWNMISQGGYVYV  665

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHR LHTI Q+Q  +DSSKAEA+VK LQ+ GRYLRDVW
Sbjct  666  CGDAKGMARDVHRALHTIAQDQGSLDSSKAEALVKNLQITGRYLRDVW  713



>ref|XP_007014268.1| P450 reductase 2 [Theobroma cacao]
 gb|EOY31887.1| P450 reductase 2 [Theobroma cacao]
Length=710

 Score =   177 bits (449),  Expect = 9e-48, Method: Composition-based stats.
 Identities = 77/108 (71%), Positives = 96/108 (89%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MD+IYE+EL NF + G +SE++VAFSREGP K+YVQHK+ ++AS +W++ISQ GYLYV
Sbjct  603  RKMDYIYEDELNNFVNGGALSEIVVAFSREGPTKEYVQHKMMQKASDIWNMISQGGYLYV  662

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMA+DVHRTLHTI+QEQ  +DSSKAE++VK LQM GRYLRDVW
Sbjct  663  CGDAKGMAKDVHRTLHTILQEQGCLDSSKAESMVKNLQMTGRYLRDVW  710



>ref|XP_004148333.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Cucumis sativus]
 gb|KGN61141.1| hypothetical protein Csa_2G059720 [Cucumis sativus]
Length=708

 Score =   177 bits (448),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MD+IYE+EL NF + G +SELI+AFSREGP K+YVQHK+ E+AS +W+L+SQ  Y+YV
Sbjct  601  RKMDYIYEDELNNFVETGALSELILAFSREGPSKEYVQHKMVEKASDIWNLLSQGAYIYV  660

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLH IVQEQ  +DSSKAE++VK LQM+GRYLRDVW
Sbjct  661  CGDAKGMARDVHRTLHNIVQEQGSLDSSKAESMVKNLQMSGRYLRDVW  708



>gb|AGC92176.1| cytochrome P450 oxidoreductase [Ocimum basilicum]
Length=707

 Score =   177 bits (448),  Expect = 1e-47, Method: Composition-based stats.
 Identities = 79/108 (73%), Positives = 91/108 (84%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MDFIY +EL NF + G+ISELIVAFSREGP K+YVQHK+T+RAS VW +IS  GY+YV
Sbjct  600  RKMDFIYGDELNNFVEAGVISELIVAFSREGPTKEYVQHKMTQRASDVWKIISDGGYVYV  659

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTI QEQ  + SS+AE +VK LQ  GRYLRDVW
Sbjct  660  CGDAKGMARDVHRTLHTIAQEQGSLSSSEAEGMVKNLQTTGRYLRDVW  707



>ref|XP_004168364.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Cucumis sativus]
Length=708

 Score =   177 bits (448),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MD+IYE+EL NF + G +SELI+AFSREGP K+YVQHK+ E+AS +W+L+SQ  Y+YV
Sbjct  601  RKMDYIYEDELNNFVETGALSELILAFSREGPSKEYVQHKMVEKASDIWNLLSQGAYIYV  660

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLH IVQEQ  +DSSKAE++VK LQM+GRYLRDVW
Sbjct  661  CGDAKGMARDVHRTLHNIVQEQGSLDSSKAESMVKNLQMSGRYLRDVW  708



>gb|EAZ10065.1| hypothetical protein OsI_32371 [Oryza sativa Indica Group]
Length=717

 Score =   177 bits (448),  Expect = 1e-47, Method: Composition-based stats.
 Identities = 78/108 (72%), Positives = 92/108 (85%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MDFIYE+EL NF + G +SELIVAFSREGP K+YVQHK+ E+A ++WS+IS  GY+YV
Sbjct  610  RKMDFIYEDELNNFVETGALSELIVAFSREGPSKEYVQHKMAEKAPEIWSIISPGGYIYV  669

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIVQEQ  +D+S  E+ VK LQM GRYLRDVW
Sbjct  670  CGDAKGMARDVHRTLHTIVQEQGSLDNSNTESYVKSLQMEGRYLRDVW  717



>ref|XP_009607226.1| PREDICTED: NADPH--cytochrome P450 reductase [Nicotiana tomentosiformis]
Length=713

 Score =   177 bits (448),  Expect = 1e-47, Method: Composition-based stats.
 Identities = 76/108 (70%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MD+IY+EEL NF + G +SEL+VAFSREGP K+YVQHK++E+A+ +W++ISQ GY+YV
Sbjct  606  RQMDYIYQEELDNFLEAGALSELVVAFSREGPNKEYVQHKMSEKAADIWNMISQGGYVYV  665

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTI Q+Q  +DSSKAE +VK LQ  GRYLRDVW
Sbjct  666  CGDAKGMARDVHRTLHTIAQDQGSLDSSKAEGLVKNLQTTGRYLRDVW  713



>gb|AHA50098.1| CYP450 reductase [Panax ginseng]
Length=709

 Score =   177 bits (448),  Expect = 1e-47, Method: Composition-based stats.
 Identities = 76/108 (70%), Positives = 96/108 (89%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R++DFIYE+EL NF + G ISE++VAFSREGP K+YVQHK++++AS++W++IS+  Y+YV
Sbjct  602  RKLDFIYEDELNNFVESGAISEMVVAFSREGPTKEYVQHKMSQKASEIWNMISEGAYIYV  661

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTI QEQ  +DSSKAE++VK LQM GRYLRDVW
Sbjct  662  CGDAKGMARDVHRTLHTIAQEQGALDSSKAESLVKNLQMTGRYLRDVW  709



>ref|XP_004957625.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Setaria italica]
Length=705

 Score =   176 bits (447),  Expect = 1e-47, Method: Composition-based stats.
 Identities = 78/108 (72%), Positives = 92/108 (85%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MDFIYE+EL NF D G +SELIVAFSREGP K+YVQHK+ ++A  +WS+ISQ GY+YV
Sbjct  598  RKMDFIYEDELSNFVDTGALSELIVAFSREGPTKEYVQHKMAQKAGVLWSIISQGGYIYV  657

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTI+QEQ  +D+SK E+ VK LQ  GRYLRDVW
Sbjct  658  CGDAKGMARDVHRTLHTIIQEQGSLDNSKTESYVKSLQTEGRYLRDVW  705



>dbj|BAG68945.1| cytochrome P450 reductase [Lotus japonicus]
Length=706

 Score =   176 bits (447),  Expect = 1e-47, Method: Composition-based stats.
 Identities = 78/108 (72%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MD+IYE+EL +F + G +SELIVAFSREGP K+YVQHK+ E+AS +W++ISQ  Y+YV
Sbjct  599  RQMDYIYEDELNHFVNSGALSELIVAFSREGPTKEYVQHKMMEKASDIWNMISQGAYIYV  658

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTI+QEQ  +DSSKAE +VK LQ+NGRYLRDVW
Sbjct  659  CGDAKGMARDVHRTLHTILQEQGSLDSSKAEGMVKNLQLNGRYLRDVW  706



>ref|XP_008391625.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Malus domestica]
Length=712

 Score =   176 bits (447),  Expect = 1e-47, Method: Composition-based stats.
 Identities = 79/107 (74%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -3

Query  675  RMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYVC  496
            +MD+IYE+EL NF   G +SEL+VAFSR+GP K+YVQHK+ ++AS VW++ISQ GY+YVC
Sbjct  606  QMDYIYEDELNNFLATGALSELVVAFSRQGPTKEYVQHKMMQKASDVWNMISQGGYIYVC  665

Query  495  GDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            GDAKGMARDVHRTLHTIVQEQ  +DSSKAE +VK LQMNGRYLRDVW
Sbjct  666  GDAKGMARDVHRTLHTIVQEQGCMDSSKAEGLVKNLQMNGRYLRDVW  712



>ref|XP_004296434.1| PREDICTED: NADPH--cytochrome P450 reductase 2 [Fragaria vesca 
subsp. vesca]
Length=709

 Score =   176 bits (447),  Expect = 2e-47, Method: Composition-based stats.
 Identities = 75/107 (70%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -3

Query  675  RMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYVC  496
            +MD+IYE+EL NF ++G +SEL+VAFSR+GP K+YVQHK+ ++AS +W++ISQ GY+YVC
Sbjct  603  QMDYIYEDELNNFVEKGALSELVVAFSRQGPTKEYVQHKMMQKASDIWNMISQGGYIYVC  662

Query  495  GDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            GDAKGMA+DVHRTLHTI+QEQ  +DSSKAE++VK LQ NGRYLRDVW
Sbjct  663  GDAKGMAKDVHRTLHTILQEQGSLDSSKAESMVKNLQTNGRYLRDVW  709



>ref|XP_010914150.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Elaeis guineensis]
Length=701

 Score =   176 bits (446),  Expect = 2e-47, Method: Composition-based stats.
 Identities = 79/108 (73%), Positives = 92/108 (85%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MDFIYE+EL NF   G +SELIVAFSREGP K+YVQHK+ E+A  +W +IS+ GY+YV
Sbjct  594  RKMDFIYEDELNNFVKAGALSELIVAFSREGPAKEYVQHKMAEKAVDIWDIISKGGYIYV  653

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHR LHTIVQEQ  +DSSKAE++VK LQM GRYLRDVW
Sbjct  654  CGDAKGMARDVHRVLHTIVQEQGSLDSSKAESMVKNLQMEGRYLRDVW  701



>gb|ADC94831.1| cytochrome P450 reductase [Perilla frutescens]
Length=709

 Score =   176 bits (445),  Expect = 3e-47, Method: Composition-based stats.
 Identities = 75/107 (70%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -3

Query  675  RMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYVC  496
            +MDFIYE+EL +F   G++SEL++AFSREGP K+YVQHK+ ++A  +W++IS+ GY+YVC
Sbjct  603  KMDFIYEDELNHFVKAGVVSELVLAFSREGPTKEYVQHKMAQKALDLWNMISEGGYVYVC  662

Query  495  GDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            GDAKGMARDVHRTLHTIVQEQ  +DSSK E+ VK LQMNGRYLRDVW
Sbjct  663  GDAKGMARDVHRTLHTIVQEQGSLDSSKTESFVKNLQMNGRYLRDVW  709



>ref|XP_009384791.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Musa acuminata 
subsp. malaccensis]
Length=694

 Score =   176 bits (445),  Expect = 3e-47, Method: Composition-based stats.
 Identities = 76/108 (70%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MDFIYE+ELKNF   G +SELI+AFSREGP K+YVQHK+ E+AS +W++ISQ GY+YV
Sbjct  587  RKMDFIYEDELKNFVGTGALSELILAFSREGPTKEYVQHKMAEKASDIWNIISQGGYIYV  646

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGD+KGMA+DVHR LHTI+Q Q  +DSSK E++VK LQM+GRYLRDVW
Sbjct  647  CGDSKGMAKDVHRALHTIIQGQGSLDSSKTESMVKGLQMDGRYLRDVW  694



>gb|KDO43876.1| hypothetical protein CISIN_1g005072mg [Citrus sinensis]
Length=509

 Score =   174 bits (440),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 76/108 (70%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MD+IYE+EL NF   G +S+LIVAFSREGP K+YVQHK+ E++S +W+++S+  YLYV
Sbjct  402  RKMDYIYEDELNNFVQSGALSQLIVAFSREGPTKEYVQHKMMEKSSDIWNMLSEGAYLYV  461

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAK MARDVHRTLHTIVQEQ  +DSSKAE++VK LQM GRYLRDVW
Sbjct  462  CGDAKSMARDVHRTLHTIVQEQGSLDSSKAESMVKNLQMTGRYLRDVW  509



>ref|XP_002444097.1| hypothetical protein SORBIDRAFT_07g007640 [Sorghum bicolor]
 gb|EES13592.1| hypothetical protein SORBIDRAFT_07g007640 [Sorghum bicolor]
Length=706

 Score =   175 bits (444),  Expect = 3e-47, Method: Composition-based stats.
 Identities = 76/107 (71%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -3

Query  675  RMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYVC  496
            +MDFIYE+EL NF +QG +SEL++AFSR+GP K+YVQHK+ ++AS++W +ISQ  Y+YVC
Sbjct  600  KMDFIYEDELNNFLEQGALSELVLAFSRQGPTKEYVQHKMAQKASEIWDMISQGAYIYVC  659

Query  495  GDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            GDAKGMARDVHR LHTIVQEQ  +DSSKAE+ VK LQM GRYLRDVW
Sbjct  660  GDAKGMARDVHRVLHTIVQEQGSLDSSKAESFVKNLQMEGRYLRDVW  706



>ref|XP_004507858.1| PREDICTED: NADPH--cytochrome P450 reductase-like isoform X2 [Cicer 
arietinum]
Length=705

 Score =   175 bits (444),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 80/109 (73%), Positives = 97/109 (89%), Gaps = 1/109 (1%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEG-YLY  502
            R++D+IYE+EL  F + G +SELIVAFSREGP K+YVQHK+ E+AS +W++ISQEG Y+Y
Sbjct  597  RQVDYIYEDELNQFVNGGALSELIVAFSREGPTKEYVQHKMMEKASDIWNMISQEGAYIY  656

Query  501  VCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            VCGDAKGMARDVHRTLHTI+QEQ  +DSSKAE++VK LQMNGRYLRDVW
Sbjct  657  VCGDAKGMARDVHRTLHTILQEQGSLDSSKAESMVKNLQMNGRYLRDVW  705



>gb|AAZ39649.1| cytochrome P450 NADPH-reductase [Petunia x hybrida]
Length=715

 Score =   175 bits (444),  Expect = 4e-47, Method: Composition-based stats.
 Identities = 75/107 (70%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = -3

Query  675  RMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYVC  496
            +MD+IY+EEL NF + G +SEL+VAFSREGP K YVQHK+TE+A+ +W++ISQ GY+YVC
Sbjct  609  KMDYIYQEELNNFLEAGALSELVVAFSREGPNKQYVQHKMTEKAADIWNMISQGGYVYVC  668

Query  495  GDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            GDAKGMARDVHRTLHTI Q+Q  +DS+KAE +VK LQ  GRYLRDVW
Sbjct  669  GDAKGMARDVHRTLHTIAQDQGSLDSTKAEGMVKNLQTTGRYLRDVW  715



>gb|AGX85599.1| NADPH:cytochrome P450 reductase [Scoparia dulcis]
Length=713

 Score =   175 bits (444),  Expect = 4e-47, Method: Composition-based stats.
 Identities = 75/108 (69%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            + MD+IYE+EL  F + G+ISEL++AFSR+GP K+YVQHK+ E+AS +W++IS+ GY+YV
Sbjct  606  KEMDYIYEDELNGFVEAGVISELVLAFSRQGPTKEYVQHKMAEKASDLWNMISEGGYIYV  665

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIVQEQ  +D+SKAE +VK LQM+GRYLRDVW
Sbjct  666  CGDAKGMARDVHRTLHTIVQEQGSLDNSKAELMVKNLQMSGRYLRDVW  713



>ref|NP_001159331.1| uncharacterized protein LOC100304425 [Zea mays]
 gb|ACN25819.1| unknown [Zea mays]
 gb|ACN28051.1| unknown [Zea mays]
 gb|AFW59698.1| hypothetical protein ZEAMMB73_961001 [Zea mays]
Length=694

 Score =   175 bits (444),  Expect = 4e-47, Method: Composition-based stats.
 Identities = 76/108 (70%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R MD+IYE+EL+ F ++G +SELIVAFSREGP K+YVQHK+ E+A+++W++IS  GYLYV
Sbjct  587  RNMDYIYEDELQTFLEEGALSELIVAFSREGPTKEYVQHKMVEKATEIWNIISHGGYLYV  646

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHR LHT+VQEQ  +DSSK E+ VK LQM GRYLRDVW
Sbjct  647  CGDAKGMARDVHRMLHTVVQEQGSLDSSKTESYVKSLQMEGRYLRDVW  694



>ref|XP_006653834.1| PREDICTED: NADPH--cytochrome P450 reductase-like, partial [Oryza 
brachyantha]
Length=628

 Score =   175 bits (443),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 77/108 (71%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R MD+IYE+EL+NF  +G +SELIVAFSREGP K+YVQHK+ ++A+++W+++SQ GYLYV
Sbjct  521  RNMDYIYEDELENFLQEGALSELIVAFSREGPTKEYVQHKMVDKATEIWNILSQGGYLYV  580

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHR LHTIVQEQ  +DSSK E+ VK LQM+GRYLRDVW
Sbjct  581  CGDAKGMARDVHRALHTIVQEQGSLDSSKTESYVKSLQMDGRYLRDVW  628



>emb|CDY28169.1| BnaA01g06800D [Brassica napus]
Length=696

 Score =   175 bits (444),  Expect = 4e-47, Method: Composition-based stats.
 Identities = 78/108 (72%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYEEEL+ F + G +SEL VAFSREGP K+YVQHK+ ++AS +WS+ISQ  Y+YV
Sbjct  589  RRMDFIYEEELQRFLESGALSELSVAFSREGPTKEYVQHKMMDKASDIWSMISQGAYVYV  648

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHR+LHTI QEQ  +DS+KAE+ VK LQM+GRYLRDVW
Sbjct  649  CGDAKGMARDVHRSLHTIAQEQGSMDSTKAESFVKNLQMSGRYLRDVW  696



>ref|XP_008789667.1| PREDICTED: NADPH--cytochrome P450 reductase [Phoenix dactylifera]
Length=706

 Score =   175 bits (443),  Expect = 5e-47, Method: Composition-based stats.
 Identities = 79/108 (73%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R++DFIYE+ELK F + G +SELIVAFSREG  K+YVQHK+ E+AS +W++ISQ GY+YV
Sbjct  599  RKLDFIYEDELKFFVETGGLSELIVAFSREGTTKEYVQHKMAEKASDIWNIISQGGYIYV  658

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIVQEQ  +DSSK E++VK LQM GRYLRDVW
Sbjct  659  CGDAKGMARDVHRTLHTIVQEQGSLDSSKTESMVKSLQMEGRYLRDVW  706



>gb|EMS66177.1| NADPH--cytochrome P450 reductase [Triticum urartu]
Length=676

 Score =   175 bits (443),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 77/108 (71%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MDFIYE+EL NF + G +SEL+VAFSREGP K+YVQHK+ E+A+++WS++SQ GY+YV
Sbjct  539  RQMDFIYEDELNNFAESGALSELVVAFSREGPTKEYVQHKMAEKAAELWSIVSQGGYVYV  598

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHR LHTIVQEQ  +DSSK E+ VK LQ  GRYLRDVW
Sbjct  599  CGDAKGMARDVHRALHTIVQEQGSLDSSKTESYVKNLQTEGRYLRDVW  646



>ref|XP_010265447.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Nelumbo nucifera]
Length=704

 Score =   175 bits (443),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MD+IYEEEL  F   G +SEL++AFSREGP K+YVQHK+ E+AS VW++IS  GY+YV
Sbjct  597  RKMDYIYEEELNGFVASGAMSELVIAFSREGPTKEYVQHKMMEKASDVWNMISNGGYIYV  656

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIVQ+Q  +DSSKAE++VK LQM GRYLRDVW
Sbjct  657  CGDAKGMARDVHRTLHTIVQQQGSLDSSKAESMVKNLQMEGRYLRDVW  704



>ref|XP_003578634.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Brachypodium 
distachyon]
Length=697

 Score =   175 bits (443),  Expect = 6e-47, Method: Composition-based stats.
 Identities = 76/108 (70%), Positives = 91/108 (84%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MDFIYE+EL NF D G +SELIVAFSR+GP K+YVQHK+  +A ++WS+ISQ GY+YV
Sbjct  590  RKMDFIYEDELNNFADAGALSELIVAFSRDGPTKEYVQHKMAAKAPELWSIISQGGYIYV  649

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHR LHTIVQ Q  +D+SK E+ +K LQM GRYLRDVW
Sbjct  650  CGDAKGMARDVHRVLHTIVQGQGSLDNSKTESYMKNLQMEGRYLRDVW  697



>emb|CDP02981.1| unnamed protein product [Coffea canephora]
Length=662

 Score =   174 bits (442),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MD+IYE+EL +F   G +SELIVAFSREGP K YVQHK+ E+AS +WS++S+  Y+YV
Sbjct  555  RQMDYIYEDELNHFAKSGALSELIVAFSREGPTKQYVQHKMAEKASDIWSMLSEGAYVYV  614

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIVQEQ  +DSSKAE+ VK LQM+GRYLRDVW
Sbjct  615  CGDAKGMARDVHRTLHTIVQEQGSMDSSKAESFVKNLQMSGRYLRDVW  662



>ref|XP_004960247.1| PREDICTED: NADPH--cytochrome P450 reductase-like isoform X2 [Setaria 
italica]
Length=694

 Score =   174 bits (442),  Expect = 6e-47, Method: Composition-based stats.
 Identities = 77/106 (73%), Positives = 93/106 (88%), Gaps = 0/106 (0%)
 Frame = -3

Query  672  MDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYVCG  493
            +D+IYE+EL+NF  +G +SELIVAFSREGP K+YVQHK+ E+A+++W++ISQ GYLYVCG
Sbjct  589  VDYIYEDELQNFLQEGALSELIVAFSREGPTKEYVQHKMVEKATEIWNIISQGGYLYVCG  648

Query  492  DAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            DAKGMARDVHR LHTIVQEQ  +DSSK E+ VK LQM GRYLRDVW
Sbjct  649  DAKGMARDVHRVLHTIVQEQGSLDSSKTESYVKSLQMEGRYLRDVW  694



>ref|XP_003579401.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Brachypodium 
distachyon]
Length=692

 Score =   174 bits (442),  Expect = 6e-47, Method: Composition-based stats.
 Identities = 75/108 (69%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R MD+IYE+EL+NF  +G +SEL+VA+SREGP K+YVQHK+ E+A+++W++ISQ GY+YV
Sbjct  585  RNMDYIYEDELQNFLQEGALSELVVAYSREGPTKEYVQHKMVEKATEIWNIISQGGYVYV  644

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHR LHTIVQEQ  +D+SK E+ VK LQM GRYLRDVW
Sbjct  645  CGDAKGMARDVHRVLHTIVQEQGSLDNSKTESYVKSLQMEGRYLRDVW  692



>gb|KDO43871.1| hypothetical protein CISIN_1g005072mg [Citrus sinensis]
Length=714

 Score =   174 bits (442),  Expect = 7e-47, Method: Composition-based stats.
 Identities = 76/108 (70%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MD+IYE+EL NF   G +S+LIVAFSREGP K+YVQHK+ E++S +W+++S+  YLYV
Sbjct  607  RKMDYIYEDELNNFVQSGALSQLIVAFSREGPTKEYVQHKMMEKSSDIWNMLSEGAYLYV  666

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAK MARDVHRTLHTIVQEQ  +DSSKAE++VK LQM GRYLRDVW
Sbjct  667  CGDAKSMARDVHRTLHTIVQEQGSLDSSKAESMVKNLQMTGRYLRDVW  714



>ref|XP_007227446.1| hypothetical protein PRUPE_ppa002142mg [Prunus persica]
 gb|EMJ28645.1| hypothetical protein PRUPE_ppa002142mg [Prunus persica]
Length=710

 Score =   174 bits (442),  Expect = 7e-47, Method: Composition-based stats.
 Identities = 75/107 (70%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -3

Query  675  RMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYVC  496
            + D+IYE+EL NF + G +SEL+VAFSR+GP K+YVQHK+T++AS +W+++SQ  Y+YVC
Sbjct  604  KTDYIYEDELNNFLETGALSELVVAFSRQGPTKEYVQHKMTQKASDIWNMLSQGAYIYVC  663

Query  495  GDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            GDAKGMARDVHRTLHTIVQEQ  +DSSKAE++VK LQM+GRYLRDVW
Sbjct  664  GDAKGMARDVHRTLHTIVQEQGSLDSSKAESMVKNLQMSGRYLRDVW  710



>gb|KJB22140.1| hypothetical protein B456_004G0316002, partial [Gossypium raimondii]
Length=398

 Score =   171 bits (432),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 92/108 (85%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MD+IYE+EL NF + G +SEL+VAFSREGP K+YVQHK+ E+AS +W++IS+ GYLYV
Sbjct  291  RKMDYIYEDELNNFVNSGALSELVVAFSREGPTKEYVQHKMMEKASDIWNMISEGGYLYV  350

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTL TI+ EQ  +DSSKAE++VK L   GRYLRDVW
Sbjct  351  CGDAKGMARDVHRTLLTILHEQGCLDSSKAESMVKNLHTTGRYLRDVW  398



>gb|KDO43870.1| hypothetical protein CISIN_1g005072mg [Citrus sinensis]
Length=687

 Score =   174 bits (442),  Expect = 7e-47, Method: Composition-based stats.
 Identities = 76/108 (70%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MD+IYE+EL NF   G +S+LIVAFSREGP K+YVQHK+ E++S +W+++S+  YLYV
Sbjct  580  RKMDYIYEDELNNFVQSGALSQLIVAFSREGPTKEYVQHKMMEKSSDIWNMLSEGAYLYV  639

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAK MARDVHRTLHTIVQEQ  +DSSKAE++VK LQM GRYLRDVW
Sbjct  640  CGDAKSMARDVHRTLHTIVQEQGSLDSSKAESMVKNLQMTGRYLRDVW  687



>gb|KDO43868.1| hypothetical protein CISIN_1g005072mg [Citrus sinensis]
Length=715

 Score =   174 bits (442),  Expect = 8e-47, Method: Composition-based stats.
 Identities = 76/108 (70%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MD+IYE+EL NF   G +S+LIVAFSREGP K+YVQHK+ E++S +W+++S+  YLYV
Sbjct  608  RKMDYIYEDELNNFVQSGALSQLIVAFSREGPTKEYVQHKMMEKSSDIWNMLSEGAYLYV  667

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAK MARDVHRTLHTIVQEQ  +DSSKAE++VK LQM GRYLRDVW
Sbjct  668  CGDAKSMARDVHRTLHTIVQEQGSLDSSKAESMVKNLQMTGRYLRDVW  715



>ref|XP_009108997.1| PREDICTED: NADPH--cytochrome P450 reductase 2 [Brassica rapa]
Length=707

 Score =   174 bits (442),  Expect = 8e-47, Method: Composition-based stats.
 Identities = 78/108 (72%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYEEEL+ F + G +SEL VAFSREGP K+YVQHK+ ++A  +WS+ISQ GY+YV
Sbjct  600  RRMDFIYEEELQRFLESGALSELSVAFSREGPTKEYVQHKMMDKACDIWSMISQGGYVYV  659

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHR+LHTI QEQ  +DS+KAE+ VK LQM+GRYLRDVW
Sbjct  660  CGDAKGMARDVHRSLHTIAQEQGSMDSTKAESFVKNLQMSGRYLRDVW  707



>ref|XP_008223694.1| PREDICTED: NADPH--cytochrome P450 reductase 2 [Prunus mume]
Length=710

 Score =   174 bits (442),  Expect = 8e-47, Method: Composition-based stats.
 Identities = 75/107 (70%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -3

Query  675  RMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYVC  496
            + D+IYE+EL NF + G +SEL+VAFSR+GP K+YVQHK+T++AS +W+++SQ  Y+YVC
Sbjct  604  KTDYIYEDELNNFLETGALSELVVAFSRQGPTKEYVQHKMTQKASDIWNMLSQGAYIYVC  663

Query  495  GDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            GDAKGMARDVHRTLHTIVQEQ  +DSSKAE++VK LQM+GRYLRDVW
Sbjct  664  GDAKGMARDVHRTLHTIVQEQGSLDSSKAESMVKNLQMSGRYLRDVW  710



>gb|KDO43869.1| hypothetical protein CISIN_1g005072mg [Citrus sinensis]
Length=710

 Score =   174 bits (442),  Expect = 8e-47, Method: Composition-based stats.
 Identities = 76/108 (70%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MD+IYE+EL NF   G +S+LIVAFSREGP K+YVQHK+ E++S +W+++S+  YLYV
Sbjct  603  RKMDYIYEDELNNFVQSGALSQLIVAFSREGPTKEYVQHKMMEKSSDIWNMLSEGAYLYV  662

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAK MARDVHRTLHTIVQEQ  +DSSKAE++VK LQM GRYLRDVW
Sbjct  663  CGDAKSMARDVHRTLHTIVQEQGSLDSSKAESMVKNLQMTGRYLRDVW  710



>ref|XP_003541616.1| PREDICTED: NADPH--cytochrome P450 reductase [Glycine max]
Length=707

 Score =   174 bits (442),  Expect = 8e-47, Method: Composition-based stats.
 Identities = 76/108 (70%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MD+IYE+EL +F + G +SELI+AFSREGP K+YVQHK+ E+AS++WS+ISQ  Y+YV
Sbjct  600  RQMDYIYEDELNHFVNTGALSELILAFSREGPTKEYVQHKMMEKASEIWSMISQGAYIYV  659

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHR LHTI+QEQ  +DSSKAE++VK LQ  GRYLRDVW
Sbjct  660  CGDAKGMARDVHRALHTILQEQGSLDSSKAESMVKNLQTTGRYLRDVW  707



>ref|XP_008383106.1| PREDICTED: NADPH--cytochrome P450 reductase isoform X2 [Malus 
domestica]
Length=708

 Score =   174 bits (441),  Expect = 9e-47, Method: Composition-based stats.
 Identities = 77/107 (72%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -3

Query  675  RMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYVC  496
            +MD+IYE+EL NF +   +SEL+VAFSR+GP K+YVQHK+ ++AS VW++ISQ GY+YVC
Sbjct  602  KMDYIYEDELNNFLETSALSELVVAFSRQGPTKEYVQHKMIQKASDVWNMISQGGYIYVC  661

Query  495  GDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            GDAKGMARDVHRTLHTIVQEQ  + SSKAE++VK LQMNGRYLRDVW
Sbjct  662  GDAKGMARDVHRTLHTIVQEQGCMGSSKAESLVKNLQMNGRYLRDVW  708



>ref|XP_008383105.1| PREDICTED: NADPH--cytochrome P450 reductase isoform X1 [Malus 
domestica]
Length=709

 Score =   174 bits (441),  Expect = 9e-47, Method: Composition-based stats.
 Identities = 77/107 (72%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -3

Query  675  RMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYVC  496
            +MD+IYE+EL NF +   +SEL+VAFSR+GP K+YVQHK+ ++AS VW++ISQ GY+YVC
Sbjct  603  KMDYIYEDELNNFLETSALSELVVAFSRQGPTKEYVQHKMIQKASDVWNMISQGGYIYVC  662

Query  495  GDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            GDAKGMARDVHRTLHTIVQEQ  + SSKAE++VK LQMNGRYLRDVW
Sbjct  663  GDAKGMARDVHRTLHTIVQEQGCMGSSKAESLVKNLQMNGRYLRDVW  709



>emb|CDY14183.1| BnaA08g13140D [Brassica napus]
Length=696

 Score =   174 bits (441),  Expect = 9e-47, Method: Composition-based stats.
 Identities = 78/108 (72%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYEEEL+ F + G +SEL VAFSREGP K+YVQHK+ ++A  +WS+ISQ GY+YV
Sbjct  589  RRMDFIYEEELQRFLESGALSELSVAFSREGPTKEYVQHKMMDKACDIWSMISQGGYVYV  648

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHR+LHTI QEQ  +DS+KAE+ VK LQM+GRYLRDVW
Sbjct  649  CGDAKGMARDVHRSLHTIAQEQGSMDSTKAESFVKNLQMSGRYLRDVW  696



>ref|XP_002447240.1| hypothetical protein SORBIDRAFT_06g031110 [Sorghum bicolor]
 gb|EES11568.1| hypothetical protein SORBIDRAFT_06g031110 [Sorghum bicolor]
Length=694

 Score =   174 bits (441),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 76/108 (70%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R MD+IYE+EL+ F ++G +SELI+AFSREGP K+YVQHK+ E+A+++W++IS  GYLYV
Sbjct  587  RNMDYIYEDELQTFLEEGALSELIIAFSREGPTKEYVQHKMVEKATEIWNIISHGGYLYV  646

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHR LHTIVQEQ  +DSSK E+ VK LQM GRYLRDVW
Sbjct  647  CGDAKGMARDVHRMLHTIVQEQGSLDSSKTESYVKSLQMEGRYLRDVW  694



>ref|XP_010259920.1| PREDICTED: NADPH--cytochrome P450 reductase [Nelumbo nucifera]
Length=705

 Score =   174 bits (441),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 74/108 (69%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MD+IYE+EL  + + G++SE +VAFSREGP K+YVQHK+ E+AS VW++IS+ GY+YV
Sbjct  598  RKMDYIYEDELNGYVNSGVLSEFVVAFSREGPTKEYVQHKMMEKASNVWNIISKGGYIYV  657

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLH IVQEQ  +DSS+AE+++K LQM GRYLRDVW
Sbjct  658  CGDAKGMARDVHRTLHAIVQEQGSLDSSQAESMIKNLQMEGRYLRDVW  705



>gb|AFW59699.1| hypothetical protein ZEAMMB73_961001 [Zea mays]
Length=509

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 76/108 (70%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R MD+IYE+EL+ F ++G +SELIVAFSREGP K+YVQHK+ E+A+++W++IS  GYLYV
Sbjct  402  RNMDYIYEDELQTFLEEGALSELIVAFSREGPTKEYVQHKMVEKATEIWNIISHGGYLYV  461

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHR LHT+VQEQ  +DSSK E+ VK LQM GRYLRDVW
Sbjct  462  CGDAKGMARDVHRMLHTVVQEQGSLDSSKTESYVKSLQMEGRYLRDVW  509



>ref|XP_010447751.1| PREDICTED: NADPH--cytochrome P450 reductase 2-like [Camelina 
sativa]
Length=710

 Score =   174 bits (441),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/108 (71%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYEEEL+ F + G ++ELIVAFSREGP K+YVQHK+ ++AS +W++ISQ  Y+YV
Sbjct  603  RRMDFIYEEELQRFVESGALAELIVAFSREGPTKEYVQHKMMDKASDIWNMISQGAYVYV  662

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHR+LHTI QEQ  +DS+KAE  VK LQM+GRYLRDVW
Sbjct  663  CGDAKGMARDVHRSLHTIAQEQGSMDSTKAEGFVKNLQMSGRYLRDVW  710



>ref|XP_010438203.1| PREDICTED: NADPH--cytochrome P450 reductase 2 [Camelina sativa]
Length=709

 Score =   174 bits (441),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/108 (71%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYEEEL+ F + G ++ELIVAFSREGP K+YVQHK+ ++AS +W++ISQ  Y+YV
Sbjct  602  RRMDFIYEEELQRFVESGALAELIVAFSREGPTKEYVQHKMMDKASDIWNMISQGAYVYV  661

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHR+LHTI QEQ  +DS+KAE  VK LQM+GRYLRDVW
Sbjct  662  CGDAKGMARDVHRSLHTIAQEQGSMDSTKAEGFVKNLQMSGRYLRDVW  709



>ref|XP_006845640.1| hypothetical protein AMTR_s00019p00222550 [Amborella trichopoda]
 gb|ERN07315.1| hypothetical protein AMTR_s00019p00222550 [Amborella trichopoda]
Length=711

 Score =   174 bits (441),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 78/106 (74%), Positives = 93/106 (88%), Gaps = 0/106 (0%)
 Frame = -3

Query  675  RMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYVC  496
            RMDFIYE+EL NF +QG++SELI+AFSREGP K+YVQHK+ ++AS +W +IS+ GYLYVC
Sbjct  602  RMDFIYEDELNNFVEQGVLSELIIAFSREGPTKEYVQHKMIDKASSLWEIISRGGYLYVC  661

Query  495  GDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDV  358
            GDAKGMARDVHRTLHTIVQEQ  ++SS AEA+VK LQ  GRYLRDV
Sbjct  662  GDAKGMARDVHRTLHTIVQEQGSMESSPAEAMVKNLQTEGRYLRDV  707



>emb|CAA81210.1| NADPH-ferrihemoprotein reductase [Helianthus tuberosus]
Length=506

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 91/108 (84%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R++DFIYE+EL NF + G +SELIVAFSREGP K+YVQHK+ E+AS +W L+S+  YLYV
Sbjct  399  RKVDFIYEDELNNFVETGALSELIVAFSREGPTKEYVQHKMNEKASDLWKLLSEGAYLYV  458

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMA+DVHRTLHTIVQEQ  +DSSKAE  VK LQ  GRYLRDVW
Sbjct  459  CGDAKGMAKDVHRTLHTIVQEQGSLDSSKAELFVKNLQCRGRYLRDVW  506



>ref|XP_006453369.1| hypothetical protein CICLE_v10007535mg [Citrus clementina]
 gb|ESR66609.1| hypothetical protein CICLE_v10007535mg [Citrus clementina]
Length=763

 Score =   174 bits (441),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 76/108 (70%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MD+IYE+EL NF   G +S+LIVAFSREGP K+YVQHK+ E++  +W+++S+  YLYV
Sbjct  656  RKMDYIYEDELNNFVQSGALSQLIVAFSREGPIKEYVQHKMMEKSWDIWNMLSEGAYLYV  715

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIVQEQ  +DSSKAE++VK LQM GRYLRDVW
Sbjct  716  CGDAKGMARDVHRTLHTIVQEQGSLDSSKAESMVKNLQMTGRYLRDVW  763



>ref|XP_009130253.1| PREDICTED: NADPH--cytochrome P450 reductase 2-like [Brassica 
rapa]
Length=681

 Score =   174 bits (440),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 77/108 (71%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYEEEL+ F + G +SEL VAFSREGP K+YVQHK+ ++AS +WS+ISQ  Y+YV
Sbjct  574  RRMDFIYEEELQRFLESGALSELSVAFSREGPTKEYVQHKMMDKASDIWSMISQGAYVYV  633

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHR+LHTI QEQ  +DS+KAE+ VK LQM+GRY+RDVW
Sbjct  634  CGDAKGMARDVHRSLHTIAQEQGSMDSTKAESFVKNLQMSGRYIRDVW  681



>ref|XP_006453370.1| hypothetical protein CICLE_v10007535mg [Citrus clementina]
 gb|ESR66610.1| hypothetical protein CICLE_v10007535mg [Citrus clementina]
Length=764

 Score =   174 bits (441),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 76/108 (70%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MD+IYE+EL NF   G +S+LIVAFSREGP K+YVQHK+ E++  +W+++S+  YLYV
Sbjct  657  RKMDYIYEDELNNFVQSGALSQLIVAFSREGPIKEYVQHKMMEKSWDIWNMLSEGAYLYV  716

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIVQEQ  +DSSKAE++VK LQM GRYLRDVW
Sbjct  717  CGDAKGMARDVHRTLHTIVQEQGSLDSSKAESMVKNLQMTGRYLRDVW  764



>gb|KHN22700.1| NADPH--cytochrome P450 reductase [Glycine soja]
Length=707

 Score =   174 bits (440),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 76/108 (70%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MD+IYE+EL +F + G +SELI+AFSREGP K+YVQHK+ E+AS++WS+ISQ  Y+YV
Sbjct  600  RQMDYIYEDELNHFVNTGALSELILAFSREGPTKEYVQHKMMEKASEIWSMISQGAYIYV  659

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHR LHTI+QEQ  +DSSKAE++VK LQ  GRYLRDVW
Sbjct  660  CGDAKGMARDVHRALHTILQEQGALDSSKAESMVKNLQTTGRYLRDVW  707



>gb|KDO43874.1| hypothetical protein CISIN_1g005072mg [Citrus sinensis]
Length=555

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 76/108 (70%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MD+IYE+EL NF   G +S+LIVAFSREGP K+YVQHK+ E++S +W+++S+  YLYV
Sbjct  448  RKMDYIYEDELNNFVQSGALSQLIVAFSREGPTKEYVQHKMMEKSSDIWNMLSEGAYLYV  507

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAK MARDVHRTLHTIVQEQ  +DSSKAE++VK LQM GRYLRDVW
Sbjct  508  CGDAKSMARDVHRTLHTIVQEQGSLDSSKAESMVKNLQMTGRYLRDVW  555



>emb|CBX24555.1| NADPH:cytochrome P450 reductase [Salvia miltiorrhiza]
Length=705

 Score =   174 bits (440),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 77/108 (71%), Positives = 90/108 (83%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MDFIYE+EL +F   G ISELIVAFSREGP K+YVQHK+++RAS +W +IS  GY+YV
Sbjct  598  RKMDFIYEDELNSFVKVGAISELIVAFSREGPAKEYVQHKMSQRASDIWKMISDGGYMYV  657

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTI QEQ  + SS+AE +VK LQ  GRYLRDVW
Sbjct  658  CGDAKGMARDVHRTLHTIAQEQGSLSSSEAEGMVKNLQTTGRYLRDVW  705



>gb|KDO43875.1| hypothetical protein CISIN_1g005072mg [Citrus sinensis]
Length=554

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 76/108 (70%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MD+IYE+EL NF   G +S+LIVAFSREGP K+YVQHK+ E++S +W+++S+  YLYV
Sbjct  447  RKMDYIYEDELNNFVQSGALSQLIVAFSREGPTKEYVQHKMMEKSSDIWNMLSEGAYLYV  506

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAK MARDVHRTLHTIVQEQ  +DSSKAE++VK LQM GRYLRDVW
Sbjct  507  CGDAKSMARDVHRTLHTIVQEQGSLDSSKAESMVKNLQMTGRYLRDVW  554



>ref|XP_006474186.1| PREDICTED: NADPH--cytochrome P450 reductase-like isoform X2 [Citrus 
sinensis]
Length=714

 Score =   173 bits (439),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 76/108 (70%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MD+IYE+EL NF   G +S+LIVAFSREGP K+YVQHK+ E++  +W+++S+  YLYV
Sbjct  607  RKMDYIYEDELNNFVQSGALSQLIVAFSREGPIKEYVQHKMMEKSWDIWNMLSEGAYLYV  666

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIVQEQ  +DSSKAE++VK LQM GRYLRDVW
Sbjct  667  CGDAKGMARDVHRTLHTIVQEQGSLDSSKAESMVKNLQMTGRYLRDVW  714



>gb|AHB33950.1| cytochrome P450 reductase [Santalum album]
Length=704

 Score =   173 bits (439),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 75/108 (69%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MD+IYE+EL +F + G +SELIVAFSREGP K YVQHK+ E+AS++W++IS  GY+YV
Sbjct  597  RKMDYIYEDELAHFVEAGALSELIVAFSREGPAKQYVQHKMMEKASEIWNMISDGGYVYV  656

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMA+DVHR LHTIV EQ  +D+SK E++VK LQMNGRYLRDVW
Sbjct  657  CGDAKGMAKDVHRALHTIVHEQGSLDNSKTESMVKNLQMNGRYLRDVW  704



>ref|XP_006474185.1| PREDICTED: NADPH--cytochrome P450 reductase-like isoform X1 [Citrus 
sinensis]
Length=715

 Score =   173 bits (439),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 76/108 (70%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MD+IYE+EL NF   G +S+LIVAFSREGP K+YVQHK+ E++  +W+++S+  YLYV
Sbjct  608  RKMDYIYEDELNNFVQSGALSQLIVAFSREGPIKEYVQHKMMEKSWDIWNMLSEGAYLYV  667

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTIVQEQ  +DSSKAE++VK LQM GRYLRDVW
Sbjct  668  CGDAKGMARDVHRTLHTIVQEQGSLDSSKAESMVKNLQMTGRYLRDVW  715



>emb|CDX68634.1| BnaC01g08190D [Brassica napus]
Length=712

 Score =   173 bits (439),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 76/108 (70%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYEEEL+ F + G +SEL VAFSREGP K+YVQHK+ ++AS++W++IS+  Y+YV
Sbjct  605  RRMDFIYEEELQGFLESGALSELSVAFSREGPTKEYVQHKMMDKASEIWNMISEGAYVYV  664

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHR+LHTI QEQ  +DS+KAE+ VK LQM+GRYLRDVW
Sbjct  665  CGDAKGMARDVHRSLHTIAQEQGSMDSTKAESFVKNLQMSGRYLRDVW  712



>ref|XP_010929254.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Elaeis guineensis]
Length=704

 Score =   173 bits (439),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 78/108 (72%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MDFIYE+EL NF + G +SELIVAFSREGP K+YVQHK+ E+A  +W +IS+ G++YV
Sbjct  597  RKMDFIYEDELSNFVNTGALSELIVAFSREGPAKEYVQHKMAEKAVVIWDIISKGGHIYV  656

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHR LHTIVQEQ  +DSSKAE++VK LQM GRYLRDVW
Sbjct  657  CGDAKGMARDVHRVLHTIVQEQGSLDSSKAESMVKNLQMEGRYLRDVW  704



>emb|CDY03543.1| BnaC03g68020D [Brassica napus]
Length=710

 Score =   173 bits (439),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 92/108 (85%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYEEEL+ F + G +SEL VAFSREGP K+YVQHK+ ++A  +WS+ISQ GY+YV
Sbjct  603  RRMDFIYEEELQRFLESGALSELSVAFSREGPTKEYVQHKMMDKACDIWSMISQGGYVYV  662

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHR LHTI QEQ  +DS+KAE+ VK LQM+GRYLRDVW
Sbjct  663  CGDAKGMARDVHRYLHTIAQEQGSMDSTKAESFVKNLQMSGRYLRDVW  710



>ref|XP_006283224.1| hypothetical protein CARUB_v10004254mg [Capsella rubella]
 gb|EOA16122.1| hypothetical protein CARUB_v10004254mg [Capsella rubella]
Length=710

 Score =   173 bits (438),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 77/108 (71%), Positives = 92/108 (85%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYEEEL+ F + G ++EL VAFSREGP K+YVQHK+ +RAS +W++ISQ  Y+YV
Sbjct  603  RRMDFIYEEELQRFVESGALAELSVAFSREGPTKEYVQHKMMDRASDIWNMISQGAYVYV  662

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHR+LHTI QEQ  +DS+KAE  VK LQM+GRYLRDVW
Sbjct  663  CGDAKGMARDVHRSLHTIAQEQGSMDSTKAEGFVKNLQMSGRYLRDVW  710



>ref|XP_010548619.1| PREDICTED: NADPH--cytochrome P450 reductase 2-like [Tarenaya 
hassleriana]
Length=714

 Score =   173 bits (438),  Expect = 3e-46, Method: Composition-based stats.
 Identities = 77/108 (71%), Positives = 92/108 (85%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYE+EL+ F + G +SEL+VAFSREGP K+YVQHK+ ++AS +W++ISQ  YLYV
Sbjct  607  RRMDFIYEDELQRFVESGALSELVVAFSREGPTKEYVQHKMIDKASDIWNMISQGAYLYV  666

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHR LHTIVQEQ  +D SKAE+ VK LQ +GRYLRDVW
Sbjct  667  CGDAKGMARDVHRALHTIVQEQGSMDGSKAESFVKNLQTSGRYLRDVW  714



>dbj|BAD05443.1| putative cytochrome P450 reductase [Oryza sativa Japonica Group]
 dbj|BAD05639.1| putative cytochrome P450 reductase [Oryza sativa Japonica Group]
Length=568

 Score =   172 bits (435),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -3

Query  675  RMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYVC  496
            +MDFIYE+EL  F ++G +SEL++AFSREGP K+YVQHK++++AS++W +ISQ GY+YVC
Sbjct  462  KMDFIYEDELNTFLEEGALSELVLAFSREGPTKEYVQHKMSQKASEIWDMISQGGYIYVC  521

Query  495  GDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            GDAKGMARDVHR LHTIVQEQ  +DSSKAE+ VK LQ  GRYLRDVW
Sbjct  522  GDAKGMARDVHRVLHTIVQEQGSLDSSKAESFVKSLQTEGRYLRDVW  568



>gb|EEE70211.1| hypothetical protein OsJ_30318 [Oryza sativa Japonica Group]
Length=795

 Score =   173 bits (439),  Expect = 3e-46, Method: Composition-based stats.
 Identities = 77/106 (73%), Positives = 91/106 (86%), Gaps = 0/106 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MDFIYE+EL NF + G +SELIVAFSREGP K+YVQHK+ E+A ++WS+ISQ GY+YV
Sbjct  632  RKMDFIYEDELNNFVETGALSELIVAFSREGPSKEYVQHKMAEKAPEIWSIISQGGYIYV  691

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRD  361
            CGDAKGMARDVHRTLHTIVQEQ  +D+S  E+ VK LQM GRYLRD
Sbjct  692  CGDAKGMARDVHRTLHTIVQEQGSLDNSNTESYVKSLQMEGRYLRD  737



>gb|EYU42400.1| hypothetical protein MIMGU_mgv1a002170mg [Erythranthe guttata]
Length=705

 Score =   172 bits (437),  Expect = 3e-46, Method: Composition-based stats.
 Identities = 74/107 (69%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -3

Query  675  RMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYVC  496
            +MDFIY++EL NF + G+ISEL +AFSR+GP K+YVQHK+ ++A+ VW++IS+ GY+YVC
Sbjct  599  KMDFIYQDELSNFVEAGVISELDLAFSRDGPTKEYVQHKMAQKAADVWNMISEGGYVYVC  658

Query  495  GDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            GDAKGMARDVHRTLH IVQEQ  +D+SK E+ VK LQMNGRYLRDVW
Sbjct  659  GDAKGMARDVHRTLHAIVQEQGSLDNSKTESFVKNLQMNGRYLRDVW  705



>ref|XP_004242931.1| PREDICTED: NADPH--cytochrome P450 reductase [Solanum lycopersicum]
Length=715

 Score =   172 bits (437),  Expect = 4e-46, Method: Composition-based stats.
 Identities = 74/108 (69%), Positives = 92/108 (85%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MD+IY++EL NF + G +S L+VAFSREGP K+YVQHK+T++A  +W++ISQ GY+YV
Sbjct  608  RQMDYIYQDELDNFLEAGALSNLVVAFSREGPNKEYVQHKMTQKADDIWNMISQGGYVYV  667

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTI Q+Q  +DSSKAE+ VK LQ  GRYLRDVW
Sbjct  668  CGDAKGMARDVHRTLHTIAQDQGSLDSSKAESFVKNLQTTGRYLRDVW  715



>gb|AAC05021.1| NADPH:ferrihemoprotein oxidoreductase [Papaver somniferum]
 gb|AHF27398.1| NADPH:ferrihemoprotein oxidoreductase [synthetic construct]
Length=683

 Score =   172 bits (436),  Expect = 4e-46, Method: Composition-based stats.
 Identities = 77/108 (71%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R MDFIYE+EL NF ++G+ISEL++AFSREG +K+YVQHK+ E+A+ VW++IS +GYLYV
Sbjct  576  RNMDFIYEDELNNFVERGVISELVIAFSREGEKKEYVQHKMMEKATDVWNVISGDGYLYV  635

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTI QEQ  ++SS AEA VKKLQ+  RYLRDVW
Sbjct  636  CGDAKGMARDVHRTLHTIAQEQGPMESSAAEAAVKKLQVEERYLRDVW  683



>ref|XP_010433014.1| PREDICTED: NADPH--cytochrome P450 reductase 2-like [Camelina 
sativa]
Length=709

 Score =   172 bits (437),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 76/108 (70%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYEEEL+ F + G ++ELIVAFSREGP K+YVQHK+ ++AS +W++IS+  Y+YV
Sbjct  602  RRMDFIYEEELQRFVESGALAELIVAFSREGPTKEYVQHKMMDKASDIWNMISRGAYVYV  661

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHR+LHTI QEQ  +DS+KAE  VK LQM+GRYLRDVW
Sbjct  662  CGDAKGMARDVHRSLHTIAQEQGSMDSTKAEGFVKNLQMSGRYLRDVW  709



>ref|NP_001061346.1| Os08g0243500, partial [Oryza sativa Japonica Group]
 dbj|BAF23260.1| Os08g0243500, partial [Oryza sativa Japonica Group]
Length=651

 Score =   172 bits (435),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -3

Query  675  RMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYVC  496
            +MDFIYE+EL  F ++G +SEL++AFSREGP K+YVQHK++++AS++W +ISQ GY+YVC
Sbjct  545  KMDFIYEDELNTFLEEGALSELVLAFSREGPTKEYVQHKMSQKASEIWDMISQGGYIYVC  604

Query  495  GDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            GDAKGMARDVHR LHTIVQEQ  +DSSKAE+ VK LQ  GRYLRDVW
Sbjct  605  GDAKGMARDVHRVLHTIVQEQGSLDSSKAESFVKSLQTEGRYLRDVW  651



>ref|XP_008667833.1| PREDICTED: uncharacterized protein LOC100279923 isoform X1 [Zea 
mays]
 tpg|DAA35631.1| TPA: hypothetical protein ZEAMMB73_666259 [Zea mays]
Length=695

 Score =   172 bits (435),  Expect = 5e-46, Method: Composition-based stats.
 Identities = 75/108 (69%), Positives = 92/108 (85%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R MD+IYE+EL+ F ++G +SELIVAFSREGP K+YVQHK+ E+A+ +W++IS  GYLYV
Sbjct  588  RNMDYIYEDELQTFLEEGALSELIVAFSREGPTKEYVQHKMVEKATDIWNIISNGGYLYV  647

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVH+ LHTIVQEQ  +D+SK E+ VK LQM GRYLRDVW
Sbjct  648  CGDAKGMARDVHKMLHTIVQEQGSLDNSKTESYVKSLQMEGRYLRDVW  695



>emb|CDX72222.1| BnaC07g42440D [Brassica napus]
Length=708

 Score =   172 bits (436),  Expect = 6e-46, Method: Composition-based stats.
 Identities = 76/108 (70%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYEEEL+ F + G +SEL VAFSREGP K+YVQHK+ ++AS +W++IS+  Y+YV
Sbjct  601  RRMDFIYEEELQRFLESGALSELSVAFSREGPTKEYVQHKMMDKASDIWNMISEGAYVYV  660

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHR+LHTI QEQ  +DS+KAE+ VK LQM+GRYLRDVW
Sbjct  661  CGDAKGMARDVHRSLHTIAQEQGSMDSTKAESFVKNLQMSGRYLRDVW  708



>ref|XP_008667834.1| PREDICTED: uncharacterized protein LOC100279923 isoform X2 [Zea 
mays]
 tpg|DAA35632.1| TPA: hypothetical protein ZEAMMB73_666259 [Zea mays]
Length=694

 Score =   172 bits (435),  Expect = 6e-46, Method: Composition-based stats.
 Identities = 75/108 (69%), Positives = 92/108 (85%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R MD+IYE+EL+ F ++G +SELIVAFSREGP K+YVQHK+ E+A+ +W++IS  GYLYV
Sbjct  587  RNMDYIYEDELQTFLEEGALSELIVAFSREGPTKEYVQHKMVEKATDIWNIISNGGYLYV  646

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVH+ LHTIVQEQ  +D+SK E+ VK LQM GRYLRDVW
Sbjct  647  CGDAKGMARDVHKMLHTIVQEQGSLDNSKTESYVKSLQMEGRYLRDVW  694



>emb|CDY51656.1| BnaAnng10960D [Brassica napus]
Length=706

 Score =   172 bits (435),  Expect = 6e-46, Method: Composition-based stats.
 Identities = 76/108 (70%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYEEEL+ F + G +SEL VAFSREGP K+YVQHK+ ++AS +W++IS+  Y+YV
Sbjct  599  RRMDFIYEEELQRFLESGALSELSVAFSREGPTKEYVQHKMMDKASDIWNMISEGAYVYV  658

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHR+LHTI QEQ  +DS+KAE+ VK LQM+GRYLRDVW
Sbjct  659  CGDAKGMARDVHRSLHTIAQEQGSMDSTKAESFVKNLQMSGRYLRDVW  706



>ref|XP_003549436.1| PREDICTED: NADPH--cytochrome P450 reductase [Glycine max]
Length=707

 Score =   172 bits (435),  Expect = 8e-46, Method: Composition-based stats.
 Identities = 75/108 (69%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MD+IYE+EL +F + G + ELI+AFSREGP K+YVQHK+ E+AS++WS+ISQ  Y+YV
Sbjct  600  RQMDYIYEDELSHFVNTGALDELILAFSREGPTKEYVQHKMMEKASEIWSMISQGAYIYV  659

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHR LHTI+QEQ  +DSSKAE++VK LQ  GRYLRDVW
Sbjct  660  CGDAKGMARDVHRALHTILQEQGSLDSSKAESMVKNLQTTGRYLRDVW  707



>ref|XP_006412733.1| hypothetical protein EUTSA_v10024546mg [Eutrema salsugineum]
 gb|ESQ54186.1| hypothetical protein EUTSA_v10024546mg [Eutrema salsugineum]
Length=711

 Score =   171 bits (434),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 76/108 (70%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYEEEL+ F + G +SEL +AFSREGP K+YVQHK+ ++AS +WS+IS+  Y+YV
Sbjct  604  RRMDFIYEEELQRFLESGALSELSLAFSREGPTKEYVQHKMMDKASDIWSMISEGAYVYV  663

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHR+LHTI QEQ  +DS+KAE+ VK LQM+GRYLRDVW
Sbjct  664  CGDAKGMARDVHRSLHTIAQEQGPMDSTKAESFVKNLQMSGRYLRDVW  711



>dbj|BAJ33878.1| unnamed protein product [Thellungiella halophila]
Length=711

 Score =   171 bits (434),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 76/108 (70%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYEEEL+ F + G +SEL +AFSREGP K+YVQHK+ ++AS +WS+IS+  Y+YV
Sbjct  604  RRMDFIYEEELQRFLESGALSELSLAFSREGPTKEYVQHKMMDKASDIWSMISEGAYVYV  663

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHR+LHTI QEQ  +DS+KAE+ VK LQM+GRYLRDVW
Sbjct  664  CGDAKGMARDVHRSLHTIAQEQGPMDSTKAESFVKNLQMSGRYLRDVW  711



>gb|EEE68301.1| hypothetical protein OsJ_26563 [Oryza sativa Japonica Group]
Length=711

 Score =   171 bits (434),  Expect = 9e-46, Method: Composition-based stats.
 Identities = 75/107 (70%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -3

Query  675  RMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYVC  496
            +MDFIYE+EL  F ++G +SEL++AFSREGP K+YVQHK++++AS++W +ISQ GY+YVC
Sbjct  605  KMDFIYEDELNTFLEEGALSELVLAFSREGPTKEYVQHKMSQKASEIWDMISQGGYIYVC  664

Query  495  GDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            GDAKGMARDVHR LHTIVQEQ  +DSSKAE+ VK LQ  GRYLRDVW
Sbjct  665  GDAKGMARDVHRVLHTIVQEQGSLDSSKAESFVKSLQTEGRYLRDVW  711



>gb|AAC05022.1| NADPH:ferrihemoprotein oxidoreductase [Eschscholzia californica]
Length=705

 Score =   171 bits (434),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/108 (71%), Positives = 92/108 (85%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MD+IYEEEL NF  +G ISE++VAFSREG  K+YVQHK+ E+AS +W +ISQ  YLYV
Sbjct  598  RQMDYIYEEELNNFVKEGAISEVVVAFSREGATKEYVQHKMAEKASYIWEMISQGAYLYV  657

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTI QEQ  +D+SK E++VK LQM+GRYLRDVW
Sbjct  658  CGDAKGMARDVHRTLHTIAQEQGSLDNSKTESLVKNLQMDGRYLRDVW  705



>gb|KHN17598.1| NADPH--cytochrome P450 reductase [Glycine soja]
Length=715

 Score =   171 bits (434),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 75/108 (69%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MD+IYE+EL +F + G + ELI+AFSREGP K+YVQHK+ E+AS++WS+ISQ  Y+YV
Sbjct  608  RQMDYIYEDELSHFVNTGALDELILAFSREGPTKEYVQHKMMEKASEIWSMISQGAYIYV  667

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHR LHTI+QEQ  +DSSKAE++VK LQ  GRYLRDVW
Sbjct  668  CGDAKGMARDVHRALHTILQEQGSLDSSKAESMVKNLQTTGRYLRDVW  715



>ref|XP_008661364.1| PREDICTED: uncharacterized protein LOC100192720 isoform X1 [Zea 
mays]
 gb|AFW57103.1| NADPH--cytochrome P450 reductase [Zea mays]
Length=699

 Score =   171 bits (433),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 75/106 (71%), Positives = 91/106 (86%), Gaps = 0/106 (0%)
 Frame = -3

Query  672  MDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYVCG  493
            MDFIYE+EL NF +QG + EL++AFSR+GP K+YVQHK+ ++AS++W +ISQ  Y+YVCG
Sbjct  594  MDFIYEDELSNFLEQGALFELVLAFSRQGPTKEYVQHKMAQKASEIWDMISQGAYIYVCG  653

Query  492  DAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            DAKGMARDVHR LHTIVQEQ  +DSSKAE+ VK LQM GRYLRDVW
Sbjct  654  DAKGMARDVHRVLHTIVQEQGSLDSSKAESFVKNLQMEGRYLRDVW  699



>ref|XP_010688489.1| PREDICTED: NADPH--cytochrome P450 reductase [Beta vulgaris subsp. 
vulgaris]
Length=705

 Score =   171 bits (433),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 76/108 (70%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R++DFIYE+EL+NF + G++SEL+VAFSREGP K+YVQHK+ ERAS VW++I+Q GY+YV
Sbjct  598  RKVDFIYEDELQNFVETGVLSELVVAFSREGPTKEYVQHKMMERASDVWNVINQGGYVYV  657

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHR LHTI+QEQ  + SS+AE +VK LQ  GRYLRDVW
Sbjct  658  CGDAKGMARDVHRVLHTILQEQGGMGSSQAEGMVKNLQTTGRYLRDVW  705



>ref|XP_006659239.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Oryza brachyantha]
Length=568

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = -3

Query  675  RMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYVC  496
            +MDFIYE EL  F ++G +SEL++AFSREGP K+YVQHK+ ++AS++W +ISQ GY+YVC
Sbjct  462  KMDFIYENELNTFLEEGALSELVLAFSREGPTKEYVQHKMAQKASEIWDVISQGGYIYVC  521

Query  495  GDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            GDAKGMARDVHR LHTIVQEQ  +DSSKAE+ VK LQ  GRYLRDVW
Sbjct  522  GDAKGMARDVHRVLHTIVQEQGSLDSSKAESFVKSLQTEGRYLRDVW  568



>ref|XP_009408053.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Musa acuminata 
subsp. malaccensis]
Length=705

 Score =   171 bits (432),  Expect = 2e-45, Method: Composition-based stats.
 Identities = 75/107 (70%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = -3

Query  675  RMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYVC  496
            +MDFIY++EL NF + GI+SELIVA SREGP K+YVQHK+TE+AS +W++ISQ GY+YVC
Sbjct  599  KMDFIYKDELNNFVETGILSELIVALSREGPIKEYVQHKMTEKASDIWNIISQGGYVYVC  658

Query  495  GDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            GDAKGMARDVH+ LHTI QEQ  +D SK E++VK LQ  GRYLRDVW
Sbjct  659  GDAKGMARDVHKVLHTICQEQGSLDGSKTESLVKSLQTEGRYLRDVW  705



>gb|ABB88839.2| NADPH cytochrome P450 reductase [Stevia rebaudiana]
Length=710

 Score =   171 bits (432),  Expect = 2e-45, Method: Composition-based stats.
 Identities = 77/108 (71%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R++DFIYE+EL NF + G +SELIVAFSREG  K+YVQHK++++AS +W L+S+  YLYV
Sbjct  603  RKVDFIYEDELNNFVETGALSELIVAFSREGTAKEYVQHKMSQKASDIWKLLSEGAYLYV  662

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMA+DVHRTLHTIVQEQ  +DSSKAE  VK LQM+GRYLRDVW
Sbjct  663  CGDAKGMAKDVHRTLHTIVQEQGSLDSSKAELYVKNLQMSGRYLRDVW  710



>ref|XP_010234513.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Brachypodium 
distachyon]
Length=700

 Score =   170 bits (431),  Expect = 2e-45, Method: Composition-based stats.
 Identities = 75/107 (70%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = -3

Query  675  RMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYVC  496
            +MDFIYE+EL NF +QG +SEL++AFSREG  K+YVQHK+ ++AS +W +I Q GY+YVC
Sbjct  594  KMDFIYEDELNNFLEQGALSELVLAFSREGSTKEYVQHKMAQKASDIWDVIFQGGYIYVC  653

Query  495  GDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            GDAKGMARDVHR LHTIVQEQ  +DSSKAE+ VK LQ  GRYLRDVW
Sbjct  654  GDAKGMARDVHRVLHTIVQEQGSLDSSKAESFVKNLQTEGRYLRDVW  700



>ref|NP_194750.1| NADPH--cytochrome P450 reductase 2 [Arabidopsis thaliana]
 sp|Q9SUM3.1|NCPR2_ARATH RecName: Full=NADPH--cytochrome P450 reductase 2 [Arabidopsis 
thaliana]
 gb|AAK17169.1|AF325101_1 NADPH-ferrihemoprotein reductase (ATR2) [Arabidopsis thaliana]
 emb|CAB52465.1| NADPH-ferrihemoprotein reductase (ATR2) [Arabidopsis thaliana]
 emb|CAB81014.1| NADPH-ferrihemoprotein reductase (ATR2) [Arabidopsis thaliana]
 gb|AEE85738.1| NADPH--cytochrome P450 reductase 2 [Arabidopsis thaliana]
Length=711

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/108 (70%), Positives = 91/108 (84%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYEEEL+ F + G ++EL VAFSREGP K+YVQHK+ ++AS +W++ISQ  YLYV
Sbjct  604  RRMDFIYEEELQRFVESGALAELSVAFSREGPTKEYVQHKMMDKASDIWNMISQGAYLYV  663

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHR+LHTI QEQ  +DS+KAE  VK LQ +GRYLRDVW
Sbjct  664  CGDAKGMARDVHRSLHTIAQEQGSMDSTKAEGFVKNLQTSGRYLRDVW  711



>ref|NP_849472.2| NADPH--cytochrome P450 reductase 2 [Arabidopsis thaliana]
 gb|AEE85737.1| NADPH--cytochrome P450 reductase 2 [Arabidopsis thaliana]
Length=712

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/108 (70%), Positives = 91/108 (84%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYEEEL+ F + G ++EL VAFSREGP K+YVQHK+ ++AS +W++ISQ  YLYV
Sbjct  605  RRMDFIYEEELQRFVESGALAELSVAFSREGPTKEYVQHKMMDKASDIWNMISQGAYLYV  664

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHR+LHTI QEQ  +DS+KAE  VK LQ +GRYLRDVW
Sbjct  665  CGDAKGMARDVHRSLHTIAQEQGSMDSTKAEGFVKNLQTSGRYLRDVW  712



>ref|XP_007154761.1| hypothetical protein PHAVU_003G145400g [Phaseolus vulgaris]
 gb|ESW26755.1| hypothetical protein PHAVU_003G145400g [Phaseolus vulgaris]
Length=707

 Score =   170 bits (431),  Expect = 2e-45, Method: Composition-based stats.
 Identities = 75/107 (70%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = -3

Query  675  RMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYVC  496
            +MD+IYE+EL +F + G +SELIVAFSREGP K YVQH++ E+AS++WS+ISQ  Y+YVC
Sbjct  601  QMDYIYEDELNHFINSGALSELIVAFSREGPTKKYVQHEMLEKASEIWSMISQGAYIYVC  660

Query  495  GDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            GDAKGMARDVHR LHTI+QEQ  +DS+KAE++VK LQ NGRYLRDVW
Sbjct  661  GDAKGMARDVHRALHTILQEQGSMDSTKAESMVKSLQTNGRYLRDVW  707



>gb|AAC09468.2| putative NADPH-cytochrome P450 reductase [Pisum sativum]
Length=704

 Score =   170 bits (431),  Expect = 2e-45, Method: Composition-based stats.
 Identities = 75/108 (69%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R++D+IYE+EL +F + G +SELIVAFSR+GP K+YVQHK+ E+AS +W++ISQ  Y+YV
Sbjct  597  RQVDYIYEDELNHFVNGGALSELIVAFSRDGPTKEYVQHKMMEKASDIWNMISQGAYVYV  656

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTI+QEQ  +DSSK E++VK LQM GRYLRDVW
Sbjct  657  CGDAKGMARDVHRTLHTILQEQGSLDSSKTESMVKNLQMTGRYLRDVW  704



>emb|CAA46815.1| NADPH-ferrihemoprotein reductase [Arabidopsis thaliana]
Length=712

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/108 (70%), Positives = 91/108 (84%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYEEEL+ F + G ++EL VAFSREGP K+YVQHK+ ++AS +W++ISQ  YLYV
Sbjct  605  RRMDFIYEEELQRFVESGALAELSVAFSREGPTKEYVQHKMMDKASDIWNMISQGAYLYV  664

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHR+LHTI QEQ  +DS+KAE  VK LQ +GRYLRDVW
Sbjct  665  CGDAKGMARDVHRSLHTIAQEQGSMDSTKAEGFVKNLQTSGRYLRDVW  712



>gb|AAS90127.1| NADPH cytochrome P450 reductase [Ammi majus]
Length=681

 Score =   170 bits (430),  Expect = 3e-45, Method: Composition-based stats.
 Identities = 76/108 (70%), Positives = 91/108 (84%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R +DFIYE+EL  F + G ISELIVAFSREGP K+YVQHK+ ++AS++W+L+S+  Y+YV
Sbjct  574  RNLDFIYEDELNKFVESGSISELIVAFSREGPTKEYVQHKMLQKASEIWNLMSEGAYIYV  633

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHR LHTI QEQ  +DSSKAE+ VK LQM GRYLRDVW
Sbjct  634  CGDAKGMARDVHRMLHTIAQEQGALDSSKAESWVKNLQMTGRYLRDVW  681



>gb|AAB97736.1| NADPH cytochrome P450 reductase [Petroselinum crispum]
Length=681

 Score =   169 bits (429),  Expect = 4e-45, Method: Composition-based stats.
 Identities = 77/108 (71%), Positives = 91/108 (84%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R +DFIYE+EL  F + G ISELIVAFSREGP K+YVQHK+ ++AS++W+LIS+  Y+YV
Sbjct  574  RNLDFIYEDELNKFVESGSISELIVAFSREGPTKEYVQHKMLQKASEIWNLISEGAYIYV  633

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHR LHTI QEQ  +DSSKAE+ VK LQM GRYLRDVW
Sbjct  634  CGDAKGMARDVHRMLHTIAQEQGALDSSKAESWVKNLQMTGRYLRDVW  681



>gb|EPS66345.1| hypothetical protein M569_08425 [Genlisea aurea]
Length=683

 Score =   169 bits (429),  Expect = 4e-45, Method: Composition-based stats.
 Identities = 77/107 (72%), Positives = 89/107 (83%), Gaps = 0/107 (0%)
 Frame = -3

Query  675  RMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYVC  496
            +MD+IYE+EL+ F   G ISELIVAFSREGP K+YVQHK+ E A+ +W LIS+  Y+YVC
Sbjct  577  KMDYIYEDELQTFVKDGAISELIVAFSREGPSKEYVQHKMAEGAADLWKLISEGAYVYVC  636

Query  495  GDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            GDAKGMARDVHRTLHTIVQEQ  +DSSK E+ VK LQM GRYLRDVW
Sbjct  637  GDAKGMARDVHRTLHTIVQEQGSLDSSKTESFVKNLQMTGRYLRDVW  683



>ref|XP_003610110.1| NADPH cytochrome P450 reductase [Medicago truncatula]
Length=490

 Score =   167 bits (424),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 74/108 (69%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R++D+IYE+EL +F   G +SELIVAFSREGP K+YVQHK+ E+AS +W++ISQ  Y+YV
Sbjct  383  RQVDYIYEDELNHFVHGGALSELIVAFSREGPTKEYVQHKMIEKASDIWNMISQGAYIYV  442

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMA+DVHRTLHTI+QEQ  +D+SK E++VK LQM GRYLRDVW
Sbjct  443  CGDAKGMAKDVHRTLHTILQEQGSLDNSKTESMVKNLQMTGRYLRDVW  490



>gb|ABM88789.1| cytochrome P450 reductase [Artemisia annua]
Length=704

 Score =   169 bits (428),  Expect = 5e-45, Method: Composition-based stats.
 Identities = 76/108 (70%), Positives = 92/108 (85%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R++DFIYE+EL NF + G +SEL+ AFSREG  K+YVQHK+T++AS +W+L+S+  YLYV
Sbjct  597  RKVDFIYEDELNNFVETGALSELVTAFSREGATKEYVQHKMTQKASDIWNLLSEGAYLYV  656

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMA+DVHRTLHTIVQEQ  +DSSKAE  VK LQM GRYLRDVW
Sbjct  657  CGDAKGMAKDVHRTLHTIVQEQGSLDSSKAELYVKNLQMAGRYLRDVW  704



>gb|ABC47946.1| cytochrome P450 reductase [Artemisia annua]
 gb|AEQ63685.1| cytochrome P450 reductase [synthetic construct]
Length=704

 Score =   169 bits (428),  Expect = 5e-45, Method: Composition-based stats.
 Identities = 76/108 (70%), Positives = 92/108 (85%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R++DFIYE+EL NF + G +SEL+ AFSREG  K+YVQHK+T++AS +W+L+S+  YLYV
Sbjct  597  RKVDFIYEDELNNFVETGALSELVTAFSREGATKEYVQHKMTQKASDIWNLLSEGAYLYV  656

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMA+DVHRTLHTIVQEQ  +DSSKAE  VK LQM GRYLRDVW
Sbjct  657  CGDAKGMAKDVHRTLHTIVQEQGSLDSSKAELYVKNLQMAGRYLRDVW  704



>gb|EPS73891.1| hypothetical protein M569_00858 [Genlisea aurea]
Length=706

 Score =   169 bits (428),  Expect = 5e-45, Method: Composition-based stats.
 Identities = 75/107 (70%), Positives = 89/107 (83%), Gaps = 0/107 (0%)
 Frame = -3

Query  675  RMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYVC  496
            +MD+IYE+EL+    +G  SEL+VAFSREGP K+YVQHK+ ERA+ +W LIS  GY+YVC
Sbjct  600  KMDYIYEDELQQLVKEGAASELVVAFSREGPTKEYVQHKMGERAADLWKLISDGGYVYVC  659

Query  495  GDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            GDAKGMARDVHRTLHTIVQEQ  +D+SK E+ VK LQM GRYLRDVW
Sbjct  660  GDAKGMARDVHRTLHTIVQEQGSMDNSKTESFVKNLQMTGRYLRDVW  706



>gb|ABI98819.1| cytochrome P450 reductase [Artemisia annua]
Length=704

 Score =   169 bits (428),  Expect = 6e-45, Method: Composition-based stats.
 Identities = 76/108 (70%), Positives = 92/108 (85%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R++DFIYE+EL NF + G +SEL+ AFSREG  K+YVQHK+T++AS +W+L+S+  YLYV
Sbjct  597  RKVDFIYEDELNNFVETGALSELVTAFSREGATKEYVQHKMTQKASDIWNLLSEGAYLYV  656

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMA+DVHRTLHTIVQEQ  +DSSKAE  VK LQM GRYLRDVW
Sbjct  657  CGDAKGMAKDVHRTLHTIVQEQGSLDSSKAELYVKNLQMAGRYLRDVW  704



>gb|KDP36395.1| hypothetical protein JCGZ_08664 [Jatropha curcas]
Length=711

 Score =   169 bits (428),  Expect = 6e-45, Method: Composition-based stats.
 Identities = 73/107 (68%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = -3

Query  675  RMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYVC  496
            +MD+IY++EL NF   G +SEL+VAFSREGP K+YVQHK+ E+AS +W+LISQ  Y+YVC
Sbjct  605  KMDYIYQDELSNFVGSGALSELVVAFSREGPTKEYVQHKMMEKASDIWNLISQGAYIYVC  664

Query  495  GDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            GDAKGMARDVHRTLHTI QEQ  + +S+AE++VK LQ +GRYLRDVW
Sbjct  665  GDAKGMARDVHRTLHTIAQEQGSLSNSRAESMVKNLQTSGRYLRDVW  711



>emb|CAQ37789.1| NADPH:cytochrome P450 reductase [Solenostemon scutellarioides]
Length=711

 Score =   169 bits (428),  Expect = 6e-45, Method: Composition-based stats.
 Identities = 73/107 (68%), Positives = 90/107 (84%), Gaps = 0/107 (0%)
 Frame = -3

Query  675  RMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYVC  496
            +MDFIY++EL NF   G++SEL++AFSREGP K+YVQHK+ ++A  VW++IS+ GY+YVC
Sbjct  605  KMDFIYQDELDNFVQAGVVSELVLAFSREGPAKEYVQHKMAQKAWDVWNMISEGGYVYVC  664

Query  495  GDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            GDAKGMARDVHRTLHTIVQEQ  +DSSK E+ VK LQM G  LRDVW
Sbjct  665  GDAKGMARDVHRTLHTIVQEQGSLDSSKTESFVKNLQMTGAVLRDVW  711



>ref|XP_011016946.1| PREDICTED: LOW QUALITY PROTEIN: NADPH--cytochrome P450 reductase-like 
[Populus euphratica]
Length=692

 Score =   169 bits (427),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = -3

Query  675  RMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYVC  496
            +MDFIYE+EL NF  QG+ISEL+VAFSREGPQK YVQHK+ ++A+++WS+ISQ  YLYVC
Sbjct  586  QMDFIYEDELNNFAAQGVISELLVAFSREGPQKXYVQHKMVDKAAEIWSIISQGSYLYVC  645

Query  495  GDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
             DAKGMARDVH TL  IVQEQ  +DSSK E++VKKLQ+ GRYLRDVW
Sbjct  646  DDAKGMARDVHWTLRAIVQEQGGLDSSKTESMVKKLQIEGRYLRDVW  692



>gb|ABL09938.1| cytochrome P450 reductase [Artemisia annua]
Length=704

 Score =   169 bits (427),  Expect = 7e-45, Method: Composition-based stats.
 Identities = 76/108 (70%), Positives = 92/108 (85%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R++DFIYE+EL NF + G +SEL+ AFSREG  K+YVQHK+T++AS +W+L+S+  YLYV
Sbjct  597  RKVDFIYEDELNNFVETGALSELVTAFSREGATKEYVQHKMTQKASDIWNLLSEGAYLYV  656

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMA+DVHRTLHTIVQEQ  +DSSKAE  VK LQM GRYLRDVW
Sbjct  657  CGDAKGMAKDVHRTLHTIVQEQGSLDSSKAELYVKNLQMAGRYLRDVW  704



>ref|XP_002869386.1| hypothetical protein ARALYDRAFT_913457 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45645.1| hypothetical protein ARALYDRAFT_913457 [Arabidopsis lyrata subsp. 
lyrata]
Length=711

 Score =   169 bits (427),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 90/108 (83%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYEEEL+ F + G ++EL VAFSREGP K+YVQHK+ ++AS +W++ISQ  Y+YV
Sbjct  604  RRMDFIYEEELQRFVESGALAELSVAFSREGPTKEYVQHKMMDKASDIWNMISQGAYVYV  663

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHR+LHTI QEQ  +DS+KAE  VK LQ  GRYLRDVW
Sbjct  664  CGDAKGMARDVHRSLHTIAQEQGSMDSTKAEGFVKNLQTTGRYLRDVW  711



>sp|Q05001.1|NCPR_CATRO RecName: Full=NADPH--cytochrome P450 reductase; Short=CPR; Short=P450R 
[Catharanthus roseus]
 emb|CAA49446.1| NADPH--ferrihemoprotein reductase [Catharanthus roseus]
Length=714

 Score =   169 bits (427),  Expect = 8e-45, Method: Composition-based stats.
 Identities = 74/108 (69%), Positives = 89/108 (82%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MD+IYE+EL +F + G +SEL+VAFSREGP K YVQHK+ E+AS +W +IS   Y+YV
Sbjct  607  RKMDYIYEDELNHFLEIGALSELLVAFSREGPTKQYVQHKMAEKASDIWRMISDGAYVYV  666

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHRTLHTI QEQ  +DS++AE  VK LQM GRYLRDVW
Sbjct  667  CGDAKGMARDVHRTLHTIAQEQGSMDSTQAEGFVKNLQMTGRYLRDVW  714



>gb|KFK29577.1| nadph-ferrihemoprotein reductase [Arabis alpina]
Length=715

 Score =   169 bits (427),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 90/108 (83%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            RRMDFIYEEEL+ F + G ++EL VAFSREGP K YVQHK+ ++AS++WS+IS+  Y+YV
Sbjct  608  RRMDFIYEEELQRFVESGALAELSVAFSREGPTKQYVQHKMMDKASEIWSMISEGAYVYV  667

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMARDVHR+LHTI QEQ  +DS+KAE  VK LQ  GRYLRDVW
Sbjct  668  CGDAKGMARDVHRSLHTIAQEQGSMDSTKAEGFVKNLQTTGRYLRDVW  715



>gb|ACG27711.1| NADPH--cytochrome P450 reductase [Zea mays]
Length=703

 Score =   168 bits (426),  Expect = 9e-45, Method: Composition-based stats.
 Identities = 75/107 (70%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = -3

Query  675  RMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYVC  496
            +MDFIYE EL NF +QG +SEL++AFSR+G  K+YVQHK+ ++AS++W +ISQ  Y+YVC
Sbjct  597  KMDFIYEGELNNFLEQGALSELVLAFSRQGLAKEYVQHKMAQKASEIWDMISQGAYIYVC  656

Query  495  GDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            GDAKGMARDVHR LHTIVQEQ  +DSSKAE+ VK LQM GRYLRDVW
Sbjct  657  GDAKGMARDVHRVLHTIVQEQGSLDSSKAESFVKNLQMEGRYLRDVW  703



>gb|KHG21257.1| NADPH--cytochrome P450 reductase [Gossypium arboreum]
Length=711

 Score =   168 bits (426),  Expect = 1e-44, Method: Composition-based stats.
 Identities = 74/108 (69%), Positives = 92/108 (85%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R+MD+IYE+EL NF + G +SEL+VAFSREGP K+YVQHK+ E+A  +W++IS+ GYLYV
Sbjct  604  RKMDYIYEDELNNFVNSGALSELVVAFSREGPTKEYVQHKMMEKALDIWNMISEGGYLYV  663

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMA+DVHRTL TI+QEQ  +DSSKAE++VK L   GRYLRDVW
Sbjct  664  CGDAKGMAKDVHRTLLTILQEQGCLDSSKAESMVKNLHTTGRYLRDVW  711



>ref|XP_008676669.1| PREDICTED: uncharacterized protein LOC100216882 isoform X1 [Zea 
mays]
 gb|AFW62053.1| hypothetical protein ZEAMMB73_790468 [Zea mays]
Length=702

 Score =   168 bits (426),  Expect = 1e-44, Method: Composition-based stats.
 Identities = 75/107 (70%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = -3

Query  675  RMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYVC  496
            +MDFIYE EL NF +QG +SEL++AFSR+G  K+YVQHK+ ++AS++W +ISQ  Y+YVC
Sbjct  596  KMDFIYEGELNNFVEQGALSELVLAFSRQGLAKEYVQHKMAQKASEIWDMISQGAYIYVC  655

Query  495  GDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            GDAKGMARDVHR LHTIVQEQ  +DSSKAE+ VK LQM GRYLRDVW
Sbjct  656  GDAKGMARDVHRVLHTIVQEQGSLDSSKAESFVKNLQMEGRYLRDVW  702



>ref|XP_004973052.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Setaria italica]
Length=702

 Score =   168 bits (425),  Expect = 1e-44, Method: Composition-based stats.
 Identities = 72/107 (67%), Positives = 91/107 (85%), Gaps = 0/107 (0%)
 Frame = -3

Query  675  RMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYVC  496
            +MDFIYE+EL NF +QG +SEL++AFSR+GP K+YVQHK+ ++AS++W +ISQ  Y+YVC
Sbjct  596  KMDFIYEDELNNFLEQGALSELVLAFSRQGPTKEYVQHKMAQKASEIWDMISQGAYIYVC  655

Query  495  GDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            GDAKGMA+DVH+ LHTIVQEQ  +DSSKAE+ VK L   GRYLRDVW
Sbjct  656  GDAKGMAKDVHKVLHTIVQEQGSLDSSKAESFVKNLHTEGRYLRDVW  702



>gb|AAG17471.1|AF123610_10 NADPH-cytochrome P450 reductase [Triticum aestivum]
Length=656

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/108 (69%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -3

Query  678  RRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQEGYLYV  499
            R MD+IYEEEL+NF  +G +SELIVA+SREGP K+YVQHK+ ++A+++W++ISQ GY+YV
Sbjct  549  REMDYIYEEELQNFLQEGALSELIVAYSREGPTKEYVQHKMVDKATEIWNVISQGGYIYV  608

Query  498  CGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  355
            CGDAKGMA+DVHR LHTIVQ+Q  +D+SK E  VK LQM GRYLRDVW
Sbjct  609  CGDAKGMAKDVHRVLHTIVQKQGSLDNSKTELYVKNLQMEGRYLRDVW  656



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1104504643240