BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF007D19

Length=617
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004240444.1|  PREDICTED: 60S ribosomal protein L5-like           224   5e-69   
ref|XP_011089578.1|  PREDICTED: 60S ribosomal protein L5-like           224   6e-69   Sesamum indicum [beniseed]
ref|XP_009801702.1|  PREDICTED: 60S ribosomal protein L5-like           222   4e-68   Nicotiana sylvestris
ref|XP_009611190.1|  PREDICTED: 60S ribosomal protein L5-like           222   5e-68   Nicotiana tomentosiformis
ref|XP_010069235.1|  PREDICTED: 60S ribosomal protein L5                221   7e-68   Eucalyptus grandis [rose gum]
ref|NP_001274803.1|  uncharacterized protein LOC102577675               221   1e-67   Solanum tuberosum [potatoes]
ref|XP_004242456.1|  PREDICTED: 60S ribosomal protein L5                221   1e-67   Solanum lycopersicum
ref|XP_008243040.1|  PREDICTED: 60S ribosomal protein L5                221   1e-67   Prunus mume [ume]
ref|XP_006366807.1|  PREDICTED: 60S ribosomal protein L5-like           221   1e-67   Solanum tuberosum [potatoes]
ref|XP_009626989.1|  PREDICTED: 60S ribosomal protein L5-like           221   2e-67   Nicotiana tomentosiformis
ref|XP_008224357.1|  PREDICTED: 60S ribosomal protein L5-2-like         220   2e-67   Prunus mume [ume]
ref|XP_004246241.1|  PREDICTED: 60S ribosomal protein L5                220   3e-67   Solanum lycopersicum
gb|KCW57514.1|  hypothetical protein EUGRSUZ_H00286                     222   3e-67   Eucalyptus grandis [rose gum]
gb|EYU46086.1|  hypothetical protein MIMGU_mgv1a010702mg                219   6e-67   Erythranthe guttata [common monkey flower]
ref|XP_010688411.1|  PREDICTED: 60S ribosomal protein L5 isoform X1     219   8e-67   
ref|XP_010688412.1|  PREDICTED: 60S ribosomal protein L5 isoform X2     219   8e-67   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006344345.1|  PREDICTED: 60S ribosomal protein L5-like           219   1e-66   Solanum tuberosum [potatoes]
gb|KJB71614.1|  hypothetical protein B456_011G133700                    218   1e-66   Gossypium raimondii
ref|XP_007223197.1|  hypothetical protein PRUPE_ppa009300mg             218   2e-66   Prunus persica
ref|XP_009767919.1|  PREDICTED: 60S ribosomal protein L5                218   2e-66   Nicotiana sylvestris
ref|XP_004296367.1|  PREDICTED: 60S ribosomal protein L5-like           218   2e-66   Fragaria vesca subsp. vesca
ref|XP_009625828.1|  PREDICTED: 60S ribosomal protein L5                218   2e-66   Nicotiana tomentosiformis
ref|XP_007033700.1|  Ribosomal protein L5 B isoform 1                   217   3e-66   
emb|CDP18434.1|  unnamed protein product                                218   3e-66   Coffea canephora [robusta coffee]
ref|XP_007033701.1|  Ribosomal protein L5 B isoform 2                   217   3e-66   
ref|XP_004287154.1|  PREDICTED: 60S ribosomal protein L5                217   4e-66   Fragaria vesca subsp. vesca
ref|XP_009358396.1|  PREDICTED: 60S ribosomal protein L5-1-like         216   6e-66   Pyrus x bretschneideri [bai li]
ref|XP_009774634.1|  PREDICTED: 60S ribosomal protein L5-like           216   6e-66   Nicotiana sylvestris
ref|XP_008394277.1|  PREDICTED: 60S ribosomal protein L5-like           216   6e-66   
ref|XP_010679028.1|  PREDICTED: 60S ribosomal protein L5                216   8e-66   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB84075.1|  hypothetical protein B456_N001600                       212   9e-66   Gossypium raimondii
ref|XP_010273742.1|  PREDICTED: 60S ribosomal protein L5-like           216   1e-65   Nelumbo nucifera [Indian lotus]
ref|XP_002524859.1|  ribosomal protein L5, putative                     214   4e-65   Ricinus communis
ref|XP_009366222.1|  PREDICTED: 60S ribosomal protein L5-1-like         214   6e-65   Pyrus x bretschneideri [bai li]
ref|XP_009410739.1|  PREDICTED: 60S ribosomal protein L5                214   7e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008384135.1|  PREDICTED: 60S ribosomal protein L5-1-like         214   7e-65   Malus domestica [apple tree]
gb|KJB84074.1|  hypothetical protein B456_N001600                       212   7e-65   Gossypium raimondii
gb|KCW46049.1|  hypothetical protein EUGRSUZ_L00023                     213   1e-64   Eucalyptus grandis [rose gum]
ref|XP_006371546.1|  hypothetical protein POPTR_0019s13040g             213   1e-64   Populus trichocarpa [western balsam poplar]
ref|XP_002524558.1|  ribosomal protein L5, putative                     213   2e-64   Ricinus communis
ref|XP_010547178.1|  PREDICTED: 60S ribosomal protein L5-2-like         213   2e-64   Tarenaya hassleriana [spider flower]
ref|XP_006492784.1|  PREDICTED: 60S ribosomal protein L5-like           212   2e-64   Citrus sinensis [apfelsine]
emb|CDP17898.1|  unnamed protein product                                214   2e-64   Coffea canephora [robusta coffee]
gb|KDO45957.1|  hypothetical protein CISIN_1g0225141mg                  212   3e-64   Citrus sinensis [apfelsine]
gb|KDP35145.1|  hypothetical protein JCGZ_10679                         212   3e-64   Jatropha curcas
ref|XP_010258446.1|  PREDICTED: 60S ribosomal protein L5                212   3e-64   Nelumbo nucifera [Indian lotus]
gb|EMT04099.1|  60S ribosomal protein L5-2                              212   4e-64   
ref|XP_011002862.1|  PREDICTED: 60S ribosomal protein L5                212   4e-64   Populus euphratica
gb|KJB84072.1|  hypothetical protein B456_N001600                       211   5e-64   Gossypium raimondii
gb|KJB84073.1|  hypothetical protein B456_N001600                       211   5e-64   Gossypium raimondii
ref|XP_010039360.1|  PREDICTED: 60S ribosomal protein L5-like           214   6e-64   
ref|XP_008367742.1|  PREDICTED: 60S ribosomal protein L5-like           211   1e-63   
ref|XP_008394279.1|  PREDICTED: 60S ribosomal protein L5-like           211   1e-63   
ref|XP_003577351.1|  PREDICTED: 60S ribosomal protein L5-1-like         211   1e-63   Brachypodium distachyon [annual false brome]
ref|XP_010101365.1|  60S ribosomal protein L5                           211   1e-63   
gb|KJB27798.1|  hypothetical protein B456_005G010200                    210   2e-63   Gossypium raimondii
ref|XP_008446013.1|  PREDICTED: 60S ribosomal protein L5                210   2e-63   Cucumis melo [Oriental melon]
ref|XP_006442191.1|  hypothetical protein CICLE_v10020582mg             213   2e-63   
ref|XP_006447905.1|  hypothetical protein CICLE_v10016107mg             210   2e-63   Citrus clementina [clementine]
ref|XP_007049514.1|  Ribosomal protein L5 B isoform 2                   210   2e-63   
ref|XP_006469375.1|  PREDICTED: 60S ribosomal protein L5-like           210   2e-63   Citrus sinensis [apfelsine]
ref|XP_008791818.1|  PREDICTED: 60S ribosomal protein L5-like           210   2e-63   Phoenix dactylifera
ref|XP_009358395.1|  PREDICTED: 60S ribosomal protein L5                210   3e-63   Pyrus x bretschneideri [bai li]
ref|XP_009420140.1|  PREDICTED: 60S ribosomal protein L5-like           210   3e-63   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO51032.1|  hypothetical protein CISIN_1g022424mg                   209   3e-63   Citrus sinensis [apfelsine]
ref|XP_010650723.1|  PREDICTED: 60S ribosomal protein L5                209   3e-63   Vitis vinifera
emb|CBI24704.3|  unnamed protein product                                210   5e-63   Vitis vinifera
ref|XP_010930276.1|  PREDICTED: 60S ribosomal protein L5                209   5e-63   Elaeis guineensis
ref|XP_008361660.1|  PREDICTED: 60S ribosomal protein L5                209   5e-63   
tpg|DAA56364.1|  TPA: hypothetical protein ZEAMMB73_635593              206   6e-63   
ref|XP_007049513.1|  Ribosomal protein L5 B isoform 1                   210   7e-63   
gb|ACU23594.1|  unknown                                                 208   8e-63   Glycine max [soybeans]
ref|XP_010927913.1|  PREDICTED: 60S ribosomal protein L5-like iso...    208   9e-63   Elaeis guineensis
gb|EMS47485.1|  60S ribosomal protein L5-1                              207   9e-63   Triticum urartu
ref|XP_010927912.1|  PREDICTED: 60S ribosomal protein L5-like iso...    208   9e-63   
gb|KHN27258.1|  60S ribosomal protein L5                                208   1e-62   Glycine soja [wild soybean]
ref|XP_003528810.1|  PREDICTED: 60S ribosomal protein L5-like           208   1e-62   Glycine max [soybeans]
ref|XP_003548576.2|  PREDICTED: 60S ribosomal protein L5-like           209   1e-62   Glycine max [soybeans]
ref|XP_011037361.1|  PREDICTED: 60S ribosomal protein L5-like           208   1e-62   Populus euphratica
ref|XP_006594790.1|  PREDICTED: 60S ribosomal protein L5-like           208   1e-62   Glycine max [soybeans]
ref|XP_003528812.1|  PREDICTED: 60S ribosomal protein L5-like iso...    208   1e-62   Glycine max [soybeans]
ref|XP_010551993.1|  PREDICTED: 60S ribosomal protein L5-like           208   1e-62   Tarenaya hassleriana [spider flower]
gb|ABK93596.1|  unknown                                                 207   2e-62   Populus trichocarpa [western balsam poplar]
ref|XP_008800755.1|  PREDICTED: 60S ribosomal protein L5-like           208   2e-62   Phoenix dactylifera
ref|XP_002321226.2|  hypothetical protein POPTR_0014s17230g             207   2e-62   Populus trichocarpa [western balsam poplar]
ref|XP_010532933.1|  PREDICTED: 60S ribosomal protein L5-2              207   2e-62   Tarenaya hassleriana [spider flower]
gb|AEV92989.1|  60S ribosomal protein L5                                207   2e-62   Triticum aestivum [Canadian hard winter wheat]
gb|AFW84308.1|  hypothetical protein ZEAMMB73_937605                    205   2e-62   
ref|XP_008807247.1|  PREDICTED: 60S ribosomal protein L5-like iso...    207   2e-62   
gb|ADR71225.1|  60S ribosomal protein L5A                               207   3e-62   Hevea brasiliensis [jebe]
ref|XP_008807248.1|  PREDICTED: 60S ribosomal protein L5-1-like i...    207   3e-62   Phoenix dactylifera
ref|XP_008339345.1|  PREDICTED: 60S ribosomal protein L5                207   3e-62   Malus domestica [apple tree]
ref|NP_001189970.1|  60S ribosomal protein L5-1                         203   4e-62   Arabidopsis thaliana [mouse-ear cress]
gb|AES74307.2|  60S ribosomal protein L5-2                              207   4e-62   Medicago truncatula
ref|XP_006583256.1|  PREDICTED: 60S ribosomal protein L5-like iso...    207   4e-62   
gb|KHN36792.1|  60S ribosomal protein L5                                206   4e-62   Glycine soja [wild soybean]
ref|XP_003543258.1|  PREDICTED: 60S ribosomal protein L5-like           206   4e-62   Glycine max [soybeans]
dbj|BAB33422.1|  putative senescence-associated protein                 206   6e-62   Pisum sativum [garden pea]
ref|XP_003604056.1|  60S ribosomal protein L5                           207   6e-62   
ref|XP_003579707.1|  PREDICTED: 60S ribosomal protein L5-1              206   8e-62   Brachypodium distachyon [annual false brome]
ref|XP_011006737.1|  PREDICTED: 60S ribosomal protein L5-like           206   9e-62   Populus euphratica
gb|ACG36552.1|  60S ribosomal protein L5-1                              206   9e-62   Zea mays [maize]
ref|XP_011091526.1|  PREDICTED: 60S ribosomal protein L5                206   9e-62   Sesamum indicum [beniseed]
dbj|BAJ89012.1|  predicted protein                                      206   1e-61   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008674702.1|  PREDICTED: 60S ribosomal protein L5-1              206   1e-61   Zea mays [maize]
gb|KDP45189.1|  hypothetical protein JCGZ_15054                         206   1e-61   Jatropha curcas
ref|NP_001267659.1|  60S ribosomal protein L5                           206   1e-61   Cucumis sativus [cucumbers]
ref|XP_004500722.1|  PREDICTED: 60S ribosomal protein L5-like           206   1e-61   Cicer arietinum [garbanzo]
ref|XP_006418614.1|  hypothetical protein EUTSA_v10002621mg             206   1e-61   Eutrema salsugineum [saltwater cress]
gb|ADR71226.1|  60S ribosomal protein L5B                               205   1e-61   Hevea brasiliensis [jebe]
ref|XP_004970894.1|  PREDICTED: 60S ribosomal protein L5-1-like         205   2e-61   Setaria italica
gb|ACJ85054.1|  unknown                                                 205   2e-61   Medicago truncatula
ref|XP_011073988.1|  PREDICTED: 60S ribosomal protein L5-like           205   2e-61   Sesamum indicum [beniseed]
gb|ABK95722.1|  unknown                                                 204   2e-61   Populus trichocarpa [western balsam poplar]
ref|XP_003561801.1|  PREDICTED: 60S ribosomal protein L5-1-like         204   3e-61   Brachypodium distachyon [annual false brome]
ref|XP_006376458.1|  hypothetical protein POPTR_0013s13220g             204   3e-61   
gb|ACR38045.1|  unknown                                                 204   4e-61   Zea mays [maize]
ref|XP_004510723.1|  PREDICTED: 60S ribosomal protein L5-like           204   4e-61   Cicer arietinum [garbanzo]
ref|XP_010264793.1|  PREDICTED: 60S ribosomal protein L5-like           204   4e-61   Nelumbo nucifera [Indian lotus]
gb|EMS59984.1|  60S ribosomal protein L5-2                              204   4e-61   Triticum urartu
gb|EMT23062.1|  60S ribosomal protein L5-2                              204   4e-61   
ref|XP_006645164.1|  PREDICTED: 60S ribosomal protein L5-1-like i...    204   5e-61   
gb|EMT20601.1|  60S ribosomal protein L5-2                              204   5e-61   
gb|KJB22669.1|  hypothetical protein B456_004G060400                    204   5e-61   Gossypium raimondii
gb|KJB22668.1|  hypothetical protein B456_004G060400                    204   5e-61   Gossypium raimondii
ref|XP_006645165.1|  PREDICTED: 60S ribosomal protein L5-1-like i...    204   5e-61   Oryza brachyantha
dbj|BAH20263.1|  AT3G25520                                              200   7e-61   Arabidopsis thaliana [mouse-ear cress]
gb|ABK93902.1|  unknown                                                 203   9e-61   Populus trichocarpa [western balsam poplar]
gb|AFK41086.1|  unknown                                                 203   1e-60   Medicago truncatula
ref|NP_566767.1|  60S ribosomal protein L5-1                            203   1e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002870764.1|  hypothetical protein ARALYDRAFT_916328             203   1e-60   Arabidopsis lyrata subsp. lyrata
ref|XP_008650733.1|  PREDICTED: 60S ribosomal protein L5-1-like         203   1e-60   Zea mays [maize]
dbj|BAC06273.1|  putative 60S ribosomal protein L5                      203   1e-60   Oryza sativa Japonica Group [Japonica rice]
sp|A2WXX3.2|RL51_ORYSI  RecName: Full=60S ribosomal protein L5-1        202   2e-60   Oryza sativa Indica Group [Indian rice]
ref|NP_001045083.1|  Os01g0896800                                       202   2e-60   
ref|XP_004171975.1|  PREDICTED: 60S ribosomal protein L5-like           201   2e-60   
gb|KJB27799.1|  hypothetical protein B456_005G010200                    202   2e-60   Gossypium raimondii
ref|NP_001151284.1|  60S ribosomal protein L5-1                         202   2e-60   Zea mays [maize]
ref|XP_007135197.1|  hypothetical protein PHAVU_010G109200g             202   3e-60   Phaseolus vulgaris [French bean]
gb|AFK36106.1|  unknown                                                 202   3e-60   Lotus japonicus
ref|XP_010441086.1|  PREDICTED: 60S ribosomal protein L5-1-like         202   3e-60   Camelina sativa [gold-of-pleasure]
sp|Q8L4L4.1|RL52_ORYSJ  RecName: Full=60S ribosomal protein L5-2        202   3e-60   
dbj|BAD82173.1|  putative ribosomal protein L5                          202   3e-60   Oryza sativa Japonica Group [Japonica rice]
gb|AGV54354.1|  60S ribosomal protein L5-like protein                   202   4e-60   Phaseolus vulgaris [French bean]
ref|XP_007160627.1|  hypothetical protein PHAVU_001G003200g             201   5e-60   Phaseolus vulgaris [French bean]
ref|XP_006858792.1|  hypothetical protein AMTR_s00066p00162800          201   5e-60   
ref|XP_002885727.1|  hypothetical protein ARALYDRAFT_480054             201   9e-60   
ref|XP_007135299.1|  hypothetical protein PHAVU_010G117700g             201   9e-60   Phaseolus vulgaris [French bean]
ref|XP_010542064.1|  PREDICTED: 60S ribosomal protein L5-1-like         201   9e-60   Tarenaya hassleriana [spider flower]
gb|EYU46087.1|  hypothetical protein MIMGU_mgv11b008897mg               201   1e-59   Erythranthe guttata [common monkey flower]
gb|AFK39593.1|  unknown                                                 201   1e-59   Lotus japonicus
gb|AFK46994.1|  unknown                                                 201   1e-59   Lotus japonicus
ref|XP_010435855.1|  PREDICTED: 60S ribosomal protein L5-1 isofor...    200   1e-59   Camelina sativa [gold-of-pleasure]
ref|XP_006296719.1|  hypothetical protein CARUB_v10014269mg             200   1e-59   Capsella rubella
ref|XP_002876523.1|  predicted protein                                  200   1e-59   Arabidopsis lyrata subsp. lyrata
ref|NP_198790.1|  60S ribosomal protein L5-2                            200   1e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004968269.1|  PREDICTED: 60S ribosomal protein L5-1-like         200   2e-59   
ref|XP_004144191.1|  PREDICTED: 60S ribosomal protein L5-like           200   2e-59   Cucumis sativus [cucumbers]
ref|XP_002465922.1|  hypothetical protein SORBIDRAFT_01g048270          200   2e-59   Sorghum bicolor [broomcorn]
ref|XP_010466965.1|  PREDICTED: 60S ribosomal protein L5-1-like         200   2e-59   Camelina sativa [gold-of-pleasure]
ref|XP_009136122.1|  PREDICTED: 60S ribosomal protein L5-1-like         200   2e-59   Brassica rapa
ref|XP_008445491.1|  PREDICTED: 60S ribosomal protein L5-like           200   2e-59   Cucumis melo [Oriental melon]
ref|XP_006647221.1|  PREDICTED: 60S ribosomal protein L5-1-like         199   2e-59   Oryza brachyantha
gb|AAM64753.1|  ribosomal protein, putative                             199   2e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009102410.1|  PREDICTED: 60S ribosomal protein L5-1              199   3e-59   
ref|XP_006284122.1|  hypothetical protein CARUB_v10005255mg             199   3e-59   Capsella rubella
ref|XP_010488654.1|  PREDICTED: 60S ribosomal protein L5-1-like         199   3e-59   Camelina sativa [gold-of-pleasure]
ref|XP_010514215.1|  PREDICTED: 60S ribosomal protein L5-1-like         199   3e-59   Camelina sativa [gold-of-pleasure]
emb|CDY52294.1|  BnaA03g57870D                                          200   3e-59   Brassica napus [oilseed rape]
emb|CDY27889.1|  BnaA07g04790D                                          199   3e-59   Brassica napus [oilseed rape]
ref|XP_006284123.1|  hypothetical protein CARUB_v10005255mg             200   4e-59   
ref|XP_010912766.1|  PREDICTED: 60S ribosomal protein L5-like           200   4e-59   Elaeis guineensis
gb|KJB10810.1|  hypothetical protein B456_001G226000                    199   5e-59   Gossypium raimondii
emb|CDY52293.1|  BnaA03g57860D                                          199   5e-59   Brassica napus [oilseed rape]
gb|AHA84189.1|  60S ribosomal protein L5                                198   6e-59   Phaseolus vulgaris [French bean]
ref|XP_009416026.1|  PREDICTED: 60S ribosomal protein L5-like           198   6e-59   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010557737.1|  PREDICTED: 60S ribosomal protein L5-1-like         198   1e-58   Tarenaya hassleriana [spider flower]
emb|CDY50258.1|  BnaC07g47930D                                          198   1e-58   Brassica napus [oilseed rape]
emb|CDY15088.1|  BnaC03g44490D                                          199   1e-58   Brassica napus [oilseed rape]
gb|AFK34395.1|  unknown                                                 197   1e-58   Lotus japonicus
emb|CDY15089.1|  BnaC03g44500D                                          197   3e-58   Brassica napus [oilseed rape]
ref|XP_009136123.1|  PREDICTED: 60S ribosomal protein L5-1-like         194   2e-57   Brassica rapa
gb|KFK38215.1|  hypothetical protein AALP_AA3G083700                    194   2e-57   Arabis alpina [alpine rockcress]
gb|KHN15970.1|  60S ribosomal protein L5                                194   2e-57   Glycine soja [wild soybean]
ref|XP_009151634.1|  PREDICTED: 60S ribosomal protein L5-2-like i...    194   3e-57   Brassica rapa
ref|XP_009151633.1|  PREDICTED: 60S ribosomal protein L5-2-like i...    194   3e-57   
ref|XP_006395196.1|  hypothetical protein EUTSA_v10004670mg             194   5e-57   Eutrema salsugineum [saltwater cress]
gb|KFK38214.1|  hypothetical protein AALP_AA3G083600                    192   1e-56   Arabis alpina [alpine rockcress]
ref|XP_009384264.1|  PREDICTED: 60S ribosomal protein L5-like iso...    188   2e-56   
emb|CDX86312.1|  BnaA06g30290D                                          192   2e-56   
ref|XP_006282684.1|  hypothetical protein CARUB_v10005363mg             191   3e-56   Capsella rubella
ref|XP_009384265.1|  PREDICTED: 60S ribosomal protein L5-like iso...    188   6e-56   
emb|CDX85331.1|  BnaC07g26420D                                          193   8e-56   
gb|ABK21084.1|  unknown                                                 189   3e-55   Picea sitchensis
ref|XP_007203851.1|  hypothetical protein PRUPE_ppa009282m2g            183   2e-53   
ref|XP_001759628.1|  predicted protein                                  184   2e-53   
ref|XP_001783411.1|  predicted protein                                  182   8e-53   
ref|XP_001767871.1|  predicted protein                                  181   3e-52   
gb|KDO51033.1|  hypothetical protein CISIN_1g022424mg                   180   4e-52   Citrus sinensis [apfelsine]
ref|XP_010648788.1|  PREDICTED: 60S ribosomal protein L5-like           177   4e-52   Vitis vinifera
gb|KJB71615.1|  hypothetical protein B456_011G133700                    180   4e-52   Gossypium raimondii
ref|XP_001783620.1|  predicted protein                                  179   1e-51   
ref|XP_002967840.1|  hypothetical protein SELMODRAFT_144921             179   3e-51   Selaginella moellendorffii
gb|KCW63927.1|  hypothetical protein EUGRSUZ_G016041                    174   3e-51   Eucalyptus grandis [rose gum]
gb|EYU36673.1|  hypothetical protein MIMGU_mgv1a0142632mg               173   3e-51   Erythranthe guttata [common monkey flower]
gb|KHG04393.1|  60S ribosomal L5                                        176   1e-50   Gossypium arboreum [tree cotton]
ref|XP_002981679.1|  hypothetical protein SELMODRAFT_154687             176   2e-50   Selaginella moellendorffii
gb|KDO45958.1|  hypothetical protein CISIN_1g0225141mg                  176   2e-50   Citrus sinensis [apfelsine]
gb|KCW46050.1|  hypothetical protein EUGRSUZ_L00023                     176   2e-50   Eucalyptus grandis [rose gum]
gb|KHG14330.1|  60S ribosomal L5                                        173   2e-49   Gossypium arboreum [tree cotton]
gb|KDO45956.1|  hypothetical protein CISIN_1g0225141mg                  171   6e-49   Citrus sinensis [apfelsine]
ref|XP_010450776.1|  PREDICTED: 60S ribosomal protein L5-1-like         169   4e-48   Camelina sativa [gold-of-pleasure]
gb|KHG10378.1|  60S ribosomal protein L5                                169   8e-48   Gossypium arboreum [tree cotton]
gb|KHG10377.1|  60S ribosomal protein L5                                169   8e-48   Gossypium arboreum [tree cotton]
ref|XP_010646096.1|  PREDICTED: 60S ribosomal protein L5-like           167   4e-47   
gb|EPS61271.1|  hypothetical protein M569_13526                         166   5e-47   Genlisea aurea
ref|XP_002456780.1|  hypothetical protein SORBIDRAFT_03g042604          165   6e-46   
ref|XP_010451808.1|  PREDICTED: 60S ribosomal protein L5-1-like         159   1e-45   
gb|KHF99386.1|  60S ribosomal L5                                        161   6e-45   Gossypium arboreum [tree cotton]
gb|KHG15135.1|  60S ribosomal L5                                        160   2e-44   Gossypium arboreum [tree cotton]
sp|P93779.1|RL5_SOLME  RecName: Full=60S ribosomal protein L5           152   3e-43   Solanum melongena [aubergine]
gb|AGV54527.1|  60S ribosomal protein L5-like protein                   155   3e-42   Phaseolus vulgaris [French bean]
gb|AFW84311.1|  hypothetical protein ZEAMMB73_937605                    154   5e-42   
ref|XP_009383145.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...    143   2e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011399144.1|  60S ribosomal protein L5-1                         147   2e-39   Auxenochlorella protothecoides
ref|XP_005843140.1|  hypothetical protein CHLNCDRAFT_37575              146   6e-39   Chlorella variabilis
gb|KDD76608.1|  ribosomal L18p/L5e                                      144   4e-38   Helicosporidium sp. ATCC 50920
gb|EME50014.1|  hypothetical protein DOTSEDRAFT_31141                   140   2e-36   Dothistroma septosporum NZE10
ref|XP_003856228.1|  60S ribosomal protein L5                           139   6e-36   Zymoseptoria tritici IPO323
gb|EMF17397.1|  60S ribosomal protein L5                                137   2e-35   Sphaerulina musiva SO2202
gb|KEQ82579.1|  hypothetical protein M438DRAFT_398586                   137   2e-35   Aureobasidium pullulans EXF-150
gb|KEQ95896.1|  hypothetical protein AUEXF2481DRAFT_39748               136   4e-35   Aureobasidium subglaciale EXF-2481
dbj|GAM82159.1|  hypothetical protein ANO11243_001380                   135   9e-35   fungal sp. No.11243
ref|XP_007920104.1|  hypothetical protein MYCFIDRAFT_54807              135   2e-34   Pseudocercospora fijiensis CIRAD86
gb|EKG20809.1|  Ribosomal protein L18/L5                                135   2e-34   Macrophomina phaseolina MS6
ref|XP_007674186.1|  hypothetical protein BAUCODRAFT_146209             134   2e-34   Baudoinia panamericana UAMH 10762
gb|KEQ78036.1|  hypothetical protein M436DRAFT_59974                    134   3e-34   Aureobasidium namibiae CBS 147.97
ref|XP_002176750.1|  predicted protein                                  134   4e-34   Phaeodactylum tricornutum CCAP 1055/1
gb|KEQ61687.1|  hypothetical protein M437DRAFT_67147                    134   4e-34   Aureobasidium melanogenum CBS 110374
emb|CEJ93107.1|  Putative 60S ribosomal protein L5 (CPR4)               131   1e-33   Torrubiella hemipterigena
ref|XP_008022306.1|  hypothetical protein SETTUDRAFT_167313             130   1e-33   Exserohilum turcica Et28A
gb|KID66354.1|  Ribosomal protein L5, eukaryotic/archaeal               132   2e-33   Metarhizium anisopliae ARSEF 549
ref|XP_007816229.1|  Ribosomal protein L5, eukaryotic/archaeal          132   2e-33   Metarhizium robertsii ARSEF 23
gb|KID85893.1|  Ribosomal protein L5, eukaryotic/archaeal               132   2e-33   Metarhizium guizhouense ARSEF 977
gb|KEF55260.1|  60S ribosomal protein L5                                132   3e-33   Exophiala aquamarina CBS 119918
gb|KID72246.1|  Ribosomal protein L5, eukaryotic/archaeal               132   3e-33   Metarhizium brunneum ARSEF 3297
gb|EMD90558.1|  hypothetical protein COCHEDRAFT_1022415                 131   4e-33   Bipolaris maydis C5
gb|KDR83692.1|  hypothetical protein GALMADRAFT_236026                  131   4e-33   Galerina marginata CBS 339.88
ref|XP_002675028.1|  predicted protein                                  131   4e-33   Naegleria gruberi strain NEG-M
ref|XP_005781727.1|  hypothetical protein EMIHUDRAFT_434648             131   5e-33   Emiliania huxleyi CCMP1516
ref|XP_007813241.1|  60S ribosomal protein L5                           131   5e-33   Metarhizium acridum CQMa 102
emb|CEJ93106.1|  Putative 60S ribosomal protein L5 (CPR4)               130   7e-33   Torrubiella hemipterigena
emb|CCX32875.1|  Similar to 60S ribosomal protein L5; acc. no. O5...    130   9e-33   Pyronema omphalodes CBS 100304
sp|Q4KTI3.1|RL5_SUBDO  RecName: Full=60S ribosomal protein L5           130   9e-33   Suberites domuncula
emb|CCE29368.1|  probable 60S ribosomal protein L5                      130   9e-33   Claviceps purpurea 20.1
gb|KHN96356.1|  60S ribosomal protein L5                                130   1e-32   Metarhizium album ARSEF 1941
gb|KIW74224.1|  60S ribosomal protein L5                                130   1e-32   Fonsecaea pedrosoi CBS 271.37
gb|EMR84013.1|  putative 60s ribosomal protein l5 protein               129   1e-32   Botrytis cinerea BcDW1
ref|XP_007712612.1|  hypothetical protein COCCADRAFT_5332               130   1e-32   Bipolaris zeicola 26-R-13
gb|KIK30810.1|  hypothetical protein PISMIDRAFT_86523                   130   2e-32   Pisolithus microcarpus 441
gb|KDQ29411.1|  hypothetical protein PLEOSDRAFT_1055401                 130   2e-32   Pleurotus ostreatus PC15
ref|XP_001547892.1|  60S ribosomal protein L5                           129   2e-32   Botrytis cinerea B05.10
gb|KIW03639.1|  60S ribosomal protein L5                                129   2e-32   Verruconis gallopava
ref|XP_002295395.1|  RL5, ribosomal protein 5, 60S large ribosoma...    129   2e-32   Thalassiosira pseudonana CCMP1335
ref|XP_007738723.1|  60S ribosomal protein L5                           129   2e-32   Capronia epimyces CBS 606.96
ref|XP_009492195.1|  50S ribosomal protein L5e                          129   2e-32   Fonticula alba
gb|EHK26573.1|  hypothetical protein TRIVIDRAFT_77851                   129   2e-32   Trichoderma virens Gv29-8
gb|KFY58522.1|  hypothetical protein V496_06088                         129   2e-32   Pseudogymnoascus sp. VKM F-4515 (FW-2607)
ref|XP_007687883.1|  hypothetical protein COCMIDRAFT_36698              129   2e-32   Bipolaris oryzae ATCC 44560
ref|XP_001940200.1|  60S ribosomal protein L5                           129   2e-32   Pyrenophora tritici-repentis Pt-1C-BFP
ref|XP_001912102.1|  hypothetical protein                               129   2e-32   Podospora anserina S mat+
ref|XP_007329342.1|  hypothetical protein AGABI1DRAFT_84575             129   2e-32   Agaricus bisporus var. burnettii JB137-S8
ref|XP_001837210.1|  60S ribosomal protein L5                           129   3e-32   Coprinopsis cinerea okayama7#130
ref|XP_006460296.1|  hypothetical protein AGABI2DRAFT_142569            129   3e-32   Agaricus bisporus var. bisporus H97
gb|KDB12690.1|  60S ribosomal protein L5                                129   3e-32   Ustilaginoidea virens
ref|XP_007581033.1|  putative 60s ribosomal protein l5 protein          129   3e-32   
ref|XP_011197235.1|  PREDICTED: 60S ribosomal protein L5                129   3e-32   Bactrocera dorsalis [papaya fruit fly]
ref|XP_003715227.1|  60S ribosomal protein L5                           129   3e-32   Magnaporthe oryzae 70-15
ref|XP_007705225.1|  hypothetical protein COCSADRAFT_41417              129   3e-32   Bipolaris sorokiniana ND90Pr
gb|KIO13004.1|  hypothetical protein M404DRAFT_706860                   129   4e-32   
gb|KIW58102.1|  60S ribosomal protein L5                                129   4e-32   
emb|CCU97371.1|  unnamed protein product                                129   4e-32   
gb|KFZ19673.1|  hypothetical protein V501_00580                         128   4e-32   
gb|KFY83677.1|  hypothetical protein V500_10007                         128   4e-32   
gb|KFY16774.1|  hypothetical protein V492_01113                         128   4e-32   
gb|KFY37418.1|  hypothetical protein V494_04756                         128   4e-32   
ref|XP_007337949.1|  hypothetical protein AURDEDRAFT_110414             128   5e-32   
ref|XP_001800680.1|  hypothetical protein SNOG_10409                    127   5e-32   
ref|XP_007366056.1|  hypothetical protein DICSQDRAFT_86741              128   6e-32   
ref|NP_983506.1|  60S ribosomal protein L5                              128   6e-32   
ref|XP_007746291.1|  60S ribosomal protein L5                           128   6e-32   
ref|XP_008715217.1|  60S ribosomal protein L5                           128   6e-32   
gb|KIW93473.1|  60S ribosomal protein L5                                128   6e-32   
ref|XP_004533872.1|  PREDICTED: 60S ribosomal protein L5-like           128   7e-32   
gb|KIW09974.1|  60S ribosomal protein L5                                128   7e-32   
gb|KIV84110.1|  60S ribosomal protein L5                                128   7e-32   
gb|KIM67945.1|  hypothetical protein SCLCIDRAFT_107388                  128   8e-32   
gb|KEZ38694.1|  hypothetical protein SAPIO_CDS10715                     127   8e-32   
ref|XP_009847564.1|  hypothetical protein NEUTE1DRAFT_75066             127   8e-32   
ref|XP_003842266.1|  similar to 60S ribosomal protein L5                128   8e-32   
gb|EPT03783.1|  hypothetical protein FOMPIDRAFT_1022326                 127   9e-32   
emb|CCF48291.1|  probable RPL5-60S large subunit ribosomal protei...    127   9e-32   
gb|KFY79291.1|  hypothetical protein V499_01707                         128   1e-31   
gb|KIX96197.1|  60S ribosomal protein L5                                127   1e-31   
ref|XP_011191002.1|  PREDICTED: 60S ribosomal protein L5                127   1e-31   
gb|ABS18358.1|  ribosomal protein L5                                    124   1e-31   
ref|XP_003298671.1|  60S ribosomal protein L5                           127   1e-31   
ref|XP_005643753.1|  60S ribosomal protein L5                           127   1e-31   
gb|KHN36791.1|  60S ribosomal protein L5                                126   1e-31   
gb|EJK70557.1|  hypothetical protein THAOC_08069                        127   1e-31   
gb|KIN05730.1|  hypothetical protein OIDMADRAFT_16965                   127   1e-31   
ref|XP_001588768.1|  60S ribosomal protein L5                           127   1e-31   
gb|KIK68088.1|  hypothetical protein GYMLUDRAFT_92742                   127   1e-31   
gb|KFY22525.1|  hypothetical protein V493_06526                         127   1e-31   
ref|XP_002434050.1|  60S ribosomal protein L5, putative                 127   1e-31   
gb|KIY49257.1|  hypothetical protein FISHEDRAFT_72600                   127   1e-31   
ref|XP_008083855.1|  Translational machinery component                  127   2e-31   
gb|EHL03541.1|  putative 60S ribosomal protein L5                       127   2e-31   
ref|XP_001268969.1|  60S ribosomal protein L5                           127   2e-31   
gb|ETN75275.1|  ribosomal L18p/L5e family protein                       127   2e-31   
ref|XP_003349274.1|  60S ribosomal protein L5                           127   2e-31   
gb|KFA64074.1|  hypothetical protein S40285_06737                       127   2e-31   
ref|XP_007290078.1|  60S ribosomal protein L5                           127   2e-31   
gb|KDR11979.1|  60S ribosomal protein L5                                127   2e-31   
ref|XP_003649901.1|  60S ribosomal protein L5                           126   2e-31   
ref|XP_008730876.1|  60S ribosomal protein L5                           127   2e-31   
sp|Q56FG6.1|RL5_LYSTE  RecName: Full=60S ribosomal protein L5           126   2e-31   
ref|XP_007268728.1|  60S ribosomal protein L5                           127   2e-31   
gb|KIY71482.1|  hypothetical protein CYLTODRAFT_487247                  127   2e-31   
ref|XP_007773415.1|  60S ribosomal protein L5                           127   2e-31   
ref|XP_006968241.1|  ribosomal protein L5                               126   2e-31   
gb|KFX88354.1|  hypothetical protein V490_07682                         126   2e-31   
ref|XP_003662289.1|  hypothetical protein MYCTH_78218                   126   2e-31   
ref|XP_960578.1|  60s ribosomal protein l5                              126   3e-31   
gb|KEY69974.1|  hypothetical protein S7711_03992                        126   3e-31   
gb|EUC66279.1|  60S ribosomal protein L5                                126   3e-31   
gb|KIX05556.1|  60S ribosomal protein L5                                126   3e-31   
gb|ADQ73874.1|  60S ribosomal protein L5                                126   3e-31   
ref|XP_007880337.1|  hypothetical protein PFL1_04620                    126   3e-31   
gb|KJB10809.1|  hypothetical protein B456_001G226000                    124   3e-31   
ref|XP_002109848.1|  expressed hypothetical protein                     126   3e-31   
gb|KJA30227.1|  hypothetical protein HYPSUDRAFT_196476                  126   3e-31   
ref|XP_006611949.1|  PREDICTED: 60S ribosomal protein L5-like           126   3e-31   
gb|EYB99479.1|  hypothetical protein Y032_0122g1070                     126   4e-31   
ref|XP_624620.2|  PREDICTED: 60S ribosomal protein L5                   126   4e-31   
gb|KII95147.1|  hypothetical protein PLICRDRAFT_97457                   126   4e-31   
dbj|BAN20290.1|  ribosomal protein L5                                   125   4e-31   
gb|KIW40012.1|  60S ribosomal protein L5                                125   4e-31   
ref|XP_007392523.1|  hypothetical protein PHACADRAFT_250801             126   5e-31   
gb|AGM32490.1|  60S ribosomal protein L5-like protein                   125   5e-31   
gb|KDN36129.1|  putative RPL5-60S large subunit ribosomal protein...    125   5e-31   
gb|KHJ35883.1|  putative 60s ribosomal protein l5                       125   5e-31   
ref|XP_002497480.1|  60S ribosomal protein L5                           125   5e-31   
gb|KIK95588.1|  hypothetical protein PAXRUDRAFT_826861                  125   5e-31   
gb|EHK45382.1|  hypothetical protein TRIATDRAFT_300024                  125   5e-31   
ref|XP_002550737.1|  60S ribosomal protein L5                           125   6e-31   
ref|XP_008198550.1|  PREDICTED: 60S ribosomal protein L5                125   6e-31   
ref|XP_007381881.1|  60S ribosomal protein L5                           125   6e-31   
gb|EPZ34992.1|  60S ribosomal protein L5                                125   6e-31   
gb|KDO24705.1|  hypothetical protein SPRG_10239                         125   6e-31   
emb|CCU76476.1|  60S ribosomal protein L5                               125   6e-31   
ref|XP_009223169.1|  60S ribosomal protein L5                           125   6e-31   
gb|KIM25886.1|  hypothetical protein M408DRAFT_330884                   125   7e-31   
gb|AGO11355.1|  AaceriACR104Cp                                          125   7e-31   
ref|XP_001877132.1|  60S ribosomal protein L5                           125   7e-31   
gb|ELR09388.1|  60S ribosomal protein L5                                125   7e-31   
gb|KIW22485.1|  60S ribosomal protein L5                                125   8e-31   
gb|KGG50093.1|  60S ribosomal protein L5-2                              125   8e-31   
emb|CAK45545.1|  unnamed protein product                                125   8e-31   
ref|XP_007861880.1|  60S ribosomal protein L5                           125   8e-31   
ref|XP_007762113.1|  60S ribosomal protein L5                           125   8e-31   
emb|CEF66000.1|  60S ribosomal protein L5                               125   8e-31   
dbj|BAA31570.1|  ribosomal protein L5 homolog                           124   8e-31   
gb|KFY01844.1|  hypothetical protein O988_02499                         125   8e-31   
ref|XP_001634531.1|  predicted protein                                  125   9e-31   
gb|ACG27083.1|  60S ribosomal protein L5-2                              125   9e-31   
ref|XP_008605837.1|  50S ribosomal protein L5e                          125   9e-31   
ref|XP_003424029.1|  PREDICTED: 60S ribosomal protein L5                125   9e-31   
ref|XP_001392690.2|  60S ribosomal protein L5                           125   1e-30   
gb|KIK06671.1|  hypothetical protein K443DRAFT_673956                   125   1e-30   
gb|KIK48932.1|  hypothetical protein CY34DRAFT_797724                   125   1e-30   
ref|XP_007779399.1|  60S ribosomal protein L5                           124   1e-30   
gb|EFX90266.1|  hypothetical protein DAPPUDRAFT_299917                  124   1e-30   
ref|XP_007834039.1|  60S ribosomal protein L5                           124   1e-30   
ref|XP_011264134.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...    124   1e-30   
gb|ELU36170.1|  60S ribosomal protein L5                                125   1e-30   
ref|XP_009153803.1|  60S ribosomal protein L5                           124   1e-30   
ref|XP_003648419.1|  hypothetical protein Ecym_8324                     124   1e-30   
ref|XP_007915920.1|  putative 60s ribosomal protein l5 protein          124   1e-30   
ref|XP_003036567.1|  60S ribosomal protein L5                           124   2e-30   
gb|EQL01602.1|  Ribosomal protein L5, eukaryotic/archaeal               124   2e-30   
gb|AAN73355.1|  ribosomal protein L5                                    124   2e-30   
gb|EPS25441.1|  hypothetical protein PDE_00374                          124   2e-30   
emb|CCQ18634.1|  60S ribosomal protein L5                               124   2e-30   
gb|KIM46136.1|  hypothetical protein M413DRAFT_441200                   124   2e-30   
ref|XP_003487475.1|  PREDICTED: 60S ribosomal protein L5-like           124   2e-30   
emb|CBN08634.1|  small nucleolar RNA, C/D box 21                        124   2e-30   
ref|XP_003006324.1|  60S ribosomal protein L5                           124   2e-30   
ref|XP_007725761.1|  60S ribosomal protein L5                           124   2e-30   
sp|Q627R7.2|RL5_CAEBR  RecName: Full=60S ribosomal protein L5           124   2e-30   
ref|XP_002630158.1|  C. briggsae CBR-RPL-5 protein                      124   2e-30   
ref|XP_007275120.1|  60s ribosomal protein l5                           124   2e-30   
emb|CDJ88514.1|  Ribosomal protein L18 L5 domain containing protein     124   2e-30   
ref|NP_001037008.1|  60S ribosomal protein L5                           124   2e-30   
gb|KIJ20064.1|  hypothetical protein PAXINDRAFT_166226                  124   2e-30   
ref|XP_006689766.1|  hypothetical protein CANTEDRAFT_116632             124   2e-30   
gb|KIV97220.1|  60S ribosomal protein L5                                124   2e-30   
emb|CDI55135.1|  probable RPL5-60S large subunit ribosomal protei...    124   3e-30   
gb|ACZ13335.1|  60S ribosomal protein L5                                124   3e-30   
gb|EPY50651.1|  60S ribosomal protein L5                                124   3e-30   
ref|XP_003708145.1|  PREDICTED: 60S ribosomal protein L5-like           124   3e-30   
ref|XP_001639289.1|  predicted protein                                  124   3e-30   
gb|AAV34814.1|  ribosomal protein L5                                    124   3e-30   
ref|NP_596399.1|  60S ribosomal protein L5                              123   3e-30   
gb|KIJ70516.1|  hypothetical protein HYDPIDRAFT_78845                   124   3e-30   
emb|CEL63831.1|  60S ribosomal protein L5-A OS=Schizosaccharomyce...    124   3e-30   
ref|XP_003394373.1|  PREDICTED: 60S ribosomal protein L5-like           124   3e-30   
ref|XP_008861011.1|  hypothetical protein H310_00139                    123   3e-30   
gb|KIW62448.1|  60S ribosomal protein L5                                123   3e-30   
gb|EQB57780.1|  hypothetical protein CGLO_02053                         123   3e-30   
ref|XP_008599464.1|  60S ribosomal protein L5 (CPR4)                    123   3e-30   
ref|XP_011390982.1|  ribosomal 60S subunit protein L5                   123   4e-30   
ref|XP_011264968.1|  PREDICTED: 60S ribosomal protein L5-like           123   4e-30   
ref|XP_009648689.1|  60S ribosomal protein L5                           123   4e-30   
gb|EPQ65986.1|  Protein component of the large (60S) ribosomal su...    123   4e-30   
ref|XP_011118753.1|  hypothetical protein AOL_s00007g551                124   5e-30   
sp|O65353.1|RL5_HELAN  RecName: Full=60S ribosomal protein L5           123   5e-30   
emb|CAJ17229.1|  ribosomal protein L5e                                  122   5e-30   
ref|XP_001973913.1|  GG21448                                            123   5e-30   
ref|XP_011167373.1|  PREDICTED: 60S ribosomal protein L5                122   6e-30   
ref|NP_001036387.1|  ribosomal protein L5, isoform A                    122   6e-30   
gb|EFZ13276.1|  hypothetical protein SINV_12586                         122   6e-30   
ref|XP_011302246.1|  PREDICTED: 60S ribosomal protein L5                122   6e-30   
emb|CCG82998.1|  60S ribosomal protein L5-B                             122   6e-30   
gb|EFN62403.1|  60S ribosomal protein L5                                123   6e-30   
gb|EGT59634.1|  hypothetical protein CAEBREN_19650                      122   6e-30   
gb|ESZ92263.1|  hypothetical protein SBOR_7352                          128   7e-30   
gb|EMD40741.1|  hypothetical protein CERSUDRAFT_80390                   122   7e-30   
ref|NP_495811.1|  Protein RPL-5                                         122   7e-30   
ref|XP_006696670.1|  60S ribosomal protein l5-like protein              122   8e-30   
emb|CDO75577.1|  hypothetical protein BN946_scf184858.g17               122   8e-30   
ref|XP_002044351.1|  GM26730                                            122   8e-30   
ref|XP_002002621.1|  GI17484                                            126   8e-30   
ref|XP_011150405.1|  PREDICTED: 60S ribosomal protein L5-like           122   9e-30   
ref|XP_003693438.1|  PREDICTED: 60S ribosomal protein L5-like           122   9e-30   
ref|XP_009830190.1|  hypothetical protein H257_06606                    122   9e-30   
ref|XP_001264474.1|  60S ribosomal protein L5                           123   9e-30   
ref|NP_001104213.1|  uncharacterized protein LOC100126642               122   1e-29   
ref|XP_002375890.1|  60S ribosomal protein L5                           122   1e-29   
ref|XP_001727600.2|  60S ribosomal protein L5                           122   1e-29   
ref|XP_007852257.1|  60s ribosomal protein l5                           122   1e-29   
gb|EST08870.1|  60S ribosomal protein                                   122   1e-29   
gb|KHJ99496.1|  ribosomal L18p/L5e family protein                       122   1e-29   
gb|EEH21335.1|  60S ribosomal protein L5                                122   1e-29   
gb|EFN77280.1|  60S ribosomal protein L5                                122   2e-29   
ref|XP_002066772.1|  GK24660                                            121   2e-29   
ref|XP_009543697.1|  hypothetical protein HETIRDRAFT_408220             122   2e-29   
ref|XP_003050722.1|  60S ribosomal protein L5                           121   2e-29   
ref|XP_003283302.1|  60S ribosomal protein L5                           121   2e-29   
ref|XP_002798009.1|  60S ribosomal protein L5                           121   2e-29   
gb|EFQ28351.1|  ribosomal L18p/L5e family protein                       121   2e-29   
ref|XP_006673626.1|  60S ribosomal protein L5 (CPR4)                    121   2e-29   
ref|NP_594180.1|  60S ribosomal protein L5                              121   2e-29   
ref|XP_002023101.1|  GL21177                                            121   2e-29   
ref|XP_008553482.1|  PREDICTED: 60S ribosomal protein L5                121   2e-29   
ref|XP_001210567.1|  60S ribosomal protein L5                           121   2e-29   
ref|XP_002490002.1|  60S ribosomal protein L5                           121   2e-29   
gb|EWC45033.1|  60S ribosomal protein L5                                121   2e-29   
dbj|GAA88524.1|  60S ribosomal protein L5                               121   2e-29   
gb|KFH68392.1|  60S ribosomal protein L5                                121   2e-29   
ref|XP_007315632.1|  hypothetical protein SERLADRAFT_461185             121   3e-29   
ref|XP_003675508.1|  hypothetical protein NCAS_0C01510                  121   3e-29   
gb|EPS64989.1|  hypothetical protein M569_09790                         119   3e-29   
gb|KIO30996.1|  hypothetical protein M407DRAFT_241930                   121   3e-29   
ref|XP_007303062.1|  hypothetical protein STEHIDRAFT_120627             121   3e-29   
gb|KIL96266.1|  60s ribosomal protein l5                                121   3e-29   
gb|EPY50445.1|  60S ribosomal protein L5                                120   3e-29   
gb|KDQ64549.1|  hypothetical protein JAAARDRAFT_28194                   121   3e-29   
ref|XP_011107683.1|  hypothetical protein H072_1692                     120   4e-29   
ref|XP_009046069.1|  hypothetical protein LOTGIDRAFT_224562             120   4e-29   
ref|XP_008035731.1|  60S ribosomal protein L5                           120   4e-29   
emb|CDK29484.1|  unnamed protein product                                120   4e-29   
ref|XP_002478553.1|  60S ribosomal protein L5                           120   4e-29   
dbj|GAD96544.1|  60S ribosomal protein L5                               122   5e-29   
ref|XP_006447904.1|  hypothetical protein CICLE_v10016107mg             115   5e-29   
emb|CDF91015.1|  ZYBA0S09-02894g1_1                                     120   5e-29   
gb|ESA07043.1|  hypothetical protein GLOINDRAFT_349608                  120   5e-29   
gb|ENH79878.1|  60s ribosomal protein l5                                120   5e-29   
dbj|GAK66444.1|  60S ribosomal protein L5                               120   5e-29   
ref|XP_004182559.1|  hypothetical protein TBLA_0J00400                  120   5e-29   
ref|XP_011442101.1|  PREDICTED: 60S ribosomal protein L5-like           120   5e-29   
ref|XP_002544923.1|  60S ribosomal protein L5                           120   5e-29   
ref|XP_001966910.1|  GF22760                                            120   5e-29   
gb|ETS60256.1|  hypothetical protein PaG_05805                          122   6e-29   
gb|EFN62999.1|  60S ribosomal protein L5                                124   6e-29   
gb|EPX72323.1|  60S ribosomal protein L5                                120   6e-29   
dbj|GAC77690.1|  60S ribosomal protein L5                               121   6e-29   
ref|XP_002845089.1|  60S ribosomal protein L5                           120   6e-29   
ref|XP_011054859.1|  PREDICTED: 60S ribosomal protein L5                120   7e-29   
emb|CDH08743.1|  probable 60S ribosomal protein L5                      120   7e-29   



>ref|XP_004240444.1| PREDICTED: 60S ribosomal protein L5-like [Solanum lycopersicum]
Length=301

 Score =   224 bits (572),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 133/159 (84%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             ESRRPFRALLDVGL+RTTTGNRVFGA KGALDGG+DIPHSEKRFAG++KDSK LDAEVH
Sbjct  135  AESRRPFRALLDVGLLRTTTGNRVFGALKGALDGGIDIPHSEKRFAGYSKDSKQLDAEVH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYIYGGHVAAYMN+L EDE EK QTHFS YIK G+EADN+E +YKKVHAAIRADPSPKK
Sbjct  195  RKYIYGGHVAAYMNTLMEDEPEKYQTHFSLYIKAGLEADNLEEMYKKVHAAIRADPSPKK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAGN  141
            S KQPPK HKR+  KKLTY+ER+AKLIER NALNAA GN
Sbjct  255  SGKQPPKTHKRYNLKKLTYEERKAKLIERLNALNAAGGN  293



>ref|XP_011089578.1| PREDICTED: 60S ribosomal protein L5-like [Sesamum indicum]
Length=302

 Score =   224 bits (571),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 133/159 (84%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             ESRRPFRALLDVGL++TTTGNRVFGA KGALDGGLDIPHS+KRFAGF+KD+K LDAEVH
Sbjct  135  AESRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSDKRFAGFSKDNKQLDAEVH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYIYGGHV+AYMN+L EDE EK Q+HFS YIKK IE DNIEA+YKKVHAAIRADP+ KK
Sbjct  195  RKYIYGGHVSAYMNTLMEDEPEKYQSHFSEYIKKSIEPDNIEAMYKKVHAAIRADPTEKK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAGN  141
            SEKQPPKEHKR+  KKLTY+ER+AKLIER NALNAAAGN
Sbjct  255  SEKQPPKEHKRYNLKKLTYEERKAKLIERLNALNAAAGN  293



>ref|XP_009801702.1| PREDICTED: 60S ribosomal protein L5-like [Nicotiana sylvestris]
Length=301

 Score =   222 bits (566),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             ESRRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHSEKRFAGF+KDSK LDA+VH
Sbjct  135  AESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDADVH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYIYGGHVA YM +L EDE EK Q+HFS YIK+G+EAD++E +YKKVHAAIRADPSPKK
Sbjct  195  RKYIYGGHVATYMKTLTEDEPEKYQSHFSEYIKQGLEADDLEEMYKKVHAAIRADPSPKK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAGN  141
            SEKQPPK+HKR+  KKLTY+ER+AKLIER NALN+AAGN
Sbjct  255  SEKQPPKQHKRYNLKKLTYEERKAKLIERLNALNSAAGN  293



>ref|XP_009611190.1| PREDICTED: 60S ribosomal protein L5-like [Nicotiana tomentosiformis]
Length=301

 Score =   222 bits (565),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             ESRRPFRALLDVGLIRTTTGNRVFGA KGALDGG+DIPHSEKRFAGF+KDSK LDA+VH
Sbjct  135  AESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGIDIPHSEKRFAGFSKDSKQLDADVH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYIYGGHVA YM +L EDE EK Q+HFS YIK+G+EAD++E +YKKVHAAIRADPSPKK
Sbjct  195  RKYIYGGHVATYMKTLTEDEPEKYQSHFSEYIKQGLEADDLEEMYKKVHAAIRADPSPKK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAGN  141
            SEKQPPK+HKR+  KKLTY+ER+AKLIER NALN+AAGN
Sbjct  255  SEKQPPKQHKRYNLKKLTYEERKAKLIERLNALNSAAGN  293



>ref|XP_010069235.1| PREDICTED: 60S ribosomal protein L5 [Eucalyptus grandis]
 gb|KCW57513.1| hypothetical protein EUGRSUZ_H00286 [Eucalyptus grandis]
Length=301

 Score =   221 bits (564),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             E+RRPFRALLDVGL+RTTTGNRVFGA KGALDGGLDIPHSEKRFAGF+KDSK LDAEVH
Sbjct  135  AETRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDAEVH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYIYGGHV+AYM+SL EDE EK Q+HFS YIKKGIE D+ EALYKKVHAAIRADP+ KK
Sbjct  195  RKYIYGGHVSAYMSSLMEDEPEKYQSHFSEYIKKGIEPDDFEALYKKVHAAIRADPTLKK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
            S+K  PKEHKRF  KKLTY+ER+ KLIER NALN+AAG
Sbjct  255  SDKPVPKEHKRFNLKKLTYEERKQKLIERLNALNSAAG  292



>ref|NP_001274803.1| uncharacterized protein LOC102577675 [Solanum tuberosum]
 gb|ABB16983.1| unknown [Solanum tuberosum]
Length=302

 Score =   221 bits (563),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 130/159 (82%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             ESRRPFRALLDVGL+RTTTGNRVFGA KGALDGG+DIPHSEKRFAG++KDSK LDAEVH
Sbjct  135  AESRRPFRALLDVGLLRTTTGNRVFGALKGALDGGIDIPHSEKRFAGYSKDSKQLDAEVH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RK+IYGGHV AYMN+L EDE EK QTHFS YIK G+EADN+E +YKKVHAAIRADP PKK
Sbjct  195  RKFIYGGHVTAYMNTLMEDEPEKYQTHFSLYIKAGLEADNLEEMYKKVHAAIRADPCPKK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAGN  141
            S KQPPK HKR+  KKLTY+ER+AKLIER NALNAA GN
Sbjct  255  SGKQPPKTHKRYNLKKLTYEERKAKLIERLNALNAAGGN  293



>ref|XP_004242456.1| PREDICTED: 60S ribosomal protein L5 [Solanum lycopersicum]
Length=301

 Score =   221 bits (563),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 133/159 (84%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             ESRRPFRALLDVGL+RTTTGNRVFGA KGALDGGLDIPHSEKRFAGF+KDSK LDA+VH
Sbjct  135  AESRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDADVH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYIYGGHVA YM +L EDE EK QTHFS YIKKG EAD +E +YKKVHAAIRADPSPKK
Sbjct  195  RKYIYGGHVATYMQTLIEDEPEKYQTHFSQYIKKGFEADGLEEMYKKVHAAIRADPSPKK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAGN  141
            SEKQPPK+HKR+  KKLTY+ER+AKLIER NALN+AAGN
Sbjct  255  SEKQPPKQHKRYNLKKLTYEERKAKLIERLNALNSAAGN  293



>ref|XP_008243040.1| PREDICTED: 60S ribosomal protein L5 [Prunus mume]
Length=298

 Score =   221 bits (562),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 133/157 (85%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             ESRRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHSEKRFAGF+KDSK LD EVH
Sbjct  135  AESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDPEVH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYIYGGHVAAYM +L EDE EK QTHFS YIKKGIEADNIEA+YKKVHAAIRADP+ KK
Sbjct  195  RKYIYGGHVAAYMRTLMEDEPEKYQTHFSDYIKKGIEADNIEAVYKKVHAAIRADPTAKK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAA  147
             EKQPPKEHKR+  KKLTY+ER+ KLIER NA N+AA
Sbjct  255  IEKQPPKEHKRYNLKKLTYEERKNKLIERLNAFNSAA  291



>ref|XP_006366807.1| PREDICTED: 60S ribosomal protein L5-like [Solanum tuberosum]
Length=301

 Score =   221 bits (562),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             E+RRPFRALLDVGL+RTTTGNRVFGA KGALDGGLDIPHSEKRFAGF+KDSK LDAEVH
Sbjct  135  AENRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDAEVH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYIYGGHVA YM +L EDE EK QTHFS YIKKG+EAD +E +YKKVHAAIRADP PKK
Sbjct  195  RKYIYGGHVATYMKTLIEDEPEKYQTHFSEYIKKGLEADGLEEMYKKVHAAIRADPCPKK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAGN  141
            SEKQPPK+HKR+  KKLTY+ER+AKLIER NALN+AAGN
Sbjct  255  SEKQPPKQHKRYNLKKLTYEERKAKLIERLNALNSAAGN  293



>ref|XP_009626989.1| PREDICTED: 60S ribosomal protein L5-like [Nicotiana tomentosiformis]
Length=301

 Score =   221 bits (562),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 130/159 (82%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             ESRRPFRALLDVGLIRTTTGNRVFGA KGALDGG+DIPHSEKRFAGF KDSK LDA+VH
Sbjct  135  AESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGIDIPHSEKRFAGFGKDSKQLDADVH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYIYGGHV+AYM +L EDE EK Q+HFS YIK G+EAD++E +YKKVHAAIRADPS KK
Sbjct  195  RKYIYGGHVSAYMKTLMEDEPEKYQSHFSEYIKTGLEADDLEEMYKKVHAAIRADPSSKK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAGN  141
            S+KQPPK+HKR+  KKLTYDER+A+LIER NALNAAAGN
Sbjct  255  SDKQPPKQHKRYNLKKLTYDERKARLIERLNALNAAAGN  293



>ref|XP_008224357.1| PREDICTED: 60S ribosomal protein L5-2-like [Prunus mume]
Length=298

 Score =   220 bits (561),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            ESRRPFRALLDVGLIRTTTGNRVFGA KGALDGGLD+PHSEKRFAGF+KD+K LD++VHR
Sbjct  136  ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDVPHSEKRFAGFSKDNKQLDSDVHR  195

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
            KYIYGGHVAAYM  L+EDE EK QTHFSGYIKKG+EA+ IE +YKKVHAAIRADP+ K +
Sbjct  196  KYIYGGHVAAYMGILSEDEPEKFQTHFSGYIKKGVEAEGIEEMYKKVHAAIRADPTVKLT  255

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAGN  141
            EK+  KEHKRF  KKLTYDER+ KLIER NA N+AAG+
Sbjct  256  EKKEVKEHKRFNLKKLTYDERKEKLIERLNAFNSAAGD  293



>ref|XP_004246241.1| PREDICTED: 60S ribosomal protein L5 [Solanum lycopersicum]
Length=301

 Score =   220 bits (560),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             ESRRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPH EKRFAGF+KDSK LDAEVH
Sbjct  135  AESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHGEKRFAGFSKDSKQLDAEVH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYIYGGHVA YM +L EDE EK  +HFSGYIK+G+EADN+E +YKKVHAAIRA+PSPKK
Sbjct  195  RKYIYGGHVATYMKTLIEDEPEKYLSHFSGYIKRGLEADNLEEMYKKVHAAIRAEPSPKK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAGN  141
            SEKQPPK+HKR+  KKLTY+ER+AKLIER NALN+AAGN
Sbjct  255  SEKQPPKKHKRYNLKKLTYEERKAKLIERLNALNSAAGN  293



>gb|KCW57514.1| hypothetical protein EUGRSUZ_H00286 [Eucalyptus grandis]
Length=365

 Score =   222 bits (565),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             E+RRPFRALLDVGL+RTTTGNRVFGA KGALDGGLDIPHSEKRFAGF+KDSK LDAEVH
Sbjct  199  AETRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDAEVH  258

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYIYGGHV+AYM+SL EDE EK Q+HFS YIKKGIE D+ EALYKKVHAAIRADP+ KK
Sbjct  259  RKYIYGGHVSAYMSSLMEDEPEKYQSHFSEYIKKGIEPDDFEALYKKVHAAIRADPTLKK  318

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
            S+K  PKEHKRF  KKLTY+ER+ KLIER NALN+AAG
Sbjct  319  SDKPVPKEHKRFNLKKLTYEERKQKLIERLNALNSAAG  356



>gb|EYU46086.1| hypothetical protein MIMGU_mgv1a010702mg [Erythranthe guttata]
Length=304

 Score =   219 bits (558),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 127/159 (80%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             E+RRPFRALLDVGLI+TTTGNRVFGA KGALDGGLDIPHS+KRFAG+ KD+K LD EVH
Sbjct  135  AETRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDKRFAGYNKDNKQLDPEVH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYIYGGHVA+YMN+L EDE +K Q+HFS Y+KKG+EADNIE +YKKVHAAIRADP+PKK
Sbjct  195  RKYIYGGHVASYMNTLMEDEPDKYQSHFSKYVKKGVEADNIEEMYKKVHAAIRADPTPKK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAGN  141
            S+KQ PK+HKR+  KKLTY+ER+AKLIER NALNAAAGN
Sbjct  255  SDKQQPKQHKRYNLKKLTYEERKAKLIERLNALNAAAGN  293



>ref|XP_010688411.1| PREDICTED: 60S ribosomal protein L5 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=306

 Score =   219 bits (558),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             E+RRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHS+KRFAGF+KD K LDAE H
Sbjct  137  AETRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFSKDGKQLDAETH  196

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYIYGGHVA YM +L EDE EK QTHFS Y+K+GIEAD +EALYKKVHAAIRADPS KK
Sbjct  197  RKYIYGGHVAGYMRTLMEDEPEKYQTHFSEYVKRGIEADGLEALYKKVHAAIRADPSVKK  256

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
            SEK  P++HKR+  KKLTYDER+A LIER NALNAAAG
Sbjct  257  SEKPQPQKHKRYNAKKLTYDERKASLIERLNALNAAAG  294



>ref|XP_010688412.1| PREDICTED: 60S ribosomal protein L5 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=304

 Score =   219 bits (558),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             E+RRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHS+KRFAGF+KD K LDAE H
Sbjct  135  AETRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFSKDGKQLDAETH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYIYGGHVA YM +L EDE EK QTHFS Y+K+GIEAD +EALYKKVHAAIRADPS KK
Sbjct  195  RKYIYGGHVAGYMRTLMEDEPEKYQTHFSEYVKRGIEADGLEALYKKVHAAIRADPSVKK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
            SEK  P++HKR+  KKLTYDER+A LIER NALNAAAG
Sbjct  255  SEKPQPQKHKRYNAKKLTYDERKASLIERLNALNAAAG  292



>ref|XP_006344345.1| PREDICTED: 60S ribosomal protein L5-like [Solanum tuberosum]
Length=301

 Score =   219 bits (557),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             ESRRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPH EKRFAGF+KDSK LDA+VH
Sbjct  135  AESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHGEKRFAGFSKDSKQLDADVH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYIYGGHVA YM +L EDE EK Q+HFS YIK+G+EADN+E +YKKVHAAIRA+PSPKK
Sbjct  195  RKYIYGGHVATYMKTLIEDEPEKYQSHFSEYIKRGLEADNLEEMYKKVHAAIRAEPSPKK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAGN  141
            SEKQPPK+HKR+  KKLTY+ER+AKLIER NALN+AAGN
Sbjct  255  SEKQPPKKHKRYNLKKLTYEERKAKLIERLNALNSAAGN  293



>gb|KJB71614.1| hypothetical protein B456_011G133700 [Gossypium raimondii]
Length=298

 Score =   218 bits (556),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            ++RRPFRALLDVGLIRTTTGNRVFGA KGALD GLDIPHS+KRFAGF+KD+K LDAEVH 
Sbjct  136  DTRRPFRALLDVGLIRTTTGNRVFGALKGALDAGLDIPHSDKRFAGFSKDNKQLDAEVHS  195

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
            KYIYGGHVAAYM +L EDE EK Q+HFS YIK+GIEADNIE+LYKKVHAAIRADP+ KK+
Sbjct  196  KYIYGGHVAAYMRTLMEDEPEKYQSHFSEYIKRGIEADNIESLYKKVHAAIRADPTAKKT  255

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAGN  141
            EK+PPK+HKRF  KKLTY+ER+AKLIER + LNAAAG+
Sbjct  256  EKEPPKQHKRFNLKKLTYEERKAKLIERLHTLNAAAGD  293



>ref|XP_007223197.1| hypothetical protein PRUPE_ppa009300mg [Prunus persica]
 gb|EMJ24396.1| hypothetical protein PRUPE_ppa009300mg [Prunus persica]
Length=298

 Score =   218 bits (555),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            ESRRPFRALLDVGLIRTTTGNRVFGA KGALDGGLD+PHSEKRFAGF+KD+K LD++VHR
Sbjct  136  ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDVPHSEKRFAGFSKDNKQLDSDVHR  195

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
            KYIYGGHVAAYM  L+EDE EK QTHFS YIKKG+EA+ IE +YKKVHAAIRADP+ K +
Sbjct  196  KYIYGGHVAAYMGILSEDEPEKFQTHFSAYIKKGVEAEGIEEMYKKVHAAIRADPTVKLT  255

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAGN  141
            EK+  KEHKRF  KKLTYDER+ KLIER NA N+AAG+
Sbjct  256  EKKEVKEHKRFNLKKLTYDERKEKLIERLNAFNSAAGD  293



>ref|XP_009767919.1| PREDICTED: 60S ribosomal protein L5 [Nicotiana sylvestris]
Length=302

 Score =   218 bits (555),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 128/159 (81%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             ESRRPFRALLDVGLIRTTTGNRVFGA KGALDGG+DIPHSEKRFAGF+KDSK LDA+VH
Sbjct  135  AESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGIDIPHSEKRFAGFSKDSKQLDADVH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            R YIYGGHVA YM +L EDE EK Q+HFS YIKKG+EAD +E +YKKVHAAIRADP+ KK
Sbjct  195  RNYIYGGHVATYMKTLIEDEPEKYQSHFSEYIKKGLEADGLEEMYKKVHAAIRADPTFKK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAGN  141
            S+KQPPK+HKR+  KKLTY+ER+AKLIER NALN+AAGN
Sbjct  255  SDKQPPKQHKRYNLKKLTYEERKAKLIERLNALNSAAGN  293



>ref|XP_004296367.1| PREDICTED: 60S ribosomal protein L5-like [Fragaria vesca subsp. 
vesca]
Length=300

 Score =   218 bits (554),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 126/157 (80%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
            GESRRPFRALLDVGL+RTTTGNRVFGA KGALDGG+D+PHSEKRFAGF+KDSK+LDAE H
Sbjct  135  GESRRPFRALLDVGLVRTTTGNRVFGALKGALDGGIDVPHSEKRFAGFSKDSKSLDAETH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYIYGGHVAAYM +L EDE EK QTHFS YIKKGIEA+ IE LYKKVHAAIRADP  KK
Sbjct  195  RKYIYGGHVAAYMGTLIEDEPEKYQTHFSEYIKKGIEAEGIEELYKKVHAAIRADPLEKK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAA  147
            + K  PK+HKRF  KKLTY+ER+ KLIER NA N+AA
Sbjct  255  TAKPEPKQHKRFNLKKLTYEERKNKLIERLNAFNSAA  291



>ref|XP_009625828.1| PREDICTED: 60S ribosomal protein L5 [Nicotiana tomentosiformis]
Length=302

 Score =   218 bits (554),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 128/159 (81%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             ESRRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHSEKRFAGF+KDSK LDA+VH
Sbjct  135  AESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDADVH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            R YIYGGHVA YM +L EDE EK Q+HFS YIKKG+EAD++E +YKKVHAAIRADP+ KK
Sbjct  195  RNYIYGGHVATYMKTLIEDEPEKYQSHFSEYIKKGLEADHLEEMYKKVHAAIRADPTFKK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAGN  141
            S+K PPK+HKR+  KKLTY+ER+AKLIER NALN+AAGN
Sbjct  255  SDKHPPKQHKRYNLKKLTYEERKAKLIERLNALNSAAGN  293



>ref|XP_007033700.1| Ribosomal protein L5 B isoform 1 [Theobroma cacao]
 gb|EOY04626.1| Ribosomal protein L5 B isoform 1 [Theobroma cacao]
Length=298

 Score =   217 bits (553),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 129/157 (82%), Positives = 145/157 (92%), Gaps = 0/157 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            ++RRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHS+KRFAGF+KDSK LDAEVHR
Sbjct  136  DTRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFSKDSKQLDAEVHR  195

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
            KY+YGGHVAAYM +L EDE EK Q+HFS YIK+GIEAD++EALYKKVHAAIRADP+ KKS
Sbjct  196  KYLYGGHVAAYMRTLMEDEPEKYQSHFSEYIKRGIEADDLEALYKKVHAAIRADPTAKKS  255

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
            EK+PPKEHKRF  KKLTY+ER+AKLIER + LN+AAG
Sbjct  256  EKEPPKEHKRFNLKKLTYEERKAKLIERLHTLNSAAG  292



>emb|CDP18434.1| unnamed protein product [Coffea canephora]
Length=332

 Score =   218 bits (556),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 130/159 (82%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             +SRRPFRALLDVGL+RTTTGNRVFGA KGALDGGLDIPH EKRFAGF K+SK LD EVH
Sbjct  165  ADSRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHGEKRFAGFDKESKQLDPEVH  224

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYIYGGHVAAYM +L EDE E+ Q+HFS YIK+G+EADNIE LYKKVHAAIRAD S KK
Sbjct  225  RKYIYGGHVAAYMRTLIEDEPERYQSHFSEYIKRGLEADNIEELYKKVHAAIRADSSAKK  284

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAGN  141
            SEK+PPKEHKR+  KKLTY+ERRAKLIER NALN+AAGN
Sbjct  285  SEKEPPKEHKRYNLKKLTYEERRAKLIERLNALNSAAGN  323



>ref|XP_007033701.1| Ribosomal protein L5 B isoform 2 [Theobroma cacao]
 gb|EOY04627.1| Ribosomal protein L5 B isoform 2 [Theobroma cacao]
Length=299

 Score =   217 bits (553),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 129/157 (82%), Positives = 145/157 (92%), Gaps = 0/157 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            ++RRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHS+KRFAGF+KDSK LDAEVHR
Sbjct  137  DTRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFSKDSKQLDAEVHR  196

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
            KY+YGGHVAAYM +L EDE EK Q+HFS YIK+GIEAD++EALYKKVHAAIRADP+ KKS
Sbjct  197  KYLYGGHVAAYMRTLMEDEPEKYQSHFSEYIKRGIEADDLEALYKKVHAAIRADPTAKKS  256

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
            EK+PPKEHKRF  KKLTY+ER+AKLIER + LN+AAG
Sbjct  257  EKEPPKEHKRFNLKKLTYEERKAKLIERLHTLNSAAG  293



>ref|XP_004287154.1| PREDICTED: 60S ribosomal protein L5 [Fragaria vesca subsp. vesca]
Length=299

 Score =   217 bits (552),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 128/156 (82%), Positives = 137/156 (88%), Gaps = 0/156 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            ESRRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHSEKRFAGF+KDSK LDAEVH 
Sbjct  136  ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDAEVHH  195

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
            KYIYGGHVAAYM +L EDE EK QTHFS Y+KKGIEADNIE +YKKVHAAIRADP+ KKS
Sbjct  196  KYIYGGHVAAYMRTLMEDEPEKYQTHFSEYLKKGIEADNIEEVYKKVHAAIRADPTMKKS  255

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAA  147
             K  P EHKR+  KKLTY+ER+ KLIER NA N+AA
Sbjct  256  SKPQPSEHKRWNLKKLTYEERKNKLIERLNAFNSAA  291



>ref|XP_009358396.1| PREDICTED: 60S ribosomal protein L5-1-like [Pyrus x bretschneideri]
Length=299

 Score =   216 bits (551),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 130/153 (85%), Positives = 138/153 (90%), Gaps = 0/153 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             ESRRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHSEKRFAGF+KDSK LDAEVH
Sbjct  135  AESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDAEVH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYIYGGHVAAYMN+L EDE EK QTHFS YIKKGIEADNIE LYKKVHAAIRADP+PKK
Sbjct  195  RKYIYGGHVAAYMNTLGEDEPEKYQTHFSEYIKKGIEADNIEELYKKVHAAIRADPTPKK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNAL  159
            +EKQPP EHKR+  KKLT+DER+ KL+ER  A 
Sbjct  255  TEKQPPTEHKRYNLKKLTFDERKKKLVERLTAF  287



>ref|XP_009774634.1| PREDICTED: 60S ribosomal protein L5-like [Nicotiana sylvestris]
Length=301

 Score =   216 bits (551),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 127/159 (80%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             E RRPFRALLDVGLIRTTTGNRVFGA KGALDGG+DIPHSEKRFAGF KDSK LDA+VH
Sbjct  135  AEGRRPFRALLDVGLIRTTTGNRVFGALKGALDGGIDIPHSEKRFAGFGKDSKQLDADVH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYIYGGHV+AYM +L EDE EK Q+HF+ YIK G+EAD++E +YKKVHAAIRADPS KK
Sbjct  195  RKYIYGGHVSAYMKTLMEDEPEKYQSHFNEYIKTGLEADDLEEMYKKVHAAIRADPSSKK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAGN  141
             +KQPPK+HKR+  KKLTYDER+A+LIER NALNAAAGN
Sbjct  255  FDKQPPKQHKRYNLKKLTYDERKARLIERLNALNAAAGN  293



>ref|XP_008394277.1| PREDICTED: 60S ribosomal protein L5-like [Malus domestica]
 ref|XP_008394278.1| PREDICTED: 60S ribosomal protein L5-like [Malus domestica]
 ref|XP_008367741.1| PREDICTED: 60S ribosomal protein L5 [Malus domestica]
Length=299

 Score =   216 bits (551),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 130/153 (85%), Positives = 138/153 (90%), Gaps = 0/153 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             ESRRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHSEKRFAGF+KDSK LDAEVH
Sbjct  135  AESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDAEVH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYIYGGHVAAYMN+L EDE EK QTHFS YIKKGIEADNIE LYKKVHAAIRADP+ KK
Sbjct  195  RKYIYGGHVAAYMNTLGEDEPEKYQTHFSEYIKKGIEADNIEELYKKVHAAIRADPTAKK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNAL  159
            +EKQPPKEHKR+  KKLT+DER+ KL+ER  A 
Sbjct  255  TEKQPPKEHKRYNLKKLTFDERKKKLVERLTAF  287



>ref|XP_010679028.1| PREDICTED: 60S ribosomal protein L5 [Beta vulgaris subsp. vulgaris]
Length=304

 Score =   216 bits (551),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 125/157 (80%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            E+RRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHS+KRFAGF+KD K LDAE HR
Sbjct  136  ETRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFSKDGKQLDAEAHR  195

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
            KYIYGGHV+ YM +L EDE EK QTHFS Y+K+GI+AD +EALYKKVHAAIRADP+ K+S
Sbjct  196  KYIYGGHVSGYMKTLMEDEPEKYQTHFSEYVKRGIDADGLEALYKKVHAAIRADPTAKQS  255

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
            EK+ PK HKR+  KKLTYDER+A LIER NALNAAAG
Sbjct  256  EKEAPKTHKRYNLKKLTYDERKASLIERLNALNAAAG  292



>gb|KJB84075.1| hypothetical protein B456_N001600 [Gossypium raimondii]
 gb|KJB84076.1| hypothetical protein B456_N001600 [Gossypium raimondii]
Length=186

 Score =   212 bits (540),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
            GESRRPFR+LLDVGL+RTTTGNRVFG  KGALDGG+DIPHSEKRFAGF KD+K LD EVH
Sbjct  21   GESRRPFRSLLDVGLVRTTTGNRVFGVLKGALDGGIDIPHSEKRFAGFNKDNKQLDPEVH  80

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYIYGGHVA+YM +L EDE EK Q+HFS YIK+GIEADN+E +YKKVHAAIRA+P  KK
Sbjct  81   RKYIYGGHVASYMRTLMEDEPEKYQSHFSEYIKRGIEADNLEGVYKKVHAAIRANPEAKK  140

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
            SEK PPKEHKR+  KKL+Y+ER+AKLI+R  ALN+AAG
Sbjct  141  SEKPPPKEHKRYNLKKLSYEERKAKLIDRLKALNSAAG  178



>ref|XP_010273742.1| PREDICTED: 60S ribosomal protein L5-like [Nelumbo nucifera]
Length=302

 Score =   216 bits (550),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 129/157 (82%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            ESRRPFRALLDVGL+RTTTGNRVFGA KGALDGGLDIPHS+KRFAGF K+ K LD EVHR
Sbjct  136  ESRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKEEKQLDPEVHR  195

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
            KYIYGGHVA+YM +LNEDE EK Q+HFS YI KGI+ADNIE LY+KVHAAIRADP+ KKS
Sbjct  196  KYIYGGHVASYMRALNEDEPEKYQSHFSEYINKGIDADNIEELYRKVHAAIRADPTTKKS  255

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
            EKQPPKEHKR+  KKLTY+ERR+KLIER NALN+AAG
Sbjct  256  EKQPPKEHKRYNLKKLTYEERRSKLIERLNALNSAAG  292



>ref|XP_002524859.1| ribosomal protein L5, putative [Ricinus communis]
 gb|EEF37483.1| ribosomal protein L5, putative [Ricinus communis]
Length=299

 Score =   214 bits (546),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             ++RRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHSEKRFAGF+KD K LD+EVH
Sbjct  135  ADTRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDGKQLDSEVH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYIYGGHVAAYMN+L EDE EK Q+HFS YIK G+EAD+IEALYKKVHAAIRADPSPKK
Sbjct  195  RKYIYGGHVAAYMNTLMEDEPEKYQSHFSKYIKSGVEADDIEALYKKVHAAIRADPSPKK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNA  153
            SEKQPPKEHKR+  KKLTY+ER+AKLIER  ALN+
Sbjct  255  SEKQPPKEHKRYNLKKLTYEERKAKLIERLQALNS  289



>ref|XP_009366222.1| PREDICTED: 60S ribosomal protein L5-1-like [Pyrus x bretschneideri]
Length=302

 Score =   214 bits (545),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 126/156 (81%), Positives = 137/156 (88%), Gaps = 0/156 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             ESRRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHSEKRFAGF+KDSK LDAEVH
Sbjct  135  AESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDAEVH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYIYGGHVAAYM +L +DE EK Q+HFS YIKKGIEADNIE LYKKVHAAIRADP+ KK
Sbjct  195  RKYIYGGHVAAYMTTLADDEPEKYQSHFSEYIKKGIEADNIEELYKKVHAAIRADPTIKK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAA  150
            +EK  P+EHKR+  KKLT+DER+ KL+ER  A N A
Sbjct  255  TEKPAPQEHKRYNLKKLTFDERKKKLVERLKAFNEA  290



>ref|XP_009410739.1| PREDICTED: 60S ribosomal protein L5 [Musa acuminata subsp. malaccensis]
Length=302

 Score =   214 bits (544),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
            GESRRPFRALLDVGL+RTTTGNRVFGA KGALDGGLDIPHS+KRFAGF KD K LDAEVH
Sbjct  135  GESRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDEKQLDAEVH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYI+GGHVA+YM +L EDE EK Q HFS YIKKGI+ D++E +YKKVHAAIRADP   K
Sbjct  195  RKYIFGGHVASYMKTLMEDEPEKYQAHFSEYIKKGIDPDDMEEMYKKVHAAIRADPIAVK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
            S K PPKEHKR+  KKLTY+ER+AKLIER NALNA+AG
Sbjct  255  STKPPPKEHKRYNLKKLTYEERKAKLIERLNALNASAG  292



>ref|XP_008384135.1| PREDICTED: 60S ribosomal protein L5-1-like [Malus domestica]
Length=302

 Score =   214 bits (544),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 126/156 (81%), Positives = 137/156 (88%), Gaps = 0/156 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             ESRRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHSEKRFAGF+KDSK LDAEVH
Sbjct  135  AESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDAEVH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYIYGGHVAAYM +L +DE EK Q+HFS YIKKGIEADNIE LYKKVHAAIRADP+ KK
Sbjct  195  RKYIYGGHVAAYMTTLADDEPEKFQSHFSEYIKKGIEADNIEELYKKVHAAIRADPTIKK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAA  150
            +EK  P+EHKR+  KKLT+DER+ KL+ER  A N A
Sbjct  255  TEKPAPQEHKRYNLKKLTFDERKKKLVERLKAFNEA  290



>gb|KJB84074.1| hypothetical protein B456_N001600 [Gossypium raimondii]
Length=252

 Score =   212 bits (540),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
            GESRRPFR+LLDVGL+RTTTGNRVFG  KGALDGG+DIPHSEKRFAGF KD+K LD EVH
Sbjct  87   GESRRPFRSLLDVGLVRTTTGNRVFGVLKGALDGGIDIPHSEKRFAGFNKDNKQLDPEVH  146

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYIYGGHVA+YM +L EDE EK Q+HFS YIK+GIEADN+E +YKKVHAAIRA+P  KK
Sbjct  147  RKYIYGGHVASYMRTLMEDEPEKYQSHFSEYIKRGIEADNLEGVYKKVHAAIRANPEAKK  206

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
            SEK PPKEHKR+  KKL+Y+ER+AKLI+R  ALN+AAG
Sbjct  207  SEKPPPKEHKRYNLKKLSYEERKAKLIDRLKALNSAAG  244



>gb|KCW46049.1| hypothetical protein EUGRSUZ_L00023 [Eucalyptus grandis]
Length=301

 Score =   213 bits (542),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             E+RRPFRALLDVGL+RTTTGNRVFGA KGALDGGLDIPHS+KRFAGF+KDSK LD +VH
Sbjct  135  AETRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFSKDSKQLDVDVH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYIYGGHVAAYM +L EDE EK Q+HFS YIK+G+EAD++E LYKKVHAAIRADP  KK
Sbjct  195  RKYIYGGHVAAYMRTLAEDEPEKYQSHFSEYIKRGLEADDLEGLYKKVHAAIRADPILKK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
            SEK+PPKEHKRF  +KLTY+ER+AKL+ER NALN+A G
Sbjct  255  SEKEPPKEHKRFNLRKLTYEERKAKLVERLNALNSAGG  292



>ref|XP_006371546.1| hypothetical protein POPTR_0019s13040g [Populus trichocarpa]
 gb|ABK95061.1| unknown [Populus trichocarpa]
 gb|ERP49343.1| hypothetical protein POPTR_0019s13040g [Populus trichocarpa]
Length=297

 Score =   213 bits (542),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 127/159 (80%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             +SRRPFRALLDVGL+RTTTGNRVFGA KGALDGGLDIPHS+KRFAGF KD+K LDAEVH
Sbjct  135  ADSRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFAKDNKQLDAEVH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYIYGGHVAAYM +L EDE EK Q+HFS Y+K+GI+AD +EALYKKVHAAIRADP+ KK
Sbjct  195  RKYIYGGHVAAYMRTLMEDEPEKYQSHFSEYLKRGIDADGMEALYKKVHAAIRADPTAKK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAGN  141
            SEKQPPKEHKR+  KKLTY+ER+AKL+ER NALN+AA +
Sbjct  255  SEKQPPKEHKRYNLKKLTYEERKAKLVERLNALNSAADD  293



>ref|XP_002524558.1| ribosomal protein L5, putative [Ricinus communis]
 gb|EEF37766.1| ribosomal protein L5, putative [Ricinus communis]
Length=298

 Score =   213 bits (541),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 128/159 (81%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
            GESRRPFRALLDVGL+RTTTGNRVFGA KGALDGGLDIPHSEKRFAGF K+SK LD+EVH
Sbjct  135  GESRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFNKESKQLDSEVH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYIYGGHVAAYM  L EDE EK Q+HFS YIKKG++ DN+E +YKKVHAAIRADPS KK
Sbjct  195  RKYIYGGHVAAYMRMLLEDEPEKYQSHFSEYIKKGVDPDNMEEMYKKVHAAIRADPSAKK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAGN  141
            +EKQPPKEHKR+  KKLTY+ER+AKLIER  ALN+AA +
Sbjct  255  TEKQPPKEHKRYNLKKLTYEERKAKLIERLTALNSAADD  293



>ref|XP_010547178.1| PREDICTED: 60S ribosomal protein L5-2-like [Tarenaya hassleriana]
Length=304

 Score =   213 bits (541),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 128/157 (82%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            ++RRPFRALLDVGL+RTTTGNRVFGA KGALDGGLDIPHS+KRFAGF K+SK LD EVHR
Sbjct  136  DTRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKESKQLDPEVHR  195

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
            KYIYGGH+A YM  LNEDE EK Q+HFS YIK+GIEADN+EALYKKVHAAIRADPS KKS
Sbjct  196  KYIYGGHIADYMRLLNEDEPEKYQSHFSEYIKRGIEADNMEALYKKVHAAIRADPSVKKS  255

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
            EKQPPKEHKRF  KKLTY+ER+A+LIER  ALN+A G
Sbjct  256  EKQPPKEHKRFNAKKLTYEERKARLIERLKALNSAGG  292



>ref|XP_006492784.1| PREDICTED: 60S ribosomal protein L5-like [Citrus sinensis]
Length=296

 Score =   212 bits (540),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 124/156 (79%), Positives = 141/156 (90%), Gaps = 0/156 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             ++RRPFRALLDVGLI+TTTGNRVFGA KGALDGGLDIPHS+KRFAGF+KD K LDAEVH
Sbjct  135  ADTRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDKRFAGFSKDGKQLDAEVH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYIYGGHVAAYM++L EDE EK Q+HF+ YIKKGI+AD +EALYKKVHAAIRADP+ KK
Sbjct  195  RKYIYGGHVAAYMSTLMEDEPEKYQSHFTEYIKKGIDADGLEALYKKVHAAIRADPTMKK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAA  150
            SEK  PKEHKR+  KKLTY+ER+AKL+ER NALN+A
Sbjct  255  SEKPAPKEHKRYNLKKLTYEERKAKLVERLNALNSA  290



>emb|CDP17898.1| unnamed protein product [Coffea canephora]
Length=359

 Score =   214 bits (545),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 128/159 (81%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
            G+SRRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHSEKRFAGF K++K LD EVH
Sbjct  189  GDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFDKETKQLDPEVH  248

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYI+GGHVAAYM +L EDE E+ Q+HFS Y K+G+EADN+E LYKKVHAAIRADP+PKK
Sbjct  249  RKYIFGGHVAAYMRTLAEDEPERYQSHFSEYHKRGLEADNLEELYKKVHAAIRADPTPKK  308

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAGN  141
            SEK PPKEHKR+  KKLTY+ER+A LIER NALN+AAGN
Sbjct  309  SEKAPPKEHKRYNLKKLTYEERKASLIERLNALNSAAGN  347



>gb|KDO45957.1| hypothetical protein CISIN_1g0225141mg [Citrus sinensis]
Length=296

 Score =   212 bits (540),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 124/156 (79%), Positives = 141/156 (90%), Gaps = 0/156 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             ++RRPFRALLDVGLI+TTTGNRVFGA KGALDGGLDIPHS+KRFAGF+KD K LDAEVH
Sbjct  135  ADTRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDKRFAGFSKDGKQLDAEVH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYIYGGHVAAYM++L EDE EK Q+HF+ YIKKGI+AD +EALYKKVHAAIRADP+ KK
Sbjct  195  RKYIYGGHVAAYMSTLMEDEPEKYQSHFTEYIKKGIDADGLEALYKKVHAAIRADPTMKK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAA  150
            SEK  PKEHKR+  KKLTY+ER+AKL+ER NALN+A
Sbjct  255  SEKPAPKEHKRYNLKKLTYEERKAKLVERLNALNSA  290



>gb|KDP35145.1| hypothetical protein JCGZ_10679 [Jatropha curcas]
Length=298

 Score =   212 bits (540),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            ++RRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHS+KRFAGFTKD+K LDAEVHR
Sbjct  136  DNRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFTKDNKQLDAEVHR  195

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
            KYIYGGHVAAYM +L EDE EK QTHFS Y+K+GIE DN+EALYKKVHAAIRADP+ KK 
Sbjct  196  KYIYGGHVAAYMKTLMEDEPEKYQTHFSEYVKRGIEPDNLEALYKKVHAAIRADPTLKKI  255

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNA  153
            EKQPPKEHKR+  +KLTY+ER+AKLIER  ALN+
Sbjct  256  EKQPPKEHKRYNLRKLTYEERKAKLIERLQALNS  289



>ref|XP_010258446.1| PREDICTED: 60S ribosomal protein L5 [Nelumbo nucifera]
Length=303

 Score =   212 bits (540),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            E+RRPFRALLDVGL+RTTTGNRVFGA KGALDGGLDIPHS+KRFAGF K+ K LD EVHR
Sbjct  136  ENRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKEDKQLDPEVHR  195

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
            KYIYGGHVA+YM +L EDE EK Q+HFS YIK+GIEADNIE LYKKVHAAIRADP+ KKS
Sbjct  196  KYIYGGHVASYMRALMEDEPEKYQSHFSEYIKRGIEADNIEELYKKVHAAIRADPTIKKS  255

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
            EK+PPKEHKR+  KKLTY+ER++KLIER NALN+AAG
Sbjct  256  EKEPPKEHKRYNLKKLTYEERKSKLIERLNALNSAAG  292



>gb|EMT04099.1| 60S ribosomal protein L5-2 [Aegilops tauschii]
Length=298

 Score =   212 bits (539),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             + RRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHS+KRFAGF KD K LDAE+H
Sbjct  132  ADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDEKQLDAEIH  191

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYIYGGHVA YM SL ++E EK Q+HFS YIKKGIEADN+EALYKKVHAAIRADP+  K
Sbjct  192  RKYIYGGHVADYMKSLADEEPEKYQSHFSEYIKKGIEADNMEALYKKVHAAIRADPTMAK  251

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
            S K+PPK HKR+  KKLTY++R+A L+ER NALN++AG
Sbjct  252  STKEPPKTHKRYNPKKLTYEQRKASLVERLNALNSSAG  289



>ref|XP_011002862.1| PREDICTED: 60S ribosomal protein L5 [Populus euphratica]
Length=297

 Score =   212 bits (539),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 125/157 (80%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             +SRRPFRALLDVGL+RTTTGNRVFGA KGALDGGLDIPHS+KRFAG+ KD+K LDAEVH
Sbjct  135  ADSRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSDKRFAGYAKDNKQLDAEVH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYIYGGHVAAYM +L EDE EK Q+HFS Y+K+GI+AD +EALYKKVHAAIRADP+ KK
Sbjct  195  RKYIYGGHVAAYMRTLMEDEPEKYQSHFSEYLKRGIDADGMEALYKKVHAAIRADPTAKK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAA  147
            SEKQP KEHKR+  KKLTY+ER+AKL+ER NALN+AA
Sbjct  255  SEKQPSKEHKRYNLKKLTYEERKAKLVERLNALNSAA  291



>gb|KJB84072.1| hypothetical protein B456_N001600 [Gossypium raimondii]
Length=300

 Score =   211 bits (538),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
            GESRRPFR+LLDVGL+RTTTGNRVFG  KGALDGG+DIPHSEKRFAGF KD+K LD EVH
Sbjct  135  GESRRPFRSLLDVGLVRTTTGNRVFGVLKGALDGGIDIPHSEKRFAGFNKDNKQLDPEVH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYIYGGHVA+YM +L EDE EK Q+HFS YIK+GIEADN+E +YKKVHAAIRA+P  KK
Sbjct  195  RKYIYGGHVASYMRTLMEDEPEKYQSHFSEYIKRGIEADNLEGVYKKVHAAIRANPEAKK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
            SEK PPKEHKR+  KKL+Y+ER+AKLI+R  ALN+AAG
Sbjct  255  SEKPPPKEHKRYNLKKLSYEERKAKLIDRLKALNSAAG  292



>gb|KJB84073.1| hypothetical protein B456_N001600 [Gossypium raimondii]
Length=297

 Score =   211 bits (538),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
            GESRRPFR+LLDVGL+RTTTGNRVFG  KGALDGG+DIPHSEKRFAGF KD+K LD EVH
Sbjct  132  GESRRPFRSLLDVGLVRTTTGNRVFGVLKGALDGGIDIPHSEKRFAGFNKDNKQLDPEVH  191

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYIYGGHVA+YM +L EDE EK Q+HFS YIK+GIEADN+E +YKKVHAAIRA+P  KK
Sbjct  192  RKYIYGGHVASYMRTLMEDEPEKYQSHFSEYIKRGIEADNLEGVYKKVHAAIRANPEAKK  251

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
            SEK PPKEHKR+  KKL+Y+ER+AKLI+R  ALN+AAG
Sbjct  252  SEKPPPKEHKRYNLKKLSYEERKAKLIDRLKALNSAAG  289



>ref|XP_010039360.1| PREDICTED: 60S ribosomal protein L5-like [Eucalyptus grandis]
Length=382

 Score =   214 bits (544),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             E+RRPFRALLDVGL+RTTTGNRVFGA KGALDGGLDIPHS+KRFAGF+KDSK LD +VH
Sbjct  216  AETRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFSKDSKQLDVDVH  275

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYIYGGHVAAYM +L EDE EK Q+HFS YIK+G+EAD++E LYKKVHAAIRADP  KK
Sbjct  276  RKYIYGGHVAAYMRTLAEDEPEKYQSHFSEYIKRGLEADDLEGLYKKVHAAIRADPILKK  335

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
            SEK+PPKEHKRF  +KLTY+ER+AKL+ER NALN+A G
Sbjct  336  SEKEPPKEHKRFNLRKLTYEERKAKLVERLNALNSAGG  373



>ref|XP_008367742.1| PREDICTED: 60S ribosomal protein L5-like [Malus domestica]
Length=302

 Score =   211 bits (537),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 127/159 (80%), Positives = 137/159 (86%), Gaps = 1/159 (1%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             ESRRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHSEKRFAGF+KDSK LD EVH
Sbjct  135  AESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDPEVH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYIYGGHVAAYM +L EDE EK Q+HFS YIKK IEADNIE LYKKVHAAIRADP+ KK
Sbjct  195  RKYIYGGHVAAYMXTLAEDEPEKYQSHFSEYIKKCIEADNIEELYKKVHAAIRADPTIKK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAGN  141
            +EK  P+EHKR+  KKLT+DER+ KL+ER  A N  AGN
Sbjct  255  TEKPAPQEHKRYNLKKLTFDERKMKLVERLKAFN-DAGN  292



>ref|XP_008394279.1| PREDICTED: 60S ribosomal protein L5-like [Malus domestica]
Length=302

 Score =   211 bits (536),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 127/159 (80%), Positives = 137/159 (86%), Gaps = 1/159 (1%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             ESRRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHSEKRFAGF+KDSK LD EVH
Sbjct  135  AESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDPEVH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYIYGGHVAAYM +L EDE EK Q+HFS YIKK IEADNIE LYKKVHAAIRADP+ KK
Sbjct  195  RKYIYGGHVAAYMXTLAEDEPEKYQSHFSEYIKKXIEADNIEELYKKVHAAIRADPTIKK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAGN  141
            +EK  P+EHKR+  KKLT+DER+ KL+ER  A N  AGN
Sbjct  255  TEKPAPQEHKRYNLKKLTFDERKMKLVERLKAFN-DAGN  292



>ref|XP_003577351.1| PREDICTED: 60S ribosomal protein L5-1-like [Brachypodium distachyon]
Length=302

 Score =   211 bits (536),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 124/157 (79%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            + RRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHS+KRFAGF KD K LDAEVHR
Sbjct  136  DERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDEKQLDAEVHR  195

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
            KYIYGGHVA YM SL ++E EK Q+HFS YIKKGI AD++EALYKKVHAAIRADPS  KS
Sbjct  196  KYIYGGHVADYMRSLADEEPEKFQSHFSEYIKKGISADDMEALYKKVHAAIRADPSMAKS  255

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
             K+PPK HKR+  KKLTYDER+A L++R NALNA+AG
Sbjct  256  TKEPPKTHKRYNLKKLTYDERKASLVQRLNALNASAG  292



>ref|XP_010101365.1| 60S ribosomal protein L5 [Morus notabilis]
 gb|EXB88312.1| 60S ribosomal protein L5 [Morus notabilis]
Length=305

 Score =   211 bits (536),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 127/156 (81%), Positives = 141/156 (90%), Gaps = 0/156 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            E+RRPFRALLDVGLI+TTTGNRVFGA KGALDGGLDIPHSEKRFAGF+KDSK LDAEVHR
Sbjct  141  ENRRPFRALLDVGLIQTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDAEVHR  200

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
            KYIYGGHVAAYM +L EDE EK   HFS Y+K+GI+ADN+E LYKKVHAAIRADP+ +KS
Sbjct  201  KYIYGGHVAAYMRTLAEDEPEKFLAHFSEYLKRGIDADNLEELYKKVHAAIRADPTGRKS  260

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAA  147
            EKQPPKEHKR+  KKLTY+ER+AKLIER NA N+AA
Sbjct  261  EKQPPKEHKRYNLKKLTYEERKAKLIERLNAFNSAA  296



>gb|KJB27798.1| hypothetical protein B456_005G010200 [Gossypium raimondii]
Length=299

 Score =   210 bits (535),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 126/157 (80%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            ++RRPFRALLDVGLIRTTTGN VFGA KGALD GLDIPHS+KRFAGF+KD K LDAEVHR
Sbjct  136  DTRRPFRALLDVGLIRTTTGNNVFGALKGALDAGLDIPHSDKRFAGFSKDGKQLDAEVHR  195

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
             YIYGGHVAAYM  L EDE EK Q+HFS YIK+GIEADNIE+LYKKVHAAIRADPS KKS
Sbjct  196  NYIYGGHVAAYMRILMEDEPEKYQSHFSEYIKRGIEADNIESLYKKVHAAIRADPSAKKS  255

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
            EK PPK+H RF  KKLTY+ER+AKLI+R + LNAAAG
Sbjct  256  EKAPPKQHMRFNLKKLTYEERKAKLIDRLHTLNAAAG  292



>ref|XP_008446013.1| PREDICTED: 60S ribosomal protein L5 [Cucumis melo]
Length=303

 Score =   210 bits (535),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 121/157 (77%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             ++RRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHS+KRFAG+TK+S+ LD EVH
Sbjct  135  ADTRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGYTKNSQQLDVEVH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYI+GGHVAAYM +L EDE EK Q+HFS YIKKGIEAD++E LYKKVHAAIRA+P+ KK
Sbjct  195  RKYIFGGHVAAYMRTLMEDEPEKYQSHFSEYIKKGIEADDLEGLYKKVHAAIRANPTVKK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAA  147
            S+K  PK HKR+  KKLTYDER+A+L+ER NALN+AA
Sbjct  255  SDKPQPKAHKRYNLKKLTYDERKARLVERLNALNSAA  291



>ref|XP_006442191.1| hypothetical protein CICLE_v10020582mg [Citrus clementina]
 gb|ESR55431.1| hypothetical protein CICLE_v10020582mg [Citrus clementina]
Length=383

 Score =   213 bits (541),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 124/157 (79%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             ++RRPFRALLDVGLI+TTTGNRVFGA KGALDGGLDIPHS+KRFAGF+KD K LDAEVH
Sbjct  222  ADTRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDKRFAGFSKDGKQLDAEVH  281

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYIYGGHVAAYM++L EDE EK Q+HF+ YIKKGI+AD +EALYKKVHAAIRADP+ KK
Sbjct  282  RKYIYGGHVAAYMSTLMEDEPEKYQSHFTEYIKKGIDADGLEALYKKVHAAIRADPTTKK  341

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAA  147
            SEK  PKEHKR+  KKLTY+ER+AKL+ER NALN+A 
Sbjct  342  SEKPAPKEHKRYNLKKLTYEERKAKLVERLNALNSAV  378



>ref|XP_006447905.1| hypothetical protein CICLE_v10016107mg [Citrus clementina]
 gb|ESR61145.1| hypothetical protein CICLE_v10016107mg [Citrus clementina]
Length=297

 Score =   210 bits (534),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            E+RRPFRALLDVGL++TTTGNRVFGA KGALDGGLDIPHSEKRFAGF+KDSK LDAEVHR
Sbjct  136  ENRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDAEVHR  195

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
            KYIY GHVAAYM +L EDE EK Q+HF  YIK+GIEADN+E LYKKVHAAIRADP+ KKS
Sbjct  196  KYIYCGHVAAYMRTLMEDEPEKYQSHFCEYIKRGIEADNLEELYKKVHAAIRADPNQKKS  255

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNAA  150
            EK+PP EHKR+  KKLTY+ER+A+L+ER  ALNAA
Sbjct  256  EKKPPAEHKRYNLKKLTYEERKARLVERLKALNAA  290



>ref|XP_007049514.1| Ribosomal protein L5 B isoform 2 [Theobroma cacao]
 gb|EOX93671.1| Ribosomal protein L5 B isoform 2 [Theobroma cacao]
Length=299

 Score =   210 bits (534),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 135/158 (85%), Gaps = 0/158 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             E+RRPFRALLDVGLIRTTTGNRVFG  KGALDGGLDIPHS+KRFAGF KDSK LD EVH
Sbjct  137  AETRRPFRALLDVGLIRTTTGNRVFGVLKGALDGGLDIPHSDKRFAGFNKDSKQLDPEVH  196

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYIYGGHVAAYM +L EDE EK Q+HFS YIK+ IE DN+E LYKKVHAAIRAD   KK
Sbjct  197  RKYIYGGHVAAYMRTLMEDEPEKYQSHFSEYIKRNIEPDNMEGLYKKVHAAIRADSEAKK  256

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
            SE++PP EHKR+  KKL+YDER+A+LI+R   LN+AAG
Sbjct  257  SEREPPMEHKRYNLKKLSYDERKARLIDRLKVLNSAAG  294



>ref|XP_006469375.1| PREDICTED: 60S ribosomal protein L5-like [Citrus sinensis]
Length=297

 Score =   210 bits (534),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            E+RRPFRALLDVGL++TTTGNRVFGA KGALDGGLDIPHSEKRFAGF+KDSK LDAEVHR
Sbjct  136  ENRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDAEVHR  195

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
            KYIY GHVAAYM +L EDE EK Q+HF  YIK+GIEADN+E LYKKVHAAIRADP+ KKS
Sbjct  196  KYIYCGHVAAYMRTLMEDEPEKYQSHFCEYIKRGIEADNLEELYKKVHAAIRADPNQKKS  255

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNAA  150
            EK+PP EHKR+  KKLTY+ER+A+L+ER  ALNAA
Sbjct  256  EKKPPAEHKRYNLKKLTYEERKARLVERLKALNAA  290



>ref|XP_008791818.1| PREDICTED: 60S ribosomal protein L5-like [Phoenix dactylifera]
Length=305

 Score =   210 bits (534),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 124/157 (79%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             ESRRPFRALLDVGL+RTTTGNRVFGA KGALDGGLDIPHS+KRFAGF KD K LDAEVH
Sbjct  135  AESRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDEKQLDAEVH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYI+GGHVA+YM  L EDE EK QTHF  YIK+GIE D++E LYKKVHAAIRADP+  K
Sbjct  195  RKYIFGGHVASYMRMLMEDEPEKYQTHFIEYIKRGIEPDDMEELYKKVHAAIRADPTLVK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAA  147
            S K+PPKEHKRF  KKLTYDER+A+LIER NALN++A
Sbjct  255  SSKEPPKEHKRFNLKKLTYDERKARLIERLNALNSSA  291



>ref|XP_009358395.1| PREDICTED: 60S ribosomal protein L5 [Pyrus x bretschneideri]
Length=302

 Score =   210 bits (534),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 134/153 (88%), Gaps = 0/153 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             ESRRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHSEKRFAGF+KDSK LD EVH
Sbjct  135  AESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDPEVH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYIYGGHVAAYM +L EDE EK Q+HFS YIKKGIEADNIE LYKKVHAAIRADP+ KK
Sbjct  195  RKYIYGGHVAAYMRNLAEDEPEKYQSHFSEYIKKGIEADNIEELYKKVHAAIRADPTIKK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNAL  159
            +EK  P+EHKR+  KKLT+DER+ KL+ER  A 
Sbjct  255  TEKPAPQEHKRYNLKKLTFDERKKKLVERLKAF  287



>ref|XP_009420140.1| PREDICTED: 60S ribosomal protein L5-like [Musa acuminata subsp. 
malaccensis]
Length=303

 Score =   210 bits (534),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 136/158 (86%), Gaps = 0/158 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             ESRRPFRALLDVGL+RTTTGNRVFGA KGALDGGLDIPHS+KRFAGF  D K LDAEVH
Sbjct  135  AESRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKNDEKQLDAEVH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            R YI+GGHVA+YM +L EDE +K QTHFS YIKKGIE D+IE +YKKVHAAIRADPS  K
Sbjct  195  RNYIFGGHVASYMRALMEDEPDKYQTHFSEYIKKGIEPDDIEEMYKKVHAAIRADPSAIK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
            S K+PP EHKR+  KKLTY+ER+AKLIER NALNA+ G
Sbjct  255  STKEPPTEHKRYNLKKLTYEERKAKLIERLNALNASGG  292



>gb|KDO51032.1| hypothetical protein CISIN_1g022424mg [Citrus sinensis]
Length=297

 Score =   209 bits (533),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            E+RRPFRALLDVGL++TTTGNRVFGA KGALDGGLDIPHSEKRFAGF+KDSK LDAEVHR
Sbjct  136  ENRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDAEVHR  195

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
            KYIY GHVAAYM +L EDE EK Q+HF  YIK+GIEADN+E LYKKVHAAIRADP+ KKS
Sbjct  196  KYIYCGHVAAYMRTLMEDEPEKYQSHFCEYIKRGIEADNLEELYKKVHAAIRADPNQKKS  255

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNAA  150
            EK+PP EHKR+  KKLTY+ER+A+L+ER  ALNAA
Sbjct  256  EKKPPAEHKRYNLKKLTYEERKARLVERLKALNAA  290



>ref|XP_010650723.1| PREDICTED: 60S ribosomal protein L5 [Vitis vinifera]
Length=301

 Score =   209 bits (533),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            +SRRPFRALLDVGL+RTTTGNRVFGA KGALDGGLDIPHS+KRFAGF+KDSK LDAEVHR
Sbjct  136  DSRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFSKDSKQLDAEVHR  195

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
            KYIYGGHV+AYM +L EDE EK Q+HFS YIKKG+E D+IE +YKKVHAAIRA+P  KK 
Sbjct  196  KYIYGGHVSAYMGTLIEDEPEKYQSHFSEYIKKGVEPDDIEEMYKKVHAAIRANPIQKKV  255

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNA  153
            EKQPPKEHKR+  KKLTY+ER+AKLIER NALN+
Sbjct  256  EKQPPKEHKRYNLKKLTYEERKAKLIERLNALNS  289



>emb|CBI24704.3| unnamed protein product [Vitis vinifera]
Length=333

 Score =   210 bits (535),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            +SRRPFRALLDVGL+RTTTGNRVFGA KGALDGGLDIPHS+KRFAGF+KDSK LDAEVHR
Sbjct  168  DSRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFSKDSKQLDAEVHR  227

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
            KYIYGGHV+AYM +L EDE EK Q+HFS YIKKG+E D+IE +YKKVHAAIRA+P  KK 
Sbjct  228  KYIYGGHVSAYMGTLIEDEPEKYQSHFSEYIKKGVEPDDIEEMYKKVHAAIRANPIQKKV  287

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNA  153
            EKQPPKEHKR+  KKLTY+ER+AKLIER NALN+
Sbjct  288  EKQPPKEHKRYNLKKLTYEERKAKLIERLNALNS  321



>ref|XP_010930276.1| PREDICTED: 60S ribosomal protein L5 [Elaeis guineensis]
Length=303

 Score =   209 bits (532),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 122/156 (78%), Positives = 137/156 (88%), Gaps = 0/156 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            ESRRPFRALLDVGL+RTTTGNRVFG  KGALDGGLDIPHS+KRFAGF+KD K LDAEVHR
Sbjct  136  ESRRPFRALLDVGLVRTTTGNRVFGCLKGALDGGLDIPHSDKRFAGFSKDDKQLDAEVHR  195

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
            KYI+GGHVA+YM  L EDE EK QTHFS YIK+GIE D++E LYKKVHAAIRADP+  KS
Sbjct  196  KYIFGGHVASYMRMLMEDEPEKYQTHFSEYIKRGIEPDDMEGLYKKVHAAIRADPTMVKS  255

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAA  147
             K+PPKEHKR+  +KLTY+ER+AKLI+R NALNA A
Sbjct  256  AKEPPKEHKRYNLRKLTYEERKAKLIDRLNALNARA  291



>ref|XP_008361660.1| PREDICTED: 60S ribosomal protein L5 [Malus domestica]
Length=302

 Score =   209 bits (532),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 125/159 (79%), Positives = 138/159 (87%), Gaps = 1/159 (1%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             ESRRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHSEKRFAGF+KD K LDAE+H
Sbjct  135  AESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDGKQLDAEIH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYIYGGHVAAYM +L EDE EK Q+HFS YIKKGIEAD+IE +YKKVHAAIRADP+ KK
Sbjct  195  RKYIYGGHVAAYMRTLAEDEPEKYQSHFSEYIKKGIEADDIEEVYKKVHAAIRADPTIKK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAGN  141
            +EK  P+EHKR+  KKLT+DER+ KL+ER  A N  AGN
Sbjct  255  TEKPAPQEHKRYNLKKLTFDERKKKLVERLKAFN-DAGN  292



>tpg|DAA56364.1| TPA: hypothetical protein ZEAMMB73_635593 [Zea mays]
Length=229

 Score =   206 bits (525),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            + RRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHSEKRFAGF KD K LDA++HR
Sbjct  64   DERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFKKDDKQLDADIHR  123

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
            KYIYGGHVA YM +L E+E EK Q+HFS YIKKGIEAD++EALYKKVHAAIRADPS  KS
Sbjct  124  KYIYGGHVADYMRNLAEEEPEKYQSHFSEYIKKGIEADDMEALYKKVHAAIRADPSVVKS  183

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
             KQPPKEHKR+  KKLTY++R+A LIER N LN++ G
Sbjct  184  TKQPPKEHKRYNPKKLTYEQRKASLIERLNQLNSSGG  220



>ref|XP_007049513.1| Ribosomal protein L5 B isoform 1 [Theobroma cacao]
 gb|EOX93670.1| Ribosomal protein L5 B isoform 1 [Theobroma cacao]
Length=353

 Score =   210 bits (535),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 135/158 (85%), Gaps = 0/158 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             E+RRPFRALLDVGLIRTTTGNRVFG  KGALDGGLDIPHS+KRFAGF KDSK LD EVH
Sbjct  191  AETRRPFRALLDVGLIRTTTGNRVFGVLKGALDGGLDIPHSDKRFAGFNKDSKQLDPEVH  250

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYIYGGHVAAYM +L EDE EK Q+HFS YIK+ IE DN+E LYKKVHAAIRAD   KK
Sbjct  251  RKYIYGGHVAAYMRTLMEDEPEKYQSHFSEYIKRNIEPDNMEGLYKKVHAAIRADSEAKK  310

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
            SE++PP EHKR+  KKL+YDER+A+LI+R   LN+AAG
Sbjct  311  SEREPPMEHKRYNLKKLSYDERKARLIDRLKVLNSAAG  348



>gb|ACU23594.1| unknown [Glycine max]
Length=298

 Score =   208 bits (530),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 129/158 (82%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            ESRRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHS+KRFAGF K+ K LDAEVHR
Sbjct  136  ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFDKEKKELDAEVHR  195

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
            KY++GGHVAAYM  L EDE EK Q+HFS YIK+GIEAD IEALYKKVHAAIRADPS KKS
Sbjct  196  KYVFGGHVAAYMKILAEDEPEKYQSHFSEYIKRGIEADGIEALYKKVHAAIRADPSLKKS  255

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAGN  141
            EKQPPKEHKR+  KKLTY+ER+AKLI R  A+N+AA N
Sbjct  256  EKQPPKEHKRYNLKKLTYEERKAKLIARVAAINSAADN  293



>ref|XP_010927913.1| PREDICTED: 60S ribosomal protein L5-like isoform X2 [Elaeis guineensis]
Length=302

 Score =   208 bits (530),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 134/159 (84%), Gaps = 0/159 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             ESRRPFRALLDVGL+RTTTGNRVF A KGA DGGLDIPHS+KRFAGF KD K LDAEVH
Sbjct  135  AESRRPFRALLDVGLVRTTTGNRVFAALKGASDGGLDIPHSDKRFAGFKKDEKQLDAEVH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            R YI GGHVA+YM ++ EDE EK Q HFS YIK+GIE D++E +YKKVHAAIRADP   K
Sbjct  195  RNYILGGHVASYMRTMMEDEPEKYQAHFSEYIKRGIEPDSMEEMYKKVHAAIRADPIAIK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAGN  141
            S K+PPKEHKRF  KKLTY+ER+A+LIER NALNA+AG 
Sbjct  255  STKEPPKEHKRFNLKKLTYEERKARLIERLNALNASAGT  293



>gb|EMS47485.1| 60S ribosomal protein L5-1 [Triticum urartu]
Length=269

 Score =   207 bits (527),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 120/158 (76%), Positives = 137/158 (87%), Gaps = 0/158 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             + RRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHS+KRFAGF KD K LDAE+H
Sbjct  103  ADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDEKQLDAEIH  162

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYIYGGHVA YM SL ++E EK Q+HFS YIKKGIE D++EALYKKVHAAIRADP+  K
Sbjct  163  RKYIYGGHVADYMKSLADEEPEKYQSHFSEYIKKGIEIDDMEALYKKVHAAIRADPTVAK  222

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
            S K+PPK HKR+  KKLTY++R+A L+ER NALN++AG
Sbjct  223  STKEPPKTHKRYNPKKLTYEQRKANLVERLNALNSSAG  260



>ref|XP_010927912.1| PREDICTED: 60S ribosomal protein L5-like isoform X1 [Elaeis guineensis]
Length=304

 Score =   208 bits (530),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 134/159 (84%), Gaps = 0/159 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             ESRRPFRALLDVGL+RTTTGNRVF A KGA DGGLDIPHS+KRFAGF KD K LDAEVH
Sbjct  137  AESRRPFRALLDVGLVRTTTGNRVFAALKGASDGGLDIPHSDKRFAGFKKDEKQLDAEVH  196

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            R YI GGHVA+YM ++ EDE EK Q HFS YIK+GIE D++E +YKKVHAAIRADP   K
Sbjct  197  RNYILGGHVASYMRTMMEDEPEKYQAHFSEYIKRGIEPDSMEEMYKKVHAAIRADPIAIK  256

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAGN  141
            S K+PPKEHKRF  KKLTY+ER+A+LIER NALNA+AG 
Sbjct  257  STKEPPKEHKRFNLKKLTYEERKARLIERLNALNASAGT  295



>gb|KHN27258.1| 60S ribosomal protein L5 [Glycine soja]
Length=301

 Score =   208 bits (530),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             ESRRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHS+KRFAGF K+ K LDAEVH
Sbjct  138  AESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFDKEKKELDAEVH  197

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKY++GGHVAAYM  L EDE EK Q+HFS YIK+GIEAD IEALYKKVHAAIRADP+ KK
Sbjct  198  RKYVFGGHVAAYMKILAEDEPEKYQSHFSEYIKRGIEADGIEALYKKVHAAIRADPTLKK  257

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAGN  141
            S+KQ PKEHKR+  KKLTY+ER+AKLI R  +LN+AA N
Sbjct  258  SDKQLPKEHKRYNLKKLTYEERKAKLIARVASLNSAADN  296



>ref|XP_003528810.1| PREDICTED: 60S ribosomal protein L5-like [Glycine max]
Length=298

 Score =   208 bits (529),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 127/159 (80%), Positives = 140/159 (88%), Gaps = 0/159 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             ESRRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHS+KRFAGF K+ K LDAEVH
Sbjct  135  AESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFDKEKKELDAEVH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKY++GGHVAAYM  L EDE EK Q+HFS YIK+GIEAD IEALYKKVHAAIRADP+ KK
Sbjct  195  RKYVFGGHVAAYMKILAEDEPEKYQSHFSEYIKRGIEADGIEALYKKVHAAIRADPTLKK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAGN  141
            S+KQPPKEHKR+  KKLTY+ER+AKLI R  +LN+AA N
Sbjct  255  SDKQPPKEHKRYNLKKLTYEERKAKLIARVASLNSAADN  293



>ref|XP_003548576.2| PREDICTED: 60S ribosomal protein L5-like [Glycine max]
Length=339

 Score =   209 bits (532),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 129/159 (81%), Positives = 140/159 (88%), Gaps = 0/159 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             ESRRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHS+KRFAGF K+ K LDAEVH
Sbjct  176  AESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFDKEKKELDAEVH  235

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKY++GGHVAAYM  L EDE EK Q+HFS YIK+GIEAD IEALYKKVHAAIRADPS KK
Sbjct  236  RKYVFGGHVAAYMKILAEDEPEKYQSHFSEYIKRGIEADGIEALYKKVHAAIRADPSLKK  295

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAGN  141
            SEKQPPKEHKR+  KKLTY+ER+AKLI R  A+N+AA N
Sbjct  296  SEKQPPKEHKRYNLKKLTYEERKAKLIARVAAINSAADN  334



>ref|XP_011037361.1| PREDICTED: 60S ribosomal protein L5-like [Populus euphratica]
 ref|XP_011037362.1| PREDICTED: 60S ribosomal protein L5-like [Populus euphratica]
Length=297

 Score =   208 bits (529),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             ++RRPFRALLDVGL+RTTTGNRVFGA KGALDGGLDIPHSEKRFAGF KD+K LDAEVH
Sbjct  135  ADTRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFGKDNKQLDAEVH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYIYGGHVAAYM +L EDE EK Q+HFS Y+K+GI+AD +EALYKKVHAAIRADP+ KK
Sbjct  195  RKYIYGGHVAAYMRTLMEDEPEKYQSHFSEYLKRGIDADCMEALYKKVHAAIRADPTTKK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAGN  141
            SEKQPPKEHKR+  KKLTY+ER+ KL+ER N  N+AA +
Sbjct  255  SEKQPPKEHKRYNLKKLTYEERKEKLVERLNTFNSAADD  293



>ref|XP_006594790.1| PREDICTED: 60S ribosomal protein L5-like [Glycine max]
Length=298

 Score =   208 bits (529),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 140/159 (88%), Gaps = 0/159 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             ESRRPFRALLDVGL+RTTTGNRVFGA KGALDGGLDIPHS+KRFAGF K+ K LDAEVH
Sbjct  135  AESRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFDKEKKELDAEVH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKY++GGHVAAYM  L EDE EK Q+HFS YIK+GIEAD IEALYKKVHAAIRADP+ +K
Sbjct  195  RKYVFGGHVAAYMKILAEDEPEKYQSHFSEYIKRGIEADGIEALYKKVHAAIRADPTLRK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAGN  141
            S+KQPPKEHKR+  KKLTY+ER+AKL+ R  A+N+AA N
Sbjct  255  SDKQPPKEHKRYNMKKLTYEERKAKLVARVAAINSAADN  293



>ref|XP_003528812.1| PREDICTED: 60S ribosomal protein L5-like isoform X1 [Glycine 
max]
 gb|KHN27259.1| 60S ribosomal protein L5 [Glycine soja]
Length=298

 Score =   208 bits (529),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 138/159 (87%), Gaps = 0/159 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             ESRRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHS+KRFAGF K+ K LDAEVH
Sbjct  135  AESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFDKEKKELDAEVH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKY++GGHVAAYM  L EDE EK Q+HFS YIK+GIEAD IEALYK VHAAIRADP+ KK
Sbjct  195  RKYVFGGHVAAYMKILAEDEPEKYQSHFSEYIKRGIEADGIEALYKNVHAAIRADPTLKK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAGN  141
            S+KQ PKEHKR+  KKLTY+ER+AKLI R  ALN+AA N
Sbjct  255  SDKQTPKEHKRYNLKKLTYEERKAKLISRVAALNSAADN  293



>ref|XP_010551993.1| PREDICTED: 60S ribosomal protein L5-like [Tarenaya hassleriana]
Length=304

 Score =   208 bits (529),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 126/157 (80%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            ++RRPFRALLDVGL+RTTTGNRVFGA KGALDGGLDIPHS+KRFAGF K+SK LDAEVHR
Sbjct  136  DTRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKESKQLDAEVHR  195

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
            KYIYG HVA YM  + EDE EK Q+HFS YIK+GIEADN+EALYKKVHAAIRADP+ KKS
Sbjct  196  KYIYGVHVADYMRVMMEDEPEKYQSHFSEYIKRGIEADNMEALYKKVHAAIRADPTIKKS  255

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
            EKQPPKEHKRF  KKLTY+ER+A+LIER  ALN+A G
Sbjct  256  EKQPPKEHKRFNAKKLTYEERKARLIERLKALNSAGG  292



>gb|ABK93596.1| unknown [Populus trichocarpa]
Length=298

 Score =   207 bits (528),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             +SRRPFRALLDVGL+RTTTGNRVFGA KGALDGGLDIPHS+KRFAGF KD K LDAEVH
Sbjct  135  ADSRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKDGKQLDAEVH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYIYGGHVAAYM +L EDE EK Q+HFS YIK+GIE DN+E LYKKVHAAIRADP+ KK
Sbjct  195  RKYIYGGHVAAYMRNLMEDEPEKYQSHFSEYIKRGIEPDNMEELYKKVHAAIRADPTAKK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNA  153
            SEKQ PKEHKR+  KKLTY+ER+AKL+ER  ALN+
Sbjct  255  SEKQLPKEHKRYNLKKLTYEERKAKLVERLKALNS  289



>ref|XP_008800755.1| PREDICTED: 60S ribosomal protein L5-like [Phoenix dactylifera]
Length=305

 Score =   208 bits (529),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 119/156 (76%), Positives = 135/156 (87%), Gaps = 0/156 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             ESRRPFRALLDVGL+RTTTGNRVFG  KGALDGGLDIPHS+KRFAGF KD K LDAEVH
Sbjct  135  AESRRPFRALLDVGLVRTTTGNRVFGCLKGALDGGLDIPHSDKRFAGFNKDGKQLDAEVH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYI+GGHVA+YM  L EDE EK QTHFS YI++GIE D++E LYKKVHAAIRAD +  K
Sbjct  195  RKYIFGGHVASYMRILMEDEPEKYQTHFSEYIQRGIEPDDLEELYKKVHAAIRADATMAK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAA  150
            S ++PPKEHKR+  KKLTY+ER+A+LIER NALNA+
Sbjct  255  STREPPKEHKRYNLKKLTYEERKARLIERLNALNAS  290



>ref|XP_002321226.2| hypothetical protein POPTR_0014s17230g [Populus trichocarpa]
 gb|EEE99541.2| hypothetical protein POPTR_0014s17230g [Populus trichocarpa]
Length=298

 Score =   207 bits (528),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             +SRRPFRALLDVGL+RTTTGNRVFGA KGALDGGLDIPHS+KRFAGF KD K LDAEVH
Sbjct  135  ADSRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKDGKQLDAEVH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYIYGGHVAAYM +L EDE EK Q+HFS YIK+GIE DN+E LYKKVHAAIRADP+ KK
Sbjct  195  RKYIYGGHVAAYMRNLMEDEPEKYQSHFSEYIKRGIEPDNMEELYKKVHAAIRADPTAKK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNA  153
            SEKQ PKEHKR+  KKLTY+ER+AKL+ER  ALN+
Sbjct  255  SEKQLPKEHKRYNLKKLTYEERKAKLVERLKALNS  289



>ref|XP_010532933.1| PREDICTED: 60S ribosomal protein L5-2 [Tarenaya hassleriana]
Length=304

 Score =   207 bits (528),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 121/157 (77%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            ++RRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHSEKRFAGF K++K LD E HR
Sbjct  136  DTRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFNKENKQLDPETHR  195

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
             YI+GGHVA YM  L EDE EK QTHFSGY+KKGIEADN+EA+YKKVHAAIRADP+ KKS
Sbjct  196  NYIFGGHVANYMKVLTEDEPEKYQTHFSGYVKKGIEADNLEAMYKKVHAAIRADPTLKKS  255

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
            EK  P EHKR+  KKLTY+ER+ +LIER  ALN+ AG
Sbjct  256  EKSAPTEHKRYNLKKLTYEERKERLIERLKALNSGAG  292



>gb|AEV92989.1| 60S ribosomal protein L5 [Triticum aestivum]
Length=301

 Score =   207 bits (528),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 120/158 (76%), Positives = 137/158 (87%), Gaps = 0/158 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             + RRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHS+KRFAGF KD K LDAE+H
Sbjct  135  ADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDEKQLDAEIH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYIYGGHVA YM SL ++E EK Q+HFS YIKKGIE D++EALYKKVHAAIRADP+  K
Sbjct  195  RKYIYGGHVADYMKSLADEEPEKYQSHFSEYIKKGIEIDDMEALYKKVHAAIRADPTVAK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
            S K+PPK HKR+  KKLTY++R+A L+ER NALN++AG
Sbjct  255  STKEPPKTHKRYNPKKLTYEQRKASLVERLNALNSSAG  292



>gb|AFW84308.1| hypothetical protein ZEAMMB73_937605 [Zea mays]
Length=229

 Score =   205 bits (521),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 122/157 (78%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            + RRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHSEKRFAGF KD K LDA+ HR
Sbjct  64   DERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFKKDDKQLDADTHR  123

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
            +YIYGGHVA YM +L E+E EK Q+HFS YIKKG+EAD IEALYKKVHAAIRADPS  KS
Sbjct  124  RYIYGGHVADYMKNLAEEEPEKYQSHFSAYIKKGVEADEIEALYKKVHAAIRADPSIVKS  183

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
             KQPPKEHKR+  KKLTY++R+A LIER N LN++ G
Sbjct  184  TKQPPKEHKRYNPKKLTYEQRKASLIERLNQLNSSGG  220



>ref|XP_008807247.1| PREDICTED: 60S ribosomal protein L5-like isoform X1 [Phoenix 
dactylifera]
Length=304

 Score =   207 bits (528),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 134/158 (85%), Gaps = 0/158 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             ESRRPFRALLDVGL+RTTTGNRVFG  KGALDGGLDIPHS+KRFAGF KD K LD EVH
Sbjct  137  AESRRPFRALLDVGLVRTTTGNRVFGCLKGALDGGLDIPHSDKRFAGFKKDEKQLDEEVH  196

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYI+GGHVA+YM ++ EDE EK Q HFS YIKKGIE DN+E +YKK HAAIRADP+  K
Sbjct  197  RKYIFGGHVASYMRTMMEDEPEKYQAHFSEYIKKGIEPDNMEEIYKKAHAAIRADPTMIK  256

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
            S K+ PKEH+RF  KKLTY+ER+A+LIER NALN +AG
Sbjct  257  STKETPKEHQRFNLKKLTYEERKARLIERLNALNESAG  294



>gb|ADR71225.1| 60S ribosomal protein L5A [Hevea brasiliensis]
Length=298

 Score =   207 bits (527),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             E+RRPFRALLDVGL+RTTTGNRVFGA KGALDGGLDIPHS+KRFAGF+KDSK LDAEVH
Sbjct  135  AETRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFSKDSKQLDAEVH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYIYGGHVAAYM  L EDE EK Q HFS YIK+GIE D++E LYKKVHAAIRADP+ KK
Sbjct  195  RKYIYGGHVAAYMRMLMEDEPEKYQLHFSEYIKRGIEPDDMEELYKKVHAAIRADPTAKK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNA  153
            SEKQPPKEHKR+  +K+TY+ER+AKLIER  ALN+
Sbjct  255  SEKQPPKEHKRYNLRKMTYEERKAKLIERLQALNS  289



>ref|XP_008807248.1| PREDICTED: 60S ribosomal protein L5-1-like isoform X2 [Phoenix 
dactylifera]
Length=302

 Score =   207 bits (527),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 134/158 (85%), Gaps = 0/158 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             ESRRPFRALLDVGL+RTTTGNRVFG  KGALDGGLDIPHS+KRFAGF KD K LD EVH
Sbjct  135  AESRRPFRALLDVGLVRTTTGNRVFGCLKGALDGGLDIPHSDKRFAGFKKDEKQLDEEVH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYI+GGHVA+YM ++ EDE EK Q HFS YIKKGIE DN+E +YKK HAAIRADP+  K
Sbjct  195  RKYIFGGHVASYMRTMMEDEPEKYQAHFSEYIKKGIEPDNMEEIYKKAHAAIRADPTMIK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
            S K+ PKEH+RF  KKLTY+ER+A+LIER NALN +AG
Sbjct  255  STKETPKEHQRFNLKKLTYEERKARLIERLNALNESAG  292



>ref|XP_008339345.1| PREDICTED: 60S ribosomal protein L5 [Malus domestica]
Length=302

 Score =   207 bits (526),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 135/154 (88%), Gaps = 0/154 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             ESRRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHSEKRFAGF+KD K LDAE+H
Sbjct  135  AESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDGKQLDAEIH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYIYGGHVAAYM +L EDE EK Q+HFS YIKKGIEAD+IE +YKKVHAAIRADP+ KK
Sbjct  195  RKYIYGGHVAAYMRTLAEDEPEKYQSHFSEYIKKGIEADDIEEVYKKVHAAIRADPTIKK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALN  156
            +EK  P+EHKR+  KKLT+DER+ KL++R  A N
Sbjct  255  TEKPAPQEHKRYNLKKLTFDERKKKLVDRLKAFN  288



>ref|NP_001189970.1| 60S ribosomal protein L5-1 [Arabidopsis thaliana]
 gb|AEE77020.1| 60S ribosomal protein L5-1 [Arabidopsis thaliana]
Length=190

 Score =   203 bits (517),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            +SRRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHS+KRFAGF K++K LDAE+HR
Sbjct  25   DSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFHKENKQLDAEIHR  84

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
             YIYGGHV+ YM  L EDE EK QTHFS YIKKG+EA++IE LYKKVHAAIRADP+PKK+
Sbjct  85   NYIYGGHVSNYMKLLGEDEPEKLQTHFSAYIKKGVEAESIEELYKKVHAAIRADPNPKKT  144

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
             K  PK+HKR+  KKLTY+ER+ KLIER  ALN A G
Sbjct  145  VKPAPKQHKRYNLKKLTYEERKNKLIERVKALNGAGG  181



>gb|AES74307.2| 60S ribosomal protein L5-2 [Medicago truncatula]
Length=300

 Score =   207 bits (526),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             +SRRPFRALLDVGL++TTTGNRVFGA KGALDGGLDIPHS+KRFAGF K+ K LDAEVH
Sbjct  135  ADSRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSDKRFAGFDKEKKELDAEVH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYI+GGHVAAYM +L EDE EK QTHFS YIK+GIEAD IE LYKKVHAAIRADPS KK
Sbjct  195  RKYIFGGHVAAYMKTLMEDEPEKYQTHFSEYIKRGIEADGIEELYKKVHAAIRADPSIKK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
             EKQPPKEHKR+  KKLTY+ER+ KL+ R  ALN+AAG
Sbjct  255  PEKQPPKEHKRYNLKKLTYEERKTKLVSRLQALNSAAG  292



>ref|XP_006583256.1| PREDICTED: 60S ribosomal protein L5-like isoform X2 [Glycine 
max]
Length=316

 Score =   207 bits (527),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 138/159 (87%), Gaps = 0/159 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             ESRRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHS+KRFAGF K+ K LDAEVH
Sbjct  153  AESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFDKEKKELDAEVH  212

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKY++GGHVAAYM  L EDE EK Q+HFS YIK+GIEAD IEALYK VHAAIRADP+ KK
Sbjct  213  RKYVFGGHVAAYMKILAEDEPEKYQSHFSEYIKRGIEADGIEALYKNVHAAIRADPTLKK  272

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAGN  141
            S+KQ PKEHKR+  KKLTY+ER+AKLI R  ALN+AA N
Sbjct  273  SDKQTPKEHKRYNLKKLTYEERKAKLISRVAALNSAADN  311



>gb|KHN36792.1| 60S ribosomal protein L5 [Glycine soja]
Length=298

 Score =   206 bits (525),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 124/157 (79%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             ESRRPFRALLDVGL+RTTTGNRVFGA KGALDGGLDIPHS+KRFAGF K+ K LDAEVH
Sbjct  135  AESRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFDKEKKELDAEVH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKY++GGHVAAYM  L EDE EK Q+HFS YIK+GIEAD IEALYKKVHAAIRADP+ +K
Sbjct  195  RKYVFGGHVAAYMKILAEDEPEKYQSHFSEYIKRGIEADGIEALYKKVHAAIRADPTLRK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAA  147
            S+KQPPKEHKR+  KKLTY+ER+AKLI R  A+N+AA
Sbjct  255  SDKQPPKEHKRYNMKKLTYEERKAKLIARVAAINSAA  291



>ref|XP_003543258.1| PREDICTED: 60S ribosomal protein L5-like [Glycine max]
Length=298

 Score =   206 bits (525),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             ESRRPFRALLDVGL+RTTTGNRVFGA KGALDGGLDIPHS+KRFAGF K+ K LDAEVH
Sbjct  135  AESRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFDKEKKELDAEVH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKY++GGHVAAYM  L EDE EK Q+HFS YIK+GIEAD IEALYKKVHAAIRADP+ +K
Sbjct  195  RKYVFGGHVAAYMKILAEDEPEKYQSHFSEYIKRGIEADGIEALYKKVHAAIRADPTLRK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAA  147
            S+K+PPKEHKR+  KKLTY+ER+AKLI R  A+N+AA
Sbjct  255  SDKEPPKEHKRYNMKKLTYEERKAKLIARVAAINSAA  291



>dbj|BAB33422.1| putative senescence-associated protein [Pisum sativum]
Length=279

 Score =   206 bits (523),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 125/157 (80%), Positives = 136/157 (87%), Gaps = 0/157 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             +SRRPFRALLDVGL++TTTGNRVFGA KGALDGGLDIPHS+KRFAGF K+ K LDAEVH
Sbjct  115  ADSRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSDKRFAGFDKEKKELDAEVH  174

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYI+GGHV AYM +L EDE EK QTHFS YIKKGIEAD IE LYKKVHAAIRADP+ KK
Sbjct  175  RKYIFGGHVTAYMKTLIEDEPEKYQTHFSQYIKKGIEADGIEELYKKVHAAIRADPANKK  234

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAA  147
            +EKQPPKEHKR+  KKLTYDERR KLI R  ALN+A 
Sbjct  235  AEKQPPKEHKRYNLKKLTYDERRTKLIARLEALNSAV  271



>ref|XP_003604056.1| 60S ribosomal protein L5 [Medicago truncatula]
Length=331

 Score =   207 bits (527),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             +SRRPFRALLDVGL++TTTGNRVFGA KGALDGGLDIPHS+KRFAGF K+ K LDAEVH
Sbjct  166  ADSRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSDKRFAGFDKEKKELDAEVH  225

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYI+GGHVAAYM +L EDE EK QTHFS YIK+GIEAD IE LYKKVHAAIRADPS KK
Sbjct  226  RKYIFGGHVAAYMKTLMEDEPEKYQTHFSEYIKRGIEADGIEELYKKVHAAIRADPSIKK  285

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
             EKQPPKEHKR+  KKLTY+ER+ KL+ R  ALN+AAG
Sbjct  286  PEKQPPKEHKRYNLKKLTYEERKTKLVSRLQALNSAAG  323



>ref|XP_003579707.1| PREDICTED: 60S ribosomal protein L5-1 [Brachypodium distachyon]
Length=301

 Score =   206 bits (524),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 121/157 (77%), Positives = 136/157 (87%), Gaps = 0/157 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            + RRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHS+KRFAGF KD K LDAEVHR
Sbjct  136  DERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDEKQLDAEVHR  195

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
            KYIYGGHVA YM +L E+E EK Q+HFS YIKKGIEA  +EALYKKVHAAIRADP+  KS
Sbjct  196  KYIYGGHVADYMKTLAEEEPEKYQSHFSEYIKKGIEAGGMEALYKKVHAAIRADPTLAKS  255

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
             K+PPK HKR+  KKLTY++R+A L+ER NALN++AG
Sbjct  256  TKEPPKTHKRYNLKKLTYEQRKASLVERLNALNSSAG  292



>ref|XP_011006737.1| PREDICTED: 60S ribosomal protein L5-like [Populus euphratica]
Length=298

 Score =   206 bits (523),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 135/155 (87%), Gaps = 0/155 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             +SRRPFRALLDVGL+RTTTGNRVFGA KGALDGGLDIPHS+KRFAGF KD K LDAEVH
Sbjct  135  ADSRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKDGKQLDAEVH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYIYGGHVAAYM +L EDE EK Q+HFS YIK+GIE DN+E LYKKVHAAIR DP+ KK
Sbjct  195  RKYIYGGHVAAYMRNLMEDEPEKYQSHFSEYIKRGIEPDNMEELYKKVHAAIREDPTAKK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNA  153
            S KQ PKEHKR+  KKLTY+ER+AKL+ER  ALN+
Sbjct  255  SGKQLPKEHKRYNLKKLTYEERKAKLVERLKALNS  289



>gb|ACG36552.1| 60S ribosomal protein L5-1 [Zea mays]
Length=302

 Score =   206 bits (523),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            + RRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHSEKRFAGF KD K LDA++HR
Sbjct  137  DERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFKKDDKQLDADIHR  196

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
            KYIYGGHVA YM +L E+E EK Q+HFS YIKKGIEAD++EALYKKVHAAIRADPS  KS
Sbjct  197  KYIYGGHVADYMRNLAEEEPEKYQSHFSEYIKKGIEADDMEALYKKVHAAIRADPSVVKS  256

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
             KQPPKEHKR+  KKLTY++R+A LIER N LN++ G
Sbjct  257  TKQPPKEHKRYNPKKLTYEQRKASLIERLNQLNSSGG  293



>ref|XP_011091526.1| PREDICTED: 60S ribosomal protein L5 [Sesamum indicum]
Length=319

 Score =   206 bits (525),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 123/149 (83%), Positives = 137/149 (92%), Gaps = 0/149 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             +SRRPFRALLDVGL+RTTTGNRVFGA KGALDGGLDIPHS+KRFAGF+KDSK LDAEVH
Sbjct  152  ADSRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFSKDSKQLDAEVH  211

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYIYGGHVA+YM +L EDE EK Q+HFS Y+KKG+EADN+E LYKKVHAAIRADP+ KK
Sbjct  212  RKYIYGGHVASYMTNLMEDEPEKYQSHFSKYVKKGLEADNLEELYKKVHAAIRADPTAKK  271

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIER  171
            SEKQPPKEHKR+  KKLTY+ER+AKLIER
Sbjct  272  SEKQPPKEHKRYNLKKLTYEERKAKLIER  300



>dbj|BAJ89012.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=301

 Score =   206 bits (523),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 136/157 (87%), Gaps = 0/157 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            + RRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHS+KRFAGF KD K LDAE+HR
Sbjct  136  DERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDEKQLDAEIHR  195

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
            KYIYGGHVA YM SL ++E EK Q+HFS YIKKGIEAD +EALYKKVHAAIRADP+  KS
Sbjct  196  KYIYGGHVADYMKSLADEEPEKYQSHFSEYIKKGIEADGMEALYKKVHAAIRADPTIAKS  255

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
             K+PPK HK++  KKLTY++R+A L+ER NALN++ G
Sbjct  256  TKEPPKTHKKYNPKKLTYEQRKASLVERLNALNSSGG  292



>ref|XP_008674702.1| PREDICTED: 60S ribosomal protein L5-1 [Zea mays]
 tpg|DAA56366.1| TPA: 60S ribosomal protein L5-1 [Zea mays]
Length=302

 Score =   206 bits (523),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            + RRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHSEKRFAGF KD K LDA++HR
Sbjct  137  DERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFKKDDKQLDADIHR  196

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
            KYIYGGHVA YM +L E+E EK Q+HFS YIKKGIEAD++EALYKKVHAAIRADPS  KS
Sbjct  197  KYIYGGHVADYMRNLAEEEPEKYQSHFSEYIKKGIEADDMEALYKKVHAAIRADPSVVKS  256

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
             KQPPKEHKR+  KKLTY++R+A LIER N LN++ G
Sbjct  257  TKQPPKEHKRYNPKKLTYEQRKASLIERLNQLNSSGG  293



>gb|KDP45189.1| hypothetical protein JCGZ_15054 [Jatropha curcas]
Length=299

 Score =   206 bits (523),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 138/154 (90%), Gaps = 0/154 (0%)
 Frame = -1

Query  608  RRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRKY  429
            RRPFRALLDVGL+RTTTGNRVFGA KGALDGGLDIPHS+KRFAGF+KDSK LDAE+HRKY
Sbjct  138  RRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFSKDSKQLDAELHRKY  197

Query  428  IYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkksek  249
            IYGGHVAAYM  L EDE EK Q+HFS Y+K+GI+ADN+E LYKKVH+AIRADP  KK+EK
Sbjct  198  IYGGHVAAYMRILMEDEPEKYQSHFSEYVKRGIDADNMEELYKKVHSAIRADPITKKTEK  257

Query  248  qppkEHKRFTQKKLTYDERRAKLIERXNALNAAA  147
            QPPKEHKR+  KKLTY+ER+ KLIER  ALN+AA
Sbjct  258  QPPKEHKRYNLKKLTYEERKNKLIERLKALNSAA  291



>ref|NP_001267659.1| 60S ribosomal protein L5 [Cucumis sativus]
 sp|Q6UNT2.1|RL5_CUCSA RecName: Full=60S ribosomal protein L5 [Cucumis sativus]
 gb|AAQ72789.1| 60S ribosomal protein L5 [Cucumis sativus]
 gb|KGN51654.1| hypothetical protein Csa_5G588730 [Cucumis sativus]
Length=302

 Score =   206 bits (523),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 136/157 (87%), Gaps = 0/157 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             ++RRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHS+KRFAG+ K+ + LD EVH
Sbjct  135  ADTRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGYAKNGQQLDVEVH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYI+GGHVAAYM +L EDE EK Q+HFS YIKKGIEAD +E LYKKVHAAIRA+P  KK
Sbjct  195  RKYIFGGHVAAYMRTLMEDEPEKYQSHFSEYIKKGIEADELEGLYKKVHAAIRANPIAKK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAA  147
            S+K  PK HKR+  KKLTYDER+A+L+ER NALN+AA
Sbjct  255  SDKPQPKAHKRYNLKKLTYDERKARLVERLNALNSAA  291



>ref|XP_004500722.1| PREDICTED: 60S ribosomal protein L5-like [Cicer arietinum]
Length=302

 Score =   206 bits (523),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 124/158 (78%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             +SRRPFRALLDVGL++TTTGNRVFGA KGALDGGLDIPHS+KRFAGF K+ K LDAEVH
Sbjct  135  ADSRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSDKRFAGFDKEKKELDAEVH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYI+GGHV AYM +L EDE EK QTHFS YIK+G+EAD IE LYKKVHAAIRADP+ KK
Sbjct  195  RKYIFGGHVTAYMKTLIEDEPEKYQTHFSEYIKRGVEADGIEELYKKVHAAIRADPTIKK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
            S KQPPKEHKR+  KKLTY+ER+AKLI R  ALN+AAG
Sbjct  255  SGKQPPKEHKRYNLKKLTYEERKAKLIARLQALNSAAG  292



>ref|XP_006418614.1| hypothetical protein EUTSA_v10002621mg [Eutrema salsugineum]
 gb|ESQ37050.1| hypothetical protein EUTSA_v10002621mg [Eutrema salsugineum]
Length=301

 Score =   206 bits (523),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 122/157 (78%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            ESRRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHS+KRFAGF K+SK LDAE+HR
Sbjct  136  ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKESKQLDAEIHR  195

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
             YIYGGHV+ YM  L EDE EK QTHFS Y+KKG++A+NIE LYKKVHAAIRADP+PKK+
Sbjct  196  NYIYGGHVSNYMKLLTEDEPEKFQTHFSQYVKKGVDAENIEELYKKVHAAIRADPNPKKT  255

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
             K  PKEHKR+  KKLTY+ER+ KLIER  ALN A G
Sbjct  256  VKAAPKEHKRYNLKKLTYEERKNKLIERVKALNGAGG  292



>gb|ADR71226.1| 60S ribosomal protein L5B [Hevea brasiliensis]
Length=298

 Score =   205 bits (522),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             E+RRPFRALLDVGL+RTTTGN VFGA KGALDGGLDIPHS+KRFAGF+KDSK LDAEVH
Sbjct  135  AETRRPFRALLDVGLVRTTTGNHVFGALKGALDGGLDIPHSDKRFAGFSKDSKQLDAEVH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYIYGGHVAAYM +L EDE EK Q HFS YIK+GIE D++E LYKKVHAAIRADP+ KK
Sbjct  195  RKYIYGGHVAAYMRTLMEDEPEKYQLHFSEYIKRGIEPDDMEELYKKVHAAIRADPTAKK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNA  153
            SEKQPPKEHKR+  +K+TY+ER+AKLIER  ALN+
Sbjct  255  SEKQPPKEHKRYNLRKMTYEERKAKLIERLQALNS  289



>ref|XP_004970894.1| PREDICTED: 60S ribosomal protein L5-1-like [Setaria italica]
Length=303

 Score =   205 bits (522),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 136/157 (87%), Gaps = 0/157 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            + RRPFRALLDVGL+RTTTGNRVFGA KGALDGGLDIPHS+KRFAGF KD KNLDAE+HR
Sbjct  137  DERRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDEKNLDAEIHR  196

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
            KYIYGGHVA YM +L E+E EK Q HFS YIKKGIEAD++EALYKKVHAAIR +P+  K 
Sbjct  197  KYIYGGHVADYMRTLAEEEPEKYQAHFSEYIKKGIEADDMEALYKKVHAAIRGEPTMAKI  256

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
             KQPPKEHKR+  KKLTY++R+A L+ER NALN++ G
Sbjct  257  TKQPPKEHKRYNPKKLTYEQRKASLVERLNALNSSGG  293



>gb|ACJ85054.1| unknown [Medicago truncatula]
 gb|KEH18731.1| 60S ribosomal protein L5-2 [Medicago truncatula]
Length=302

 Score =   205 bits (522),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 124/157 (79%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             ESRRPFRALLDVGL++TTTGNRVFGA KGALDGGLDIPHS+KRFAGF K+ K LDAEVH
Sbjct  135  AESRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSDKRFAGFDKEKKELDAEVH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYI+GGHV+AYM +L EDE EK QTHFS YIKKGIEAD +E LYKKVHAAIRADP+ KK
Sbjct  195  RKYIFGGHVSAYMKTLIEDEPEKYQTHFSEYIKKGIEADGLEELYKKVHAAIRADPTIKK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAA  147
            SEKQPPK+HKR+  KKLTY+ER+AKL+ R  ALNAA 
Sbjct  255  SEKQPPKQHKRYNLKKLTYEERKAKLVSRLAALNAAV  291



>ref|XP_011073988.1| PREDICTED: 60S ribosomal protein L5-like [Sesamum indicum]
Length=302

 Score =   205 bits (521),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 123/149 (83%), Positives = 135/149 (91%), Gaps = 0/149 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             ESRRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHS+KRFAGF+KDSK LDAEVH
Sbjct  135  AESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFSKDSKQLDAEVH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYIYGGHVA+YM +L EDE EK Q+HF  Y+KKG+E DN+E LYKKVHAAIRADP+ KK
Sbjct  195  RKYIYGGHVASYMTTLMEDEPEKYQSHFGLYVKKGLEPDNLEELYKKVHAAIRADPTAKK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIER  171
            SEKQPPKEHKR+  KKLTY+ER+AKLIER
Sbjct  255  SEKQPPKEHKRYNLKKLTYEERKAKLIER  283



>gb|ABK95722.1| unknown [Populus trichocarpa]
Length=297

 Score =   204 bits (520),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             ++RRPFRALLDVGL+RTTTGNRVFGA KGALDGGLDIPHSEKRFAGF KD+K LDAEVH
Sbjct  135  ADTRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFGKDNKQLDAEVH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYIYGGHVAAYM +L EDE EK Q+HFS Y+K+ I+AD +EALYKKVHAAIRADP+ KK
Sbjct  195  RKYIYGGHVAAYMRTLMEDEPEKYQSHFSEYLKREIDADCMEALYKKVHAAIRADPTTKK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAGN  141
            SEK+P KEHKR+  KKLTY+ER+ KL+ER N  N+AA +
Sbjct  255  SEKEPLKEHKRYNLKKLTYEERKEKLVERLNTFNSAADD  293



>ref|XP_003561801.1| PREDICTED: 60S ribosomal protein L5-1-like [Brachypodium distachyon]
Length=301

 Score =   204 bits (520),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 135/155 (87%), Gaps = 0/155 (0%)
 Frame = -1

Query  608  RRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRKY  429
            RRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHS+KRFAGF KD K LD+EVHRKY
Sbjct  138  RRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDEKQLDSEVHRKY  197

Query  428  IYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkksek  249
            IYGGHVA YM SL ++E EK Q+HFS YIKKGI AD+IE++YKKVHAAIRADP+  KS K
Sbjct  198  IYGGHVADYMRSLADEEPEKYQSHFSEYIKKGISADDIESVYKKVHAAIRADPTLVKSTK  257

Query  248  qppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
            + PK HKR+  KKLTY++R+A L+ER NALN++AG
Sbjct  258  EAPKTHKRYNLKKLTYEQRKASLVERLNALNSSAG  292



>ref|XP_006376458.1| hypothetical protein POPTR_0013s13220g [Populus trichocarpa]
 gb|ERP54255.1| hypothetical protein POPTR_0013s13220g [Populus trichocarpa]
Length=292

 Score =   204 bits (519),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             ++RRPFRALLDVGL+RTTTGNRVFGA KGALDGGLDIPHSEKRFAGF KD+K LDAEVH
Sbjct  130  ADTRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFGKDNKQLDAEVH  189

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYIYGGHVAAYM +L EDE EK Q+HFS Y+K+ I+AD +EALYKKVHAAIRADP+ KK
Sbjct  190  RKYIYGGHVAAYMRTLMEDEPEKYQSHFSEYLKREIDADCMEALYKKVHAAIRADPTTKK  249

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAGN  141
            SEK+P KEHKR+  KKLTY+ER+ KL+ER N  N+AA +
Sbjct  250  SEKEPLKEHKRYNLKKLTYEERKEKLVERLNTFNSAADD  288



>gb|ACR38045.1| unknown [Zea mays]
 gb|AFW84309.1| 60S ribosomal protein L5-1 [Zea mays]
Length=302

 Score =   204 bits (519),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 122/157 (78%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            + RRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHSEKRFAGF KD K LDA+ HR
Sbjct  137  DERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFKKDDKQLDADTHR  196

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
            +YIYGGHVA YM +L E+E EK Q+HFS YIKKG+EAD IEALYKKVHAAIRADPS  KS
Sbjct  197  RYIYGGHVADYMKNLAEEEPEKYQSHFSAYIKKGVEADEIEALYKKVHAAIRADPSIVKS  256

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
             KQPPKEHKR+  KKLTY++R+A LIER N LN++ G
Sbjct  257  TKQPPKEHKRYNPKKLTYEQRKASLIERLNQLNSSGG  293



>ref|XP_004510723.1| PREDICTED: 60S ribosomal protein L5-like [Cicer arietinum]
Length=301

 Score =   204 bits (519),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 124/157 (79%), Positives = 136/157 (87%), Gaps = 0/157 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             ++RRPFRALLDVGL++TTTGNRVFGA KGALDGGLDIPHS+KRFAGF K+ K LDAEVH
Sbjct  135  ADTRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSDKRFAGFDKEKKELDAEVH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYI+GGHV+AYM +L EDE EK QTHFS YIKKGIEAD +E LYKKVHAAIRADPS KK
Sbjct  195  RKYIFGGHVSAYMKTLIEDEPEKYQTHFSEYIKKGIEADGLEELYKKVHAAIRADPSIKK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAA  147
            SEK P KEHKRF  KKLTY+ER+AKLI R  ALNAA 
Sbjct  255  SEKPPRKEHKRFNLKKLTYEERKAKLIARLQALNAAV  291



>ref|XP_010264793.1| PREDICTED: 60S ribosomal protein L5-like [Nelumbo nucifera]
Length=302

 Score =   204 bits (519),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 124/157 (79%), Positives = 136/157 (87%), Gaps = 1/157 (1%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            ESRRPF ALLDVGL+RTTTGNRVFGA KGALDGGLDIPHS+KRFAGF K+ K LD EVH 
Sbjct  137  ESRRPFHALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKEDKQLDPEVHH  196

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
            KYIYGGHVA+YM +L EDE EK Q+HF  YIKKGIE DNIEALY+KVHAAIRAD    KS
Sbjct  197  KYIYGGHVASYMMTLMEDEPEKYQSHFGEYIKKGIEPDNIEALYRKVHAAIRAD-PTMKS  255

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
            EKQPPKEHKR+  KKLTY+ER++KLIER NALN+AAG
Sbjct  256  EKQPPKEHKRYNLKKLTYEERKSKLIERLNALNSAAG  292



>gb|EMS59984.1| 60S ribosomal protein L5-2 [Triticum urartu]
Length=303

 Score =   204 bits (519),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 136/157 (87%), Gaps = 0/157 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            + RRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHS+KRFAGF KD K+LDAE+HR
Sbjct  137  DERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDEKSLDAEIHR  196

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
            KYI+GGHVA YM SL ++E EK QTHFS YIK+GI AD++EA+YKKVHAAIRADP+  KS
Sbjct  197  KYIFGGHVADYMRSLADEEPEKYQTHFSEYIKRGISADDMEAVYKKVHAAIRADPTMAKS  256

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
             K PPK HKR+  KKLTY++R+A L+ER NALN +AG
Sbjct  257  TKAPPKTHKRYNPKKLTYEQRKASLVERLNALNNSAG  293



>gb|EMT23062.1| 60S ribosomal protein L5-2 [Aegilops tauschii]
Length=299

 Score =   204 bits (519),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 136/157 (87%), Gaps = 0/157 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            + RRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHS+KRFAGF KD K+LDAE+HR
Sbjct  133  DERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDEKSLDAEIHR  192

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
            KYI+GGHVA YM SL ++E EK QTHFS YIK+GI AD++EA+YKKVHAAIRADP+  KS
Sbjct  193  KYIFGGHVADYMRSLADEEPEKFQTHFSEYIKRGISADDMEAVYKKVHAAIRADPTMAKS  252

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
             K PPK HKR+  KKLTY++R+A L+ER NALN +AG
Sbjct  253  TKAPPKTHKRYNPKKLTYEQRKASLVERLNALNNSAG  289



>ref|XP_006645164.1| PREDICTED: 60S ribosomal protein L5-1-like isoform X1 [Oryza 
brachyantha]
Length=306

 Score =   204 bits (519),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            + RRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHS+KRFAGF KD KNLDA++HR
Sbjct  140  DERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDEKNLDADIHR  199

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
            KYI+GGHVA YM S+ E+E EK Q HFS Y+K+GI+AD +EALYKKVHAAIRADP+  KS
Sbjct  200  KYIFGGHVADYMRSMAEEEPEKYQAHFSEYLKRGIDADGMEALYKKVHAAIRADPTMAKS  259

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
             K+PP  HKR+  KKLTY++R+A+L+ER NALN++AG
Sbjct  260  TKKPPTTHKRYNLKKLTYEQRKARLVERLNALNSSAG  296



>gb|EMT20601.1| 60S ribosomal protein L5-2 [Aegilops tauschii]
Length=299

 Score =   204 bits (518),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 136/157 (87%), Gaps = 0/157 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            + RRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHS+KRFAGF KD K+LDAE+HR
Sbjct  133  DERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDEKSLDAEIHR  192

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
            KYI+GGHVA YM SL ++E EK QTHFS YIK+GI AD++EA+YKKVHAAIRADP+  KS
Sbjct  193  KYIFGGHVADYMRSLADEEPEKFQTHFSEYIKRGISADDMEAVYKKVHAAIRADPTMAKS  252

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
             K PPK HKR+  KKLTY++R+A L+ER NALN +AG
Sbjct  253  TKAPPKTHKRYNPKKLTYEQRKASLVERLNALNNSAG  289



>gb|KJB22669.1| hypothetical protein B456_004G060400 [Gossypium raimondii]
Length=298

 Score =   204 bits (518),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 134/158 (85%), Gaps = 0/158 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             E+RRPFRALLDVGLIRTTTGNRVFG  KGALDGG+DIPHS+KRFAGF KD K LD EVH
Sbjct  132  AETRRPFRALLDVGLIRTTTGNRVFGVLKGALDGGIDIPHSDKRFAGFNKDGKQLDPEVH  191

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYIYGGHVAAYM +L EDE EK Q+HFS YIK+ IE D IE +YKKVHAAIRA P  KK
Sbjct  192  RKYIYGGHVAAYMRNLMEDEPEKYQSHFSEYIKRSIEPDTIEGMYKKVHAAIRASPEAKK  251

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
            SEK PPKEHKR+  KKL+Y+ER+AKLI+R  ALN+AAG
Sbjct  252  SEKAPPKEHKRYNLKKLSYEERKAKLIDRLKALNSAAG  289



>gb|KJB22668.1| hypothetical protein B456_004G060400 [Gossypium raimondii]
Length=301

 Score =   204 bits (518),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 134/158 (85%), Gaps = 0/158 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             E+RRPFRALLDVGLIRTTTGNRVFG  KGALDGG+DIPHS+KRFAGF KD K LD EVH
Sbjct  135  AETRRPFRALLDVGLIRTTTGNRVFGVLKGALDGGIDIPHSDKRFAGFNKDGKQLDPEVH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYIYGGHVAAYM +L EDE EK Q+HFS YIK+ IE D IE +YKKVHAAIRA P  KK
Sbjct  195  RKYIYGGHVAAYMRNLMEDEPEKYQSHFSEYIKRSIEPDTIEGMYKKVHAAIRASPEAKK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
            SEK PPKEHKR+  KKL+Y+ER+AKLI+R  ALN+AAG
Sbjct  255  SEKAPPKEHKRYNLKKLSYEERKAKLIDRLKALNSAAG  292



>ref|XP_006645165.1| PREDICTED: 60S ribosomal protein L5-1-like isoform X2 [Oryza 
brachyantha]
Length=303

 Score =   204 bits (519),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            + RRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHS+KRFAGF KD KNLDA++HR
Sbjct  137  DERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDEKNLDADIHR  196

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
            KYI+GGHVA YM S+ E+E EK Q HFS Y+K+GI+AD +EALYKKVHAAIRADP+  KS
Sbjct  197  KYIFGGHVADYMRSMAEEEPEKYQAHFSEYLKRGIDADGMEALYKKVHAAIRADPTMAKS  256

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
             K+PP  HKR+  KKLTY++R+A+L+ER NALN++AG
Sbjct  257  TKKPPTTHKRYNLKKLTYEQRKARLVERLNALNSSAG  293



>dbj|BAH20263.1| AT3G25520 [Arabidopsis thaliana]
Length=202

 Score =   200 bits (509),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 134/157 (85%), Gaps = 0/157 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            +SRRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHS+KRFAGF K++K LDAE+HR
Sbjct  37   DSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFHKENKQLDAEIHR  96

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
             YIYGG V+ YM  L EDE EK QTHFS YIKKG+EA++IE LYKKVHAAIRADP+PKK+
Sbjct  97   NYIYGGDVSNYMKLLGEDEPEKLQTHFSAYIKKGVEAESIEELYKKVHAAIRADPNPKKT  156

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
             K  PK+HKR+  KKLTY+ER+ KLIER  ALN A G
Sbjct  157  VKPAPKQHKRYNLKKLTYEERKNKLIERVKALNGAGG  193



>gb|ABK93902.1| unknown [Populus trichocarpa]
Length=297

 Score =   203 bits (516),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             ++RRPFRALLDVGL+RTTTGNRVFGA KGALDGGLDIPHSEKRFAGF KD+K LDAEVH
Sbjct  135  ADTRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFGKDNKQLDAEVH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYIYGGHVAAYM +L EDE EK Q+HFS Y+K+ I+AD +EALYKKVHAAIRADP+ KK
Sbjct  195  RKYIYGGHVAAYMRTLMEDEPEKYQSHFSEYLKREIDADCMEALYKKVHAAIRADPTTKK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAGN  141
            SEK+P KEHK++  KKLTY+ER+ KL+ER N  N+AA +
Sbjct  255  SEKEPLKEHKKYNLKKLTYEERKEKLVERLNTFNSAADD  293



>gb|AFK41086.1| unknown [Medicago truncatula]
Length=302

 Score =   203 bits (516),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             ESRRPFRALLDVGL++TT GNRVFGA KGALDGGLDIPHS+KRFAGF K+ K LDAEVH
Sbjct  135  AESRRPFRALLDVGLVKTTIGNRVFGALKGALDGGLDIPHSDKRFAGFDKEKKELDAEVH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYI+GGHV+AYM +L EDE EK QTHFS YIKKGIEAD +E LYKKVHAAIRADP+ KK
Sbjct  195  RKYIFGGHVSAYMKTLIEDEPEKYQTHFSEYIKKGIEADGLEELYKKVHAAIRADPTIKK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAA  147
            SEKQPPK+HKR+  KKLTY+ER+AKL+ R  ALNAA 
Sbjct  255  SEKQPPKQHKRYNLKKLTYEERKAKLVSRLAALNAAV  291



>ref|NP_566767.1| 60S ribosomal protein L5-1 [Arabidopsis thaliana]
 sp|Q8LBI1.2|RL51_ARATH RecName: Full=60S ribosomal protein L5-1 [Arabidopsis thaliana]
 gb|AAL06822.1| AT5g39740/MKM21_30 [Arabidopsis thaliana]
 gb|AAL38279.1| 60S ribosomal protein L5 [Arabidopsis thaliana]
 gb|AAM10263.1| 60S ribosomal protein L5 [Arabidopsis thaliana]
 gb|AAM96985.1| putative ribosomal protein [Arabidopsis thaliana]
 gb|AAN15730.1| putative ribosomal protein [Arabidopsis thaliana]
 gb|AAO00787.1| ribosomal protein, putative [Arabidopsis thaliana]
 gb|AAO73340.1| ribosomal protein L5 [Arabidopsis thaliana]
 gb|AAP42718.1| At3g25520 [Arabidopsis thaliana]
 gb|AEE77019.1| 60S ribosomal protein L5-1 [Arabidopsis thaliana]
Length=301

 Score =   203 bits (516),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            +SRRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHS+KRFAGF K++K LDAE+HR
Sbjct  136  DSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFHKENKQLDAEIHR  195

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
             YIYGGHV+ YM  L EDE EK QTHFS YIKKG+EA++IE LYKKVHAAIRADP+PKK+
Sbjct  196  NYIYGGHVSNYMKLLGEDEPEKLQTHFSAYIKKGVEAESIEELYKKVHAAIRADPNPKKT  255

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
             K  PK+HKR+  KKLTY+ER+ KLIER  ALN A G
Sbjct  256  VKPAPKQHKRYNLKKLTYEERKNKLIERVKALNGAGG  292



>ref|XP_002870764.1| hypothetical protein ARALYDRAFT_916328 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47023.1| hypothetical protein ARALYDRAFT_916328 [Arabidopsis lyrata subsp. 
lyrata]
Length=302

 Score =   203 bits (516),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 121/157 (77%), Positives = 136/157 (87%), Gaps = 0/157 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            +SRRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHS+KRFAGF K++K LDAE+HR
Sbjct  136  DSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKENKQLDAEIHR  195

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
             YIYGGHV+ YM  L EDE EK QTHFS YIKKG+EA++IE +YKKVHAAIRADP+PKK+
Sbjct  196  NYIYGGHVSNYMKLLGEDEPEKLQTHFSAYIKKGVEAESIEEMYKKVHAAIRADPNPKKT  255

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
            EK  PKEHKR+  KKLTY+ER+ KLIER  ALN A G
Sbjct  256  EKPAPKEHKRYNLKKLTYEERKNKLIERVKALNGAGG  292



>ref|XP_008650733.1| PREDICTED: 60S ribosomal protein L5-1-like [Zea mays]
 tpg|DAA43179.1| TPA: hypothetical protein ZEAMMB73_131299 [Zea mays]
Length=301

 Score =   203 bits (516),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 135/158 (85%), Gaps = 0/158 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             E RRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHS+KRFAGF KD K LDA++H
Sbjct  136  AEERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDDKQLDADIH  195

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYIYG HVA YM +L ++E EK Q HFS YIKKGIEAD++EALYKKVHAAIRADPS  K
Sbjct  196  RKYIYGLHVAEYMKNLADEEPEKYQAHFSEYIKKGIEADDMEALYKKVHAAIRADPSMAK  255

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
            S K  PKEHKR+  KKLTY++R+A+L+ER NALN++ G
Sbjct  256  STKAQPKEHKRYNPKKLTYEQRKARLVERLNALNSSGG  293



>dbj|BAC06273.1| putative 60S ribosomal protein L5 [Oryza sativa Japonica Group]
 gb|EAZ14478.1| hypothetical protein OsJ_04401 [Oryza sativa Japonica Group]
Length=301

 Score =   203 bits (516),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 134/157 (85%), Gaps = 0/157 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            + RRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHS+KRFAGF KD K LD+++HR
Sbjct  134  DERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDEKQLDSDIHR  193

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
            KYIYGGHVA YM S+ E+E EK Q HFS Y+KKGI+AD +EALYKKVHAAIRADP+  KS
Sbjct  194  KYIYGGHVADYMRSMAEEEPEKFQAHFSEYLKKGIDADGMEALYKKVHAAIRADPTMAKS  253

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
             K+ P  HKR+  KKLTY++R+A L+ER NALN++AG
Sbjct  254  TKKEPATHKRYNLKKLTYEQRKASLVERLNALNSSAG  290



>sp|A2WXX3.2|RL51_ORYSI RecName: Full=60S ribosomal protein L5-1 [Oryza sativa Indica 
Group]
 gb|EEC71954.1| hypothetical protein OsI_04779 [Oryza sativa Indica Group]
Length=304

 Score =   202 bits (515),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 134/157 (85%), Gaps = 0/157 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            + RRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHS+KRFAGF KD K LD+++HR
Sbjct  137  DERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDEKQLDSDIHR  196

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
            KYIYGGHVA YM S+ E+E EK Q HFS Y+KKGI+AD +EALYKKVHAAIRADP+  KS
Sbjct  197  KYIYGGHVADYMRSMAEEEPEKFQAHFSEYLKKGIDADGMEALYKKVHAAIRADPTMAKS  256

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
             K+ P  HKR+  KKLTY++R+A L+ER NALN++AG
Sbjct  257  TKKEPATHKRYNLKKLTYEQRKASLVERLNALNSSAG  293



>ref|NP_001045083.1| Os01g0896800 [Oryza sativa Japonica Group]
 sp|Q0JGY1.1|RL51_ORYSJ RecName: Full=60S ribosomal protein L5-1 [Oryza sativa Japonica 
Group]
 dbj|BAD82174.1| putative ribosomal protein L5 [Oryza sativa Japonica Group]
 dbj|BAF06997.1| Os01g0896800 [Oryza sativa Japonica Group]
 gb|ACA50481.1| 60S ribosomal protein L5 [Oryza sativa Japonica Group]
 dbj|BAG96886.1| unnamed protein product [Oryza sativa Japonica Group]
Length=304

 Score =   202 bits (515),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 134/157 (85%), Gaps = 0/157 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            + RRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHS+KRFAGF KD K LD+++HR
Sbjct  137  DERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDEKQLDSDIHR  196

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
            KYIYGGHVA YM S+ E+E EK Q HFS Y+KKGI+AD +EALYKKVHAAIRADP+  KS
Sbjct  197  KYIYGGHVADYMRSMAEEEPEKFQAHFSEYLKKGIDADGMEALYKKVHAAIRADPTMAKS  256

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
             K+ P  HKR+  KKLTY++R+A L+ER NALN++AG
Sbjct  257  TKKEPATHKRYNLKKLTYEQRKASLVERLNALNSSAG  293



>ref|XP_004171975.1| PREDICTED: 60S ribosomal protein L5-like, partial [Cucumis sativus]
Length=246

 Score =   201 bits (510),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 136/157 (87%), Gaps = 0/157 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            +SRRPFRALLDVGL+RTTTGNRVFGA KGALDGGLD+PHS KRFAGF+K +  L+A+VHR
Sbjct  81   DSRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDVPHSVKRFAGFSKGNNELNADVHR  140

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
            KYI+GGHVAAYM +L EDE EK QT FS YIKKGIE DNIE L KKVH+AIRA+P  K +
Sbjct  141  KYIFGGHVAAYMRTLMEDEPEKYQTQFSDYIKKGIEPDNIEELLKKVHSAIRAEPLVKTT  200

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
            EKQPPK HKR+  KKLTY++R+AKL+ER NALN+AAG
Sbjct  201  EKQPPKTHKRYNLKKLTYEQRKAKLVERLNALNSAAG  237



>gb|KJB27799.1| hypothetical protein B456_005G010200 [Gossypium raimondii]
Length=296

 Score =   202 bits (514),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 124/157 (79%), Positives = 136/157 (87%), Gaps = 3/157 (2%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            ++RRPFRALLDVGLIRTTTGN VFGA KGALD GLDIPHS+KRFAGF+KD K LDAEVHR
Sbjct  136  DTRRPFRALLDVGLIRTTTGNNVFGALKGALDAGLDIPHSDKRFAGFSKDGKQLDAEVHR  195

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
             YIYGGHVAAYM  L EDE EK Q+HFS YIK+GIEADNIE+LYKKVHAAIRADPS KKS
Sbjct  196  NYIYGGHVAAYMRILMEDEPEKYQSHFSEYIKRGIEADNIESLYKKVHAAIRADPSAKKS  255

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
            EK PPK+H R    KLTY+ER+AKLI+R + LNAAAG
Sbjct  256  EKAPPKQHMRL---KLTYEERKAKLIDRLHTLNAAAG  289



>ref|NP_001151284.1| 60S ribosomal protein L5-1 [Zea mays]
 gb|ACG42230.1| 60S ribosomal protein L5-1 [Zea mays]
Length=302

 Score =   202 bits (515),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 121/157 (77%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            + RRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHSEKRFAGF KD K LDA+ HR
Sbjct  137  DERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFKKDDKQLDADTHR  196

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
            +YIYGGHVA YM +L E+E EK Q+HFS YIKKG+EA+ IEALYKKVHAAIRADPS  KS
Sbjct  197  RYIYGGHVADYMKNLAEEEPEKYQSHFSAYIKKGVEAEEIEALYKKVHAAIRADPSVVKS  256

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
             KQPPKEHKR+  KKLTY++R+A LIER N LN++ G
Sbjct  257  TKQPPKEHKRYNPKKLTYEQRKASLIERLNQLNSSGG  293



>ref|XP_007135197.1| hypothetical protein PHAVU_010G109200g [Phaseolus vulgaris]
 gb|ESW07191.1| hypothetical protein PHAVU_010G109200g [Phaseolus vulgaris]
Length=301

 Score =   202 bits (514),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             ++RRPFRALLDVGLI+TTTGNRVFGA KGALDGGLDIPHS+KRFAGF KD K LD ++H
Sbjct  135  ADTRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDKRFAGFDKDKKELDVDIH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKY++GGHVA+YM +L EDE EK QTHFS YIK+GIEAD +E LYKKVHAAIRADP+ KK
Sbjct  195  RKYVFGGHVASYMKTLIEDEPEKYQTHFSEYIKRGIEADCLEDLYKKVHAAIRADPTFKK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
            SEK+ PKEHKR+  KKLTY+ER+AKL+ R  ALN+AAG
Sbjct  255  SEKETPKEHKRYNLKKLTYEERKAKLVARLQALNSAAG  292



>gb|AFK36106.1| unknown [Lotus japonicus]
Length=302

 Score =   202 bits (514),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             E+RRPFRALLDVGLI+TTTGNRVFGA KGALDGGLDIPHSEKRFAGF K+ K LDAEVH
Sbjct  135  AETRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSEKRFAGFDKEKKELDAEVH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYI+GGHVA+YM +L EDE EK Q+HFS YIK+GIEAD +E LYKKVHAAIRADPS KK
Sbjct  195  RKYIFGGHVASYMKTLTEDEPEKYQSHFSEYIKRGIEADGLEELYKKVHAAIRADPSTKK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNA  153
            S K  PKEHKR+  KKLTYDER+ KLI R  ALN+
Sbjct  255  SGKPEPKEHKRYNLKKLTYDERKNKLIARLQALNS  289



>ref|XP_010441086.1| PREDICTED: 60S ribosomal protein L5-1-like [Camelina sativa]
Length=301

 Score =   202 bits (513),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 134/157 (85%), Gaps = 0/157 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            +SRRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHS+KRFAGF K++K LDA +HR
Sbjct  136  DSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKENKQLDAAIHR  195

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
             YIYGGHV+ YM +L EDE EK QTHFS YIKKG+EA+ IE LYKKVHAAIRADP+PKK+
Sbjct  196  NYIYGGHVSNYMKTLAEDEPEKLQTHFSAYIKKGVEAEGIEELYKKVHAAIRADPNPKKT  255

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
             K  PK+HKR+  KKLTY+ER+ KLIER  ALN A G
Sbjct  256  VKPAPKQHKRYNLKKLTYEERKNKLIERVKALNGAGG  292



>sp|Q8L4L4.1|RL52_ORYSJ RecName: Full=60S ribosomal protein L5-2 [Oryza sativa Japonica 
Group]
 pdb|3J61|D Chain D, Localization Of The Large Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 dbj|BAC06272.1| putative 60S ribosomal protein L5 [Oryza sativa Japonica Group]
Length=304

 Score =   202 bits (514),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 134/157 (85%), Gaps = 0/157 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            + RRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHS+KRFAGF KD K LD+++HR
Sbjct  137  DERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDEKQLDSDIHR  196

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
            KYIYGGHVA YM S+ E+E EK Q HFS Y+KKGI+AD +E+LYKKVHAAIRADP+  KS
Sbjct  197  KYIYGGHVADYMRSMAEEEPEKFQAHFSEYLKKGIDADGMESLYKKVHAAIRADPTMAKS  256

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
             K+ P  HKR+  KKLTY++R+A L+ER NALN++AG
Sbjct  257  TKKEPATHKRYNLKKLTYEQRKASLVERLNALNSSAG  293



>dbj|BAD82173.1| putative ribosomal protein L5 [Oryza sativa Japonica Group]
 gb|ACA50480.1| 60S ribosomal protein L5 [Oryza sativa Japonica Group]
 gb|EEC71953.1| hypothetical protein OsI_04778 [Oryza sativa Indica Group]
 gb|EEE55807.1| hypothetical protein OsJ_04400 [Oryza sativa Japonica Group]
Length=304

 Score =   202 bits (513),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 134/157 (85%), Gaps = 0/157 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            + RRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHS+KRFAGF KD K LD+++HR
Sbjct  137  DERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDEKQLDSDIHR  196

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
            KYIYGGHVA YM S+ E+E EK Q HFS Y+KKGI+AD +E+LYKKVHAAIRADP+  KS
Sbjct  197  KYIYGGHVADYMRSMAEEEPEKFQAHFSEYLKKGIDADGMESLYKKVHAAIRADPTMAKS  256

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
             K+ P  HKR+  KKLTY++R+A L+ER NALN++AG
Sbjct  257  TKKEPATHKRYNLKKLTYEQRKASLVERLNALNSSAG  293



>gb|AGV54354.1| 60S ribosomal protein L5-like protein [Phaseolus vulgaris]
Length=301

 Score =   202 bits (513),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 137/158 (87%), Gaps = 0/158 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             ++RRPFRALLDVGLI+TTTGNRVFGA KGALDGGLDIPHS+KRFAGF KD K LD ++H
Sbjct  135  ADTRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDKRFAGFDKDKKELDVDIH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKY++GGHVA+YM +L EDE EK QTHFS YIK+GIEAD +E LYKKVHAAIRADP+ KK
Sbjct  195  RKYVFGGHVASYMKTLIEDEPEKYQTHFSEYIKRGIEADGLEDLYKKVHAAIRADPTFKK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
             EK+ PKEHKR+  KKLTY+ER+AKL+ R  ALN+AAG
Sbjct  255  FEKETPKEHKRYNLKKLTYEERKAKLVARLQALNSAAG  292



>ref|XP_007160627.1| hypothetical protein PHAVU_001G003200g [Phaseolus vulgaris]
 gb|ESW32621.1| hypothetical protein PHAVU_001G003200g [Phaseolus vulgaris]
Length=300

 Score =   201 bits (512),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             ++RRPFRALLDVGLI+TTTGNRVFGA KGALDGGLDIPHS+KRFAGF KD K LDA++H
Sbjct  135  ADTRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDKRFAGFDKDKKELDADIH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKY++GGHVA+YM +L EDE EK QTHFS YIK+GIE DN+E +YKKVHAAIRADP+ KK
Sbjct  195  RKYVFGGHVASYMKTLIEDEPEKYQTHFSDYIKRGIEPDNLEEVYKKVHAAIRADPTFKK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAA  147
            SEK+PPKEHKR+  KKLTY+ER+AKL+ R  ALN+AA
Sbjct  255  SEKEPPKEHKRYNLKKLTYEERKAKLVARLQALNSAA  291



>ref|XP_006858792.1| hypothetical protein AMTR_s00066p00162800 [Amborella trichopoda]
 gb|ERN20259.1| hypothetical protein AMTR_s00066p00162800 [Amborella trichopoda]
Length=298

 Score =   201 bits (511),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 135/159 (85%), Gaps = 1/159 (1%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             ESRRPFRALLDVGL++TTTGNRVFGA KGALDGGLDIPHS+KRFAG++KD K+LDAEVH
Sbjct  135  AESRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSDKRFAGYSKDDKSLDAEVH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYIYGGHVAAYM+ L EDE EK Q+HF  Y+K+ IE ++IE +YKKVH AIRAD     
Sbjct  195  RKYIYGGHVAAYMSMLREDEPEKYQSHFVEYLKREIEPESIEEMYKKVHTAIRAD-PSSV  253

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAGN  141
             +K  PKEHKR+  KKLTY+ER+AKL+ER NALN+AAG+
Sbjct  254  KKKPAPKEHKRYNLKKLTYEERKAKLVERLNALNSAAGD  292



>ref|XP_002885727.1| hypothetical protein ARALYDRAFT_480054 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61986.1| hypothetical protein ARALYDRAFT_480054 [Arabidopsis lyrata subsp. 
lyrata]
Length=304

 Score =   201 bits (510),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 116/160 (73%), Positives = 130/160 (81%), Gaps = 3/160 (2%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgg---lDIPHSEKRFAGFTKDSKNLDAE  444
            ESRRPFRALLDVGLIRTTTGNRVFGA K         LDIPHS+KRFAGF K++K LDAE
Sbjct  136  ESRRPFRALLDVGLIRTTTGNRVFGALKVLKGALDGGLDIPHSDKRFAGFNKENKQLDAE  195

Query  443  VHRKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpsp  264
            +HR YIYGGHV+ YM  L EDE EK QTHFS YIKKG+EA++IE LYKKVHAAIRADP+P
Sbjct  196  IHRNYIYGGHVSNYMKLLGEDEPEKLQTHFSAYIKKGVEAESIEELYKKVHAAIRADPNP  255

Query  263  kksekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
            KK+EK  PK+HKR+  KKLTY+ER+ KLIER  ALN A G
Sbjct  256  KKTEKPAPKQHKRYNLKKLTYEERKNKLIERVKALNGAGG  295



>ref|XP_007135299.1| hypothetical protein PHAVU_010G117700g [Phaseolus vulgaris]
 gb|ESW07293.1| hypothetical protein PHAVU_010G117700g [Phaseolus vulgaris]
Length=299

 Score =   201 bits (510),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 136/157 (87%), Gaps = 0/157 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             ++RRPFRALLDVGLI+TTTGNRVFGA KGALDGGLDIPHS+KRFAGF KD K LD ++H
Sbjct  135  ADTRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDKRFAGFDKDKKELDVDIH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKY++GGHVA+YM +L EDE EK QTHFS YIK+G+EAD +E LYKKVHAAIRADP+ KK
Sbjct  195  RKYVFGGHVASYMKTLMEDEPEKYQTHFSDYIKRGVEADGLEDLYKKVHAAIRADPTFKK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAA  147
            S K+ PKEHKR+  KKLTY+ER+AKL+ R  ALN+AA
Sbjct  255  SSKEAPKEHKRYNLKKLTYEERKAKLVARLQALNSAA  291



>ref|XP_010542064.1| PREDICTED: 60S ribosomal protein L5-1-like [Tarenaya hassleriana]
Length=304

 Score =   201 bits (510),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            ++RRPFRALLDVGL+RTTTGNR+FGA KGALDGGLDIPHS+KRFAGF K++K LDAE HR
Sbjct  136  DTRRPFRALLDVGLLRTTTGNRIFGALKGALDGGLDIPHSDKRFAGFNKETKQLDAETHR  195

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
             YI+GGHV +YM  + EDE EK Q+HFS Y KKGIEADN+EALYKKVHAAIRADP+ KKS
Sbjct  196  NYIFGGHVGSYMKLMMEDEPEKYQSHFSEYAKKGIEADNLEALYKKVHAAIRADPTLKKS  255

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
            +K  P EHKR+  KKLTY+ER+A+LIER  ALN+ AG
Sbjct  256  DKPAPTEHKRYNLKKLTYEERKARLIERLKALNSGAG  292



>gb|EYU46087.1| hypothetical protein MIMGU_mgv11b008897mg [Erythranthe guttata]
Length=304

 Score =   201 bits (510),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 119/149 (80%), Positives = 135/149 (91%), Gaps = 0/149 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             E+RRPFRALLDVGLI+TTTGNRVFGA KGALDGGLDIPHS+KRFAG+ KD+K LD EVH
Sbjct  135  AETRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDKRFAGYNKDNKQLDPEVH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYIYGGHVA+YMN+L EDE EK Q+HF  YIK+G+EADNIE +YKKVHAAIRADP+PKK
Sbjct  195  RKYIYGGHVASYMNALMEDEPEKYQSHFKEYIKRGVEADNIEEMYKKVHAAIRADPTPKK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIER  171
            S+KQ PKEHKR+  KKLTY+ER+AKLIER
Sbjct  255  SDKQQPKEHKRYNLKKLTYEERKAKLIER  283



>gb|AFK39593.1| unknown [Lotus japonicus]
Length=301

 Score =   201 bits (510),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 121/157 (77%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             E+R PFRALLDVGLI+TTTGNRVFGA KGALDGGLDIPHS+KRFAGF K+ K LDAEVH
Sbjct  135  AETRGPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDKRFAGFDKEKKELDAEVH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKY++GGHVAAYM +L EDE EK Q+HFS YIK+GIEAD +E LYKKVHAAIRADP+ KK
Sbjct  195  RKYVFGGHVAAYMKTLIEDEPEKYQSHFSEYIKRGIEADGLEELYKKVHAAIRADPTSKK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAA  147
            SEK  PKEHKR+  KKLTYDER+ KLI R  ALN+AA
Sbjct  255  SEKPQPKEHKRYNLKKLTYDERKNKLIARLQALNSAA  291



>gb|AFK46994.1| unknown [Lotus japonicus]
Length=302

 Score =   201 bits (510),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 133/155 (86%), Gaps = 0/155 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             E+RRPFRALLDVGLI+TTTGNRVFGA KGALDGGLDIPHSEKRFAGF K+ K LDAEVH
Sbjct  135  AETRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSEKRFAGFDKEKKELDAEVH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYI+GGHVA+YM +L EDE EK Q+HFS YIK+GIEAD +E LYKKVHAAIRADPS KK
Sbjct  195  RKYIFGGHVASYMKTLTEDEPEKYQSHFSEYIKRGIEADGLEELYKKVHAAIRADPSTKK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNA  153
            S K  PKEHKR+  KKLTYDER+ +LI R  ALN+
Sbjct  255  SGKPEPKEHKRYNLKKLTYDERKNELIARLQALNS  289



>ref|XP_010435855.1| PREDICTED: 60S ribosomal protein L5-1 isoform X1 [Camelina sativa]
 ref|XP_010435856.1| PREDICTED: 60S ribosomal protein L5-1 isoform X2 [Camelina sativa]
Length=301

 Score =   200 bits (509),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 133/157 (85%), Gaps = 0/157 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            +SRRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHS+KRFAGF K++K LDA +HR
Sbjct  136  DSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKENKQLDAAIHR  195

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
             YIYGGHV+ YM  L EDE EK QTHFS YIKKG+EA+ IE LYKKVHAAIRADP+PKK+
Sbjct  196  NYIYGGHVSNYMKILAEDEPEKLQTHFSAYIKKGVEAEGIEELYKKVHAAIRADPNPKKT  255

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
             K  PK+HKR+  KKLTY+ER+ KLIER  ALN A G
Sbjct  256  VKPAPKQHKRYNLKKLTYEERKNKLIERVKALNGAGG  292



>ref|XP_006296719.1| hypothetical protein CARUB_v10014269mg [Capsella rubella]
 gb|EOA29617.1| hypothetical protein CARUB_v10014269mg [Capsella rubella]
Length=301

 Score =   200 bits (509),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 133/157 (85%), Gaps = 0/157 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            +SRRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHS+KRFAGF K++K LDA +HR
Sbjct  136  DSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKENKQLDAAIHR  195

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
             YIYGGHV+ YM  L EDE EK QTHFSGYIKKG+EA+ IE +YKKVHAAIRA+P+ KK+
Sbjct  196  NYIYGGHVSNYMKMLAEDEPEKLQTHFSGYIKKGVEAEGIEEMYKKVHAAIRAEPNHKKT  255

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
             K  PKEHKR+  KKLTY+ER+ KLIER  ALN A G
Sbjct  256  VKSAPKEHKRYNLKKLTYEERKNKLIERVKALNGAGG  292



>ref|XP_002876523.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52782.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=301

 Score =   200 bits (509),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 119/156 (76%), Positives = 132/156 (85%), Gaps = 0/156 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            E+RRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHS+KRFAGF+K++K LD   H 
Sbjct  137  ENRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFSKENKQLDFATHA  196

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
            KYIYGGHVA YM +LNEDE EK QTHFS Y+KKGIEAD +EALYKKVHAAIRADP  KK+
Sbjct  197  KYIYGGHVADYMKTLNEDEPEKFQTHFSEYVKKGIEADEMEALYKKVHAAIRADPLAKKA  256

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAA  147
             KQ  KEHKRF  KKLTY +R+A LI+R   LN+AA
Sbjct  257  GKQSLKEHKRFNLKKLTYKQRKANLIDRITTLNSAA  292



>ref|NP_198790.1| 60S ribosomal protein L5-2 [Arabidopsis thaliana]
 ref|NP_001190439.1| 60S ribosomal protein L5-2 [Arabidopsis thaliana]
 sp|P49227.3|RL52_ARATH RecName: Full=60S ribosomal protein L5-2 [Arabidopsis thaliana]
 dbj|BAB11380.1| 60S ribosomal protein L5 [Arabidopsis thaliana]
 gb|AAL84975.1| AT5g39740/MKM21_30 [Arabidopsis thaliana]
 gb|AAM13122.1| ribosomal protein L5 - like [Arabidopsis thaliana]
 gb|AAP42719.1| At5g39740 [Arabidopsis thaliana]
 gb|AED94469.1| 60S ribosomal protein L5-2 [Arabidopsis thaliana]
 gb|AED94470.1| 60S ribosomal protein L5-2 [Arabidopsis thaliana]
Length=301

 Score =   200 bits (509),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            +SRRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHS+KRFAGF K++K LDAE+HR
Sbjct  136  DSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFHKENKQLDAEIHR  195

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
             YIYGGHV+ YM  L EDE EK QTHFS YIKKG+EA++IE +YKKVHAAIRA+P+ KK+
Sbjct  196  NYIYGGHVSNYMKLLGEDEPEKLQTHFSAYIKKGVEAESIEEMYKKVHAAIRAEPNHKKT  255

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
            EK  PKEHKR+  KKLTY+ER+ KLIER  ALN A G
Sbjct  256  EKSAPKEHKRYNLKKLTYEERKNKLIERVKALNGAGG  292



>ref|XP_004968269.1| PREDICTED: 60S ribosomal protein L5-1-like [Setaria italica]
Length=299

 Score =   200 bits (508),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 135/159 (85%), Gaps = 0/159 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             + RRPFRALLDVGLIRTTTGNRVF A KGALDGGLDIPHS+KRFAGF KD K LDAEVH
Sbjct  135  ADGRRPFRALLDVGLIRTTTGNRVFAALKGALDGGLDIPHSDKRFAGFKKDEKQLDAEVH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
             KYIYGGHVA YM +L E+E EK Q+HFS YIKKGI+AD++E LYKKVHAAIRADPS  K
Sbjct  195  HKYIYGGHVADYMRTLAEEEFEKYQSHFSEYIKKGIKADDVETLYKKVHAAIRADPSVAK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAGN  141
            S K+PPKEHKR+  KKLT++ERR++L+ER NALN+   +
Sbjct  255  STKEPPKEHKRYNSKKLTHEERRSRLVERLNALNSCGDD  293



>ref|XP_004144191.1| PREDICTED: 60S ribosomal protein L5-like [Cucumis sativus]
 gb|KGN47624.1| hypothetical protein Csa_6G365730 [Cucumis sativus]
Length=301

 Score =   200 bits (508),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 136/157 (87%), Gaps = 0/157 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            +SRRPFRALLDVGL+RTTTGNRVFGA KGALDGGLD+PHS KRFAGF+K +  L+A+VHR
Sbjct  136  DSRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDVPHSVKRFAGFSKGNNELNADVHR  195

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
            KYI+GGHVAAYM +L EDE EK QT FS YIKKGIE DNIE L KKVH+AIRA+P  K +
Sbjct  196  KYIFGGHVAAYMRTLMEDEPEKYQTQFSDYIKKGIEPDNIEELLKKVHSAIRAEPLVKTT  255

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
            EKQPPK HKR+  KKLTY++R+AKL+ER NALN+AAG
Sbjct  256  EKQPPKTHKRYNLKKLTYEQRKAKLVERLNALNSAAG  292



>ref|XP_002465922.1| hypothetical protein SORBIDRAFT_01g048270 [Sorghum bicolor]
 gb|EER92920.1| hypothetical protein SORBIDRAFT_01g048270 [Sorghum bicolor]
Length=302

 Score =   200 bits (508),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 134/157 (85%), Gaps = 0/157 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             E RRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHS+KRFAGF KD K LDA++H
Sbjct  137  AEGRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDDKQLDADIH  196

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYIYG HVA YM +L ++E EK Q HFS YIKKGIEAD++EALYKKVHAAIRADPS  K
Sbjct  197  RKYIYGLHVAEYMKNLADEEPEKYQAHFSEYIKKGIEADDMEALYKKVHAAIRADPSMAK  256

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAA  147
            S K PPKEHKR+  KKLTY++R+A L+ER NALN++ 
Sbjct  257  STKTPPKEHKRYNPKKLTYEQRKASLVERLNALNSSG  293



>ref|XP_010466965.1| PREDICTED: 60S ribosomal protein L5-1-like [Camelina sativa]
Length=301

 Score =   200 bits (508),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 134/157 (85%), Gaps = 0/157 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            +SRRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHS+KRFAGF K++K LDA +HR
Sbjct  136  DSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKENKQLDAAIHR  195

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
             YIYGGHV+ YM  L EDE EK QTHFS YIKKG+EA++IE +YKKVHAAIRADP+PKK+
Sbjct  196  NYIYGGHVSNYMKMLAEDEPEKLQTHFSAYIKKGVEAESIEEIYKKVHAAIRADPNPKKT  255

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
            EK  PK HKR+  KKLTY+ER+ KLIER  ALN A G
Sbjct  256  EKPAPKGHKRYNLKKLTYEERKNKLIERVKALNGAGG  292



>ref|XP_009136122.1| PREDICTED: 60S ribosomal protein L5-1-like [Brassica rapa]
Length=302

 Score =   200 bits (508),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 134/153 (88%), Gaps = 0/153 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            ESRRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHS+KRFAGF K++K LDAE+HR
Sbjct  136  ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKENKQLDAEIHR  195

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
             YIYGGHV+ YM  LNEDE EK QTHFS Y+KKG++A+++E LYKKVHAAIRADP+PKK+
Sbjct  196  NYIYGGHVSNYMKMLNEDEPEKFQTHFSQYLKKGVDAESMEELYKKVHAAIRADPNPKKT  255

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALN  156
            EK  PK HKR+  KKLTY+ER+ KLIER  ALN
Sbjct  256  EKPAPKTHKRYNLKKLTYEERKNKLIERVKALN  288



>ref|XP_008445491.1| PREDICTED: 60S ribosomal protein L5-like [Cucumis melo]
Length=301

 Score =   200 bits (508),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 136/157 (87%), Gaps = 0/157 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            +SRRPFRALLDVGL+RTTTGNRVFGA KGALDGGLD+PHS KRFAGF+K +  L+A+VHR
Sbjct  136  DSRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDVPHSVKRFAGFSKGNNELNADVHR  195

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
            KYI+GGHVAAYM +L EDE EK QT FS YIKKGIE DNIE L KKVH+AIRA+P  K +
Sbjct  196  KYIFGGHVAAYMRTLMEDEPEKYQTQFSDYIKKGIEPDNIEELLKKVHSAIRAEPLAKTT  255

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
            EKQPPK HKR+  KKLTY++R+AKL+ER NALN+AAG
Sbjct  256  EKQPPKTHKRYNLKKLTYEQRKAKLVERLNALNSAAG  292



>ref|XP_006647221.1| PREDICTED: 60S ribosomal protein L5-1-like [Oryza brachyantha]
Length=303

 Score =   199 bits (507),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 134/157 (85%), Gaps = 0/157 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            + RRPF ALLDVGL+RTTTGNRVFGA KGALDGGLDIPH EKRFAGF KD K LDAE+HR
Sbjct  137  DERRPFHALLDVGLVRTTTGNRVFGALKGALDGGLDIPHGEKRFAGFKKDEKQLDAEIHR  196

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
            KYIYGGHVA YM SL E+E EK Q HFS YIK+GIEAD++EALYKKVHAAIRA+P+  KS
Sbjct  197  KYIYGGHVADYMRSLAEEEPEKFQAHFSDYIKRGIEADDMEALYKKVHAAIRANPTMVKS  256

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
             K+PPK HKR+  KKLTY+ R+A L++R NALN++AG
Sbjct  257  TKEPPKTHKRYNLKKLTYEGRKASLVQRLNALNSSAG  293



>gb|AAM64753.1| ribosomal protein, putative [Arabidopsis thaliana]
Length=301

 Score =   199 bits (507),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 133/157 (85%), Gaps = 0/157 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            +SRRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHS+KRFAGF K++K LDAE+HR
Sbjct  136  DSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFHKENKQLDAEIHR  195

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
             YIYGGHV+ YM  L EDE EK QTHFS YIKKG+EA++IE LYKKVHAAIRA P+ +K+
Sbjct  196  NYIYGGHVSNYMKLLGEDEPEKLQTHFSAYIKKGVEAESIEELYKKVHAAIRAXPNXRKT  255

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
             K  PK+HKR+  KKLTY+ER+ KLIER  ALN A G
Sbjct  256  VKPAPKQHKRYNLKKLTYEERKNKLIERVKALNGAGG  292



>ref|XP_009102410.1| PREDICTED: 60S ribosomal protein L5-1 [Brassica rapa]
Length=302

 Score =   199 bits (507),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 132/153 (86%), Gaps = 0/153 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            ESRRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHS+KRFAGF K++K LDAE+HR
Sbjct  136  ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKENKQLDAEIHR  195

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
             YIYGGHV+ YM  LNEDE EK QTHFS Y+KKG++A+ +E LYKKVHAAIRADP+PKK+
Sbjct  196  NYIYGGHVSNYMKMLNEDEPEKFQTHFSQYLKKGVDAETMEELYKKVHAAIRADPNPKKT  255

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALN  156
             K  PK HKR+  KKLTY+ER+ KLIER  ALN
Sbjct  256  AKPAPKAHKRYNLKKLTYEERKNKLIERVKALN  288



>ref|XP_006284122.1| hypothetical protein CARUB_v10005255mg [Capsella rubella]
 gb|EOA17020.1| hypothetical protein CARUB_v10005255mg [Capsella rubella]
Length=301

 Score =   199 bits (507),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 136/158 (86%), Gaps = 0/158 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            +SRRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHS+KRFAGF K++K L+AE HR
Sbjct  136  DSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKENKQLNAETHR  195

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
             YIYGGHV+ YM  L EDE EK QTHFS Y+KKG+EA++IE +YKKVHAAIRADP+PKK+
Sbjct  196  NYIYGGHVSNYMKMLAEDEPEKLQTHFSAYLKKGVEAESIEEMYKKVHAAIRADPNPKKT  255

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAGN  141
            EK  PK+HKR+  KKLTY+ER+ KLIER  ALN A G+
Sbjct  256  EKPAPKQHKRYNLKKLTYEERKNKLIERVKALNGAGGD  293



>ref|XP_010488654.1| PREDICTED: 60S ribosomal protein L5-1-like [Camelina sativa]
Length=301

 Score =   199 bits (507),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 133/157 (85%), Gaps = 0/157 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            +SRRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHS+KRFAGF K++K LDA +HR
Sbjct  136  DSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKENKQLDAAIHR  195

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
             YIYGGHV+ YM  L EDE EK QTHFS YIKKG+EA+ IE +YKKVHAAIRADP+PKK+
Sbjct  196  NYIYGGHVSNYMKMLAEDEPEKLQTHFSAYIKKGVEAEGIEEIYKKVHAAIRADPNPKKT  255

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
            EK  PK HKR+  KKLTY+ER+ KLIER  ALN A G
Sbjct  256  EKPAPKGHKRYNLKKLTYEERKNKLIERVKALNGAGG  292



>ref|XP_010514215.1| PREDICTED: 60S ribosomal protein L5-1-like [Camelina sativa]
Length=302

 Score =   199 bits (507),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 133/157 (85%), Gaps = 0/157 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            +SRRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHS+KRFAGF K++K LDA +HR
Sbjct  136  DSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKENKQLDAAIHR  195

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
             YIYGGHV+ YM  L EDE EK QTHFS YIKKG+EA+ IE +YKKVHAAIRADP+PKK+
Sbjct  196  NYIYGGHVSNYMKMLAEDEPEKLQTHFSAYIKKGVEAEGIEEIYKKVHAAIRADPNPKKT  255

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
            EK  PK HKR+  KKLTY+ER+ KLIER  ALN A G
Sbjct  256  EKPAPKGHKRYNLKKLTYEERKNKLIERVKALNGAGG  292



>emb|CDY52294.1| BnaA03g57870D [Brassica napus]
Length=332

 Score =   200 bits (509),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 134/153 (88%), Gaps = 0/153 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            ESRRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHS+KRFAGF K++K LDAE+HR
Sbjct  166  ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKENKQLDAEIHR  225

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
             YIYGGHV+ YM  LNEDE EK QTHFS Y+KKG++A+++E LYKKVHAAIRADP+PKK+
Sbjct  226  NYIYGGHVSNYMKMLNEDEPEKFQTHFSQYLKKGVDAESMEELYKKVHAAIRADPNPKKT  285

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALN  156
            EK  PK HKR+  KKLTY+ER+ KLIER  ALN
Sbjct  286  EKPAPKTHKRYNLKKLTYEERKNKLIERVKALN  318



>emb|CDY27889.1| BnaA07g04790D [Brassica napus]
Length=309

 Score =   199 bits (507),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 133/153 (87%), Gaps = 0/153 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            ESRRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHS+KRFAGF K++K LDAE+HR
Sbjct  143  ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKENKQLDAEIHR  202

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
             YIYGGHV+ YM  LNEDE EK QTHFS Y+KKG++A+ +E LYKKVHAAIRADP+PKK+
Sbjct  203  NYIYGGHVSNYMKMLNEDEPEKFQTHFSQYLKKGVDAETMEELYKKVHAAIRADPNPKKT  262

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALN  156
            EK  PK HKR+  KKLTY+ER+ KLIER  ALN
Sbjct  263  EKPAPKAHKRYNLKKLTYEERKNKLIERVKALN  295



>ref|XP_006284123.1| hypothetical protein CARUB_v10005255mg, partial [Capsella rubella]
 gb|EOA17021.1| hypothetical protein CARUB_v10005255mg, partial [Capsella rubella]
Length=322

 Score =   200 bits (508),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 136/158 (86%), Gaps = 0/158 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            +SRRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHS+KRFAGF K++K L+AE HR
Sbjct  157  DSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKENKQLNAETHR  216

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
             YIYGGHV+ YM  L EDE EK QTHFS Y+KKG+EA++IE +YKKVHAAIRADP+PKK+
Sbjct  217  NYIYGGHVSNYMKMLAEDEPEKLQTHFSAYLKKGVEAESIEEMYKKVHAAIRADPNPKKT  276

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAGN  141
            EK  PK+HKR+  KKLTY+ER+ KLIER  ALN A G+
Sbjct  277  EKPAPKQHKRYNLKKLTYEERKNKLIERVKALNGAGGD  314



>ref|XP_010912766.1| PREDICTED: 60S ribosomal protein L5-like [Elaeis guineensis]
Length=331

 Score =   200 bits (508),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            ESRRPFRALLDVGL+RTTTGNRVFGA KGALDGGLDIPHS+KRFAGF+KD K LD EVHR
Sbjct  164  ESRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFSKDEKQLDPEVHR  223

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
            KYI+GGHV++YM  L EDE EK QTHFS Y+K+GIE D+IE LYKKVHAAIRADP+  KS
Sbjct  224  KYIFGGHVSSYMRMLMEDEPEKYQTHFSEYVKRGIEPDDIEELYKKVHAAIRADPNMVKS  283

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIER  171
             K+PPKEHKRF  KKLTY+ER+A+LIER
Sbjct  284  TKEPPKEHKRFNLKKLTYEERKARLIER  311



>gb|KJB10810.1| hypothetical protein B456_001G226000 [Gossypium raimondii]
Length=298

 Score =   199 bits (505),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 133/158 (84%), Gaps = 4/158 (3%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             ESRRPFRALLDVGL+RTTTGNRVF   KGALDGG+DIPHSEKRFAGF KDSK LD EVH
Sbjct  135  AESRRPFRALLDVGLVRTTTGNRVFSVLKGALDGGVDIPHSEKRFAGFNKDSKQLDPEVH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYIYGGHVAAYM        EK Q+HFS YIK+GIE D+IE +YKKVHAAIRADP  KK
Sbjct  195  RKYIYGGHVAAYMKM----SPEKYQSHFSEYIKRGIEPDSIEGMYKKVHAAIRADPEAKK  250

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
            S+K+PPKEHKR+  KKL+Y+ER+AKLI+R  ALN+AAG
Sbjct  251  SKKEPPKEHKRYNLKKLSYEERKAKLIDRLKALNSAAG  288



>emb|CDY52293.1| BnaA03g57860D [Brassica napus]
Length=326

 Score =   199 bits (507),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 134/153 (88%), Gaps = 0/153 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            ESRRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHS+KRFAGF K++K LDAE+HR
Sbjct  160  ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKENKQLDAEIHR  219

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
             YIYGGHV+ YM  LNEDE EK QTHFS Y+KKG++A+++E LYKKVHAAIRADP+PKK+
Sbjct  220  NYIYGGHVSNYMKMLNEDEPEKFQTHFSQYLKKGVDAESMEELYKKVHAAIRADPNPKKT  279

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALN  156
            EK  PK HKR+  KKLTY+ER+ KLIER  ALN
Sbjct  280  EKPAPKTHKRYNLKKLTYEERKNKLIERVKALN  312



>gb|AHA84189.1| 60S ribosomal protein L5 [Phaseolus vulgaris]
Length=299

 Score =   198 bits (504),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             ++RRPFRALLDVGLI+TTTGNRVFGA KGALDGGLDIPHS+KRFAGF KD K LD ++H
Sbjct  135  ADTRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDKRFAGFDKDKKELDVDIH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKY++GGHVA+YM +L EDE EK QTHFS YIK+G+EAD +E LYKKVHAAIRADP+ KK
Sbjct  195  RKYVFGGHVASYMKTLIEDEPEKYQTHFSDYIKRGVEADGLEDLYKKVHAAIRADPTFKK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAA  147
            S K+ PKEHKR+  KKLTY+ER+AKL+ R  A N+AA
Sbjct  255  SSKEAPKEHKRYNLKKLTYEERKAKLVARLQAFNSAA  291



>ref|XP_009416026.1| PREDICTED: 60S ribosomal protein L5-like [Musa acuminata subsp. 
malaccensis]
Length=302

 Score =   198 bits (504),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 134/159 (84%), Gaps = 0/159 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             ESRRPFRALLDVGL+RTTTGNRVFG  KGALDGGLD+PHS+KRFAGF KD K LDA+ H
Sbjct  135  AESRRPFRALLDVGLVRTTTGNRVFGVLKGALDGGLDVPHSDKRFAGFKKDEKQLDADFH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            R YI+GGHVA+YM +L EDE EK QTHFS YIK+ +  D++E LYKKVHAAIRADPS  K
Sbjct  195  RNYIFGGHVASYMRTLMEDEPEKYQTHFSDYIKRNVGPDDMEDLYKKVHAAIRADPSTVK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAGN  141
            S K+PPKEHKR+  KKLTY+ER+AKLI+R NALN+A  +
Sbjct  255  STKEPPKEHKRYNLKKLTYEERKAKLIDRLNALNSATAD  293



>ref|XP_010557737.1| PREDICTED: 60S ribosomal protein L5-1-like [Tarenaya hassleriana]
Length=305

 Score =   198 bits (503),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 116/154 (75%), Positives = 133/154 (86%), Gaps = 0/154 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            ++RRPFRALLDVGL+RTTTGNRVFGA KGALDGGLDIPHS+KRFAGF K+SK LDAE HR
Sbjct  136  DTRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKESKQLDAETHR  195

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
             YI+GGHVA YM  LN+DE EK QTHFS Y+KKG++ADN+EALYKKVH AIRADP+ KKS
Sbjct  196  NYIFGGHVANYMKLLNDDEPEKYQTHFSEYLKKGMDADNLEALYKKVHTAIRADPTLKKS  255

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNA  153
            EK  P EHKR+  KKLTY+ER+ +LIER  ALN+
Sbjct  256  EKPAPTEHKRYNLKKLTYEERKERLIERLKALNS  289



>emb|CDY50258.1| BnaC07g47930D [Brassica napus]
Length=310

 Score =   198 bits (503),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 133/153 (87%), Gaps = 0/153 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            ESRRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHS+KRFAGF K++K LDA++HR
Sbjct  144  ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKENKQLDADIHR  203

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
             YIYGGHV+ YM  LNEDE EK QTHFS Y+KKG++A+ +E LYKKVHAAIRADP+PKK+
Sbjct  204  NYIYGGHVSNYMKMLNEDEPEKFQTHFSQYLKKGVDAETMEELYKKVHAAIRADPNPKKT  263

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALN  156
            EK  PK HKR+  KKLTY+ER+ KLIER  ALN
Sbjct  264  EKPAPKAHKRYNLKKLTYEERKNKLIERVKALN  296



>emb|CDY15088.1| BnaC03g44490D [Brassica napus]
Length=335

 Score =   199 bits (505),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 134/153 (88%), Gaps = 0/153 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            ESRRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHS+KRFAGF K++K LDAE+HR
Sbjct  169  ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKENKQLDAEIHR  228

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
             YIYGGHV+ YM  LNEDE EK QTHFS Y+KKG++A+++E LYKKVHAAIRADP+PKK+
Sbjct  229  NYIYGGHVSNYMKMLNEDEPEKFQTHFSQYLKKGVDAESMEELYKKVHAAIRADPNPKKT  288

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALN  156
            +K  PK HKR+  KKLTY+ER+ KLIER  ALN
Sbjct  289  KKPAPKTHKRYNLKKLTYEERKNKLIERVKALN  321



>gb|AFK34395.1| unknown [Lotus japonicus]
Length=301

 Score =   197 bits (502),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 120/158 (76%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             E+RRPFRALLDVGL++TTTGNRVFGA KGALDGGLDIPHS+KRFAGF K+ K LD EVH
Sbjct  135  AETRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSDKRFAGFEKEKKELDPEVH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYI+GGHVAAYM +L EDE EK Q+HFS YIK+GIEAD +E LYKKVHAAIRADP+ KK
Sbjct  195  RKYIFGGHVAAYMKTLIEDEPEKYQSHFSEYIKRGIEADGLEDLYKKVHAAIRADPTIKK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
            +EK+PPK+ KR+  KKLTY+ER+AKLI R  ALN+AAG
Sbjct  255  AEKKPPKKSKRYNLKKLTYEERKAKLIARLQALNSAAG  292



>emb|CDY15089.1| BnaC03g44500D [Brassica napus]
Length=319

 Score =   197 bits (502),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 133/153 (87%), Gaps = 0/153 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            ESRRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHS+KRFAGF K++K LDAE+HR
Sbjct  153  ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKENKQLDAEIHR  212

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
             YIYGGHV+ YM  LNEDE EK QTHFS Y+KKG++A+++E LYKKVHAAIRADP+PKK+
Sbjct  213  NYIYGGHVSNYMKMLNEDEPEKFQTHFSQYLKKGVDAESMEELYKKVHAAIRADPNPKKT  272

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALN  156
            EK  PK H R+  KKLTY+ER+ KLIER  ALN
Sbjct  273  EKPAPKTHNRYNLKKLTYEERKNKLIERVKALN  305



>ref|XP_009136123.1| PREDICTED: 60S ribosomal protein L5-1-like [Brassica rapa]
Length=302

 Score =   194 bits (494),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 116/153 (76%), Positives = 133/153 (87%), Gaps = 0/153 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            ESRRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHS+KRFAGF K++K LDAE+HR
Sbjct  136  ESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKENKQLDAEIHR  195

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
             YIYGGHV+ YM  LN DE EK QTHFS ++KKG++A+++E LYKKVHAAIRADP+PKK+
Sbjct  196  NYIYGGHVSNYMKMLNYDEPEKFQTHFSQHLKKGVDAESMEELYKKVHAAIRADPNPKKT  255

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALN  156
            EK  PK HKR+  KKLTY+ER+ KLIER  ALN
Sbjct  256  EKPAPKTHKRYNLKKLTYEERKNKLIERVKALN  288



>gb|KFK38215.1| hypothetical protein AALP_AA3G083700 [Arabis alpina]
Length=303

 Score =   194 bits (494),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 131/154 (85%), Gaps = 0/154 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            +SRRPFRALLDVGL+ TTTGNRVFGA KGALDGGLDIPHS+KRFAGF K+ K LDAE+HR
Sbjct  136  DSRRPFRALLDVGLVMTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKEGKQLDAEIHR  195

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
            KYIYGGHV  YM  L EDE EK QTHFS ++KKG+E +N+E +YKKVHAAIRADP  KKS
Sbjct  196  KYIYGGHVVDYMKLLMEDEPEKYQTHFSDFLKKGLEPENMEEMYKKVHAAIRADPLAKKS  255

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNA  153
            +K+ PKEHKR+  KKLTY+ER+A LIER  ALN+
Sbjct  256  DKETPKEHKRYNPKKLTYEERKASLIERVKALNS  289



>gb|KHN15970.1| 60S ribosomal protein L5 [Glycine soja]
Length=292

 Score =   194 bits (493),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 136/159 (86%), Gaps = 6/159 (4%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             ESRRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHS+KRFAGF K+ K LDAEVH
Sbjct  135  AESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFDKEKKELDAEVH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKY++GGH+      L EDE EK Q+HFS YIK+GIEAD IEALYKKVHAAIRADPS KK
Sbjct  195  RKYVFGGHI------LAEDEPEKYQSHFSEYIKRGIEADGIEALYKKVHAAIRADPSLKK  248

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAGN  141
            SEKQPPKEHKR+  KKLTY+ER+AKLI R  A+N+AA N
Sbjct  249  SEKQPPKEHKRYNLKKLTYEERKAKLIARVAAINSAADN  287



>ref|XP_009151634.1| PREDICTED: 60S ribosomal protein L5-2-like isoform X2 [Brassica 
rapa]
Length=303

 Score =   194 bits (494),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 133/157 (85%), Gaps = 0/157 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            ++RRPFRALLDVGL+ TTTGNRVFGA KGALDGGLDIPHS+KRFAGF K+ KNLDAE+HR
Sbjct  136  DTRRPFRALLDVGLVMTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKEGKNLDAEIHR  195

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
            KYIYGGHVA YM  L EDE EK Q+HFS Y+KK +  +N+E +YK VHAAIRADPS KKS
Sbjct  196  KYIYGGHVADYMKLLMEDEPEKYQSHFSNYLKKDLAPENMEEMYKNVHAAIRADPSIKKS  255

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
            +K+ PKEHKR+  KKLTYDER+A LI+R  ALN+A G
Sbjct  256  DKEAPKEHKRYNPKKLTYDERKASLIQRVKALNSAIG  292



>ref|XP_009151633.1| PREDICTED: 60S ribosomal protein L5-2-like isoform X1 [Brassica 
rapa]
Length=307

 Score =   194 bits (493),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 133/157 (85%), Gaps = 0/157 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            ++RRPFRALLDVGL+ TTTGNRVFGA KGALDGGLDIPHS+KRFAGF K+ KNLDAE+HR
Sbjct  140  DTRRPFRALLDVGLVMTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKEGKNLDAEIHR  199

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
            KYIYGGHVA YM  L EDE EK Q+HFS Y+KK +  +N+E +YK VHAAIRADPS KKS
Sbjct  200  KYIYGGHVADYMKLLMEDEPEKYQSHFSNYLKKDLAPENMEEMYKNVHAAIRADPSIKKS  259

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
            +K+ PKEHKR+  KKLTYDER+A LI+R  ALN+A G
Sbjct  260  DKEAPKEHKRYNPKKLTYDERKASLIQRVKALNSAIG  296



>ref|XP_006395196.1| hypothetical protein EUTSA_v10004670mg [Eutrema salsugineum]
 gb|ESQ32482.1| hypothetical protein EUTSA_v10004670mg [Eutrema salsugineum]
Length=303

 Score =   194 bits (492),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 132/155 (85%), Gaps = 0/155 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            E+RRPFRALLDVGL+ TTTGNRVFGA KGALDGGLDIPHS+KRFAGF K+ KNLDAE+HR
Sbjct  136  ETRRPFRALLDVGLVMTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKEGKNLDAEIHR  195

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
            KYIYGGHVA YM  L EDE EK Q+HFS Y+KK +  +N+E +YKKVHAAIRADPS KKS
Sbjct  196  KYIYGGHVADYMRLLMEDEPEKYQSHFSDYLKKDLAPENMEEMYKKVHAAIRADPSVKKS  255

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNAA  150
            +K+ PKEHKR+  KKLTYDER+A LI+R  ALN+ 
Sbjct  256  DKEAPKEHKRYNPKKLTYDERKASLIQRVKALNSV  290



>gb|KFK38214.1| hypothetical protein AALP_AA3G083600 [Arabis alpina]
Length=302

 Score =   192 bits (489),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 113/154 (73%), Positives = 130/154 (84%), Gaps = 0/154 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            +SRRPFRALLDVGL+ TTTGNRVFGA KGALDGGLDIPHS+KRFAGF K+ K LDAE+HR
Sbjct  136  DSRRPFRALLDVGLVMTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKEGKQLDAEIHR  195

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
            KYIYGGHV  YM  L EDE EK QTHFS ++KKG+E +N+E +YK VHAAIRADP  KKS
Sbjct  196  KYIYGGHVVDYMKLLMEDEPEKYQTHFSDFLKKGLEPENMEEMYKNVHAAIRADPLAKKS  255

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNA  153
            +K+ PKEHKR+  KKLTY+ER+A LIER  ALN+
Sbjct  256  DKEAPKEHKRYNPKKLTYEERKASLIERVKALNS  289



>ref|XP_009384264.1| PREDICTED: 60S ribosomal protein L5-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=173

 Score =   188 bits (477),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 131/157 (83%), Gaps = 6/157 (4%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             ESRRPFRALLDVGL+RTTTGNRVFGA KGALDGGLDIPHS+KR      D K LDAEVH
Sbjct  14   AESRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKR------DEKQLDAEVH  67

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            R YI+GGHVA+Y+ +L EDE EK Q HFS YIK+GIE D++E +YKKVHAAI ADP+  K
Sbjct  68   RNYIFGGHVASYVKTLMEDEPEKYQVHFSEYIKRGIEPDDMEEMYKKVHAAIHADPTTIK  127

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAA  147
            S KQPPKEH+RF  KKLTY+ER+AKLIER NALNA+A
Sbjct  128  STKQPPKEHRRFNLKKLTYEERKAKLIERLNALNASA  164



>emb|CDX86312.1| BnaA06g30290D [Brassica napus]
Length=313

 Score =   192 bits (489),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 132/155 (85%), Gaps = 0/155 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            ++RRPFRALLDVGL+ TTTGNRVFGA KGALDGGLDIPHS+KRFAGF K+ KNLDAE+HR
Sbjct  146  DTRRPFRALLDVGLVMTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKEGKNLDAEIHR  205

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
            KYIYGGHVA YM  L EDE EK Q+HFS Y+KK +  +N+E +YK VHAAIRADPS KKS
Sbjct  206  KYIYGGHVADYMKLLMEDEPEKYQSHFSNYLKKDLAPENMEEMYKNVHAAIRADPSIKKS  265

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNAA  150
            +K+ PKEHKR+  KKLTYDER+A LI+R  ALN+A
Sbjct  266  DKEAPKEHKRYNPKKLTYDERKASLIQRVKALNSA  300



>ref|XP_006282684.1| hypothetical protein CARUB_v10005363mg [Capsella rubella]
 gb|EOA15582.1| hypothetical protein CARUB_v10005363mg [Capsella rubella]
Length=298

 Score =   191 bits (486),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 132/156 (85%), Gaps = 0/156 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            +SRRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHS+KRFAGF K++K L+AE+HR
Sbjct  136  DSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKENKQLNAEIHR  195

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
             YI+GGHV+ YM  L EDE EK QTHFS YIKKG+E ++IE +YKKVH AIRADP+PKK 
Sbjct  196  NYIFGGHVSNYMKMLAEDEPEKLQTHFSAYIKKGVEPESIEEMYKKVHLAIRADPNPKKC  255

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAA  147
            EK  PKEHKR   KKLTY+ER+ KLIER  ALN A+
Sbjct  256  EKPAPKEHKRHNLKKLTYEERKNKLIERVKALNRAS  291



>ref|XP_009384265.1| PREDICTED: 60S ribosomal protein L5-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=224

 Score =   188 bits (478),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 131/157 (83%), Gaps = 6/157 (4%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             ESRRPFRALLDVGL+RTTTGNRVFGA KGALDGGLDIPHS+KR      D K LDAEVH
Sbjct  65   AESRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKR------DEKQLDAEVH  118

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            R YI+GGHVA+Y+ +L EDE EK Q HFS YIK+GIE D++E +YKKVHAAI ADP+  K
Sbjct  119  RNYIFGGHVASYVKTLMEDEPEKYQVHFSEYIKRGIEPDDMEEMYKKVHAAIHADPTTIK  178

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAA  147
            S KQPPKEH+RF  KKLTY+ER+AKLIER NALNA+A
Sbjct  179  STKQPPKEHRRFNLKKLTYEERKAKLIERLNALNASA  215



>emb|CDX85331.1| BnaC07g26420D [Brassica napus]
Length=395

 Score =   193 bits (490),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 132/155 (85%), Gaps = 0/155 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            ++RRPFRALLDVGL+ TTTGNRVFGA KGALDGGLDIPHS+KRFAGF K+ KNLDAE+HR
Sbjct  228  DTRRPFRALLDVGLVMTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKEGKNLDAEIHR  287

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
            KYIYGGHVA YM  L EDE EK Q+HFS Y+KK +  +N+E +YK VHAAIRADPS KKS
Sbjct  288  KYIYGGHVADYMKLLMEDEPEKYQSHFSNYLKKDLAPENMEEMYKNVHAAIRADPSIKKS  347

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNAA  150
            +K+ PKEHKR+  KKLTYDER+A LI+R  ALN+A
Sbjct  348  DKEAPKEHKRYNPKKLTYDERKASLIQRVKALNSA  382



>gb|ABK21084.1| unknown [Picea sitchensis]
Length=297

 Score =   189 bits (480),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 131/156 (84%), Gaps = 0/156 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            ++RRPFRALLDVGL+RTTTGNRVFGA KGALDGGLDIPHS+KRFAG+ K+SK+LDA++HR
Sbjct  136  DARRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAGYNKESKSLDADLHR  195

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
            KYI GGHVAAYM +L EDE EK Q+ FS Y KKGIE +NIE LYKKVHAAIRADP+ K S
Sbjct  196  KYILGGHVAAYMKTLREDEPEKYQSQFSEYHKKGIEPENIEELYKKVHAAIRADPTIKYS  255

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAA  147
            EK  PK  K +  +KLTY+ER+ KLI R NALNA A
Sbjct  256  EKHVPKVQKHYLTRKLTYEERKNKLIARLNALNAGA  291



>ref|XP_007203851.1| hypothetical protein PRUPE_ppa009282m2g, partial [Prunus persica]
 gb|EMJ05050.1| hypothetical protein PRUPE_ppa009282m2g, partial [Prunus persica]
Length=264

 Score =   183 bits (465),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             ESRRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHSEKRFAGF+KDSK LD EVH
Sbjct  135  AESRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDPEVH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYIYGGHVAAYM +L EDE EK QTHFS YIKKGIEADNIEA+YKKV AAIRADP+ KK
Sbjct  195  RKYIYGGHVAAYMRTLMEDEPEKYQTHFSDYIKKGIEADNIEAVYKKVQAAIRADPTAKK  254

Query  257  sekqppkEHK  228
             EKQPPKEHK
Sbjct  255  IEKQPPKEHK  264



>ref|XP_001759628.1| predicted protein [Physcomitrella patens]
 gb|EDQ75540.1| predicted protein [Physcomitrella patens]
Length=293

 Score =   184 bits (466),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 132/155 (85%), Gaps = 0/155 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
            GE +RPFRALLDVGL+RTTTGNRVFGA KGALDGGLD+PHSEKRFAG++K+ K+L+AE+H
Sbjct  135  GEGKRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDVPHSEKRFAGYSKEDKSLNAEIH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYI GGHVA YM  L EDE EK Q+HFSG+IK+GIEAD++  +Y KVHAAIRADP+ +K
Sbjct  195  RKYILGGHVADYMRLLKEDEPEKYQSHFSGFIKEGIEADDLADMYSKVHAAIRADPTSQK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNA  153
            + K+ P E +++  +KLTY+ER+A L++R NA+N 
Sbjct  255  TAKKAPAEKRKWKIQKLTYEERQAALVKRLNAING  289



>ref|XP_001783411.1| predicted protein [Physcomitrella patens]
 gb|EDQ51751.1| predicted protein [Physcomitrella patens]
Length=293

 Score =   182 bits (463),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 130/155 (84%), Gaps = 0/155 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
            GE +RPFRALLDVGL+RTTTGNRVFGA KGALDGGLD+PHSEKRFAG+ K+ K+L+AE+H
Sbjct  135  GEGKRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDVPHSEKRFAGYNKEDKSLNAEIH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYI GGHVA YM  L EDE EK Q+HFSG+IK G+EA+N+  +Y  VHAAIRADP+ +K
Sbjct  195  RKYILGGHVADYMKLLKEDEPEKYQSHFSGFIKAGVEAENLAEMYTSVHAAIRADPTQQK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNA  153
            +EK+ P E +++  +KLTYDER+A L++R NA+N 
Sbjct  255  TEKKAPAEKRKWKIQKLTYDERQAALVKRLNAING  289



>ref|XP_001767871.1| predicted protein [Physcomitrella patens]
 gb|EDQ67385.1| predicted protein [Physcomitrella patens]
Length=293

 Score =   181 bits (459),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 130/155 (84%), Gaps = 0/155 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
            GE +RPFRALLDVGL+RTTTGNRVFGA KGALDGGLD+PHSEKRFAG++K+ K+L+AE H
Sbjct  135  GEGKRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDVPHSEKRFAGYSKEDKSLNAETH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYI GGH+A YM  L EDE EK Q+HFSG+IK G+EADN+  +Y  VHAAIRADP+ +K
Sbjct  195  RKYILGGHIADYMRLLKEDEPEKYQSHFSGFIKAGVEADNLAEMYTSVHAAIRADPTQQK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNA  153
            +EK+ P E +++  +KLTY+ER+A L++R NA+N 
Sbjct  255  TEKKAPAEKRKWKIQKLTYEERQAALVKRLNAVNG  289



>gb|KDO51033.1| hypothetical protein CISIN_1g022424mg [Citrus sinensis]
Length=274

 Score =   180 bits (457),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 109/133 (82%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            E+RRPFRALLDVGL++TTTGNRVFGA KGALDGGLDIPHSEKRFAGF+KDSK LDAEVHR
Sbjct  136  ENRRPFRALLDVGLVKTTTGNRVFGALKGALDGGLDIPHSEKRFAGFSKDSKQLDAEVHR  195

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
            KYIY GHVAAYM +L EDE EK Q+HF  YIK+GIEADN+E LYKKVHAAIRADP+ KKS
Sbjct  196  KYIYCGHVAAYMRTLMEDEPEKYQSHFCEYIKRGIEADNLEELYKKVHAAIRADPNQKKS  255

Query  254  ekqppkEHKRFTQ  216
            EK+PP EHKR+ Q
Sbjct  256  EKKPPAEHKRYGQ  268



>ref|XP_010648788.1| PREDICTED: 60S ribosomal protein L5-like, partial [Vitis vinifera]
Length=191

 Score =   177 bits (450),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 126/157 (80%), Gaps = 0/157 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            +SR+PF   L+VGL+RTTTGNRVFGA KGALDGGLDIPHS+KRF GF+ DSK LDAEVHR
Sbjct  23   DSRKPFCVFLNVGLLRTTTGNRVFGALKGALDGGLDIPHSDKRFFGFSNDSKQLDAEVHR  82

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
            K IY GHV+AYM +  EDE E  Q+HFS YIKK +E D IE +YKKVHA I A+P  KK 
Sbjct  83   KCIYVGHVSAYMGTFMEDEPETYQSHFSEYIKKIVEQDGIEEMYKKVHATICANPIQKKV  142

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
            EKQPPKEHKR+  KKLTY+ER+AKL+ER NALN+   
Sbjct  143  EKQPPKEHKRYNLKKLTYEERKAKLVERLNALNSTTA  179



>gb|KJB71615.1| hypothetical protein B456_011G133700 [Gossypium raimondii]
Length=274

 Score =   180 bits (456),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            ++RRPFRALLDVGLIRTTTGNRVFGA KGALD GLDIPHS+KRFAGF+KD+K LDAEVH 
Sbjct  136  DTRRPFRALLDVGLIRTTTGNRVFGALKGALDAGLDIPHSDKRFAGFSKDNKQLDAEVHS  195

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
            KYIYGGHVAAYM +L EDE EK Q+HFS YIK+GIEADNIE+LYKKVHAAIRADP+ KK+
Sbjct  196  KYIYGGHVAAYMRTLMEDEPEKYQSHFSEYIKRGIEADNIESLYKKVHAAIRADPTAKKT  255

Query  254  ekqppkEHKR  225
            EK+PPK+HKR
Sbjct  256  EKEPPKQHKR  265



>ref|XP_001783620.1| predicted protein [Physcomitrella patens]
 gb|EDQ51584.1| predicted protein [Physcomitrella patens]
Length=293

 Score =   179 bits (455),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 130/155 (84%), Gaps = 0/155 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
            GE +RPFRALLDVGL+RTTTGNRVFGA KGALDGGLD+PHSEKRFAGF+K+ K+L+AE H
Sbjct  135  GEGKRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDVPHSEKRFAGFSKEDKSLNAETH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYI GGHVA YM  L EDE EK Q+HF+ +IK+GIEAD +  +Y KVHAAIRADP  +K
Sbjct  195  RKYILGGHVADYMRLLKEDEPEKYQSHFNKFIKEGIEADELAEMYTKVHAAIRADPDQQK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNA  153
            +EK+ P E +++  +KLT++ER+A L++R NA+NA
Sbjct  255  TEKKAPAEKRKWKIQKLTFEERQAALVQRLNAINA  289



>ref|XP_002967840.1| hypothetical protein SELMODRAFT_144921 [Selaginella moellendorffii]
 gb|EFJ31187.1| hypothetical protein SELMODRAFT_144921 [Selaginella moellendorffii]
Length=296

 Score =   179 bits (453),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 104/156 (67%), Positives = 129/156 (83%), Gaps = 1/156 (1%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            E+RRPFRALLDVGL+RTTTGNRVFGA KGALDGGLDIPHSEKRFAG++K+ K+L+AEVHR
Sbjct  137  ENRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSEKRFAGYSKEDKSLNAEVHR  196

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
            KYIYGGHVAAYM  L +++ EK Q+HFS +IK+G+E +++E LY KVHAAIRADPSP++ 
Sbjct  197  KYIYGGHVAAYMLKLKDEDPEKYQSHFSQFIKEGVEPESLEELYTKVHAAIRADPSPREP  256

Query  254  ekqpp-kEHKRFTQKKLTYDERRAKLIERXNALNAA  150
              +     HK+    KL+Y++R+A LI R  ALNAA
Sbjct  257  PPKKDHGPHKKVKPTKLSYEQRKANLINRIKALNAA  292



>gb|KCW63927.1| hypothetical protein EUGRSUZ_G016041, partial [Eucalyptus grandis]
Length=150

 Score =   174 bits (440),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 94/114 (82%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            E+RRPFRALLDVGL+RTTTGNRVFGA KGALDGGLDIPHS+KRFAGF+KDSK LD +VHR
Sbjct  22   ETRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFSKDSKQLDVDVHR  81

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRAD  273
            KYIYGGHVAAYM +L EDE EK Q+HFS YIK+G+EAD++E LYKKVHAAIRAD
Sbjct  82   KYIYGGHVAAYMRTLAEDEPEKYQSHFSEYIKRGLEADDLEGLYKKVHAAIRAD  135



>gb|EYU36673.1| hypothetical protein MIMGU_mgv1a0142632mg, partial [Erythranthe 
guttata]
Length=140

 Score =   173 bits (439),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = -1

Query  506  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIE  327
            IPHS+KRFAG+ KDSK+LDAEVHRKYIYGGHVAAYMN+L EDE +K QTHFS Y+K G+E
Sbjct  9    IPHSDKRFAGYAKDSKSLDAEVHRKYIYGGHVAAYMNTLMEDEPDKYQTHFSKYVKNGLE  68

Query  326  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAA  147
            AD +EALYKKVHAAIRADP+PKKS+KQP KEHKRF  KKLTY+ER+ KLIER NALN+AA
Sbjct  69   ADELEALYKKVHAAIRADPTPKKSDKQPRKEHKRFNLKKLTYEERKNKLIERLNALNSAA  128



>gb|KHG04393.1| 60S ribosomal L5 [Gossypium arboreum]
Length=260

 Score =   176 bits (445),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 97/121 (80%), Positives = 108/121 (89%), Gaps = 0/121 (0%)
 Frame = -1

Query  506  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIE  327
            IPHS+KRFAGF+KDSK LDAEVHRKYIYGGHVA+YM  L EDE EK Q+HFS YIK+GIE
Sbjct  133  IPHSDKRFAGFSKDSKQLDAEVHRKYIYGGHVASYMRILMEDEPEKYQSHFSEYIKRGIE  192

Query  326  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAA  147
            ADNIE+LYKKVHAAIRADPS KKSEK PPK+HKRF  KKLTY+ER+AKLI+R + LNAAA
Sbjct  193  ADNIESLYKKVHAAIRADPSAKKSEKAPPKQHKRFNLKKLTYEERKAKLIDRLHTLNAAA  252

Query  146  G  144
            G
Sbjct  253  G  253



>ref|XP_002981679.1| hypothetical protein SELMODRAFT_154687 [Selaginella moellendorffii]
 gb|EFJ17161.1| hypothetical protein SELMODRAFT_154687 [Selaginella moellendorffii]
Length=296

 Score =   176 bits (447),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 103/156 (66%), Positives = 128/156 (82%), Gaps = 1/156 (1%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            E+RRPFRALLDVGL+RTTTGNRVFGA KGALDGGLDIPHSEKRFAG++K+ K+L+AEVHR
Sbjct  137  ENRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSEKRFAGYSKEDKSLNAEVHR  196

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
            KYIYGGHVAAYM  L +++ EK Q+HFS +IK+G+E +++E LY KVHAAIR DPSP++ 
Sbjct  197  KYIYGGHVAAYMLKLKDEDPEKYQSHFSQFIKEGVEPESLEELYTKVHAAIREDPSPREP  256

Query  254  ekqpp-kEHKRFTQKKLTYDERRAKLIERXNALNAA  150
              +     HK+    KL+Y++R+A LI R  ALNAA
Sbjct  257  PPKKDHGPHKKVKPTKLSYEQRKANLINRIKALNAA  292



>gb|KDO45958.1| hypothetical protein CISIN_1g0225141mg, partial [Citrus sinensis]
Length=264

 Score =   176 bits (445),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             ++RRPFRALLDVGLI+TTTGNRVFGA KGALDGGLDIPHS+KRFAGF+KD K LDAEVH
Sbjct  135  ADTRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDKRFAGFSKDGKQLDAEVH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYIYGGHVAAYM++L EDE EK Q+HF+ YIKKGI+AD +EALYKKVHAAIRADP+ KK
Sbjct  195  RKYIYGGHVAAYMSTLMEDEPEKYQSHFTEYIKKGIDADGLEALYKKVHAAIRADPTMKK  254

Query  257  sekqppkEHK  228
            SEK  PKEHK
Sbjct  255  SEKPAPKEHK  264



>gb|KCW46050.1| hypothetical protein EUGRSUZ_L00023 [Eucalyptus grandis]
Length=300

 Score =   176 bits (447),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 107/132 (81%), Positives = 120/132 (91%), Gaps = 0/132 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             E+RRPFRALLDVGL+RTTTGNRVFGA KGALDGGLDIPHS+KRFAGF+KDSK LD +VH
Sbjct  135  AETRRPFRALLDVGLLRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFSKDSKQLDVDVH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYIYGGHVAAYM +L EDE EK Q+HFS YIK+G+EAD++E LYKKVHAAIRADP  KK
Sbjct  195  RKYIYGGHVAAYMRTLAEDEPEKYQSHFSEYIKRGLEADDLEGLYKKVHAAIRADPILKK  254

Query  257  sekqppkEHKRF  222
            SEK+PPKEHKR+
Sbjct  255  SEKEPPKEHKRW  266



>gb|KHG14330.1| 60S ribosomal L5 [Gossypium arboreum]
Length=260

 Score =   173 bits (438),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 93/121 (77%), Positives = 108/121 (89%), Gaps = 0/121 (0%)
 Frame = -1

Query  506  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIE  327
            IPHS+KRFAGF+KD+K LDAEVH KYIYGGHVAAYM +L EDE EK Q+HFS YIK+GIE
Sbjct  133  IPHSDKRFAGFSKDNKQLDAEVHSKYIYGGHVAAYMRTLMEDEPEKYQSHFSEYIKRGIE  192

Query  326  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAA  147
            ADNIE+LYK VHAAIRADP+ KK+EK+PPK+HKRF  KKLTY+ER++KLIER + LNAAA
Sbjct  193  ADNIESLYKNVHAAIRADPTAKKTEKEPPKQHKRFNLKKLTYEERKSKLIERLHTLNAAA  252

Query  146  G  144
            G
Sbjct  253  G  253



>gb|KDO45956.1| hypothetical protein CISIN_1g0225141mg [Citrus sinensis]
Length=257

 Score =   171 bits (434),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = -1

Query  506  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIE  327
            IPHS+KRFAGF+KD K LDAEVHRKYIYGGHVAAYM++L EDE EK Q+HF+ YIKKGI+
Sbjct  133  IPHSDKRFAGFSKDGKQLDAEVHRKYIYGGHVAAYMSTLMEDEPEKYQSHFTEYIKKGID  192

Query  326  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFTQKKLTYDERRAKLIERXNALNAA  150
            AD +EALYKKVHAAIRADP+ KKSEK  PKEHKR+  KKLTY+ER+AKL+ER NALN+A
Sbjct  193  ADGLEALYKKVHAAIRADPTMKKSEKPAPKEHKRYNLKKLTYEERKAKLVERLNALNSA  251



>ref|XP_010450776.1| PREDICTED: 60S ribosomal protein L5-1-like [Camelina sativa]
Length=265

 Score =   169 bits (429),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 102/130 (78%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            +SRRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHS+KRFAGF K++K LDA +HR
Sbjct  136  DSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFNKENKQLDAAIHR  195

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
             YIYGGHV+ YM +L EDE EK QTHFS YIKKG+EA+ IE LYKKVHAAIRADP+PKK+
Sbjct  196  NYIYGGHVSNYMKTLAEDEPEKLQTHFSAYIKKGVEAEGIEELYKKVHAAIRADPNPKKT  255

Query  254  ekqppkEHKR  225
             K  PK+HKR
Sbjct  256  VKPAPKQHKR  265



>gb|KHG10378.1| 60S ribosomal protein L5 [Gossypium arboreum]
Length=261

 Score =   169 bits (427),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = -1

Query  506  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIE  327
            IPHSEKRFAGF KDSK LD EVHRKYIYGGHVA+YM +L EDE EK Q+HFS YIK+GIE
Sbjct  133  IPHSEKRFAGFNKDSKQLDPEVHRKYIYGGHVASYMRTLMEDEPEKYQSHFSEYIKRGIE  192

Query  326  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAA  147
            ADN+E +YKKVHAAIRA+P  KKSEK PPKEHKR+  KKL+Y+ER+AKLI+R  ALN+AA
Sbjct  193  ADNLEGVYKKVHAAIRANPEAKKSEKPPPKEHKRYNLKKLSYEERKAKLIDRLKALNSAA  252

Query  146  G  144
            G
Sbjct  253  G  253



>gb|KHG10377.1| 60S ribosomal protein L5 [Gossypium arboreum]
Length=268

 Score =   169 bits (427),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = -1

Query  506  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIE  327
            IPHSEKRFAGF KDSK LD EVHRKYIYGGHVA+YM +L EDE EK Q+HFS YIK+GIE
Sbjct  140  IPHSEKRFAGFNKDSKQLDPEVHRKYIYGGHVASYMRTLMEDEPEKYQSHFSEYIKRGIE  199

Query  326  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAA  147
            ADN+E +YKKVHAAIRA+P  KKSEK PPKEHKR+  KKL+Y+ER+AKLI+R  ALN+AA
Sbjct  200  ADNLEGVYKKVHAAIRANPEAKKSEKPPPKEHKRYNLKKLSYEERKAKLIDRLKALNSAA  259

Query  146  G  144
            G
Sbjct  260  G  260



>ref|XP_010646096.1| PREDICTED: 60S ribosomal protein L5-like [Vitis vinifera]
Length=263

 Score =   167 bits (422),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 91/121 (75%), Positives = 106/121 (88%), Gaps = 0/121 (0%)
 Frame = -1

Query  506  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIE  327
            IPHS+KRFAGF++D K LDA+VHRKYI+GGHVAAYM +L EDE EK Q+HFS YIK+GIE
Sbjct  134  IPHSDKRFAGFSRDGKQLDADVHRKYIFGGHVAAYMTTLMEDEPEKYQSHFSEYIKRGIE  193

Query  326  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAA  147
             D IE +YKKVHA+IRADP+PKKSEK+PPK HKR   KKLTY+ER+AKLIER NALN+AA
Sbjct  194  PDGIEEMYKKVHASIRADPTPKKSEKEPPKVHKRHNLKKLTYEERKAKLIERLNALNSAA  253

Query  146  G  144
            G
Sbjct  254  G  254



>gb|EPS61271.1| hypothetical protein M569_13526, partial [Genlisea aurea]
Length=242

 Score =   166 bits (420),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 90/115 (78%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             ESRRPFRALLDVGL+RTTTGNRVFGA KGALD G+DIPHS+KRFAGF+KD K LDA+VH
Sbjct  111  AESRRPFRALLDVGLLRTTTGNRVFGALKGALDAGIDIPHSDKRFAGFSKDGKQLDAKVH  170

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRAD  273
            RKYIYGGHVAAYMN+L EDE EK + HFS + K+ IEAD +E LY+KVHAAIRAD
Sbjct  171  RKYIYGGHVAAYMNTLAEDEPEKYERHFSEFAKREIEADGLEELYRKVHAAIRAD  225



>ref|XP_002456780.1| hypothetical protein SORBIDRAFT_03g042604 [Sorghum bicolor]
 gb|EES01900.1| hypothetical protein SORBIDRAFT_03g042604 [Sorghum bicolor]
Length=304

 Score =   165 bits (417),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 91/112 (81%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            + RRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHSEKRFAGF KD K LDA++HR
Sbjct  137  DERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFKKDDKQLDADIHR  196

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIR  279
            KYIYGGHVA YM +L E+E EK Q+HFS YIKKGIEA+++E LYKKVHAAIR
Sbjct  197  KYIYGGHVADYMKNLAEEEPEKYQSHFSDYIKKGIEAEDMEGLYKKVHAAIR  248



>ref|XP_010451808.1| PREDICTED: 60S ribosomal protein L5-1-like [Camelina sativa]
Length=143

 Score =   159 bits (403),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = -1

Query  506  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIE  327
            IPHS+KRFAGF K++K LDA +HR YIYGGHV+ YM +L EDE EK QTHFS YIKKG+E
Sbjct  13   IPHSDKRFAGFNKENKQLDAAIHRNYIYGGHVSNYMKTLAEDEPEKLQTHFSAYIKKGVE  72

Query  326  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAA  147
            A+ IE LYKKVHAAIRADP+PKK+ K  PK+HKR+  KKLTY+ER+ KLIER  ALN A 
Sbjct  73   AEGIEELYKKVHAAIRADPNPKKTVKPAPKQHKRYNLKKLTYEERKNKLIERVKALNGAG  132

Query  146  G  144
            G
Sbjct  133  G  133



>gb|KHF99386.1| 60S ribosomal L5 [Gossypium arboreum]
Length=259

 Score =   161 bits (407),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 103/121 (85%), Gaps = 0/121 (0%)
 Frame = -1

Query  506  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIE  327
            IP SEKRFAGF K SK LD EVHRKYIYGGHVAAYM +L EDE EK Q+HFS YIK+GI+
Sbjct  129  IPLSEKRFAGFNKGSKQLDPEVHRKYIYGGHVAAYMKNLMEDEPEKYQSHFSEYIKRGIQ  188

Query  326  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAA  147
             D+IE +YKKVHAAIRADP  KKS+K+PPKEHKR+  KKL+Y+ER+AKLI+R  ALN+AA
Sbjct  189  PDSIEGMYKKVHAAIRADPEAKKSKKEPPKEHKRYNLKKLSYEERKAKLIDRLKALNSAA  248

Query  146  G  144
            G
Sbjct  249  G  249



>gb|KHG15135.1| 60S ribosomal L5 [Gossypium arboreum]
Length=262

 Score =   160 bits (404),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 88/121 (73%), Positives = 99/121 (82%), Gaps = 0/121 (0%)
 Frame = -1

Query  506  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIE  327
            IPH +KRFAGF KDSK LD EVHRKYIYGGHVAAYM +L EDE EK Q+HFS YIK+ IE
Sbjct  133  IPHGDKRFAGFNKDSKQLDPEVHRKYIYGGHVAAYMRTLMEDEPEKYQSHFSEYIKRSIE  192

Query  326  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAA  147
             D IE +YKKVH AIRA P  KKSEK PPKEHKR+  KKL+Y+ER+AKLI+R  ALN+AA
Sbjct  193  PDTIEGMYKKVHTAIRASPEAKKSEKAPPKEHKRYNLKKLSYEERKAKLIDRLKALNSAA  252

Query  146  G  144
            G
Sbjct  253  G  253



>sp|P93779.1|RL5_SOLME RecName: Full=60S ribosomal protein L5, partial [Solanum melongena]
 dbj|BAA19415.1| ribosomal protein L5 [Solanum melongena]
Length=121

 Score =   152 bits (384),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 86/111 (77%), Positives = 94/111 (85%), Gaps = 0/111 (0%)
 Frame = -1

Query  473  TKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKV  294
            +KDSK LDAEVHRKYIYGGHVAAYMN L EDE EK Q+HFS YIK  +  DNIE +YKKV
Sbjct  2    SKDSKQLDAEVHRKYIYGGHVAAYMNILMEDEPEKYQSHFSSYIKADLAPDNIEEMYKKV  61

Query  293  HAAIRADpspkksekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAGN  141
            HAAIR DPSPKKS+KQPPK HKR+  KKLTY+ER+AKLIER NALNAA GN
Sbjct  62   HAAIRPDPSPKKSQKQPPKTHKRYNLKKLTYEERKAKLIERLNALNAAGGN  112



>gb|AGV54527.1| 60S ribosomal protein L5-like protein [Phaseolus vulgaris]
Length=300

 Score =   155 bits (392),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 100/157 (64%), Positives = 122/157 (78%), Gaps = 0/157 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
             ++RRPFRALLDVGLI+TTTGNRVFGA KGALDGGLDIPHS++RFAG +KD K L  E H
Sbjct  135  ADTRRPFRALLDVGLIKTTTGNRVFGALKGALDGGLDIPHSDQRFAGISKDKKELGPEFH  194

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKY++G  +  YM +L EDE  K QT F  Y   G + +++E ++KKVHAAIRA+P+ KK
Sbjct  195  RKYVFGDWLRPYMKTLIEDEPGKYQTPFMDYFSGGKKPEDLEEVFKKVHAAIRANPTFKK  254

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAA  147
             EKQPPKE KR+  KKLTY+ER+AKL+ R  ALN AA
Sbjct  255  VEKQPPKEPKRYNLKKLTYEERKAKLVARLQALNFAA  291



>gb|AFW84311.1| hypothetical protein ZEAMMB73_937605 [Zea mays]
Length=278

 Score =   154 bits (389),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 105/157 (67%), Positives = 116/157 (74%), Gaps = 24/157 (15%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            + RRPFRALLDVGLIRTTTGNRVFGA KGALDGGLDIPHSEKRFAGF K+          
Sbjct  137  DERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSEKRFAGFKKN----------  186

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
                          L E+E EK Q+HFS YIKKG+EAD IEALYKKVHAAIRADPS  KS
Sbjct  187  --------------LAEEEPEKYQSHFSAYIKKGVEADEIEALYKKVHAAIRADPSIVKS  232

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAAG  144
             KQPPKEHKR+  KKLTY++R+A LIER N LN++ G
Sbjct  233  TKQPPKEHKRYNPKKLTYEQRKASLIERLNQLNSSGG  269



>ref|XP_009383145.1| PREDICTED: LOW QUALITY PROTEIN: 60S ribosomal protein L5-2 [Musa 
acuminata subsp. malaccensis]
Length=140

 Score =   143 bits (361),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 88/121 (73%), Gaps = 2/121 (2%)
 Frame = -1

Query  506  IPHSEKRFAGFTKDSKNLDAEVHRKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIE  327
            IPH++KRFAGF KD K LDAE+HRKYI+GGHVA+ M +L EDE EKXQ HF  YIK+  E
Sbjct  11   IPHNDKRFAGFKKDKKQLDAEIHRKYIFGGHVASSMRNLMEDEPEKXQAHFIEYIKRQAE  70

Query  326  ADNIEALYKKVHAAIRADpspkksekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAA  147
             D +E +YKKVHAAIR+  S           H RF  KKLTY+ER+A+LIER NALNA A
Sbjct  71   PDGMEEMYKKVHAAIRS--SKIDKVTTNGALHCRFNLKKLTYEERKARLIERLNALNACA  128

Query  146  G  144
            G
Sbjct  129  G  129



>ref|XP_011399144.1| 60S ribosomal protein L5-1 [Auxenochlorella protothecoides]
 gb|KFM26248.1| 60S ribosomal protein L5-1 [Auxenochlorella protothecoides]
Length=293

 Score =   147 bits (372),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 89/155 (57%), Positives = 115/155 (74%), Gaps = 0/155 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            E  RPF ALLD GL RT+TG++VF A KGALDGGLD+PHS+KRF G+++++K LD+EV R
Sbjct  137  EGPRPFVALLDTGLKRTSTGSKVFAALKGALDGGLDVPHSDKRFVGYSRETKELDSEVLR  196

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
            KYI GGHVA YM SL E+E EK + HFS Y+K G+EA+ +E LY  VHAAIRADP  K+ 
Sbjct  197  KYILGGHVAEYMESLKEEEPEKYERHFSRYVKAGLEAEGLEELYTSVHAAIRADPVQKRK  256

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNAA  150
            E++ P + K + + KLTY+ R+ KL  +   L AA
Sbjct  257  ERKAPADKKAWKESKLTYEARKEKLKAKLAELTAA  291



>ref|XP_005843140.1| hypothetical protein CHLNCDRAFT_37575 [Chlorella variabilis]
 gb|EFN51038.1| hypothetical protein CHLNCDRAFT_37575 [Chlorella variabilis]
Length=295

 Score =   146 bits (369),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 85/155 (55%), Positives = 113/155 (73%), Gaps = 0/155 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            ++ RPF+ +LD GL RT+TG++VF A KGALDGGLDIPH+EKRF GF  DSK  DAEV R
Sbjct  137  DAPRPFQCILDAGLKRTSTGSKVFAALKGALDGGLDIPHNEKRFVGFDPDSKEFDAEVLR  196

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
            KYIYGGHV  YM  + E++ EK   HF+ Y+K G+E+D++E +Y KVH AIRADP+P+  
Sbjct  197  KYIYGGHVGEYMEEMQEEDPEKYTAHFAEYLKAGLESDDLEDMYTKVHDAIRADPAPQLK  256

Query  254  ekqppkEHKRFTQKKLTYDERRAKLIERXNALNAA  150
             +  P E KR+ + KLTY++R+ KL  + + L A 
Sbjct  257  ARSKPAESKRWKEVKLTYEQRKDKLKAKLSELMAG  291



>gb|KDD76608.1| ribosomal L18p/L5e [Helicosporidium sp. ATCC 50920]
Length=290

 Score =   144 bits (363),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 85/152 (56%), Positives = 111/152 (73%), Gaps = 0/152 (0%)
 Frame = -1

Query  608  RRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRKY  429
            +RPF ALLD GL RT+TG++VF A KGALDGGLD+PHSEKRF G++++SK+LD++V RKY
Sbjct  139  KRPFVALLDTGLKRTSTGSKVFAALKGALDGGLDVPHSEKRFVGYSRESKSLDSDVLRKY  198

Query  428  IYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkksek  249
            I+GGHV  YM S+ E++ EK + HFS YIK G+EAD +EALY KVHAAIRA P   K  +
Sbjct  199  IFGGHVGEYMESMAEEDEEKFKRHFSCYIKAGLEADGLEALYTKVHAAIRASPEAAKKSR  258

Query  248  qppkEHKRFTQKKLTYDERRAKLIERXNALNA  153
              P +   +   K TY+ER+ +L  +   L A
Sbjct  259  SKPAKAGSWKTPKSTYEERKERLKAKLAELMA  290



>gb|EME50014.1| hypothetical protein DOTSEDRAFT_31141 [Dothistroma septosporum 
NZE10]
Length=302

 Score =   140 bits (352),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 110/164 (67%), Gaps = 7/164 (4%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
            GE RRPF+  LDVGL+RT+TG RVFGA KGA DGG+ IPHSEKRF G+  +SK LDAE  
Sbjct  139  GEERRPFKCFLDVGLVRTSTGARVFGALKGASDGGVYIPHSEKRFPGYDMESKELDAETL  198

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADp----  270
            RKYI+GGHVA YM +L +D+ E+ ++ F GYI   IEAD +E LY   H  IR DP    
Sbjct  199  RKYIFGGHVAEYMETLADDDEERYKSQFQGYIDDEIEADGLEELYADAHKQIREDPFKKD  258

Query  269  ---spkksekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAA  147
                 KKS+ +   E K+F Q KLT+ ER+ ++ E+  AL + A
Sbjct  259  EEEGEKKSKDEWKAESKKFRQVKLTHAERKQRVQEKIKALASEA  302



>ref|XP_003856228.1| 60S ribosomal protein L5 [Zymoseptoria tritici IPO323]
 gb|EGP91204.1| hypothetical protein MYCGRDRAFT_102365 [Zymoseptoria tritici 
IPO323]
Length=300

 Score =   139 bits (349),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 84/162 (52%), Positives = 110/162 (68%), Gaps = 7/162 (4%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
            GE+RRPF+A LDVGL RT+TG RVFGA KGA DGGL IPHSEKRF GF  ++K LDAE  
Sbjct  139  GETRRPFKAFLDVGLARTSTGARVFGAMKGASDGGLYIPHSEKRFPGFDIETKELDAETL  198

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYI+GGHVA YM +L +D+ E+ ++ F+GYI   IEAD +E LY+  H  IR DP  K 
Sbjct  199  RKYIFGGHVAEYMETLADDDEERYKSQFNGYIDDEIEADGLEELYQDAHKQIREDPFKKA  258

Query  257  sekqppkEHK-------RFTQKKLTYDERRAKLIERXNALNA  153
              +   K  +       ++ QKKLT+ +R+ ++ E+  AL +
Sbjct  259  EGEGEKKTKEQWKAESLKYKQKKLTHAQRQERVQEKIKALTS  300



>gb|EMF17397.1| 60S ribosomal protein L5 [Sphaerulina musiva SO2202]
Length=302

 Score =   137 bits (345),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 83/160 (52%), Positives = 112/160 (70%), Gaps = 7/160 (4%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
            GE+RRPF+  LDVGL RT+TG RVFGA KGA DGGL +PHSEKRF G+  ++K LDAE  
Sbjct  139  GETRRPFKVFLDVGLTRTSTGARVFGAMKGASDGGLYVPHSEKRFPGYDIETKELDAETL  198

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADps---  267
            RKYI+ GHVA YM +L +D+ E+ ++ FSGYI   IEAD +E LY++ H AIR DP    
Sbjct  199  RKYIFAGHVAEYMETLADDDEERYKSQFSGYIDDEIEADGLEELYQEAHKAIREDPWKKD  258

Query  266  ----pkksekqppkEHKRFTQKKLTYDERRAKLIERXNAL  159
                 KK++++   E +++  KKLT++ERR ++ E+   L
Sbjct  259  EDAGEKKTKEEWKAESQKYKLKKLTHEERRQRVQEKIKTL  298



>gb|KEQ82579.1| hypothetical protein M438DRAFT_398586 [Aureobasidium pullulans 
EXF-150]
Length=299

 Score =   137 bits (345),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 106/161 (66%), Gaps = 6/161 (4%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
            GE RRPF+  LDVGL RT+TG RVF A KGA DGGL +PHSEKRF GF  ++K LDAE  
Sbjct  139  GEERRPFKVYLDVGLTRTSTGARVFAAMKGASDGGLYVPHSEKRFPGFDIETKELDAETL  198

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADp----  270
            RKYI+ GHVA YM +L +D+ E+ ++ F GYI   IEAD +E LY+  H  IR DP    
Sbjct  199  RKYIFAGHVAEYMETLADDDEERYKSQFQGYIDDDIEADGLEELYQDAHKQIREDPFKKV  258

Query  269  --spkksekqppkEHKRFTQKKLTYDERRAKLIERXNALNA  153
                KKS+    +E K+F   KLT  ER AK+ E+  AL+A
Sbjct  259  EGEEKKSKDFWKEESKKFRDNKLTKAEREAKIQEKIKALSA  299



>gb|KEQ95896.1| hypothetical protein AUEXF2481DRAFT_39748 [Aureobasidium subglaciale 
EXF-2481]
Length=299

 Score =   136 bits (343),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 106/161 (66%), Gaps = 6/161 (4%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
            GE RRPF+  LDVGL RT+TG RVF A KGA DGGL +PHSEKRF GF  ++K LDAE  
Sbjct  139  GEERRPFKVYLDVGLTRTSTGARVFAAMKGASDGGLYVPHSEKRFPGFDIETKELDAETL  198

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADp----  270
            RKYI+ GHVA YM +L +D+ E+ ++ F GYI   IEAD +E LY+  H  IR DP    
Sbjct  199  RKYIFAGHVAEYMETLADDDEERYKSQFQGYIDDDIEADGLEELYQDAHKQIREDPFKKV  258

Query  269  --spkksekqppkEHKRFTQKKLTYDERRAKLIERXNALNA  153
                KKS+    +E K+F   KLT  ER AK+ E+  AL+A
Sbjct  259  EGEEKKSKDFWKEESKKFRDNKLTKAERDAKIQEKIKALSA  299



>dbj|GAM82159.1| hypothetical protein ANO11243_001380 [fungal sp. No.11243]
Length=303

 Score =   135 bits (341),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 108/164 (66%), Gaps = 7/164 (4%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
            GESRRPF+  LDVGL RT+TG RVFGA KGA DGGL IPHSEKRF GF  +SK LDAE  
Sbjct  139  GESRRPFKCFLDVGLTRTSTGARVFGAMKGASDGGLYIPHSEKRFPGFDIESKELDAETL  198

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRAD-----  273
            RKYI+GGHVA YM +L +D+ E+ ++ F GYI   +EAD +E LY + H+ IR D     
Sbjct  199  RKYIFGGHVAEYMETLADDDEERYKSQFQGYIDDEVEADGLEELYAEAHSQIREDPFKKD  258

Query  272  --pspkksekqppkEHKRFTQKKLTYDERRAKLIERXNALNAAA  147
                 KK ++    E K++   KL++ E++ ++ ER   + A A
Sbjct  259  DEEEEKKDKEHWKSESKKYRSTKLSHAEKKKRVQERIKQIKADA  302



>ref|XP_007920104.1| hypothetical protein MYCFIDRAFT_54807 [Pseudocercospora fijiensis 
CIRAD86]
 gb|EME87665.1| hypothetical protein MYCFIDRAFT_54807 [Pseudocercospora fijiensis 
CIRAD86]
Length=303

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 108/161 (67%), Gaps = 8/161 (5%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
            GE+RRPF+  LDVGL RT+TG RVFGA KGA DGGL +PHSEKRF G+  ++K LDAE  
Sbjct  139  GETRRPFKVFLDVGLTRTSTGARVFGAMKGASDGGLYVPHSEKRFPGYDIETKELDAETL  198

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADp----  270
            RKYI+GGHVA YM +L +D+ E+ Q+ F GYI   IEAD +E LY   H  IR DP    
Sbjct  199  RKYIFGGHVAEYMETLADDDEERYQSQFKGYIDDEIEADGLEELYADAHKQIREDPWKKA  258

Query  269  ----spkksekqppkEHKRFTQKKLTYDERRAKLIERXNAL  159
                  KKS+++   E K+   KKLT +ERR ++ ++  AL
Sbjct  259  EDDGEQKKSKEEWKAETKKHMHKKLTREERRERVSQKIQAL  299



>gb|EKG20809.1| Ribosomal protein L18/L5 [Macrophomina phaseolina MS6]
Length=303

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 101/155 (65%), Gaps = 0/155 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
            GE RRPF+  LDVGL+RT+TGNRVF A KGA DGGL +PHSE RF G+  +SK LDAE  
Sbjct  140  GEERRPFKVFLDVGLVRTSTGNRVFAAMKGASDGGLYVPHSENRFPGYDIESKELDAETL  199

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYI+GGHVA YM +L +D+ E+ ++ F GYI   +EAD +E LY++ H  IR DP    
Sbjct  200  RKYIFGGHVAEYMETLADDDEERYKSQFQGYIDDDLEADGLEELYEEAHKQIREDPFKAD  259

Query  257  sekqppkEHKRFTQKKLTYDERRAKLIERXNALNA  153
             E +  K    + Q+ L Y +++    E+   + A
Sbjct  260  PEAKAKKSKDEYKQESLKYRQKKLTKAEKEERVKA  294



>ref|XP_007674186.1| hypothetical protein BAUCODRAFT_146209 [Baudoinia compniacensis 
UAMH 10762]
 gb|EMC99242.1| hypothetical protein BAUCODRAFT_146209 [Baudoinia compniacensis 
UAMH 10762]
Length=303

 Score =   134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 82/163 (50%), Positives = 109/163 (67%), Gaps = 8/163 (5%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
            GE RRPF+  LDVGL RT+TG RVFGA KGA DGGL +PHSEKRF G+  +SK LDAE  
Sbjct  139  GEERRPFKCFLDVGLTRTSTGARVFGAMKGASDGGLYVPHSEKRFPGYDMESKELDAETL  198

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkk  258
            RKYI+ GHVA YM +L +D+ E+ ++ FSGYI   IEAD +E LY + H+ IR DP  K 
Sbjct  199  RKYIFAGHVAEYMETLADDDEERYKSQFSGYIDDEIEADGLEELYAEAHSQIREDPWKKD  258

Query  257  sekqppkEHKRFTQ--------KKLTYDERRAKLIERXNALNA  153
             +++  K+ K   +        KK++YDE+R ++ E+  A+  
Sbjct  259  EDEEGEKKTKEEWKEESKKHRTKKMSYDEKRQRVQEKIKAMTG  301



>gb|KEQ78036.1| hypothetical protein M436DRAFT_59974 [Aureobasidium pullulans 
var. namibiae CBS 147.97]
Length=299

 Score =   134 bits (337),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 105/161 (65%), Gaps = 6/161 (4%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
            GE RRPF+  LDVGL RT+TG RVF A KGA DGGL +PHSEKRF GF  ++K LDAE  
Sbjct  139  GEERRPFKVYLDVGLTRTSTGARVFAALKGASDGGLYVPHSEKRFPGFDIETKELDAETL  198

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADp----  270
            RKYI+ GHVA YM +L +D+ E+ ++ F GYI   IEAD +E LY+  H  IR DP    
Sbjct  199  RKYIFAGHVAEYMETLADDDEERYKSQFQGYIDDDIEADGLEELYQDAHKQIREDPFKKV  258

Query  269  --spkksekqppkEHKRFTQKKLTYDERRAKLIERXNALNA  153
                KKS+    +E K++   KLT  ER AK+ E+  AL A
Sbjct  259  EGEEKKSKDFWKEESKKYRDNKLTKAEREAKIQEKIKALAA  299



>ref|XP_002176750.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC51213.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=305

 Score =   134 bits (337),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 85/155 (55%), Positives = 107/155 (69%), Gaps = 3/155 (2%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            E +RPFR LLDVG   TTTG+RVFGA KGA DGGLDIPHSEKRF GF +DSK  DA++HR
Sbjct  146  EDKRPFRCLLDVGCKPTTTGHRVFGALKGAADGGLDIPHSEKRFPGFDRDSKEYDADMHR  205

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
            + I+GGHV  YM  L E++ +K Q HF+ +I   +EAD +E LY+ VH  IR D  P  S
Sbjct  206  ERIFGGHVGEYMEYLEEEDNQKYQEHFASFIAAEVEADGLEELYESVHEKIRED--PSPS  263

Query  254  ekqppkEHKRFTQK-KLTYDERRAKLIERXNALNA  153
             K+     K F +K KLT DER+A++  + +A NA
Sbjct  264  PKKDFSPDKSFKRKAKLTLDERKARVQAKKDAKNA  298



>gb|KEQ61687.1| hypothetical protein M437DRAFT_67147 [Aureobasidium melanogenum 
CBS 110374]
Length=300

 Score =   134 bits (336),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 83/162 (51%), Positives = 105/162 (65%), Gaps = 7/162 (4%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
            GE RRPF+  LDVGL RT+TG RVF A KGA DGGL +PHSEKRF GF  ++K LD+E  
Sbjct  139  GEERRPFKVYLDVGLTRTSTGARVFAAMKGASDGGLYVPHSEKRFPGFDIETKELDSETL  198

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRAD-----  273
            RKYI+ GHVA YM +L +D+ E+ ++ F GYI   IEAD +E LY+  H  IR D     
Sbjct  199  RKYIFAGHVAEYMETLADDDEERYKSQFQGYIDDDIEADGLEELYQDAHKQIREDPFKKE  258

Query  272  --pspkksekqppkEHKRFTQKKLTYDERRAKLIERXNALNA  153
                 KKS+    +E K++   KLT  ER AK+ E+  AL+A
Sbjct  259  EGAGEKKSKDFWKEESKKYRDNKLTKAEREAKVQEKIKALSA  300



>emb|CEJ93107.1| Putative 60S ribosomal protein L5 (CPR4) [Torrubiella hemipterigena]
Length=243

 Score =   131 bits (330),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 87/115 (76%), Gaps = 0/115 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
            GE RRPF+A LDVGL RT+TG RVFGA KGA DGG+ +PHSEKRF G+  ++K LDA+V 
Sbjct  78   GEERRPFKAFLDVGLARTSTGARVFGALKGASDGGILVPHSEKRFPGYDMETKELDADVL  137

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRAD  273
            R YIYGGHVA YM +L +D+ E+ Q  F  YI+  +EA+++E LY + HAAIR D
Sbjct  138  RNYIYGGHVAEYMETLADDDEERYQGQFKMYIEDDVEAESLEELYTEAHAAIRED  192



>ref|XP_008022306.1| hypothetical protein SETTUDRAFT_167313 [Setosphaeria turcica 
Et28A]
 gb|EOA90474.1| hypothetical protein SETTUDRAFT_167313 [Setosphaeria turcica 
Et28A]
Length=225

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 85/115 (74%), Gaps = 0/115 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
            GE RRPF+  LDVGL RT+TG RVFGA KG  DGG+ +PHSE RF G+  ++K LDAE  
Sbjct  64   GEERRPFKVFLDVGLARTSTGARVFGAMKGCSDGGVFVPHSENRFPGYDMEAKELDAETL  123

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRAD  273
            RKYI+GGHVA YM +L +D+ E+ ++ FSGYI+  IEAD +E LY++ H  IR D
Sbjct  124  RKYIFGGHVAEYMETLADDDEERYKSQFSGYIEDDIEADGLEELYQEAHKQIRED  178



>gb|KID66354.1| Ribosomal protein L5, eukaryotic/archaeal, partial [Metarhizium 
anisopliae ARSEF 549]
Length=297

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 108/159 (68%), Gaps = 7/159 (4%)
 Frame = -1

Query  608  RRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRKY  429
            RRPF+  LDVGL RT+TG RVFGA KGA DGG+ IPHSEKRF G+  +S+ LD+EV +KY
Sbjct  137  RRPFKVFLDVGLARTSTGARVFGAMKGASDGGIFIPHSEKRFPGYDMESEELDSEVLQKY  196

Query  428  IYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpsp-----  264
            I+GGHVA YM +L +D+ E+ Q+ F  YI  G+EAD +E LY + HAAIRADP       
Sbjct  197  IFGGHVAEYMETLADDDEERYQSQFQKYIDDGLEADGLEDLYTEAHAAIRADPWKKVESD  256

Query  263  --kksekqppkEHKRFTQKKLTYDERRAKLIERXNALNA  153
              KK++++     K++ Q K T  E+  ++ ER  A+ A
Sbjct  257  GPKKTKEEWKAISKKYRQTKSTKAEKEKRVQERIKAILA  295



>ref|XP_007816229.1| Ribosomal protein L5, eukaryotic/archaeal [Metarhizium robertsii 
ARSEF 23]
 gb|EFZ02966.1| Ribosomal protein L5, eukaryotic/archaeal [Metarhizium robertsii 
ARSEF 23]
 gb|EXU98823.1| 60S ribosomal protein L5 [Metarhizium robertsii]
 gb|KFG80307.1| 60S ribosomal protein L5 [Metarhizium anisopliae]
Length=302

 Score =   132 bits (331),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 108/159 (68%), Gaps = 7/159 (4%)
 Frame = -1

Query  608  RRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRKY  429
            RRPF+  LDVGL RT+TG RVFGA KGA DGG+ IPHSEKRF G+  +S+ LD+EV +KY
Sbjct  142  RRPFKVFLDVGLARTSTGARVFGAMKGASDGGIFIPHSEKRFPGYDMESEELDSEVLQKY  201

Query  428  IYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpsp-----  264
            I+GGHVA YM +L +D+ E+ Q+ F  YI  G+EAD +E LY + HAAIRADP       
Sbjct  202  IFGGHVAEYMETLADDDEERYQSQFQKYIDDGLEADGLEDLYTEAHAAIRADPWKKVESD  261

Query  263  --kksekqppkEHKRFTQKKLTYDERRAKLIERXNALNA  153
              KK++++     K++ Q K T  E+  ++ ER  A+ A
Sbjct  262  GPKKTKEEWKAISKKYRQTKSTKAEKEKRVQERIKAILA  300



>gb|KID85893.1| Ribosomal protein L5, eukaryotic/archaeal [Metarhizium guizhouense 
ARSEF 977]
 gb|KID97028.1| Ribosomal protein L5, eukaryotic/archaeal, partial [Metarhizium 
majus ARSEF 297]
Length=302

 Score =   132 bits (331),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 108/159 (68%), Gaps = 7/159 (4%)
 Frame = -1

Query  608  RRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRKY  429
            RRPF+  LDVGL RT+TG RVFGA KGA DGG+ IPHSEKRF G+  +S+ LD+EV +KY
Sbjct  142  RRPFKVFLDVGLARTSTGARVFGAMKGASDGGIFIPHSEKRFPGYDMESEELDSEVLQKY  201

Query  428  IYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpsp-----  264
            I+GGHVA YM +L +D+ E+ Q+ F  YI  G+EAD +E LY + HAAIRADP       
Sbjct  202  IFGGHVAEYMETLADDDEERYQSQFQKYIDDGLEADGLEDLYTEAHAAIRADPWKKVESD  261

Query  263  --kksekqppkEHKRFTQKKLTYDERRAKLIERXNALNA  153
              KK++++     K++ Q K T  E+  ++ ER  A+ A
Sbjct  262  GPKKTKEEWKAISKKYRQTKSTKAEKEKRVQERIKAILA  300



>gb|KEF55260.1| 60S ribosomal protein L5 [Exophiala aquamarina CBS 119918]
Length=301

 Score =   132 bits (331),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 110/160 (69%), Gaps = 7/160 (4%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
            GE RRPF+A LDVGL RT+TG RVFGA KGA DGGL IPH+EKRF G+ ++SK LDA+  
Sbjct  140  GEGRRPFKAFLDVGLHRTSTGARVFGALKGASDGGLYIPHNEKRFPGYDQESKELDADTL  199

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIR-------  279
            RKYI+GGHVA YM +L +D+ E+ ++ FS YI   +EAD +E LY + HAAIR       
Sbjct  200  RKYIFGGHVAEYMETLADDDEERYKSQFSKYIDNDVEADGLEELYSEAHAAIREDPFKKD  259

Query  278  ADpspkksekqppkEHKRFTQKKLTYDERRAKLIERXNAL  159
             D   KKS+ +   E K+  Q+KL+ +E+  ++ E+  +L
Sbjct  260  EDEGEKKSKDEWKAEGKKHRQQKLSKEEKEQRIKEKIASL  299



>gb|KID72246.1| Ribosomal protein L5, eukaryotic/archaeal, partial [Metarhizium 
brunneum ARSEF 3297]
Length=317

 Score =   132 bits (331),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 105/159 (66%), Gaps = 7/159 (4%)
 Frame = -1

Query  608  RRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHRKY  429
            RRPF+  LDVGL RT+TG RVFGA KGA DGG+ +PHSEKRF G+  +S+ LD+EV +KY
Sbjct  157  RRPFKVFLDVGLARTSTGARVFGAMKGASDGGILVPHSEKRFPGYDMESEELDSEVLQKY  216

Query  428  IYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkkse-  252
            I+GGHVA YM +L +D+ E+ Q+ F  YI  G+EAD +E LY + HAAIRADP  K    
Sbjct  217  IFGGHVAEYMETLADDDEERYQSQFQKYIDDGLEADGLEDLYTEAHAAIRADPWKKAESD  276

Query  251  ------kqppkEHKRFTQKKLTYDERRAKLIERXNALNA  153
                  ++     K++ Q K T  E+  ++ ER  A+ A
Sbjct  277  GPKKTKEEWKAISKKYRQTKSTKAEKEKRVQERIKAILA  315



>gb|EMD90558.1| hypothetical protein COCHEDRAFT_1022415 [Bipolaris maydis C5]
 gb|ENI09230.1| hypothetical protein COCC4DRAFT_30092 [Bipolaris maydis ATCC 
48331]
Length=301

 Score =   131 bits (330),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 85/115 (74%), Gaps = 0/115 (0%)
 Frame = -1

Query  617  GESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVH  438
            GE RRPF+  LDVGL RT+TG RVFGA KG  DGG+ +PHSE RF G+  ++K LDAEV 
Sbjct  139  GEERRPFKVFLDVGLTRTSTGARVFGAMKGCSDGGVFVPHSENRFPGYDIEAKELDAEVL  198

Query  437  RKYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRAD  273
            RKYI+GGHVA YM +L +D+ E+ ++ FSGYI+  IEAD +E LY+  H  IR D
Sbjct  199  RKYIFGGHVAEYMETLADDDEERYKSQFSGYIEDDIEADGLEELYQDAHKQIRED  253



>gb|KDR83692.1| hypothetical protein GALMADRAFT_236026 [Galerina marginata CBS 
339.88]
Length=306

 Score =   131 bits (330),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 110/159 (69%), Gaps = 2/159 (1%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            ++ RPF+  LDVGL RT+TG+RVFGA KGA DGG+ IPHS+KRF G+  + K+LDAEV +
Sbjct  139  DAPRPFKCYLDVGLKRTSTGSRVFGAMKGASDGGIFIPHSDKRFPGYDPEGKSLDAEVLK  198

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
            KYI+GGHVA YM SL E++ E+ +  FS Y+  G+ +++IE +Y   HAAIR DP+ K +
Sbjct  199  KYIFGGHVAEYMESLEEEDDERFKKQFSTYLADGVGSEDIEEIYTNAHAAIREDPTFKPT  258

Query  254  ekqppkEHK--RFTQKKLTYDERRAKLIERXNALNAAAG  144
            EK    + +  ++  KKLTYDER+A +  +     +  G
Sbjct  259  EKSKDWKAEGLKYKAKKLTYDERQANIAAKIEKFKSGGG  297



>ref|XP_002675028.1| predicted protein [Naegleria gruberi]
 gb|EFC42284.1| predicted protein [Naegleria gruberi]
Length=297

 Score =   131 bits (329),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 108/160 (68%), Gaps = 7/160 (4%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            ++ RPF+A LDVGL+RTTTGNRVFGA KGA DGGL IPHS +RF GF K+  + +A  HR
Sbjct  137  DAPRPFKAFLDVGLVRTTTGNRVFGALKGACDGGLYIPHSNQRFPGFNKEDDSYNATAHR  196

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRADpspkks  255
            + IYG HV  YM SL E   E+ +  FS +IK G+ A+NIE  YK+ HAAIR +P   K+
Sbjct  197  ERIYGVHVGKYMKSLKEANEEEFKAKFSQFIKNGVTAENIEKKYKEAHAAIRKNPDAVKT  256

Query  254  ekqppkEHKRFTQKKLTYDER-------RAKLIERXNALN  156
            EK  PK  KRF+++KL    R       +AKLIE+ NA+ 
Sbjct  257  EKTAPKTQKRFSKEKLDLKSRKQRIESKKAKLIEKLNAIQ  296



>ref|XP_005781727.1| hypothetical protein EMIHUDRAFT_434648 [Emiliania huxleyi CCMP1516]
 gb|EOD29298.1| hypothetical protein EMIHUDRAFT_434648 [Emiliania huxleyi CCMP1516]
Length=304

 Score =   131 bits (329),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 89/114 (78%), Gaps = 0/114 (0%)
 Frame = -1

Query  614  ESRRPFRALLDVGLIRTTTGNRVFgaxkgaldgglDIPHSEKRFAGFTKDSKNLDAEVHR  435
            +  RPF  +LDVGLIRTTTG +VFGA KGA+DGGL+IPHS+KRF G+  D+K LD E H+
Sbjct  136  DGPRPFTCVLDVGLIRTTTGAKVFGALKGAVDGGLNIPHSDKRFPGYDPDAKELDGETHK  195

Query  434  KYIYGGHVAAYMNSLNEDEREKXQTHFSGYIKKGIEADNIEALYKKVHAAIRAD  273
            KYI+GGHVA YM  L E++ ++ QT F+ YI+K IEAD++E +Y+K H AIR D
Sbjct  196  KYIFGGHVAEYMELLEEEDPDRYQTQFANYIEKDIEADSLEEMYQKAHEAIRED  249



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 856559115090