BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF007B14

Length=732
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AFY26882.1|  catalase                                                325   2e-109   Ipomoea batatas [batate]
gb|ADB03784.1|  catalase                                                324   8e-105   Ipomoea batatas [batate]
sp|P07145.1|CATA_IPOBA  RecName: Full=Catalase                          324   8e-105   Ipomoea batatas [batate]
ref|XP_009624788.1|  PREDICTED: catalase isozyme 3                      269   2e-83    Nicotiana tomentosiformis
ref|XP_010907090.1|  PREDICTED: catalase isozyme 1-like                 265   5e-82    Elaeis guineensis
ref|XP_010061172.1|  PREDICTED: catalase isozyme 3-like                 265   1e-81    Eucalyptus grandis [rose gum]
gb|AGC65520.1|  catalase                                                264   2e-81    Eriobotrya japonica [loquat]
ref|XP_009794469.1|  PREDICTED: catalase isozyme 3                      264   2e-81    Nicotiana sylvestris
gb|ABR15776.1|  catalase                                                257   3e-81    Litchi
emb|CAB56850.1|  catalase                                               261   3e-81    Prunus persica
ref|XP_006473789.1|  PREDICTED: catalase-like isoform X1                262   6e-81    Citrus sinensis [apfelsine]
ref|XP_006435361.1|  hypothetical protein CICLE_v10000948mg             262   8e-81    Citrus clementina [clementine]
ref|NP_001289779.1|  catalase isozyme 1                                 262   1e-80    Nelumbo nucifera [Indian lotus]
ref|XP_008237987.1|  PREDICTED: catalase isozyme 1                      262   1e-80    Prunus mume [ume]
ref|XP_007209948.1|  hypothetical protein PRUPE_ppa004776mg             261   2e-80    Prunus persica
emb|CAD42908.1|  catalase                                               261   2e-80    Prunus persica
ref|XP_010061174.1|  PREDICTED: catalase isozyme 3-like isoform X2      261   3e-80    Eucalyptus grandis [rose gum]
gb|AAB88173.1|  catalase                                                255   3e-80    Glycine max [soybeans]
sp|Q9AXH0.1|CATA_AVIMR  RecName: Full=Catalase                          261   3e-80    Avicennia marina
gb|ABY19573.1|  catalase                                                253   3e-80    Manihot esculenta [manioc]
gb|KJB57963.1|  hypothetical protein B456_009G187600                    260   4e-80    Gossypium raimondii
gb|AAX84671.1|  catalase CAT2                                           253   4e-80    Manihot esculenta [manioc]
ref|XP_010918244.1|  PREDICTED: catalase isozyme 1                      260   4e-80    Elaeis guineensis
ref|XP_008237989.1|  PREDICTED: catalase isozyme 1-like                 260   5e-80    Prunus mume [ume]
ref|XP_009600533.1|  PREDICTED: catalase isozyme 3-like                 260   5e-80    Nicotiana tomentosiformis
sp|P49317.1|CATA3_NICPL  RecName: Full=Catalase isozyme 3               260   5e-80    Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_009413057.1|  PREDICTED: catalase isozyme 2-like                 260   5e-80    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002306976.2|  catalase family protein                            260   5e-80    
ref|XP_010536470.1|  PREDICTED: catalase-2-like                         260   6e-80    Tarenaya hassleriana [spider flower]
dbj|BAF91369.1|  catalase                                               260   6e-80    Capsicum annuum
gb|AIX10947.1|  putative catalase                                       260   7e-80    Gardenia jasminoides
gb|AAM97542.1|  catalase 3                                              259   1e-79    Capsicum annuum
ref|XP_008365915.1|  PREDICTED: catalase isozyme 1                      259   1e-79    
ref|XP_008348924.1|  PREDICTED: catalase isozyme 1                      259   1e-79    
ref|XP_011041225.1|  PREDICTED: catalase isozyme 1                      259   1e-79    Populus euphratica
ref|XP_010242894.1|  PREDICTED: catalase isozyme 1-like isoform X1      259   2e-79    Nelumbo nucifera [Indian lotus]
emb|CDP07287.1|  unnamed protein product                                259   2e-79    Coffea canephora [robusta coffee]
ref|XP_010061175.1|  PREDICTED: catalase-like                           259   2e-79    Eucalyptus grandis [rose gum]
ref|XP_008802866.1|  PREDICTED: catalase isozyme 1                      259   2e-79    Phoenix dactylifera
gb|KJB14249.1|  hypothetical protein B456_002G115900                    254   2e-79    Gossypium raimondii
ref|XP_009773579.1|  PREDICTED: catalase isozyme 3-like                 258   2e-79    Nicotiana sylvestris
sp|Q9M5L6.1|CATA_CAPAN  RecName: Full=Catalase; AltName: Full=CaCat1    258   3e-79    Capsicum annuum
ref|XP_010498496.1|  PREDICTED: catalase-3                              258   3e-79    Camelina sativa [gold-of-pleasure]
ref|XP_009110221.1|  PREDICTED: catalase-3                              258   3e-79    Brassica rapa
ref|XP_007210576.1|  hypothetical protein PRUPE_ppa004763mg             258   3e-79    Prunus persica
ref|XP_009400996.1|  PREDICTED: catalase isozyme 2                      258   4e-79    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008789355.1|  PREDICTED: catalase isozyme 1-like                 258   4e-79    Phoenix dactylifera
ref|XP_002301920.1|  catalase family protein                            258   4e-79    Populus trichocarpa [western balsam poplar]
emb|CAI43948.1|  catalase                                               258   4e-79    Populus deltoides
ref|NP_001031072.3|  catalase 3                                         254   4e-79    Arabidopsis thaliana [mouse-ear cress]
gb|KFK44175.1|  hypothetical protein AALP_AA1G224300                    258   5e-79    Arabis alpina [alpine rockcress]
gb|AEQ30070.1|  catalase                                                257   5e-79    Litchi chinensis [litchi]
emb|CDY33636.1|  BnaC08g19360D                                          257   7e-79    Brassica napus [oilseed rape]
emb|CDY31488.1|  BnaC05g15970D                                          257   7e-79    Brassica napus [oilseed rape]
emb|CDY29519.1|  BnaA06g14510D                                          257   7e-79    Brassica napus [oilseed rape]
gb|AAA57551.1|  catalase                                                254   7e-79    Nicotiana sylvestris
ref|XP_009103334.1|  PREDICTED: catalase-3-like                         257   8e-79    Brassica rapa
ref|XP_011034872.1|  PREDICTED: catalase isozyme 1-like                 257   8e-79    Populus euphratica
gb|ACJ11733.1|  catalase                                                257   9e-79    Gossypium hirsutum [American cotton]
gb|AIS20825.1|  CAT                                                     257   1e-78    Pyrus x bretschneideri [bai li]
ref|XP_009149539.1|  PREDICTED: catalase-3                              258   1e-78    Brassica rapa
ref|XP_008373403.1|  PREDICTED: catalase isozyme 1                      256   1e-78    
ref|XP_011074091.1|  PREDICTED: catalase isozyme 3 isoform X2           256   1e-78    
gb|KCW68095.1|  hypothetical protein EUGRSUZ_F01777                     259   1e-78    Eucalyptus grandis [rose gum]
ref|XP_011074092.1|  PREDICTED: catalase isozyme 3 isoform X3           256   2e-78    Sesamum indicum [beniseed]
emb|CAD42909.1|  catalase                                               256   2e-78    Prunus persica
gb|AGV54297.1|  peroxisomal catalase                                    256   2e-78    Phaseolus vulgaris [French bean]
gb|ACJ76836.3|  catalase                                                256   2e-78    Dimocarpus longan [longan]
ref|XP_006828714.1|  hypothetical protein AMTR_s00001p00022550          256   2e-78    Amborella trichopoda
gb|ACJ73905.1|  CAT1                                                    246   2e-78    Solanum nigrum
dbj|BAH20307.1|  AT1G20620                                              255   2e-78    Arabidopsis thaliana [mouse-ear cress]
emb|CDY01364.1|  BnaA07g11370D                                          258   2e-78    
ref|NP_001237571.1|  catalase-4                                         256   2e-78    Glycine max [soybeans]
ref|XP_007136018.1|  hypothetical protein PHAVU_009G011100g             256   2e-78    Phaseolus vulgaris [French bean]
dbj|BAC79443.1|  catalase                                               256   3e-78    Acacia ampliceps
gb|ADC95629.1|  catalase                                                256   3e-78    Bruguiera gymnorhiza [Burma mangrove]
sp|O24339.1|CATA_SOLAP  RecName: Full=Catalase                          256   3e-78    Soldanella alpina
sp|P55311.1|CATA_SOLME  RecName: Full=Catalase                          256   3e-78    Solanum melongena [aubergine]
gb|KHG25152.1|  Catalase isozyme 1                                      256   3e-78    Gossypium arboreum [tree cotton]
gb|AAR84578.1|  catalase 1a                                             256   3e-78    Lotus japonicus
ref|NP_001240021.1|  catalase                                           255   4e-78    Glycine max [soybeans]
emb|CDY31878.1|  BnaC07g15280D                                          255   4e-78    Brassica napus [oilseed rape]
ref|NP_564120.1|  catalase 3                                            255   4e-78    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009590727.1|  PREDICTED: catalase isozyme 1                      255   4e-78    Nicotiana tomentosiformis
gb|AAM65021.1|  unknown                                                 255   5e-78    Arabidopsis thaliana [mouse-ear cress]
gb|AHF27428.1|  catalase                                                251   5e-78    Cucurbita moschata [ayote]
dbj|BAJ33995.1|  unnamed protein product                                255   5e-78    Eutrema halophilum
ref|XP_006412153.1|  hypothetical protein EUTSA_v10024932mg             255   5e-78    Eutrema salsugineum [saltwater cress]
gb|AGE15298.2|  catalase 1                                              255   5e-78    Eriobotrya japonica [loquat]
gb|AJE26131.1|  catalase                                                255   5e-78    Salix matsudana [tortured willow]
ref|XP_003631925.1|  PREDICTED: catalase isozyme 1-like                 255   6e-78    Vitis vinifera
ref|XP_009792372.1|  PREDICTED: catalase isozyme 1                      255   6e-78    Nicotiana sylvestris
ref|NP_001268098.1|  catalase                                           255   6e-78    Vitis vinifera
sp|P49319.2|CATA1_TOBAC  RecName: Full=Catalase isozyme 1; AltNam...    254   6e-78    Nicotiana tabacum [American tobacco]
emb|CAC04509.1|  catalase                                               247   8e-78    Digitalis lanata [Grecian foxglove]
emb|CDP07288.1|  unnamed protein product                                254   1e-77    Coffea canephora [robusta coffee]
gb|KJB14250.1|  hypothetical protein B456_002G115900                    254   1e-77    Gossypium raimondii
ref|XP_004238430.1|  PREDICTED: catalase isozyme 3                      254   1e-77    Solanum lycopersicum
ref|XP_010530333.1|  PREDICTED: catalase-2                              254   1e-77    Tarenaya hassleriana [spider flower]
gb|ACV30589.1|  catalase                                                243   2e-77    Carica papaya [mamon]
gb|AET97564.1|  catalase                                                254   2e-77    Ziziphus jujuba [Chinese jujube]
ref|XP_006306495.1|  hypothetical protein CARUB_v10012481mg             253   2e-77    Capsella rubella
gb|AAF19965.1|AF207906_1  catalase 1                                    253   2e-77    Zantedeschia aethiopica [arum-lily]
ref|XP_007160597.1|  hypothetical protein PHAVU_001G001000g             253   2e-77    Phaseolus vulgaris [French bean]
ref|NP_001291326.1|  catalase isozyme 1                                 253   3e-77    Sesamum indicum [beniseed]
ref|XP_010663966.1|  PREDICTED: catalase isozyme 1                      253   3e-77    Vitis vinifera
ref|XP_007018034.1|  Catalase 2                                         253   3e-77    
gb|AHF27433.1|  catalase                                                253   3e-77    Cucurbita maxima [Boston marrow]
gb|AHF27430.1|  catalase                                                253   3e-77    Cucurbita moschata [ayote]
gb|AFU48609.1|  catalase 1                                              253   3e-77    Nicotiana benthamiana
emb|CCP37650.1|  catalase-1                                             253   3e-77    Nicotiana tabacum [American tobacco]
ref|NP_001237556.1|  catalase-1/2                                       253   3e-77    Glycine max [soybeans]
gb|ACL27272.1|  catalase                                                253   3e-77    Nicotiana benthamiana
sp|P49316.1|CATA2_NICPL  RecName: Full=Catalase isozyme 2               253   4e-77    Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_006828715.1|  hypothetical protein AMTR_s00001p00024160          252   5e-77    Amborella trichopoda
ref|XP_002867092.1|  hypothetical protein ARALYDRAFT_491144             252   5e-77    
gb|ACV92695.1|  catalase                                                252   5e-77    Brassica oleracea
ref|XP_006435363.1|  hypothetical protein CICLE_v10000951mg             252   5e-77    Citrus clementina [clementine]
ref|XP_006473794.1|  PREDICTED: catalase isozyme 1-like isoform X4      252   6e-77    Citrus sinensis [apfelsine]
gb|AAB62892.1|  catalase-1                                              252   6e-77    Nicotiana glutinosa
emb|CDX76313.1|  BnaA08g10870D                                          252   6e-77    
gb|AAD30292.1|AF139539_1  catalase 3                                    252   7e-77    Raphanus sativus
emb|CAA64220.1|  catalase                                               252   7e-77    Arabidopsis thaliana [mouse-ear cress]
gb|AFU90822.1|  catalase                                                252   7e-77    Populus tomentosa [Chinese white poplar]
ref|XP_006473791.1|  PREDICTED: catalase isozyme 1-like isoform X1      253   7e-77    
ref|XP_010941422.1|  PREDICTED: catalase isozyme B                      252   7e-77    Elaeis guineensis
gb|AAB86582.2|  catalase                                                252   8e-77    Raphanus sativus
ref|XP_006283612.1|  hypothetical protein CARUB_v10004668mg             252   8e-77    Capsella rubella
gb|AAF71742.1|AF248491_1  catalase                                      252   8e-77    Raphanus sativus
gb|AAB71764.1|  catalase 1                                              252   8e-77    Nicotiana tabacum [American tobacco]
sp|P49315.1|CATA1_NICPL  RecName: Full=Catalase isozyme 1               252   8e-77    Nicotiana plumbaginifolia [leadwort-leaved tobacco]
dbj|BAQ21275.1|  catalase                                               251   8e-77    Citrus tamurana
gb|ABM47415.1|  catalase                                                252   8e-77    Prunus avium [gean]
gb|AFU90823.1|  catalase                                                251   8e-77    Populus x beijingensis
emb|CAA45564.1|  catalase                                               252   9e-77    Arabidopsis thaliana [mouse-ear cress]
prf||1906388A  catalase                                                 252   9e-77 
ref|XP_008452956.1|  PREDICTED: catalase isozyme 1                      251   1e-76    Cucumis melo [Oriental melon]
gb|AAD30291.2|AF139538_1  catalase 2                                    251   1e-76    Raphanus sativus
ref|NP_195235.1|  catalase 2                                            251   1e-76    Arabidopsis thaliana [mouse-ear cress]
sp|P17598.2|CATA1_GOSHI  RecName: Full=Catalase isozyme 1               251   1e-76    Gossypium hirsutum [American cotton]
gb|AAD17935.1|  catalase                                                251   1e-76    Brassica juncea [brown mustard]
gb|AAK96854.1|  catalase                                                251   1e-76    Arabidopsis thaliana [mouse-ear cress]
gb|AIA61608.1|  catalase                                                251   1e-76    Gynostemma pentaphyllum [jiaogulan]
ref|XP_010934843.1|  PREDICTED: catalase isozyme 2                      251   1e-76    
ref|XP_006342134.1|  PREDICTED: catalase isozyme 3-like                 251   1e-76    Solanum tuberosum [potatoes]
emb|CDY40645.1|  BnaA03g53180D                                          251   1e-76    Brassica napus [oilseed rape]
ref|XP_009138342.1|  PREDICTED: catalase-2                              251   1e-76    Brassica rapa
gb|AAG43363.1|AF151368_1  catalase                                      251   2e-76    Hevea brasiliensis [jebe]
ref|XP_008791900.1|  PREDICTED: catalase isozyme 2                      251   2e-76    Phoenix dactylifera
gb|AAD50974.1|AF170272_1  catalase CAT1                                 251   2e-76    Manihot esculenta [manioc]
gb|KFK30147.1|  catalase                                                251   2e-76    Arabis alpina [alpine rockcress]
sp|P32290.1|CATA_VIGRR  RecName: Full=Catalase                          251   2e-76    Vigna radiata var. radiata [golden gram]
gb|AAD17936.1|  catalase                                                251   2e-76    Brassica juncea [brown mustard]
ref|XP_004500876.1|  PREDICTED: catalase-4-like isoform X1              251   2e-76    
gb|AAC49807.1|  catalase 3                                              251   2e-76    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010523643.1|  PREDICTED: catalase-2-like                         250   3e-76    Tarenaya hassleriana [spider flower]
ref|XP_004500877.1|  PREDICTED: catalase-4-like isoform X2              250   3e-76    Cicer arietinum [garbanzo]
gb|ACA50528.1|  putative catalase 2                                     250   3e-76    Brassica napus [oilseed rape]
emb|CDY17510.1|  BnaC03g65530D                                          250   3e-76    Brassica napus [oilseed rape]
emb|CDX72514.1|  BnaC07g45360D                                          250   3e-76    
sp|P48350.1|CATA1_CUCPE  RecName: Full=Catalase isozyme 1               250   3e-76    Cucurbita pepo
ref|XP_011074090.1|  PREDICTED: catalase isoform X1                     251   4e-76    Sesamum indicum [beniseed]
gb|AAC48918.1|  salicylic acid binding catalase                         250   4e-76    Nicotiana tabacum [American tobacco]
sp|P45739.1|CATA_HELAN  RecName: Full=Catalase                          250   4e-76    Helianthus annuus
prf||2104177A  catalase                                                 250   4e-76 
ref|XP_009794245.1|  PREDICTED: catalase isozyme 1                      250   4e-76    Nicotiana sylvestris
ref|XP_006382992.1|  hypothetical protein POPTR_0005s10340g             250   4e-76    
ref|NP_001235974.1|  catalase-3                                         250   4e-76    Glycine max [soybeans]
gb|ACJ73906.1|  CAT2                                                    244   5e-76    Solanum nigrum
ref|XP_002306427.1|  hypothetical protein POPTR_0005s10340g             250   5e-76    Populus trichocarpa [western balsam poplar]
gb|EYU30275.1|  hypothetical protein MIMGU_mgv1a005250mg                250   5e-76    Erythranthe guttata [common monkey flower]
ref|XP_008464839.1|  PREDICTED: catalase isozyme 3                      250   5e-76    Cucumis melo [Oriental melon]
ref|XP_009597278.1|  PREDICTED: catalase isozyme 1                      249   6e-76    Nicotiana tomentosiformis
emb|CDP01803.1|  unnamed protein product                                249   6e-76    Coffea canephora [robusta coffee]
ref|XP_010094556.1|  Catalase isozyme 1                                 249   6e-76    Morus notabilis
ref|XP_009106100.1|  PREDICTED: catalase-2                              249   6e-76    Brassica rapa
sp|P48352.1|CATA3_CUCPE  RecName: Full=Catalase isozyme 3               249   6e-76    Cucurbita pepo
ref|XP_010536468.1|  PREDICTED: catalase-3-like                         249   6e-76    Tarenaya hassleriana [spider flower]
sp|Q01297.2|CATA1_RICCO  RecName: Full=Catalase isozyme 1               249   7e-76    Ricinus communis
gb|AAD37788.1|AF149283_1  catalase 1                                    248   7e-76    Phaseolus vulgaris [French bean]
dbj|BAJ87148.1|  predicted protein                                      243   8e-76    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010432341.1|  PREDICTED: catalase-2-like                         249   8e-76    Camelina sativa [gold-of-pleasure]
gb|KGN55499.1|  hypothetical protein Csa_4G658590                       249   9e-76    Cucumis sativus [cucumbers]
ref|XP_010437527.1|  PREDICTED: catalase-2                              249   9e-76    Camelina sativa [gold-of-pleasure]
gb|AAR14052.2|  catalase                                                249   9e-76    Solanum tuberosum [potatoes]
gb|AFW69584.1|  catalase1                                               245   1e-75    
ref|XP_004144240.1|  PREDICTED: catalase isozyme 3-like                 249   1e-75    
ref|XP_011022275.1|  PREDICTED: catalase-like                           249   1e-75    Populus euphratica
gb|ADM96039.1|  catalase                                                249   1e-75    Cucumis sativus [cucumbers]
ref|NP_001234186.1|  catalase isozyme 2                                 249   1e-75    
gb|AHF27429.1|  catalase                                                248   1e-75    Cucurbita moschata [ayote]
ref|NP_001048861.1|  Os03g0131200                                       249   1e-75    
gb|AHF27432.1|  catalase                                                248   1e-75    Cucurbita maxima [Boston marrow]
dbj|BAA34205.1|  catalase                                               249   1e-75    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004158284.1|  PREDICTED: catalase isozyme 3-like                 249   1e-75    
ref|NP_001234827.1|  catalase isozyme 1                                 249   1e-75    Solanum lycopersicum
ref|XP_011022153.1|  PREDICTED: catalase-2-like isoform X2              249   1e-75    Populus euphratica
sp|P30567.1|CATA2_GOSHI  RecName: Full=Catalase isozyme 2               248   2e-75    Gossypium hirsutum [American cotton]
gb|KHG12976.1|  Catalase isozyme 2                                      248   2e-75    Gossypium arboreum [tree cotton]
emb|CDY52649.1|  BnaAnng11640D                                          247   2e-75    Brassica napus [oilseed rape]
ref|XP_006656514.1|  PREDICTED: catalase isozyme B-like                 248   2e-75    Oryza brachyantha
gb|ABQ44283.1|  catalase                                                243   3e-75    Saccharum hybrid cultivar NCo 376
ref|XP_011022152.1|  PREDICTED: catalase-2-like isoform X1              248   3e-75    Populus euphratica
gb|AAC19397.1|  leaf catalase                                           248   3e-75    Mesembryanthemum crystallinum
sp|P48351.1|CATA2_CUCPE  RecName: Full=Catalase isozyme 2               248   3e-75    Cucurbita pepo
pir||S40265  catalase (EC 1.11.1.6) - eggplant                          248   3e-75 
gb|AAY59707.1|  catalase                                                248   3e-75    Oryza sativa Indica Group [Indian rice]
ref|XP_006340832.1|  PREDICTED: catalase isozyme 2                      248   3e-75    Solanum tuberosum [potatoes]
sp|A2YH64.2|CATA2_ORYSI  RecName: Full=Catalase isozyme B; Short=...    248   4e-75    Oryza sativa Indica Group [Indian rice]
dbj|BAH20283.1|  AT1G20620                                              236   4e-75    Arabidopsis thaliana [mouse-ear cress]
gb|ADZ45555.1|  catalase                                                248   4e-75    Vigna radiata [mung bean]
ref|XP_010446982.1|  PREDICTED: catalase-2-like                         247   5e-75    Camelina sativa [gold-of-pleasure]
ref|XP_008452957.1|  PREDICTED: catalase isozyme 1-like                 247   6e-75    Cucumis melo [Oriental melon]
ref|XP_007046520.1|  Catalase 2                                         247   7e-75    Theobroma cacao [chocolate]
gb|AAO17721.1|  catalase                                                247   8e-75    Hypericum perforatum
gb|AAM97541.1|  catalase 2                                              246   9e-75    Capsicum annuum
ref|XP_009108683.1|  PREDICTED: catalase-2-like isoform X2              246   1e-74    
gb|ADZ45556.1|  catalase                                                246   1e-74    Vigna radiata [mung bean]
ref|XP_006649332.1|  PREDICTED: catalase-1-like                         246   1e-74    Oryza brachyantha
dbj|BAA05494.1|  catalase                                               246   1e-74    Oryza sativa Japonica Group [Japonica rice]
dbj|BAA34204.1|  catalase                                               246   1e-74    Oryza sativa Japonica Group [Japonica rice]
gb|AHF21552.1|  catalase                                                246   1e-74    Hylocereus undatus [dragon fruit]
ref|NP_001058635.1|  Os06g0727200                                       246   1e-74    
gb|AFR53082.1|  CAT                                                     246   1e-74    Anthurium andraeanum [flamingo-lily]
gb|KDP43757.1|  hypothetical protein JCGZ_22384                         246   1e-74    Jatropha curcas
gb|ABC01913.1|  catalase isozyme 1-like protein                         246   1e-74    Solanum tuberosum [potatoes]
gb|AAC17729.1|  catalase 1                                              243   2e-74    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACB11496.1|  catalase                                                246   2e-74    Pinus sylvestris [Scotch pine]
gb|AAD17933.1|  catalase                                                246   2e-74    Brassica juncea [brown mustard]
ref|NP_001241808.1|  catalase isozyme B                                 245   2e-74    Zea mays [maize]
gb|AAF79625.1|AC027665_26  F5M15.5                                      254   2e-74    Arabidopsis thaliana [mouse-ear cress]
gb|AFN81243.1|  catalase 1                                              245   2e-74    Brassica rapa subsp. pekinensis [bai cai]
ref|XP_010534184.1|  PREDICTED: catalase isozyme 3-like                 245   2e-74    Tarenaya hassleriana [spider flower]
emb|CAA42720.1|  catalase-1                                             245   3e-74    Zea mays [maize]
gb|AIU99479.1|  catalase                                                245   3e-74    Saccharum arundinaceum
gb|ACJ22771.1|  catalase 1                                              245   3e-74    Jatropha curcas
sp|P49318.1|CATA2_RICCO  RecName: Full=Catalase isozyme 2               245   3e-74    Ricinus communis
ref|NP_001274863.1|  catalase isozyme 1                                 244   5e-74    Solanum tuberosum [potatoes]
sp|P49284.1|CATA1_SOLTU  RecName: Full=Catalase isozyme 1               244   5e-74    Solanum tuberosum [potatoes]
gb|KJB17473.1|  hypothetical protein B456_003G002800                    244   6e-74    Gossypium raimondii
gb|AIU99488.1|  catalase                                                244   6e-74    Saccharum hybrid cultivar ROC22
gb|AIU99481.1|  catalase                                                244   7e-74    Saccharum spontaneum [fodder cane]
sp|P55312.1|CATA2_SOLTU  RecName: Full=Catalase isozyme 2               244   7e-74    Solanum tuberosum [potatoes]
emb|CAG23920.1|  catalase                                               244   7e-74    Festuca arundinacea [tall fescue]
gb|AIM43584.1|  catalase                                                244   8e-74    Saccharum hybrid cultivar Yacheng05-179
emb|CDX69111.1|  BnaC01g03420D                                          244   8e-74    
emb|CAA85470.1|  catalase                                               244   8e-74    Solanum tuberosum [potatoes]
gb|AIU99485.1|  catalase                                                244   8e-74    Saccharum spontaneum [fodder cane]
gb|AAR97905.1|  catalase                                                244   8e-74    Solanum tuberosum [potatoes]
gb|AIU99484.1|  catalase                                                244   8e-74    Saccharum arundinaceum
ref|XP_002437631.1|  hypothetical protein SORBIDRAFT_10g030840          244   8e-74    
sp|Q43206.1|CATA1_WHEAT  RecName: Full=Catalase-1                       244   1e-73    Triticum aestivum [Canadian hard winter wheat]
ref|XP_003558892.1|  PREDICTED: catalase-1                              244   1e-73    Brachypodium distachyon [annual false brome]
ref|XP_003563243.1|  PREDICTED: catalase isozyme 1                      243   1e-73    Brachypodium distachyon [annual false brome]
sp|P55307.1|CATA1_HORVU  RecName: Full=Catalase isozyme 1               243   1e-73    Hordeum vulgare [barley]
ref|NP_001105415.1|  catalase isozyme 1                                 243   1e-73    
ref|XP_002890395.1|  F5M15.5                                            251   2e-73    
gb|KEH36312.1|  catalase heme-binding enzyme                            243   2e-73    Medicago truncatula
emb|CDP01802.1|  unnamed protein product                                243   2e-73    Coffea canephora [robusta coffee]
gb|ABK24453.1|  unknown                                                 243   2e-73    Picea sitchensis
gb|KGN55500.1|  hypothetical protein Csa_4G658600                       241   2e-73    Cucumis sativus [cucumbers]
gb|EMT05040.1|  Catalase-1                                              244   2e-73    
gb|AIU99480.1|  catalase                                                243   3e-73    Saccharum spontaneum [fodder cane]
gb|AAC17731.1|  catalase 1                                              243   3e-73    Arabidopsis thaliana [mouse-ear cress]
ref|NP_564121.1|  catalase 1                                            243   3e-73    Arabidopsis thaliana [mouse-ear cress]
gb|EPS69543.1|  catalase                                                242   4e-73    Genlisea aurea
gb|AFR42410.1|  catalase                                                231   4e-73    Eperua falcata
ref|XP_004985840.1|  PREDICTED: catalase-1-like                         242   5e-73    Setaria italica
gb|AHA50082.1|  catalase                                                242   5e-73    Eleutherococcus senticosus
gb|ACN36234.1|  unknown                                                 237   6e-73    Zea mays [maize]
gb|EYU36566.1|  hypothetical protein MIMGU_mgv1a005245mg                242   6e-73    Erythranthe guttata [common monkey flower]
ref|XP_010692544.1|  PREDICTED: catalase-like                           242   6e-73    Beta vulgaris subsp. vulgaris [field beet]
gb|ADU56198.1|  catalase                                                241   7e-73    Musa acuminata AAA Group [Cavendish banana]
dbj|BAJ90861.1|  predicted protein                                      241   9e-73    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AIU99486.1|  catalase                                                241   9e-73    Saccharum spontaneum [fodder cane]
gb|AIU99482.1|  catalase                                                241   1e-72    Saccharum hybrid cultivar ROC22
gb|AAZ29552.1|  catalase-C                                              241   1e-72    Oryza sativa Indica Group [Indian rice]
ref|XP_010063132.1|  PREDICTED: LOW QUALITY PROTEIN: catalase iso...    241   1e-72    
ref|XP_010692546.1|  PREDICTED: catalase                                241   1e-72    Beta vulgaris subsp. vulgaris [field beet]
gb|AAG61140.2|AF332973_1  catalase 2                                    241   1e-72    
dbj|BAJ88747.1|  predicted protein                                      242   2e-72    
gb|KFK44176.1|  hypothetical protein AALP_AA1G224400                    241   2e-72    
gb|AIZ77475.1|  catalase                                                241   2e-72    
ref|XP_004966515.1|  PREDICTED: catalase isozyme 1-like                 242   2e-72    
gb|ACL35349.1|  catalase                                                241   2e-72    
gb|AIP93616.1|  CAT1                                                    241   2e-72    
ref|XP_006412154.1|  hypothetical protein EUTSA_v10024932mg             241   2e-72    
gb|AIU99487.1|  catalase                                                241   2e-72    
gb|AAL00886.1|  catalase                                                234   2e-72    
gb|AAK67359.2|AF390210_1  catalase                                      240   2e-72    
ref|XP_002510677.1|  catalase, putative                                 248   2e-72    
gb|AAF61732.1|AF243517_1  catalase 2                                    240   2e-72    
ref|XP_002521709.1|  catalase, putative                                 240   3e-72    
emb|CDY31877.1|  BnaC07g15270D                                          239   4e-72    
emb|CDY01363.1|  BnaA07g11360D                                          239   4e-72    
ref|XP_009103333.1|  PREDICTED: catalase-1                              239   4e-72    
sp|P18122.1|CATA1_MAIZE  RecName: Full=Catalase isozyme 1               239   6e-72    
gb|ADU56199.1|  catalase                                                239   7e-72    
emb|CAE82295.1|  catalase                                               239   8e-72    
gb|AAF61733.1|AF243518_1  catalase 3                                    239   9e-72    
gb|AIU99483.1|  catalase                                                239   9e-72    
sp|P55313.1|CATA2_WHEAT  RecName: Full=Catalase                         238   1e-71    
gb|AFR42412.1|  catalase                                                227   1e-71    
ref|XP_009392261.1|  PREDICTED: catalase isozyme A-like isoform X2      238   1e-71    
ref|XP_004300681.1|  PREDICTED: catalase isozyme 1                      237   3e-71    
gb|AHB72694.1|  catalase                                                237   3e-71    
gb|AAB07026.1|  catalase 1                                              237   3e-71    
gb|AAF61734.1|AF243519_1  catalase 4                                    237   4e-71    
ref|XP_006416378.1|  hypothetical protein EUTSA_v10007472mg             237   4e-71    
tpg|DAA43177.1|  TPA: catalase2                                         237   5e-71    
gb|AAC19398.1|  root catalase                                           236   6e-71    
prf||1803522A  catalase                                                 236   7e-71 
sp|P12365.3|CATA2_MAIZE  RecName: Full=Catalase isozyme 2               236   7e-71    
ref|NP_001105310.1|  catalase isozyme 2                                 236   7e-71    
gb|ABV55108.1|  catalase 2                                              236   8e-71    
gb|ADN94253.1|  catalase                                                236   9e-71    
ref|XP_009398521.1|  PREDICTED: catalase isozyme A                      236   1e-70    
gb|ADK25939.1|  catalase                                                228   1e-70    
ref|XP_002963086.1|  hypothetical protein SELMODRAFT_438313             234   3e-70    
gb|ABB72796.1|  catalase isozyme 1-like protein                         235   3e-70    
ref|XP_004145541.1|  PREDICTED: catalase isozyme 1-like                 243   3e-70    
ref|NP_001031073.1|  catalase 3                                         234   4e-70    
tpg|DAA43178.1|  TPA: catalase2                                         235   4e-70    
gb|ABY21704.1|  catalase-1 precursor                                    234   5e-70    
gb|KHG21219.1|  Catalase isozyme 1                                      232   7e-70    
ref|XP_002980247.1|  hypothetical protein SELMODRAFT_178171             233   1e-69    
dbj|BAH37035.1|  catalase 1                                             233   2e-69    
gb|ACH63223.1|  catalase                                                233   2e-69    
ref|XP_002961779.1|  hypothetical protein SELMODRAFT_140901             233   2e-69    
ref|XP_010061173.1|  PREDICTED: catalase isozyme 2-like isoform X1      233   2e-69    
gb|AFD29285.1|  catalase                                                233   2e-69    
gb|KDO85095.1|  hypothetical protein CISIN_1g044386mg                   231   7e-68    
gb|AJF34884.1|  catalase                                                228   8e-68    
sp|P25890.1|CATA_PEA  RecName: Full=Catalase                            228   1e-67    
emb|CDY31490.1|  BnaC05g15990D                                          228   1e-67    
emb|CDY29518.1|  BnaA06g14520D                                          228   1e-67    
ref|XP_009149540.1|  PREDICTED: catalase-1                              228   1e-67    
ref|XP_010498497.1|  PREDICTED: catalase-1-like                         226   8e-67    
dbj|BAD07937.1|  catalase catA-like protein                             214   2e-66    
ref|XP_010459749.1|  PREDICTED: catalase-1-like                         224   3e-66    
gb|ACL81498.1|  catalase                                                224   3e-66    
ref|XP_001779509.1|  predicted protein                                  224   5e-66    
ref|XP_010477308.1|  PREDICTED: catalase-1                              223   9e-66    
dbj|BAH56915.1|  AT1G20620                                              222   2e-65    
gb|AAC17730.1|  catalase 2                                              219   2e-65    
dbj|BAJ92414.1|  predicted protein                                      222   3e-65    
ref|XP_009108684.1|  PREDICTED: catalase-2-like isoform X3              221   4e-65    
gb|ADY02963.1|  catalase                                                221   7e-65    
emb|CAH61266.1|  catalase                                               221   8e-65    
gb|EMS51034.1|  Catalase isozyme 2                                      221   8e-65    
ref|NP_001045673.1|  Os02g0115700                                       220   1e-64    
gb|EAZ21490.1|  hypothetical protein OsJ_05114                          220   1e-64    
ref|XP_008778560.1|  PREDICTED: catalase isozyme 2-like                 220   1e-64    
sp|P55308.1|CATA2_HORVU  RecName: Full=Catalase isozyme 2               220   1e-64    
gb|ABN71233.2|  catalase                                                220   1e-64    
ref|XP_010105996.1|  Catalase isozyme 1                                 216   2e-64    
ref|NP_001031791.1|  catalase 2                                         219   2e-64    
dbj|BAH19523.1|  AT4G35090                                              219   2e-64    
ref|XP_006382986.1|  hypothetical protein POPTR_0005s10340g             220   2e-64    
ref|XP_001752315.1|  predicted protein                                  217   2e-63    
ref|XP_004952158.1|  PREDICTED: catalase isozyme 3-like isoform X2      217   2e-63    
gb|ADQ28492.1|  catalase                                                216   3e-63    
ref|XP_003573241.1|  PREDICTED: catalase isozyme 2                      216   4e-63    
gb|AAX88799.1|  catalase                                                216   5e-63    
gb|EMT06167.1|  Catalase isozyme 2                                      219   6e-63    
ref|XP_008812256.1|  PREDICTED: catalase isozyme B                      215   8e-63    
gb|EMS61345.1|  Catalase isozyme 1                                      217   1e-62    
ref|XP_001784759.1|  predicted protein                                  214   2e-62    
ref|XP_002453177.1|  hypothetical protein SORBIDRAFT_04g001130          213   5e-62    
gb|ABK24449.1|  unknown                                                 213   5e-62    
gb|AGI65617.1|  catalase                                                211   2e-61    
gb|AGT16203.1|  catalase                                                211   3e-61    
emb|CAA10286.1|  catalase                                               199   4e-61    
dbj|BAA34714.1|  catalase                                               211   5e-61    
ref|XP_005645077.1|  catalase                                           211   5e-61    
pir||CSRZ  catalase (EC 1.11.1.6) catA - rice                           211   6e-61 
emb|CAA43814.1|  catalase                                               210   7e-61    
ref|XP_006646781.1|  PREDICTED: LOW QUALITY PROTEIN: catalase iso...    210   9e-61    
sp|P55310.1|CATA_SECCE  RecName: Full=Catalase                          209   1e-60    
gb|AII23739.1|  catalase                                                206   1e-59    
gb|ABR16304.1|  unknown                                                 206   2e-59    
gb|ABK24543.1|  unknown                                                 206   3e-59    
gb|AFI48111.1|  catalase isozyme B                                      194   5e-59    
gb|ABY68162.1|  catalase                                                193   1e-58    
gb|ABY68159.1|  catalase                                                193   1e-58    
gb|ABY68158.1|  catalase                                                193   1e-58    
gb|ABY68164.1|  catalase                                                193   2e-58    
gb|AFI48054.1|  catalase isozyme B                                      192   4e-58    
gb|ABY68160.1|  catalase                                                191   5e-58    
gb|ABY68161.1|  catalase                                                191   9e-58    
gb|ABK41476.1|  catalase                                                202   1e-57    
gb|AGT16054.1|  catalase                                                201   1e-57    
gb|AGT16188.1|  catalase                                                201   1e-57    
gb|AGT15888.1|  catalase                                                201   1e-57    
gb|AFI48068.1|  catalase isozyme B                                      190   2e-57    
gb|AGT16310.1|  catalase                                                201   2e-57    
sp|P18123.2|CATA3_MAIZE  RecName: Full=Catalase isozyme 3               201   2e-57    
gb|AFW66787.1|  catalase3                                               201   2e-57    
gb|AFI48101.1|  catalase isozyme B                                      190   2e-57    
ref|XP_005847557.1|  hypothetical protein CHLNCDRAFT_57817              201   2e-57    
gb|AHZ13843.1|  catalase                                                200   5e-57    
gb|AID50071.1|  catalase                                                189   1e-56    
gb|KIY96954.1|  catalase                                                195   1e-56    
gb|AFI48131.1|  catalase isozyme B                                      187   2e-56    
gb|AFI48098.1|  catalase isozyme B                                      187   3e-56    
gb|AFW66785.1|  catalase3 isoform 1                                     201   6e-56    
gb|AFI48130.1|  catalase isozyme B                                      185   2e-55    
gb|KCW70315.1|  hypothetical protein EUGRSUZ_F03557                     195   2e-55    
gb|EMS35721.1|  Catalase isozyme 1                                      187   4e-54    
gb|AEY70510.1|  catalase                                                187   4e-54    
ref|XP_004952157.1|  PREDICTED: catalase isozyme 3-like isoform X1      192   8e-54    
emb|CBI29556.3|  unnamed protein product                                179   2e-53    
ref|XP_002950455.1|  catalase                                           189   5e-53    
ref|NP_001105416.1|  catalase isozyme 3                                 189   1e-52    
gb|AAA33441.1|  catalase isozyme 3 (EC 1.11.1.6)                        188   1e-52    
ref|XP_001696763.1|  catalase/peroxidase                                186   7e-52    
ref|XP_011396830.1|  Catalase isozyme 2                                 186   9e-52    
ref|XP_005708279.1|  catalase                                           185   2e-51    
gb|AFW66789.1|  catalase3                                               181   2e-51    
emb|CAA73663.1|  catalase                                               184   7e-51    
gb|AAB70006.1|  catalase                                                183   1e-50    
gb|AFK46618.1|  unknown                                                 171   3e-50    
gb|AFW66788.1|  catalase3                                               180   2e-49    
dbj|BAD94702.1|  catalase                                               169   3e-49    
gb|ABY68163.1|  catalase                                                167   2e-48    
ref|XP_006382990.1|  hypothetical protein POPTR_0005s10340g             175   7e-48    
pir||A55092  catalase (EC 1.11.1.6) CAT-2 - maize (fragment)            175   1e-47 
gb|AAR84577.1|  catalase 1b                                             172   7e-47    
ref|XP_009108682.1|  PREDICTED: catalase-2-like isoform X1              172   1e-46    
ref|XP_009392260.1|  PREDICTED: catalase isozyme A-like isoform X1      170   9e-46    
gb|KJB10391.1|  hypothetical protein B456_001G198700                    167   5e-45    
gb|ABB88582.1|  catalase                                                165   8e-44    
gb|KJB17474.1|  hypothetical protein B456_003G002800                    163   2e-43    
gb|KDD77132.1|  catalase                                                161   2e-42    
gb|AAO16182.1|  catalase-1                                              148   4e-41    
gb|AAP57673.1|  catalase                                                149   5e-40    
ref|XP_005536240.1|  catalase                                           150   2e-38    
gb|ABS72010.1|  putative catalase                                       139   8e-38    
ref|XP_002963084.1|  hypothetical protein SELMODRAFT_404656             140   1e-37    
gb|AGS17821.1|  catalase 2                                              144   4e-37    
ref|XP_008365914.1|  PREDICTED: catalase isozyme 3-like                 137   5e-37    
gb|ABB51561.1|  truncated catalase 2                                    144   1e-36    
gb|AFH53187.1|  catalase                                                140   2e-36    
gb|AFH53190.1|  catalase                                                140   2e-36    
gb|AFH53189.1|  catalase                                                140   2e-36    
ref|XP_008348923.1|  PREDICTED: catalase isozyme 3-like                 135   3e-36    
emb|CAA42026.1|  catalase                                               132   2e-35    
ref|XP_005712277.1|  unnamed protein product                            140   9e-35    
ref|XP_010242895.1|  PREDICTED: catalase isozyme 1-like isoform X2      137   5e-34    
ref|XP_006435362.1|  hypothetical protein CICLE_v10000948mg             136   7e-34    
ref|XP_008348922.1|  PREDICTED: catalase isozyme 1-like                 136   1e-33    
ref|XP_008382478.1|  PREDICTED: catalase isozyme 1-like                 136   1e-33    
emb|CDP22058.1|  unnamed protein product                                129   2e-33    
ref|XP_006382987.1|  hypothetical protein POPTR_0005s10340g             133   1e-32    
gb|KJE89728.1|  catalase isozyme 2                                      132   5e-32    
ref|XP_004366029.2|  catalase isozyme 2                                 132   5e-32    
gb|ACU23083.1|  unknown                                                 127   8e-32    
ref|XP_002980252.1|  hypothetical protein SELMODRAFT_112333             121   1e-30    
ref|NP_973873.1|  catalase 3                                            127   1e-30    
emb|CDY43951.1|  BnaC04g21590D                                          123   2e-30    
emb|CDY31866.1|  BnaC07g15160D                                          122   3e-30    
gb|KCW70319.1|  hypothetical protein EUGRSUZ_F03561                     124   1e-29    
gb|KEH36313.1|  catalase heme-binding enzyme                            123   4e-29    
gb|AEA86295.1|  putative catalase                                       116   3e-28    
gb|ABS89000.1|  catalase                                                114   1e-27    
gb|AFA36510.1|  catalase                                                115   3e-27    
ref|XP_005644653.1|  catalase-domain-containing protein                 119   4e-27    
gb|AAR25790.1|  catalase                                                109   2e-26    
ref|XP_005647994.1|  catalase-domain-containing protein                 115   3e-26    
ref|WP_043830984.1|  catalase                                           113   2e-25    
ref|XP_005642928.1|  catalase                                           111   1e-24    
ref|WP_037277190.1|  catalase                                           110   2e-24    
gb|ADR01107.1|  catalase 3                                              108   3e-24    
ref|WP_026826608.1|  catalase                                           109   4e-24    
ref|WP_015881004.1|  catalase                                           108   9e-24    
gb|AHB35639.1|  catalase                                                104   1e-23    
gb|AFN85536.1|  catalase                                                100   1e-23    
gb|ACJ71245.1|  catalase 2                                              107   1e-23    
ref|WP_044037961.1|  catalase                                           108   1e-23    
ref|WP_029723487.1|  catalase                                           108   1e-23    
ref|WP_016429054.1|  hypothetical protein                               108   2e-23    
ref|WP_034418237.1|  catalase                                           107   5e-23    
ref|WP_026673818.1|  catalase                                           107   6e-23    
gb|ABR25882.1|  catalase isozyme b                                    98.6    1e-22    
ref|WP_031421259.1|  catalase                                           105   1e-22    
gb|ACJ71244.1|  catalase 2                                              104   1e-22    
ref|WP_032664185.1|  catalase                                           105   2e-22    
gb|ACY30463.1|  catalase                                                103   3e-22    
ref|WP_032632526.1|  catalase                                           104   3e-22    
ref|WP_026688518.1|  catalase                                           104   3e-22    
ref|WP_033543820.1|  catalase                                           104   3e-22    
gb|AAY34915.1|  catalase                                              97.1    3e-22    
ref|WP_043304355.1|  catalase                                           104   4e-22    
gb|KIQ35234.1|  catalase                                                104   4e-22    
ref|WP_004887231.1|  catalase                                           103   5e-22    
ref|WP_024631056.1|  MULTISPECIES: catalase                             104   6e-22    
ref|WP_032610664.1|  catalase                                           103   8e-22    
ref|WP_003355010.1|  catalase                                           102   1e-21    
ref|WP_037022052.1|  catalase                                           102   1e-21    
ref|WP_006679508.1|  catalase                                           102   2e-21    



>gb|AFY26882.1| catalase, partial [Ipomoea batatas]
Length=173

 Score =   325 bits (832),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 153/157 (97%), Positives = 156/157 (99%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDKMLQAR FAYADTHRHRLGPNYMLLPVNAPKCA+HNNSYDGYMNFVHRDEEVDYFPS
Sbjct  17   SDDKMLQARVFAYADTHRHRLGPNYMLLPVNAPKCAHHNNSYDGYMNFVHRDEEVDYFPS  76

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            KFDNTRNAERFPTPLRIVTG+RDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVK+LS
Sbjct  77   KFDNTRNAERFPTPLRIVTGQRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKALS  136

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM
Sbjct  137  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  173



>gb|ADB03784.1| catalase [Ipomoea batatas]
Length=492

 Score =   324 bits (831),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 153/157 (97%), Positives = 156/157 (99%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDKMLQAR FAYADTHRHRLGPNYMLLPVNAPKCA+HNNSYDGYMNFVHRDEEVDYFPS
Sbjct  336  SDDKMLQARVFAYADTHRHRLGPNYMLLPVNAPKCAHHNNSYDGYMNFVHRDEEVDYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            KFDNTRNAERFPTPLRIVTG+RDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVK+LS
Sbjct  396  KFDNTRNAERFPTPLRIVTGQRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM
Sbjct  456  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  492



>sp|P07145.1|CATA_IPOBA RecName: Full=Catalase [Ipomoea batatas]
 emb|CAA29063.1| unnamed protein product [Ipomoea batatas]
Length=492

 Score =   324 bits (830),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 153/157 (97%), Positives = 156/157 (99%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDKMLQAR FAYADTHRHRLGPNYMLLPVNAPKCA+HNNSYDGYMNFVHRDEEVDYFPS
Sbjct  336  SDDKMLQARVFAYADTHRHRLGPNYMLLPVNAPKCAHHNNSYDGYMNFVHRDEEVDYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            KFDNTRNAERFPTPLRIVTG+RDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVK+LS
Sbjct  396  KFDNTRNAERFPTPLRIVTGQRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM
Sbjct  456  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  492



>ref|XP_009624788.1| PREDICTED: catalase isozyme 3 [Nicotiana tomentosiformis]
Length=492

 Score =   269 bits (687),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 144/157 (92%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+Y+DT RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            +FD  R+AE++P PLR++TG+RDKC++EKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS
Sbjct  396  RFDPCRHAEQYPIPLRVLTGKRDKCIVEKENNFKQPGERYRSWAPDRQERFICRWVDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHEIRS WISY +QAD+SLGQK+ASRLNIRPTM
Sbjct  456  DPRVTHEIRSIWISYWSQADKSLGQKIASRLNIRPTM  492



>ref|XP_010907090.1| PREDICTED: catalase isozyme 1-like [Elaeis guineensis]
Length=492

 Score =   265 bits (678),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 143/157 (91%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY++LP NAPKCA+HNN +DG+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRIFSYADTQRHRLGPNYLMLPANAPKCAHHNNHHDGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AERFP P RI+TGRR+KCVI KENNFKQPG+RYRSWAPDRQ+RFI RWV++LS
Sbjct  396  RYDPVRHAERFPIPFRILTGRREKCVIHKENNFKQPGERYRSWAPDRQERFICRWVEALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVT+EIR+ WISY +Q DRSLGQK+A+RLN++P+M
Sbjct  456  DPRVTYEIRTIWISYWSQCDRSLGQKIATRLNVKPSM  492



>ref|XP_010061172.1| PREDICTED: catalase isozyme 3-like [Eucalyptus grandis]
 gb|KCW68094.1| hypothetical protein EUGRSUZ_F01776 [Eucalyptus grandis]
Length=492

 Score =   265 bits (676),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 144/157 (92%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            S+DK+LQAR FAY+DTHR+RLGPNY+ LPVNAPKCA+HNN +DG+MN +HRDEE++YFPS
Sbjct  336  SNDKLLQARIFAYSDTHRYRLGPNYLQLPVNAPKCAHHNNHHDGFMNIMHRDEEINYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            KFD  R+AER+P P +IVTG+R+K +IEKENNFKQPG+RYRSWAPDRQ+RFINRW+K+L+
Sbjct  396  KFDPVRHAERYPIPSQIVTGKREKVIIEKENNFKQPGERYRSWAPDRQERFINRWIKALT  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            EPRVTHE RS WISY TQAD+SLGQK+ASRL+ RP+M
Sbjct  456  EPRVTHEHRSIWISYWTQADKSLGQKLASRLSARPSM  492



>gb|AGC65520.1| catalase [Eriobotrya japonica]
 gb|AGC65522.1| catalase [Eriobotrya japonica]
 gb|AGC65523.1| catalase [Eriobotrya japonica]
 gb|AGC65524.1| catalase [Eriobotrya japonica]
 gb|AGE15297.2| catalase 2 [Eriobotrya japonica]
Length=492

 Score =   264 bits (674),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            S+DKMLQ R FAY+DT RHRLGPNY+ LPVNAPKCA+HNN YDG+MNF+HRDEEVDYFPS
Sbjct  336  SNDKMLQTRLFAYSDTQRHRLGPNYLQLPVNAPKCAHHNNHYDGFMNFMHRDEEVDYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++   R+AE FP P  I+TG+RDKCVIEKENNFKQPG+RYRSWAPDRQ+RF++RWV  LS
Sbjct  396  RYQPARHAETFPIPSNIITGKRDKCVIEKENNFKQPGERYRSWAPDRQERFLHRWVDVLS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            EPRVT+EIRS WISY +QADRS GQK+A+RLN+RP++
Sbjct  456  EPRVTYEIRSIWISYWSQADRSFGQKLATRLNVRPSI  492



>ref|XP_009794469.1| PREDICTED: catalase isozyme 3 [Nicotiana sylvestris]
 emb|CCP37652.1| catalase-3 [Nicotiana tabacum]
Length=492

 Score =   264 bits (674),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+Y+DT RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            +FD  R+AE+ P P R++TG+RDKC+IEKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS
Sbjct  396  RFDPCRHAEQHPIPPRVLTGKRDKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHEIRS WISY +QAD++LGQK+ASRLN+RPTM
Sbjct  456  DPRVTHEIRSIWISYWSQADKTLGQKIASRLNVRPTM  492



>gb|ABR15776.1| catalase [Litchi chinensis]
Length=291

 Score =   257 bits (657),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 134/157 (85%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDKMLQ R FAY DT RHRLGPNY++LPVNAPKC +HNN YDG+MNF+HRDEEVDYFPS
Sbjct  135  SDDKMLQCRIFAYGDTQRHRLGPNYLMLPVNAPKCPHHNNHYDGFMNFMHRDEEVDYFPS  194

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            KF N  NAE+FP P RI +G+R+K  IEKENNFK PGDRYRSWAPDRQ+RFI R V  LS
Sbjct  195  KFTNVANAEKFPIPGRICSGKREKACIEKENNFKLPGDRYRSWAPDRQERFIKRVVDGLS  254

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVT EIRS W+SY +QAD+SLGQK+ASRLN+RP +
Sbjct  255  DPRVTFEIRSIWVSYWSQADKSLGQKIASRLNVRPNI  291



>emb|CAB56850.1| catalase [Prunus persica]
Length=423

 Score =   261 bits (667),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDKMLQ R FAY+DT RHRLGPNY+ LPVNAPKC +HNN ++G+MNF+HRDEEV+YFPS
Sbjct  267  SDDKMLQTRIFAYSDTQRHRLGPNYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPS  326

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            + D  R+AER+P P  I++G+R+KCVIEKENNFKQPG+RYRSWAPDRQ+RFI+RWV +LS
Sbjct  327  RHDPVRHAERYPIPSNILSGKREKCVIEKENNFKQPGERYRSWAPDRQERFIHRWVDALS  386

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  387  DPRVTHEIRSVWISYWSQADKSLGQKLASRLNVRPSI  423



>ref|XP_006473789.1| PREDICTED: catalase-like isoform X1 [Citrus sinensis]
Length=477

 Score =   262 bits (670),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            S+DKMLQ R FAY DT RHRLGPNY++LPVNAPKC + NN YDG+MNF+HRDEEVDYFPS
Sbjct  321  SNDKMLQCRIFAYGDTQRHRLGPNYLMLPVNAPKCPHRNNHYDGFMNFMHRDEEVDYFPS  380

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D TR+AER+P P  ++TGRR+K  IEKENNFKQPG+RYRSWAPDRQ+RF+NRW+K+L 
Sbjct  381  RYDPTRHAERYPIPSDVITGRREKACIEKENNFKQPGERYRSWAPDRQERFLNRWIKALC  440

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHE+RS W+SY +QADRSLGQK+ASRLN+RP++
Sbjct  441  DPRVTHEVRSIWVSYWSQADRSLGQKLASRLNVRPSI  477



>ref|XP_006435361.1| hypothetical protein CICLE_v10000948mg [Citrus clementina]
 ref|XP_006473790.1| PREDICTED: catalase-like isoform X2 [Citrus sinensis]
 gb|ESR48601.1| hypothetical protein CICLE_v10000948mg [Citrus clementina]
Length=493

 Score =   262 bits (670),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            S+DKMLQ R FAY DT RHRLGPNY++LPVNAPKC + NN YDG+MNF+HRDEEVDYFPS
Sbjct  337  SNDKMLQCRIFAYGDTQRHRLGPNYLMLPVNAPKCPHRNNHYDGFMNFMHRDEEVDYFPS  396

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D TR+AER+P P  ++TGRR+K  IEKENNFKQPG+RYRSWAPDRQ+RF+NRW+K+L 
Sbjct  397  RYDPTRHAERYPIPSDVITGRREKACIEKENNFKQPGERYRSWAPDRQERFLNRWIKALC  456

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHE+RS W+SY +QADRSLGQK+ASRLN+RP++
Sbjct  457  DPRVTHEVRSIWVSYWSQADRSLGQKLASRLNVRPSI  493



>ref|NP_001289779.1| catalase isozyme 1 [Nelumbo nucifera]
 gb|ADY11209.1| catalase [Nelumbo nucifera]
Length=492

 Score =   262 bits (669),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 143/157 (91%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+Y+DT RHRLGPNY+LLP NAPKCA+HNN ++G+MNF+HR+EEV+YFPS
Sbjct  336  SDDKLLQTRIFSYSDTQRHRLGPNYLLLPANAPKCAHHNNHHEGFMNFLHREEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AER+P P +I TG+R+KCVIEKENNFKQPG+RYRSWAPDRQ+RFI RW+ +LS
Sbjct  396  RYDPVRHAERYPIPPQICTGKREKCVIEKENNFKQPGERYRSWAPDRQERFIKRWIDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHEIRS WISY +QAD+SLGQK+ASRLN++P+M
Sbjct  456  DPRVTHEIRSIWISYWSQADKSLGQKLASRLNVKPSM  492



>ref|XP_008237987.1| PREDICTED: catalase isozyme 1 [Prunus mume]
Length=492

 Score =   262 bits (669),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 143/157 (91%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+Y+DT RHRLGPNY+ LPVNAPKC++HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  RNAERFP P  I++G+R+KC+IEKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS
Sbjct  396  RYDPVRNAERFPIPPNILSGKREKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  456  DPRVTHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_007209948.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
 gb|EMJ11147.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
Length=492

 Score =   261 bits (668),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 144/157 (92%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+Y+DT RHRLGPNY+ LPVNAPKC++HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AERFP P  I++G+R+KC+IEKENNFKQPG+RYRSWAPDRQ+RFI+RWV +LS
Sbjct  396  RYDPVRHAERFPIPPNILSGKREKCIIEKENNFKQPGERYRSWAPDRQERFIHRWVDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  456  DPRVTHEIRSVWISYWSQADKSLGQKLASRLNVRPSI  492



>emb|CAD42908.1| catalase [Prunus persica]
Length=492

 Score =   261 bits (668),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 144/157 (92%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+Y+DT RHRLGPNY+ LPVNAPKC++HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AERFP P  I++G+R+KC+IEKENNFKQPG+RYRSWAPDRQ+RFI+RWV +LS
Sbjct  396  RYDPVRHAERFPIPPNILSGKREKCIIEKENNFKQPGERYRSWAPDRQERFIHRWVDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  456  DPRVTHEIRSVWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_010061174.1| PREDICTED: catalase isozyme 3-like isoform X2 [Eucalyptus grandis]
 gb|KCW68092.1| hypothetical protein EUGRSUZ_F01775 [Eucalyptus grandis]
Length=492

 Score =   261 bits (667),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 143/157 (91%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            S+DK+LQAR FAY+DTHR+RLGPNY+ LPVNAPKCA+HNN +DG+MNF+HRDEE++YFPS
Sbjct  336  SNDKLLQARIFAYSDTHRYRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEINYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            KFD  R+AER+P P +IVTG+R++ +IEKENNFKQ G+RYRSWAPDRQ+RFINRW+K+LS
Sbjct  396  KFDPVRHAERYPIPSQIVTGKRERVIIEKENNFKQAGERYRSWAPDRQERFINRWIKALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            EPRVTHE RS WISY TQAD+S+GQK+AS L+ RP+M
Sbjct  456  EPRVTHEHRSIWISYWTQADKSIGQKLASSLSARPSM  492



>gb|AAB88173.1| catalase, partial [Glycine max]
Length=308

 Score =   255 bits (651),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDKMLQ R F+YAD+ RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  152  SDDKMLQTRIFSYADSQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPS  211

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE FP P  I +GRR+KC IEKENNFKQPG+RYRSWAPDRQDRF  RWV +LS
Sbjct  212  RYDPVRHAETFPIPPAICSGRREKCGIEKENNFKQPGERYRSWAPDRQDRFNRRWVDALS  271

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHEIRS WISY +QADRSLGQK+ASRL++RP +
Sbjct  272  DPRVTHEIRSVWISYWSQADRSLGQKIASRLSMRPNI  308



>sp|Q9AXH0.1|CATA_AVIMR RecName: Full=Catalase [Avicennia marina]
 gb|AAK06839.1|AF328861_1 catalase [Avicennia marina]
 gb|AAP13538.1| catalase [Avicennia marina]
Length=492

 Score =   261 bits (666),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            S+DKMLQ R FAY DT RHRLGPNY+LLPVNAPKCAYHNN YDG+MNF+HRDEEVDYFPS
Sbjct  336  SNDKMLQTRIFAYGDTQRHRLGPNYLLLPVNAPKCAYHNNHYDGFMNFMHRDEEVDYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            K+D TR+AER P P  ++TGRRD+ VIEKE+NFKQ GDRYRSWAPDRQ+RF+ RWV +LS
Sbjct  396  KYDPTRHAERHPIPNAVITGRRDRRVIEKEDNFKQAGDRYRSWAPDRQERFLRRWVDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PR+T EIRS W+SY +QAD+S GQK+ASRLN+RPTM
Sbjct  456  DPRLTLEIRSIWVSYWSQADKSFGQKLASRLNVRPTM  492



>gb|ABY19573.1| catalase [Manihot esculenta]
Length=261

 Score =   253 bits (647),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            S+DK+ Q R FAYADT RHRLGPNY +LPVNAPKC YHNN YDG+MNF+HRDEEVDYFPS
Sbjct  105  SNDKLFQLRTFAYADTQRHRLGPNYKMLPVNAPKCNYHNNHYDGFMNFMHRDEEVDYFPS  164

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AER P P  I++GRR+KCVIEKENNFKQPGDRYRSW PDRQ+RF+ R V +LS
Sbjct  165  RYDPVRHAERTPLPHAIISGRREKCVIEKENNFKQPGDRYRSWTPDRQERFLCRLVNALS  224

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PR+THEIRS W+SY +Q D+SLGQK+ASRLN+RP  
Sbjct  225  DPRITHEIRSIWVSYWSQCDKSLGQKLASRLNVRPNF  261



>gb|KJB57963.1| hypothetical protein B456_009G187600 [Gossypium raimondii]
Length=492

 Score =   260 bits (665),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 143/157 (91%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+Y+DT RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEE++YFPS
Sbjct  336  SDDKLLQTRVFSYSDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEINYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D +R+AERFP P  + TG+R+KC+IEKENNFKQPG+RYRSWAPDRQ+RFINRWV ++S
Sbjct  396  RYDPSRHAERFPIPPALCTGKREKCIIEKENNFKQPGERYRSWAPDRQERFINRWVDAMS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHEIRS WI+Y +QAD+SLGQK+ASRLN+RP++
Sbjct  456  DPRVTHEIRSIWITYWSQADKSLGQKLASRLNVRPSI  492



>gb|AAX84671.1| catalase CAT2, partial [Manihot esculenta]
Length=270

 Score =   253 bits (647),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            S+DK+ Q R FAYADT RHRLGPNY +LPVNAPKC YHNN YDG+MNF+HRDEEVDYFPS
Sbjct  114  SNDKLFQLRTFAYADTQRHRLGPNYKMLPVNAPKCNYHNNHYDGFMNFMHRDEEVDYFPS  173

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AER P P  I++GRR+KCVIEKENNFKQPGDRYRSW PDRQ+RF+ R V +LS
Sbjct  174  RYDPVRHAERTPLPHAIISGRREKCVIEKENNFKQPGDRYRSWTPDRQERFLCRLVNALS  233

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PR+THEIRS W+SY +Q D+SLGQK+ASRLN+RP  
Sbjct  234  DPRITHEIRSIWVSYWSQCDKSLGQKLASRLNVRPNF  270



>ref|XP_010918244.1| PREDICTED: catalase isozyme 1 [Elaeis guineensis]
Length=492

 Score =   260 bits (665),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY++LP NAPKCA+HNN +DG+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRIFSYADTQRHRLGPNYLMLPANAPKCAHHNNHHDGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AERFP P RI+TGRR+KCVI KENNFKQPG+RYRSW P+RQ+RFI RWV++LS
Sbjct  396  RYDPVRHAERFPIPSRILTGRREKCVIHKENNFKQPGERYRSWDPNRQERFIRRWVEALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHEI+S WISY +Q D+SLGQK+A+RLN++P M
Sbjct  456  DPRVTHEIQSIWISYWSQCDKSLGQKIATRLNVKPCM  492



>ref|XP_008237989.1| PREDICTED: catalase isozyme 1-like [Prunus mume]
Length=492

 Score =   260 bits (665),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDKMLQ R FAY+DT RHRLGPNY+ LPVNAPKC +HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKMLQTRIFAYSDTQRHRLGPNYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AER+P P  I+ G+R+KCVIEKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS
Sbjct  396  RYDPVRHAERYPIPSNILYGKREKCVIEKENNFKQPGERYRSWAPDRQERFIRRWVDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  456  DPRVTHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_009600533.1| PREDICTED: catalase isozyme 3-like [Nicotiana tomentosiformis]
Length=492

 Score =   260 bits (665),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+Y+DT RHRLGPNY+ LPVNAPKCA+HNN ++G MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGVMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            +FD  R+AE++P P RI+TG+RD+C+IEKENNFKQPG+RYRSW+PDRQ+RFI RW+ +LS
Sbjct  396  RFDPCRHAEQYPIPPRILTGKRDRCIIEKENNFKQPGERYRSWSPDRQERFICRWINALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHEI + WISY +QAD+SLG+K+ASRLN+RPTM
Sbjct  456  DPRVTHEIHTIWISYWSQADKSLGEKIASRLNVRPTM  492



>sp|P49317.1|CATA3_NICPL RecName: Full=Catalase isozyme 3 [Nicotiana plumbaginifolia]
 emb|CAA85426.1| catalase [Nicotiana plumbaginifolia]
Length=492

 Score =   260 bits (665),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+Y+D  RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRIFSYSDAQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            +FD  R+AE++P P  ++TG+RDKC+IEKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS
Sbjct  396  RFDPCRHAEQYPIPPCVLTGKRDKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHEIRS W SY +QAD++LGQK+ASRLN+RPTM
Sbjct  456  DPRVTHEIRSIWFSYWSQADKTLGQKIASRLNVRPTM  492



>ref|XP_009413057.1| PREDICTED: catalase isozyme 2-like [Musa acuminata subsp. malaccensis]
Length=492

 Score =   260 bits (665),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+Y+DT RHRLGPNY++LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRIFSYSDTQRHRLGPNYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AERFP P  +VTGRR+K +I KENNFKQPG+RYRSWAPDRQ+RF++RWV +LS
Sbjct  396  RYDPVRHAERFPIPSSVVTGRREKSIINKENNFKQPGERYRSWAPDRQERFVHRWVDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHEIR  WISY +Q D+SLGQK+A+RLN++PTM
Sbjct  456  DPRVTHEIRDIWISYWSQCDKSLGQKIATRLNVKPTM  492



>ref|XP_002306976.2| catalase family protein [Populus trichocarpa]
 gb|EEE93972.2| catalase family protein [Populus trichocarpa]
Length=492

 Score =   260 bits (664),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRIFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            + D +R+AERFP P  + +GRR+KC+IEKENNFKQPG+RYRSWAPDRQ+RF+ RWV +LS
Sbjct  396  RHDPSRHAERFPIPSAVCSGRREKCIIEKENNFKQPGERYRSWAPDRQERFVRRWVDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            EPRVTHE+RS WISY +QAD+SLGQK+AS LN+RP++
Sbjct  456  EPRVTHEVRSIWISYWSQADKSLGQKLASHLNVRPSV  492



>ref|XP_010536470.1| PREDICTED: catalase-2-like [Tarenaya hassleriana]
Length=492

 Score =   260 bits (664),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY+ LPVNAPKC +HNN +DG+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRIFSYADTQRHRLGPNYLQLPVNAPKCVHHNNHHDGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            +FD  R+AERFP+P  I +GRR+KC+IEKENNFKQPG+RYRSWAPDRQ+RF+ RWV++LS
Sbjct  396  RFDPVRHAERFPSPPAICSGRREKCIIEKENNFKQPGERYRSWAPDRQERFLKRWVEALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            + R THEIRS WISY +QAD+SLGQK+ASRLN+RP+ 
Sbjct  456  DKRCTHEIRSIWISYWSQADKSLGQKLASRLNVRPSF  492



>dbj|BAF91369.1| catalase [Capsicum annuum]
Length=492

 Score =   260 bits (664),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            S+DK+LQ R FAYADT RHR+GPNYM LPVNAPKCA+HNN  DG MNF+HRDEEVDY PS
Sbjct  336  SEDKLLQTRIFAYADTQRHRIGPNYMQLPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            +FD  R AE++P P  ++TGRR+KCVI KENNFKQ G+RYRSWAPDRQDR+IN+WV+SLS
Sbjct  396  RFDPCRPAEQYPIPSCVLTGRREKCVIPKENNFKQAGERYRSWAPDRQDRYINKWVESLS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHEIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  456  DPRVTHEIRSIWISYLSQADKSCGQKVASRLTVKPTM  492



>gb|AIX10947.1| putative catalase [Gardenia jasminoides]
Length=492

 Score =   260 bits (664),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            S+DK+LQ R FAY+DTHRHRLGPNY+ LPVNAPKCA+HNN YDGYMN +HRDEE+DYFPS
Sbjct  336  SEDKLLQGRIFAYSDTHRHRLGPNYLQLPVNAPKCAHHNNHYDGYMNIMHRDEEIDYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AER P P R++TGRR++ VIEKENNFKQP +RYRSWAPDRQ+RF+ RWV +LS
Sbjct  396  RYDPVRHAERHPIPTRVLTGRRERRVIEKENNFKQPVERYRSWAPDRQERFVRRWVDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PR+THEIRS WISY +QAD+SLGQK+A RLN+RPTM
Sbjct  456  DPRLTHEIRSIWISYWSQADKSLGQKIAFRLNVRPTM  492



>gb|AAM97542.1| catalase 3 [Capsicum annuum]
Length=492

 Score =   259 bits (663),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRVFSYADTQRHRLGPNYLQLPPNAPKCAHHNNHHEGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            +FD  R+AE++P P R++ G+RD+C+I+KENNFKQPG+RYRSWAPDRQ+RFI RWV +LS
Sbjct  396  RFDPCRHAEQYPIPPRVLNGKRDRCIIQKENNFKQPGERYRSWAPDRQERFICRWVDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            EPRVTHEIR+ W+SY +QAD+SLGQK+ASRLN++PTM
Sbjct  456  EPRVTHEIRTIWLSYWSQADKSLGQKLASRLNVKPTM  492



>ref|XP_008365915.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   259 bits (662),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+Y+DT RHRLGPNY+ LPVNAPKC++HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE FP P  I TG+R+KCVIEKENNFKQPG+RYRSWAPDRQ+RF++RWV  LS
Sbjct  396  RYDPARHAETFPIPSNICTGKREKCVIEKENNFKQPGERYRSWAPDRQERFLHRWVDVLS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            EPRVTHEIRS WISY +QADRS GQK+ASRLN+RP++
Sbjct  456  EPRVTHEIRSIWISYWSQADRSFGQKLASRLNVRPSI  492



>ref|XP_008348924.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   259 bits (662),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+Y+DT RHRLGPNY+ LPVNAPKC++HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE FP P  I TG+R+KCVIEKENNFKQPG+RYRSWAPDRQ+RF++RWV  LS
Sbjct  396  RYDPARHAETFPIPSNICTGKREKCVIEKENNFKQPGERYRSWAPDRQERFLHRWVDVLS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            EPRVTHEIRS WISY +QADRS GQK+ASRLN+RP++
Sbjct  456  EPRVTHEIRSIWISYWSQADRSFGQKLASRLNVRPSI  492



>ref|XP_011041225.1| PREDICTED: catalase isozyme 1 [Populus euphratica]
Length=492

 Score =   259 bits (661),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+Y+DT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            + D +R+AERFP P  + +GRR+KC+IEKENNFKQPG+RYRSWAPDRQ+RF+ RWV +LS
Sbjct  396  RHDPSRHAERFPIPSAVCSGRREKCIIEKENNFKQPGERYRSWAPDRQERFVCRWVDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            EPRVTHE+RS WISY +QAD+SLGQK+AS LN+RP++
Sbjct  456  EPRVTHEVRSIWISYWSQADKSLGQKLASHLNVRPSI  492



>ref|XP_010242894.1| PREDICTED: catalase isozyme 1-like isoform X1 [Nelumbo nucifera]
Length=492

 Score =   259 bits (661),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+Y+DT RHRLGPNY++LP NAPKCA+HNN +DG+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRIFSYSDTQRHRLGPNYLMLPANAPKCAHHNNHHDGFMNFLHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AERFP P RI TG+R+KCVIEKENNFKQPG+RYRS+ PDRQ+RFI RW  +LS
Sbjct  396  RYDPVRHAERFPIPPRICTGKREKCVIEKENNFKQPGERYRSFDPDRQERFIKRWFDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHEIRS WISY +QAD+SLGQK+A+RLN++P+M
Sbjct  456  DPRVTHEIRSIWISYWSQADKSLGQKLATRLNVKPSM  492



>emb|CDP07287.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   259 bits (661),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY+ LP NAPKCA+HNN +DG+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCAHHNNHHDGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AER P P  +++G+RDKCVI+KENNFKQPG+RYRSWAPDRQ+RFI RWV +LS
Sbjct  396  RYDPVRHAERHPIPPPVLSGKRDKCVIQKENNFKQPGERYRSWAPDRQERFICRWVDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            + RVTHEIRS WISY +QAD+SLGQK+A+RLN+RPTM
Sbjct  456  DARVTHEIRSIWISYWSQADKSLGQKIATRLNVRPTM  492



>ref|XP_010061175.1| PREDICTED: catalase-like [Eucalyptus grandis]
Length=492

 Score =   259 bits (661),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ+R F+YADT RHRLGPNY+ LPVNAPKC +HNN ++G MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQSRIFSYADTQRHRLGPNYLQLPVNAPKCTHHNNHHEGLMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            +FD+ R+AE+FP P  ++ G+RD+C+IEKENNFKQPG+RYRSWAPDRQ+RFI RWV++LS
Sbjct  396  RFDSVRHAEKFPIPPPVLNGKRDRCMIEKENNFKQPGERYRSWAPDRQERFIGRWVEALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVT EIRS WISY TQAD+SLGQK+AS LN+RP+M
Sbjct  456  DPRVTQEIRSIWISYWTQADKSLGQKIASCLNVRPSM  492



>ref|XP_008802866.1| PREDICTED: catalase isozyme 1 [Phoenix dactylifera]
Length=492

 Score =   259 bits (661),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY++LP NAPKCA+HNN +DG+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRIFSYADTQRHRLGPNYLMLPANAPKCAHHNNHHDGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE FP P  ++TGRR+KCVI KENNFKQPG+RYRSWAPDRQ RFI RWV++LS
Sbjct  396  RYDPVRHAETFPIPSCVLTGRREKCVIHKENNFKQPGERYRSWAPDRQGRFICRWVEALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVT+EIRS WISY +Q DRSLGQK+A+RLN++P+M
Sbjct  456  DPRVTYEIRSIWISYWSQCDRSLGQKIATRLNVKPSM  492



>gb|KJB14249.1| hypothetical protein B456_002G115900 [Gossypium raimondii]
Length=344

 Score =   254 bits (649),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+Y+DT RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEE++YFPS
Sbjct  188  SDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEINYFPS  247

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE FP P  + TGRR+KC+IEKENNFKQPG+RYRSWA DRQ+RFI RWV +LS
Sbjct  248  RYDPVRHAEMFPIPPAVCTGRREKCIIEKENNFKQPGERYRSWAADRQERFICRWVDALS  307

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHEIRS WISY +QAD+S+GQK+ASRLN+RP++
Sbjct  308  DPRVTHEIRSIWISYWSQADKSVGQKLASRLNVRPSI  344



>ref|XP_009773579.1| PREDICTED: catalase isozyme 3-like [Nicotiana sylvestris]
Length=492

 Score =   258 bits (660),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+Y+DT RHRLGPNY+ LPVNAPKCA+HNN ++G MNF++RDEEV+YFPS
Sbjct  336  SDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGVMNFMYRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            +FD  R+AE++P P RI+TG+RD+C+IEKENNFKQPG+RYRSW+PDRQ+RFI RW+ +LS
Sbjct  396  RFDPCRHAEQYPIPPRILTGKRDRCIIEKENNFKQPGERYRSWSPDRQERFICRWINALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHEIR  WISY +QAD+SLG+K+ASRLN+RPTM
Sbjct  456  DPRVTHEIRIIWISYWSQADKSLGEKIASRLNVRPTM  492



>sp|Q9M5L6.1|CATA_CAPAN RecName: Full=Catalase; AltName: Full=CaCat1 [Capsicum annuum]
 gb|AAF34718.1|AF227952_1 catalase [Capsicum annuum]
Length=492

 Score =   258 bits (660),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            S+DK+LQ R FAYADT RHR+GPNYM LPVNAPKCA+HNN  DG MNF+HRDEEVDY PS
Sbjct  336  SEDKLLQTRIFAYADTQRHRIGPNYMQLPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            +FD  R AE++P P  ++TGRR+KCVI KENNFKQ G+RYRSWAPDRQDR+IN+WV+SLS
Sbjct  396  RFDPCRPAEQYPIPSCVLTGRREKCVIPKENNFKQAGERYRSWAPDRQDRYINKWVESLS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PR THEIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  456  DPRATHEIRSIWISYLSQADKSCGQKVASRLTVKPTM  492



>ref|XP_010498496.1| PREDICTED: catalase-3 [Camelina sativa]
 ref|XP_010459748.1| PREDICTED: catalase-3 [Camelina sativa]
 ref|XP_010477307.1| PREDICTED: catalase-3 [Camelina sativa]
Length=492

 Score =   258 bits (660),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R FAY DT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PS
Sbjct  336  SDDKLLQCRIFAYGDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            KFD  R AE+ P P +  TG R KC+I+KENNFKQPGDRYRSWAPDRQDRF+ RWV+ LS
Sbjct  396  KFDPVRCAEKVPIPTKSYTGIRTKCIIKKENNFKQPGDRYRSWAPDRQDRFVKRWVEILS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            EPR+THEIRS WISY +QADRSLGQK+ASRLN+RP++
Sbjct  456  EPRLTHEIRSIWISYWSQADRSLGQKLASRLNVRPSI  492



>ref|XP_009110221.1| PREDICTED: catalase-3 [Brassica rapa]
 gb|AFN81244.1| catalase 2 [Brassica rapa subsp. pekinensis]
 emb|CDX96630.1| BnaA08g21730D [Brassica napus]
Length=492

 Score =   258 bits (659),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R FAY DT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PS
Sbjct  336  SDDKLLQCRIFAYGDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            KFD  R AE+ P P +  TG R KC+I+KENNFKQPGDRYRSWAPDRQDRF+ RWV+ LS
Sbjct  396  KFDPVRCAEKVPIPTKSYTGIRTKCIIKKENNFKQPGDRYRSWAPDRQDRFVKRWVEILS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            EPR+THEIRS WISY +QADRSLGQK+ASRLN+RP++
Sbjct  456  EPRLTHEIRSIWISYWSQADRSLGQKLASRLNVRPSI  492



>ref|XP_007210576.1| hypothetical protein PRUPE_ppa004763mg [Prunus persica]
 gb|EMJ11775.1| hypothetical protein PRUPE_ppa004763mg [Prunus persica]
Length=492

 Score =   258 bits (659),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDKMLQ R FAY+DT RHRLGPNY+ LPVNAPKC +HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKMLQTRIFAYSDTQRHRLGPNYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            + D  R+AER+P P  I++G+R+KCVIEKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS
Sbjct  396  RHDPVRHAERYPIPSNILSGKREKCVIEKENNFKQPGERYRSWAPDRQERFIRRWVDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHEIRS WISY +QAD+SLGQK+ SRLN+RP++
Sbjct  456  DPRVTHEIRSIWISYWSQADKSLGQKLLSRLNVRPSI  492



>ref|XP_009400996.1| PREDICTED: catalase isozyme 2 [Musa acuminata subsp. malaccensis]
Length=492

 Score =   258 bits (659),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 143/157 (91%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+Y+DT RHRLGPNY++LPVNAPKCA+HNN YDG+MNF+HRDEEVDYFPS
Sbjct  336  SDDKLLQTRIFSYSDTQRHRLGPNYLMLPVNAPKCAHHNNHYDGFMNFMHRDEEVDYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AERFP P R++TG+R+KC+I KENNFKQPG+RYRS++PDRQ+RFI RWV++LS
Sbjct  396  RYDPVRHAERFPIPTRVLTGKREKCMISKENNFKQPGERYRSFSPDRQERFIRRWVEALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +P+VTHEIRS WISY +Q D+SL QK+A+RL+++P+M
Sbjct  456  DPKVTHEIRSIWISYWSQCDKSLSQKLATRLSVKPSM  492



>ref|XP_008789355.1| PREDICTED: catalase isozyme 1-like [Phoenix dactylifera]
Length=492

 Score =   258 bits (659),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY++LP NAPKCA+HNN +DG+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRIFSYADTQRHRLGPNYLMLPANAPKCAHHNNHHDGFMNFLHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AER P P RI+TGRR+KCVI+KENNFKQPG+RYRSW PDRQ RFI RWV++LS
Sbjct  396  RYDPVRHAERCPIPSRILTGRREKCVIQKENNFKQPGERYRSWDPDRQGRFIRRWVEALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHEI+S WISY +Q D+SLG+K+A+RLN++P+M
Sbjct  456  DPRVTHEIQSIWISYWSQCDKSLGRKIATRLNVKPSM  492



>ref|XP_002301920.1| catalase family protein [Populus trichocarpa]
 gb|ABK96479.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE81193.1| catalase family protein [Populus trichocarpa]
Length=492

 Score =   258 bits (659),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE FP P  + +G+R+KC+IEKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS
Sbjct  396  RYDPVRHAESFPIPPAVCSGKREKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  456  DPRVTHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>emb|CAI43948.1| catalase [Populus deltoides]
 gb|ABK96317.1| unknown [Populus trichocarpa x Populus deltoides]
Length=492

 Score =   258 bits (658),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE FP P  + +G+R+KC+IEKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS
Sbjct  396  RYDPVRHAESFPIPPAVCSGKREKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  456  DPRVTHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|NP_001031072.3| catalase 3 [Arabidopsis thaliana]
 gb|AEE29996.1| catalase 3 [Arabidopsis thaliana]
Length=377

 Score =   254 bits (649),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R FAY DT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PS
Sbjct  221  SDDKLLQCRIFAYGDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPS  280

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            KFD  R AE+ PTP    TG R KCVI+KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LS
Sbjct  281  KFDPVRCAEKVPTPTNSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILS  340

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            EPR+THEIR  WISY +QADRSLGQK+ASRLN+RP++
Sbjct  341  EPRLTHEIRGIWISYWSQADRSLGQKLASRLNVRPSI  377



>gb|KFK44175.1| hypothetical protein AALP_AA1G224300 [Arabis alpina]
Length=492

 Score =   258 bits (658),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 136/157 (87%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R FAY DT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PS
Sbjct  336  SDDKLLQCRIFAYGDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            KFD  R AE+ P P +  TG R KCVI+KENNFKQPGDRYRSWAPDRQDRFI RWV+ LS
Sbjct  396  KFDPVRCAEKVPVPSKSYTGIRTKCVIKKENNFKQPGDRYRSWAPDRQDRFIKRWVEILS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            EPR+THEIR  WISY +QADRSLGQK+ASRLN+RP++
Sbjct  456  EPRLTHEIRGIWISYWSQADRSLGQKLASRLNVRPSI  492



>gb|AEQ30070.1| catalase, partial [Litchi chinensis]
Length=487

 Score =   257 bits (657),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 134/157 (85%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDKMLQ R FAY DT RHRLGPNY++LPVNAPKC +HNN YDG+MNF+HRDEEVDYFPS
Sbjct  331  SDDKMLQCRIFAYGDTQRHRLGPNYLMLPVNAPKCPHHNNHYDGFMNFMHRDEEVDYFPS  390

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            KF N  NAE+FP P RI +G+R+K  IEKENNFK PGDRYRSWAPDRQ+RFI R V  LS
Sbjct  391  KFTNVANAEKFPIPGRICSGKREKACIEKENNFKLPGDRYRSWAPDRQERFIKRVVDGLS  450

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVT EIRS W+SY +QAD+SLGQK+ASRLN+RP +
Sbjct  451  DPRVTFEIRSIWVSYWSQADKSLGQKIASRLNVRPNI  487



>emb|CDY33636.1| BnaC08g19360D [Brassica napus]
Length=492

 Score =   257 bits (657),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R FAY DT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PS
Sbjct  336  SDDKLLQCRIFAYGDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            KFD  R AE+ P P +  TG R KC+I+KENNFKQPGDRYRSWAPDRQDRF+ RWV+ LS
Sbjct  396  KFDPVRCAEKVPIPNKSYTGIRTKCIIKKENNFKQPGDRYRSWAPDRQDRFVKRWVEILS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            EPR+THEIRS WISY +QADRSLGQK+ASRLN+RP++
Sbjct  456  EPRLTHEIRSIWISYWSQADRSLGQKLASRLNVRPSI  492



>emb|CDY31488.1| BnaC05g15970D [Brassica napus]
Length=500

 Score =   257 bits (657),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R FAY DT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PS
Sbjct  344  SDDKLLQCRIFAYGDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPS  403

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            KFD  R AE+ P P +  TG R KC+I+KENNFKQPGDRYRSWAPDRQDRF+ RWV+ LS
Sbjct  404  KFDPVRCAEKVPIPNKSYTGIRTKCIIKKENNFKQPGDRYRSWAPDRQDRFVKRWVEILS  463

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            EPR+THEIRS WISY +QADRSLGQK+ASRLN+RP++
Sbjct  464  EPRLTHEIRSIWISYWSQADRSLGQKLASRLNVRPSI  500



>emb|CDY29519.1| BnaA06g14510D [Brassica napus]
Length=492

 Score =   257 bits (657),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R FAY DT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PS
Sbjct  336  SDDKLLQCRIFAYGDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            KFD  R AE+ P P +  TG R KC+I+KENNFKQPGDRYRSWAPDRQDRF+ RWV+ LS
Sbjct  396  KFDPVRCAEKVPIPNKSYTGIRTKCIIKKENNFKQPGDRYRSWAPDRQDRFVKRWVEILS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            EPR+THEIRS WISY +QADRSLGQK+ASRLN+RP++
Sbjct  456  EPRLTHEIRSIWISYWSQADRSLGQKLASRLNVRPSI  492



>gb|AAA57551.1| catalase, partial [Nicotiana sylvestris]
Length=383

 Score =   254 bits (648),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            S+DK+LQ R FAYADT RHR+GPNYM LPVNAPKCA+HNN  DG MNF+HRDEEVDY PS
Sbjct  227  SEDKLLQTRIFAYADTQRHRIGPNYMQLPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPS  286

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            +FD  R+AE++P P R++TGRR+ CVIEKENNFKQ G+RYRSW PDRQDR++++WV+ LS
Sbjct  287  RFDPCRHAEQYPIPSRVLTGRREMCVIEKENNFKQAGERYRSWEPDRQDRYVSKWVEHLS  346

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVT+EIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  347  DPRVTYEIRSIWISYLSQADKSCGQKVASRLTLKPTM  383



>ref|XP_009103334.1| PREDICTED: catalase-3-like [Brassica rapa]
 gb|AAB53101.2| catalase [Brassica napus]
 gb|AET08935.1| catalase [Brassica napus]
Length=492

 Score =   257 bits (657),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R FAY DT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PS
Sbjct  336  SDDKLLQCRIFAYGDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            KFD  R AE+ P P +  TG R KC+I+KENNFKQPGDRYRSWAPDRQDRF+ RWV+ LS
Sbjct  396  KFDPVRCAEKVPIPNKSYTGIRTKCIIKKENNFKQPGDRYRSWAPDRQDRFVKRWVEILS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            EPR+THEIRS WISY +QADRSLGQK+ASRLN+RP++
Sbjct  456  EPRLTHEIRSIWISYWSQADRSLGQKLASRLNVRPSI  492



>ref|XP_011034872.1| PREDICTED: catalase isozyme 1-like [Populus euphratica]
Length=492

 Score =   257 bits (657),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE FP P  + +G+R+KC+IEKENNFKQPG+RYRSWAPDRQ+RF+ RWV +LS
Sbjct  396  RYDPVRHAESFPIPPAVCSGKREKCIIEKENNFKQPGERYRSWAPDRQERFVCRWVDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  456  DPRVTHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|ACJ11733.1| catalase [Gossypium hirsutum]
Length=492

 Score =   257 bits (656),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEE++YFPS
Sbjct  336  SDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEINYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE FP P  + TGRR+KC+IEKENNFKQPG+RYRSWA DRQ+RFI RWV++LS
Sbjct  396  RYDPVRHAEMFPIPPAVCTGRREKCIIEKENNFKQPGERYRSWAADRQERFICRWVEALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  456  DPRVTHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|AIS20825.1| CAT [Pyrus x bretschneideri]
Length=492

 Score =   257 bits (656),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+Y+DT RHRLGPNY+ LPVNAPKC++HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE FP P  I TG+R+KCVIEKENNFKQPG+RYRSWAPDRQ+RF++RWV +LS
Sbjct  396  RYDPARHAETFPIPSNICTGKREKCVIEKENNFKQPGERYRSWAPDRQERFLHRWVDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVT+EIRS WISY +QADRS GQK+ASRLN+RP++
Sbjct  456  DPRVTYEIRSIWISYWSQADRSFGQKLASRLNVRPSI  492



>ref|XP_009149539.1| PREDICTED: catalase-3 [Brassica rapa]
Length=543

 Score =   258 bits (659),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R FAY DT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PS
Sbjct  387  SDDKLLQCRIFAYGDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPS  446

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            KFD  R AE+ P P +  TG R KC+I+KENNFKQPGDRYRSWAPDRQDRF+ RWV+ LS
Sbjct  447  KFDPVRCAEKVPIPNKSYTGIRTKCIIKKENNFKQPGDRYRSWAPDRQDRFVKRWVEILS  506

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            EPR+THEIRS WISY +QADRSLGQK+ASRLN+RP++
Sbjct  507  EPRLTHEIRSIWISYWSQADRSLGQKLASRLNVRPSI  543



>ref|XP_008373403.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   256 bits (655),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+Y+DT RHRLGPNY+ LPVNAPKC++HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE FP P  I TG+R+KCVIEKENNFKQPG+RYRSWAPDRQ+RF++RWV +LS
Sbjct  396  RYDPVRHAETFPIPSNICTGKREKCVIEKENNFKQPGERYRSWAPDRQERFLHRWVDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVT+EIRS WISY +QADRS GQK+ASRLN+RP++
Sbjct  456  DPRVTYEIRSIWISYWSQADRSFGQKLASRLNVRPSI  492



>ref|XP_011074091.1| PREDICTED: catalase isozyme 3 isoform X2 [Sesamum indicum]
Length=492

 Score =   256 bits (655),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRIFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D +R+AER+P P  +++G+R K  IEKENNFKQPGDRYRSWAPDRQ+RFI RWV++LS
Sbjct  396  RYDPSRHAERYPIPPVVLSGKRGKICIEKENNFKQPGDRYRSWAPDRQERFIRRWVEALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PR+THEIRS W+SY +QAD+SLGQK+ASRLN+RP M
Sbjct  456  DPRLTHEIRSIWVSYWSQADKSLGQKLASRLNVRPAM  492



>gb|KCW68095.1| hypothetical protein EUGRSUZ_F01777 [Eucalyptus grandis]
Length=584

 Score =   259 bits (661),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ+R F+YADT RHRLGPNY+ LPVNAPKC +HNN ++G MNF+HRDEEV+YFPS
Sbjct  428  SDDKLLQSRIFSYADTQRHRLGPNYLQLPVNAPKCTHHNNHHEGLMNFMHRDEEVNYFPS  487

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            +FD+ R+AE+FP P  ++ G+RD+C+IEKENNFKQPG+RYRSWAPDRQ+RFI RWV++LS
Sbjct  488  RFDSVRHAEKFPIPPPVLNGKRDRCMIEKENNFKQPGERYRSWAPDRQERFIGRWVEALS  547

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVT EIRS WISY TQAD+SLGQK+AS LN+RP+M
Sbjct  548  DPRVTQEIRSIWISYWTQADKSLGQKIASCLNVRPSM  584



>ref|XP_011074092.1| PREDICTED: catalase isozyme 3 isoform X3 [Sesamum indicum]
Length=492

 Score =   256 bits (654),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRIFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D +R+AER+P P  +++G+R K  IEKENNFKQPGDRYRSWAPDRQ+RFI RWV++LS
Sbjct  396  RYDPSRHAERYPIPPVVLSGKRGKICIEKENNFKQPGDRYRSWAPDRQERFIRRWVEALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PR+THEIRS W+SY +QAD+SLGQK+AS LN+RPTM
Sbjct  456  DPRLTHEIRSIWVSYWSQADKSLGQKLASHLNVRPTM  492



>emb|CAD42909.1| catalase [Prunus persica]
Length=492

 Score =   256 bits (654),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R FAY+DT RHRLGPNY+ LPVNAPKC +HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKVLQTRIFAYSDTQRHRLGPNYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            + D  R+AER+P P  I++G+R+KCVIEKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS
Sbjct  396  RHDPVRHAERYPIPSNILSGKREKCVIEKENNFKQPGERYRSWAPDRQERFIRRWVDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHEIRS WISY +QAD+SLGQK+ SRLN+RP++
Sbjct  456  DPRVTHEIRSIWISYWSQADKSLGQKLLSRLNVRPSI  492



>gb|AGV54297.1| peroxisomal catalase [Phaseolus vulgaris]
Length=492

 Score =   256 bits (654),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDKMLQ R F+YAD+ RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKMLQTRIFSYADSQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D+ R+AE FP P  I +GRR+KC IEKENNFKQ G+R+RSWAPDRQDRFI RWV +LS
Sbjct  396  RYDSVRHAESFPIPPAICSGRREKCGIEKENNFKQAGERFRSWAPDRQDRFIRRWVDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHEIRS WISY +QADRSLGQK+AS LN+RP +
Sbjct  456  DPRVTHEIRSVWISYWSQADRSLGQKIASHLNMRPNI  492



>gb|ACJ76836.3| catalase [Dimocarpus longan]
Length=492

 Score =   256 bits (654),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 134/157 (85%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDKMLQ R FAY DT RHRLGPNY++LPVNAPKC +HNN YDG+MNF+HRDEEVDYFPS
Sbjct  336  SDDKMLQCRIFAYGDTQRHRLGPNYLMLPVNAPKCPHHNNHYDGFMNFMHRDEEVDYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            KF N  NAE+FP P RI +G+R+K  IEKENNFK PGDRYRSWAPDRQ+RFI R V  LS
Sbjct  396  KFTNVANAEKFPIPSRICSGKREKACIEKENNFKLPGDRYRSWAPDRQERFIKRVVDGLS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVT E+RS W+SY +QAD+SLGQK+ASRLN+RP +
Sbjct  456  DPRVTFELRSIWVSYWSQADKSLGQKIASRLNVRPNI  492



>ref|XP_006828714.1| hypothetical protein AMTR_s00001p00022550 [Amborella trichopoda]
 gb|ERM96130.1| hypothetical protein AMTR_s00001p00022550 [Amborella trichopoda]
Length=492

 Score =   256 bits (654),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK LQAR FAY DT RHRLGPNY++LPVNAPKCA+HNN YDG+MNF HRDEEVDYFPS
Sbjct  336  SDDKFLQARTFAYGDTQRHRLGPNYLMLPVNAPKCAHHNNHYDGFMNFAHRDEEVDYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            +FD  R+AER P P ++V+G+R++CVIEKENNFKQPGDRYRS+APDRQ+RF+ R V +LS
Sbjct  396  RFDPVRHAERCPLPPQLVSGKRERCVIEKENNFKQPGDRYRSFAPDRQERFVKRIVDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            + RVTHEIRS WISY +Q D+SLGQK+A+RLNI+P M
Sbjct  456  DTRVTHEIRSIWISYWSQCDKSLGQKIATRLNIKPHM  492



>gb|ACJ73905.1| CAT1 [Solanum nigrum]
Length=168

 Score =   246 bits (627),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 105/157 (67%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDKMLQ R F+Y+DT R+RLGPNY+ LP NAPKCA+HNN YDG MNF+HRDEE+DYFPS
Sbjct  12   SDDKMLQTRIFSYSDTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPS  71

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE +P P ++ +G+R+KC+I+KENNFKQ G+RYR++ PDRQ+RF+ RWV+ LS
Sbjct  72   RYDQVRHAEIYPIPSKVCSGKREKCIIQKENNFKQAGERYRTFTPDRQERFVRRWVEPLS  131

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PR+T+EIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  132  DPRITYEIRSIWISYWSQADKSLGQKLASRLNVRPSI  168



>dbj|BAH20307.1| AT1G20620 [Arabidopsis thaliana]
Length=458

 Score =   255 bits (651),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R FAY DT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PS
Sbjct  302  SDDKLLQCRIFAYGDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPS  361

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            KFD  R AE+ PTP    TG R KCVI+KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LS
Sbjct  362  KFDPVRCAEKVPTPTNSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILS  421

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            EPR+THEIR  WISY +QADRSLGQK+ASRLN+RP++
Sbjct  422  EPRLTHEIRGIWISYWSQADRSLGQKLASRLNVRPSI  458



>emb|CDY01364.1| BnaA07g11370D [Brassica napus]
Length=556

 Score =   258 bits (658),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R FAY DT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PS
Sbjct  400  SDDKLLQCRIFAYGDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPS  459

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            KFD  R AE+ P P +  TG R KC+I+KENNFKQPGDRYRSWAPDRQDRF+ RWV+ LS
Sbjct  460  KFDPVRCAEKVPIPNKSYTGIRTKCIIKKENNFKQPGDRYRSWAPDRQDRFVKRWVEILS  519

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            EPR+THEIRS WISY +QADRSLGQK+ASRLN+RP++
Sbjct  520  EPRLTHEIRSIWISYWSQADRSLGQKLASRLNVRPSI  556



>ref|NP_001237571.1| catalase-4 [Glycine max]
 sp|O48561.1|CATA4_SOYBN RecName: Full=Catalase-4 [Glycine max]
 gb|AAB88172.1| catalase [Glycine max]
 gb|KHN33801.1| Catalase-4 [Glycine soja]
Length=492

 Score =   256 bits (653),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 136/157 (87%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDKMLQ R F+YAD+ RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKMLQTRIFSYADSQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AERFP P  I +GRR+KC IEKENNFKQPG+RYRSWAPDRQDRF  RWV +LS
Sbjct  396  RYDPVRHAERFPIPPAICSGRREKCGIEKENNFKQPGERYRSWAPDRQDRFARRWVDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHEIRS WISY +QADRSLGQK+AS L+ RP +
Sbjct  456  DPRVTHEIRSVWISYWSQADRSLGQKIASHLSTRPNI  492



>ref|XP_007136018.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
 gb|ESW08012.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
Length=492

 Score =   256 bits (653),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDKMLQ R F+YAD+ RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKMLQTRIFSYADSQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D+ R+AE FP P  I +GRR+KC IEKENNFKQ G+R+RSWAPDRQDRFI RWV +LS
Sbjct  396  RYDSVRHAESFPIPPAICSGRREKCGIEKENNFKQAGERFRSWAPDRQDRFIRRWVDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHEIRS WISY +QADRSLGQK+AS LN+RP +
Sbjct  456  DPRVTHEIRSVWISYWSQADRSLGQKIASHLNMRPNI  492



>dbj|BAC79443.1| catalase [Acacia ampliceps]
Length=492

 Score =   256 bits (653),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQAR FAY DT RHR+GPNY+ LPVNAPKCA+HNN YDG MNF+HRDEEVDYFPS
Sbjct  336  SDDKVLQARIFAYGDTQRHRIGPNYLQLPVNAPKCAHHNNHYDGTMNFMHRDEEVDYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE+FP P   + GRRD+ +IEKENNFKQPGD YR+WAPDRQ+RFI RW+  LS
Sbjct  396  RYDTARHAEKFPIPPVNLIGRRDRRIIEKENNFKQPGDLYRTWAPDRQERFIRRWIGVLS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +P+VTHE+RS WISYL+QADRSLGQKVAS LN+RP++
Sbjct  456  DPKVTHEVRSIWISYLSQADRSLGQKVASHLNMRPSI  492



>gb|ADC95629.1| catalase [Bruguiera gymnorhiza]
Length=492

 Score =   256 bits (653),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY+ LP NAPKCA+HNN +DG+MNF+HRDEEV+Y PS
Sbjct  336  SDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCAHHNNHHDGFMNFMHRDEEVNYLPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            +FD  R+AERFP P  + TGRR+KC+IEKENNFKQPG+RYRSWAPDRQ+RF +RWV++LS
Sbjct  396  RFDPVRHAERFPIPPAVCTGRREKCIIEKENNFKQPGERYRSWAPDRQERFTHRWVEALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHEI S WISY TQ D+ LGQK+A+RLN+RP++
Sbjct  456  DPRVTHEICSIWISYWTQCDKFLGQKLATRLNVRPSI  492



>sp|O24339.1|CATA_SOLAP RecName: Full=Catalase [Soldanella alpina]
 emb|CAB16749.1| catalase [Soldanella alpina]
Length=492

 Score =   256 bits (653),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY+ LP NAPKCA+HNN ++G MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRIFSYADTQRHRLGPNYLQLPPNAPKCAHHNNHHEGLMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            +FD  R+AER P P  ++TG+RD+C+IEKENNFKQPG+RYR++APDRQ+RF+ RWV +LS
Sbjct  396  RFDPVRHAERHPIPPPVLTGKRDRCMIEKENNFKQPGERYRTFAPDRQERFVCRWVDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHEIRS WISY TQAD+SLGQK+ASRLN+RPTM
Sbjct  456  DPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRPTM  492



>sp|P55311.1|CATA_SOLME RecName: Full=Catalase [Solanum melongena]
 emb|CAA50644.1| catalase [Solanum melongena]
Length=492

 Score =   256 bits (653),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            S+DK+LQ R FAYADT RHR+GPNYM LPVNAPKCA+HNN  DG MNF+HRDEEVDY PS
Sbjct  336  SEDKLLQTRIFAYADTQRHRIGPNYMQLPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            +FD  R AE++P P  ++TGRR+KCVI KENNFKQ G+RYR+W PDRQDR+IN+WV+SLS
Sbjct  396  RFDPCRPAEQYPIPSCVLTGRREKCVIPKENNFKQAGERYRTWEPDRQDRYINKWVESLS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHEIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  456  DPRVTHEIRSIWISYLSQADKSCGQKVASRLLVKPTM  492



>gb|KHG25152.1| Catalase isozyme 1 [Gossypium arboreum]
Length=492

 Score =   256 bits (653),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEE++YFPS
Sbjct  336  SDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEINYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE FP P  + TGRR+KC+IEKENNFKQPG+RYRSWA DRQ+RFI RWV++ S
Sbjct  396  RYDPVRHAEMFPIPPAVCTGRREKCIIEKENNFKQPGERYRSWAADRQERFICRWVEAFS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  456  DPRVTHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|AAR84578.1| catalase 1a [Lotus japonicus]
Length=492

 Score =   256 bits (653),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDKMLQ R F+YAD+ RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKMLQTRIFSYADSQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AER+P P  I TG R++C IEKENNFKQPG+RYRS+APDRQDRF+ RWV +LS
Sbjct  396  RYDPVRHAERYPIPPAICTGSRERCAIEKENNFKQPGERYRSFAPDRQDRFVRRWVDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHEIRSTWISY +QADRSLGQK+AS LN+RP++
Sbjct  456  DPRVTHEIRSTWISYWSQADRSLGQKIASHLNLRPSI  492



>ref|NP_001240021.1| catalase [Glycine max]
 dbj|BAG09375.1| peroxisomal catalase [Glycine max]
 gb|KHN20113.1| Catalase-4 [Glycine soja]
Length=492

 Score =   255 bits (652),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDKMLQ R F+YAD+ RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKMLQTRIFSYADSQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE FP P  I +GRR+KC IEKENNFKQPG+RYRSWAPDRQDRF  RWV +LS
Sbjct  396  RYDPVRHAETFPIPPAICSGRREKCGIEKENNFKQPGERYRSWAPDRQDRFNRRWVDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHEIRS WISY +QADRSLGQK+ASRL++RP +
Sbjct  456  DPRVTHEIRSVWISYWSQADRSLGQKIASRLSMRPNI  492



>emb|CDY31878.1| BnaC07g15280D [Brassica napus]
Length=492

 Score =   255 bits (652),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 136/157 (87%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R FAY DT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PS
Sbjct  336  SDDKLLQCRIFAYGDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            KFD  R AE+ P P +  TG R KC+I+KENNFKQPGDRYRSWAPDRQDRF+ RWV+ LS
Sbjct  396  KFDPVRCAEKAPIPNKSYTGIRTKCIIKKENNFKQPGDRYRSWAPDRQDRFVKRWVEILS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            EPR+THEIR  WISY +QADRSLGQK+ASRLN+RP++
Sbjct  456  EPRLTHEIRGIWISYWSQADRSLGQKLASRLNVRPSI  492



>ref|NP_564120.1| catalase 3 [Arabidopsis thaliana]
 sp|Q42547.3|CATA3_ARATH RecName: Full=Catalase-3 [Arabidopsis thaliana]
 gb|AAL08303.1| At1g20620/F5M15_4 [Arabidopsis thaliana]
 gb|AAL24212.1| At1g20620/F5M15_4 [Arabidopsis thaliana]
 gb|AEE29995.1| catalase 3 [Arabidopsis thaliana]
Length=492

 Score =   255 bits (652),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R FAY DT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PS
Sbjct  336  SDDKLLQCRIFAYGDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            KFD  R AE+ PTP    TG R KCVI+KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LS
Sbjct  396  KFDPVRCAEKVPTPTNSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            EPR+THEIR  WISY +QADRSLGQK+ASRLN+RP++
Sbjct  456  EPRLTHEIRGIWISYWSQADRSLGQKLASRLNVRPSI  492



>ref|XP_009590727.1| PREDICTED: catalase isozyme 1 [Nicotiana tomentosiformis]
Length=492

 Score =   255 bits (652),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            S+DK+LQ R FAYADT RHR+GPNYM LPVNAPKCA+HNN  DG MNF+HRDEEVDY PS
Sbjct  336  SEDKLLQTRIFAYADTQRHRIGPNYMQLPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            +FD  R+AE++P P R++TGRR+ CVIEKENNFKQ G+RYRSW PDRQDR++++WV+ LS
Sbjct  396  RFDPCRHAEQYPIPSRVLTGRREMCVIEKENNFKQAGERYRSWEPDRQDRYVSKWVEHLS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVT+EIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  456  DPRVTYEIRSIWISYLSQADKSCGQKVASRLTVKPTM  492



>gb|AAM65021.1| unknown [Arabidopsis thaliana]
Length=492

 Score =   255 bits (651),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R FAY DT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PS
Sbjct  336  SDDKLLQCRIFAYGDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            KFD  R AE+ PTP    TG R KCVI+KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LS
Sbjct  396  KFDPVRCAEKVPTPTNSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            EPR+THEIR  WISY +QADRSLGQK+ASRLN+RP++
Sbjct  456  EPRLTHEIRGIWISYWSQADRSLGQKLASRLNVRPSI  492



>gb|AHF27428.1| catalase, partial [Cucurbita moschata]
 gb|AHF27431.1| catalase, partial [Cucurbita maxima]
Length=344

 Score =   251 bits (640),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  188  SDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPS  247

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            +FD +R+AER+P P  + +G+R++C+IEKENNFK+PG+RYRSW PDRQ+RF+ RWV +LS
Sbjct  248  RFDPSRHAERYPHPPAVCSGKRERCIIEKENNFKEPGERYRSWTPDRQERFVRRWVDALS  307

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            + RVTHEIRS WISY +QADRSLGQK+AS LN+RP++
Sbjct  308  DTRVTHEIRSIWISYWSQADRSLGQKLASHLNVRPSI  344



>dbj|BAJ33995.1| unnamed protein product [Thellungiella halophila]
Length=492

 Score =   255 bits (651),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 144/157 (92%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY+ LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE++PTP  + +G+R++C+IEKENNFK+PG+RYRS+AP+RQ+RFI RW+++LS
Sbjct  396  RYDPVRHAEKYPTPPAVCSGKRERCIIEKENNFKEPGERYRSFAPERQERFIRRWIEALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  456  DPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_006412153.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
 gb|ESQ53606.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
Length=492

 Score =   255 bits (651),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 144/157 (92%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY+ LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE++PTP  + +G+R++C+IEKENNFK+PG+RYRS+AP+RQ+RFI RW+++LS
Sbjct  396  RYDPVRHAEKYPTPPAVCSGKRERCIIEKENNFKEPGERYRSFAPERQERFIRRWIEALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  456  DPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|AGE15298.2| catalase 1 [Eriobotrya japonica]
Length=492

 Score =   255 bits (651),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY+ LPVNAPKC++HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRIFSYADTQRHRLGPNYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++   R+AE FP P  I+TG+RDKCVIEKENNFKQPG+RYRSWAPDRQ+RF++RWV  LS
Sbjct  396  RYQPARHAETFPIPSSIITGKRDKCVIEKENNFKQPGERYRSWAPDRQERFLHRWVDVLS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            E RVT+EIRS WISY +QADRS GQK+A+RLN+RP++
Sbjct  456  ESRVTYEIRSIWISYWSQADRSFGQKLATRLNVRPSI  492



>gb|AJE26131.1| catalase [Salix matsudana]
Length=492

 Score =   255 bits (651),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+Y+DT RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE FP P  + +G+R+KC+IEKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS
Sbjct  396  RYDPVRHAESFPIPPAVCSGKREKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PR THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  456  DPRATHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_003631925.1| PREDICTED: catalase isozyme 1-like [Vitis vinifera]
Length=492

 Score =   255 bits (651),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            ++DKMLQ R FAY+DT RHRLGPNY+ LPVNAPKCA+HNN +DG MNF+HRDEEVDYFPS
Sbjct  336  TNDKMLQGRIFAYSDTQRHRLGPNYLQLPVNAPKCAFHNNHHDGSMNFMHRDEEVDYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            +FD  R+AE FP P  I  G+R+K VIEKENNFKQPG+RYRS+APDRQ+RFINRWV++LS
Sbjct  396  RFDPVRHAETFPIPSTICHGKREKVVIEKENNFKQPGERYRSFAPDRQERFINRWVETLS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRP  266
            +PRVT+EIRS WISY +QADRSLGQK+ASRLN++P
Sbjct  456  DPRVTYEIRSIWISYWSQADRSLGQKLASRLNVKP  490



>ref|XP_009792372.1| PREDICTED: catalase isozyme 1 [Nicotiana sylvestris]
Length=492

 Score =   255 bits (651),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            S+DK+LQ R FAYADT RHR+GPNYM LPVNAPKCA+HNN  DG MNF+HRDEEVDY PS
Sbjct  336  SEDKLLQTRIFAYADTQRHRIGPNYMQLPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            +FD  R+AE++P P R++TGRR+ CVIEKENNFKQ G+RYRSW PDRQDR++++WV+ LS
Sbjct  396  RFDPCRHAEQYPIPSRVLTGRREMCVIEKENNFKQAGERYRSWEPDRQDRYVSKWVEHLS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVT+EIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  456  DPRVTYEIRSIWISYLSQADKSCGQKVASRLTLKPTM  492



>ref|NP_001268098.1| catalase [Vitis vinifera]
 gb|AAL83720.1|AF236127_1 catalase [Vitis vinifera]
Length=492

 Score =   255 bits (651),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            ++DKMLQ R FAY+DT RHRLGPNY+ LPVNAPKCA+HNN +DG MNF+HRDEEVDYFPS
Sbjct  336  TNDKMLQGRIFAYSDTQRHRLGPNYLQLPVNAPKCAFHNNHHDGSMNFMHRDEEVDYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            +FD  R+AE FP P  I  G+R+K VIEKENNFKQPG+RYRS+APDRQ+RFINRWV++LS
Sbjct  396  RFDPVRHAETFPIPSTICHGKREKVVIEKENNFKQPGERYRSFAPDRQERFINRWVETLS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRP  266
            +PRVT+EIRS WISY +QADRSLGQK+ASRLN++P
Sbjct  456  DPRVTYEIRSIWISYWSQADRSLGQKLASRLNVKP  490



>sp|P49319.2|CATA1_TOBAC RecName: Full=Catalase isozyme 1; AltName: Full=Salicylic acid-binding 
protein; Short=SABP [Nicotiana tabacum]
 gb|AAA57552.1| catalase [Nicotiana tabacum]
Length=492

 Score =   254 bits (650),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            S+DK+LQ R FAYADT RHR+GPNYM LPVNAPKCA+HNN  DG MNF+HRDEEVDY PS
Sbjct  336  SEDKLLQTRIFAYADTQRHRIGPNYMQLPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            +FD  R+AE++P P R++TGRR+ CVIEKENNFKQ G+RYRSW PDRQDR++++WV+ LS
Sbjct  396  RFDPCRHAEQYPIPSRVLTGRREMCVIEKENNFKQAGERYRSWEPDRQDRYVSKWVEHLS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVT+EIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  456  DPRVTYEIRSIWISYLSQADKSCGQKVASRLTLKPTM  492



>emb|CAC04509.1| catalase [Digitalis lanata]
Length=265

 Score =   247 bits (631),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+Y+DT RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  109  SDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPS  168

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AERFP P   + G+RD+  IEKENNFKQPG++YRS+ PDRQ+RFI RWV +LS
Sbjct  169  RYDPCRHAERFPHPPVALNGKRDRICIEKENNFKQPGEKYRSFPPDRQERFIKRWVDALS  228

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PR+THEIRS W+SY TQAD+SLGQK+ASRLNIRPTM
Sbjct  229  DPRLTHEIRSIWVSYWTQADKSLGQKLASRLNIRPTM  265



>emb|CDP07288.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   254 bits (649),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            ++DK+LQ R FAY DT RHRLGPNYM LPVNAPKCA+HNN YDG+MNF+HRDEEVDYFPS
Sbjct  336  TEDKLLQTRIFAYGDTQRHRLGPNYMQLPVNAPKCAHHNNHYDGFMNFMHRDEEVDYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            +FD  R+A R P P  ++ G+RD+CVI KENNFKQ G+RYRSWAPDRQ+RFI RWV  LS
Sbjct  396  RFDPVRHAARHPIPSTVLRGKRDRCVIPKENNFKQAGERYRSWAPDRQERFICRWVDILS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            + RVTHEIRS WISY +QAD+SLGQK+A+RLN+RPTM
Sbjct  456  DARVTHEIRSIWISYWSQADKSLGQKMATRLNVRPTM  492



>gb|KJB14250.1| hypothetical protein B456_002G115900 [Gossypium raimondii]
Length=492

 Score =   254 bits (648),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+Y+DT RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEE++YFPS
Sbjct  336  SDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEINYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE FP P  + TGRR+KC+IEKENNFKQPG+RYRSWA DRQ+RFI RWV +LS
Sbjct  396  RYDPVRHAEMFPIPPAVCTGRREKCIIEKENNFKQPGERYRSWAADRQERFICRWVDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHEIRS WISY +QAD+S+GQK+ASRLN+RP++
Sbjct  456  DPRVTHEIRSIWISYWSQADKSVGQKLASRLNVRPSI  492



>ref|XP_004238430.1| PREDICTED: catalase isozyme 3 [Solanum lycopersicum]
Length=492

 Score =   254 bits (648),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY+ LPVNAPKCA+HNN ++G MNF+HRDEEV+Y PS
Sbjct  336  SDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGLMNFMHRDEEVNYLPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            + D  R+AE++P P R++TG+R+K +IEKENNFKQPG+ YRSWAPDRQ+RF+ RWV +LS
Sbjct  396  RLDPCRHAEQYPIPPRVLTGKREKVIIEKENNFKQPGEHYRSWAPDRQERFLCRWVDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PR THEIRS WISY +QAD+SLGQK+ASRLNIRPTM
Sbjct  456  DPRATHEIRSIWISYWSQADKSLGQKLASRLNIRPTM  492



>ref|XP_010530333.1| PREDICTED: catalase-2 [Tarenaya hassleriana]
Length=492

 Score =   254 bits (648),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+Y+DT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AER+P P  I +GRR++C+IEKENNFKQPG+RYRS+ PDRQ+RFI RW+++LS
Sbjct  396  RYDPVRHAERYPIPPVICSGRRERCIIEKENNFKQPGERYRSFTPDRQERFIRRWIEALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  456  DPRITHEIRSIWISYWSQADQSLGQKLASRLNVRPSI  492



>gb|ACV30589.1| catalase [Carica papaya]
Length=170

 Score =   243 bits (620),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 110/158 (70%), Positives = 137/158 (87%), Gaps = 1/158 (1%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R FAY DT RHRLGPN+M LPVNAPKCA+ NN +DGYMNF+HRDEEV+Y PS
Sbjct  13   SDDKLLQCRIFAYDDTQRHRLGPNFMQLPVNAPKCAHRNNHFDGYMNFMHRDEEVNYHPS  72

Query  550  KFDNTRNAERFPTPLRIVTG-RRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSL  374
            KFD   NAER+P P ++ +  +R+KC+IEK+N+FKQPG+RYR++ PDRQ+RFINRWVK+L
Sbjct  73   KFDPVTNAERYPIPTKVYSACKREKCIIEKQNDFKQPGERYRTFEPDRQERFINRWVKAL  132

Query  373  SEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            SEPR+THEIRS WI +L++AD SLG+KVA RLNIRP++
Sbjct  133  SEPRITHEIRSIWIDWLSRADESLGRKVAMRLNIRPSI  170



>gb|AET97564.1| catalase [Ziziphus jujuba]
Length=492

 Score =   254 bits (648),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+Y+DT RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE+ P P  I  G+R+KC+IEKENNFKQPG+RYRSWAPDRQ+RFI RW+ +LS
Sbjct  396  RYDPVRHAEQHPIPSAIFNGKREKCIIEKENNFKQPGERYRSWAPDRQERFIRRWIDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  456  DPRVTHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_006306495.1| hypothetical protein CARUB_v10012481mg [Capsella rubella]
 gb|EOA39393.1| hypothetical protein CARUB_v10012481mg [Capsella rubella]
Length=492

 Score =   253 bits (647),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 134/157 (85%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R FAY DT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PS
Sbjct  336  SDDKLLQCRIFAYGDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            KFD  R AE+ P P    TG R KCVI+KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LS
Sbjct  396  KFDPVRCAEKVPIPTNSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            EPR+THEIR  WISY +QADRSLGQK+ASRLN+RP++
Sbjct  456  EPRLTHEIRGIWISYWSQADRSLGQKLASRLNVRPSI  492



>gb|AAF19965.1|AF207906_1 catalase 1 [Zantedeschia aethiopica]
Length=492

 Score =   253 bits (647),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY++LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRIFSYADTQRHRLGPNYLMLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE+FP P RI+ G R+KC I+KENNFKQPG++YRSWAPDRQ+RFI RW+ +LS
Sbjct  396  RYDPVRHAEQFPIPPRILNGGREKCCIQKENNFKQPGEKYRSWAPDRQERFIKRWIDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHEIR+ WI+Y +Q D+ LGQK+ASRLNI+PT+
Sbjct  456  DPRVTHEIRTIWITYWSQCDKFLGQKLASRLNIKPTL  492



>ref|XP_007160597.1| hypothetical protein PHAVU_001G001000g [Phaseolus vulgaris]
 gb|ESW32591.1| hypothetical protein PHAVU_001G001000g [Phaseolus vulgaris]
Length=492

 Score =   253 bits (647),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YAD+ RHRLGPNY+ +P NAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRIFSYADSQRHRLGPNYLQIPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AER P P RI+ G+R+KC+IEKENNFKQPG+RYRSWA DRQ+RF+ RWV +LS
Sbjct  396  RYDPVRHAERIPVPPRILDGKREKCMIEKENNFKQPGERYRSWASDRQERFLRRWVDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            EPRVTHEIRS WISY +QADRSLGQK+AS LN++P++
Sbjct  456  EPRVTHEIRSIWISYWSQADRSLGQKIASHLNLKPSI  492



>ref|NP_001291326.1| catalase isozyme 1 [Sesamum indicum]
 gb|AFJ42575.1| catalase [Sesamum indicum]
Length=492

 Score =   253 bits (646),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D TR++E +P P  +++G+R+K  IEKENNFKQPG+RYRSWAPDRQ+RFI RWV++LS
Sbjct  396  RYDPTRHSEMYPIPPVVLSGKREKRCIEKENNFKQPGERYRSWAPDRQERFIRRWVEALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PR+THEIRS WISY +QAD+SLGQK+ASRLN+RPTM
Sbjct  456  DPRLTHEIRSIWISYWSQADKSLGQKLASRLNVRPTM  492



>ref|XP_010663966.1| PREDICTED: catalase isozyme 1 [Vitis vinifera]
 emb|CBI40714.3| unnamed protein product [Vitis vinifera]
Length=492

 Score =   253 bits (646),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+Y+DT RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AER+P P  I+TGRR+KC+I KENNFKQPG+RYRS+APDRQ+RFI RWV +LS
Sbjct  396  RYDPVRHAERYPIPPAILTGRREKCIIPKENNFKQPGERYRSFAPDRQERFIQRWVDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVT+EIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  456  DPRVTYEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_007018034.1| Catalase 2 [Theobroma cacao]
 gb|EOY15259.1| Catalase 2 [Theobroma cacao]
Length=492

 Score =   253 bits (646),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEE++YFPS
Sbjct  336  SDDKLLQTRIFSYADTQRHRLGPNYLQLPPNAPKCAHHNNHHEGFMNFMHRDEEINYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AERFP P  + +GRR+KC+IEKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS
Sbjct  396  RYDPVRHAERFPIPPAVCSGRREKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHEIRS WI+Y +QA +SLGQK+ASRLN++P +
Sbjct  456  DPRVTHEIRSIWITYWSQACKSLGQKLASRLNVKPNI  492



>gb|AHF27433.1| catalase [Cucurbita maxima]
Length=492

 Score =   253 bits (646),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 141/158 (89%), Gaps = 1/158 (1%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDKMLQAR FAYADT RHRLGPNY+ LPVNAPKC +HNN ++G+MNF+HRDEEV+YFPS
Sbjct  335  SDDKMLQARSFAYADTQRHRLGPNYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPS  394

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKE-NNFKQPGDRYRSWAPDRQDRFINRWVKSL  374
            ++D  R+AE+FP P  ++TG+R++CVI KE NNFKQ GDRYRSWAPDRQDRF+ R+V++L
Sbjct  395  RYDPCRHAEKFPMPPNVLTGKRERCVIPKENNNFKQAGDRYRSWAPDRQDRFVKRFVEAL  454

Query  373  SEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            S+PRVTHE+R+ WISY +QADRSLGQK+ASRLN+RP +
Sbjct  455  SDPRVTHEVRNIWISYWSQADRSLGQKIASRLNVRPNI  492



>gb|AHF27430.1| catalase [Cucurbita moschata]
Length=492

 Score =   253 bits (646),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 141/158 (89%), Gaps = 1/158 (1%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDKMLQAR FAYADT RHRLGPNY+ LPVNAPKC +HNN ++G+MNF+HRDEEV+YFPS
Sbjct  335  SDDKMLQARSFAYADTQRHRLGPNYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPS  394

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKE-NNFKQPGDRYRSWAPDRQDRFINRWVKSL  374
            ++D  R+AE+FP P  ++TG+R++CVI KE NNFKQ GDRYRSWAPDRQDRF+ R+V++L
Sbjct  395  RYDPCRHAEKFPMPPNVLTGKRERCVIPKENNNFKQAGDRYRSWAPDRQDRFVKRFVEAL  454

Query  373  SEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            S+PRVTHE+R+ WISY +QADRSLGQK+ASRLN+RP +
Sbjct  455  SDPRVTHEVRNIWISYWSQADRSLGQKIASRLNVRPNI  492



>gb|AFU48609.1| catalase 1, partial [Nicotiana benthamiana]
Length=491

 Score =   253 bits (646),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDKMLQ R F+Y+DT R+RLGPNY+ LP NAPKCA+HNN YDG MNF+HRDEE+DYFPS
Sbjct  335  SDDKMLQTRIFSYSDTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPS  394

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE++P P  + TG+R+KCVI+KENNFKQPGDRYRS+ PDRQ+RFI RWV++LS
Sbjct  395  RYDPVRHAEKYPIPSTMCTGKREKCVIQKENNFKQPGDRYRSFTPDRQERFIRRWVEALS  454

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PR+T+EIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  455  DPRITYEIRSIWISYWSQADKSLGQKLASRLNVRPSI  491



>emb|CCP37650.1| catalase-1 [Nicotiana tabacum]
Length=492

 Score =   253 bits (646),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDKMLQ R F+Y+DT R+RLGPNY+ LP NAPKCA+HNN YDG MNF+HRDEE+DYFPS
Sbjct  336  SDDKMLQTRIFSYSDTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE++P P  + TG+R+KCVI+KENNFKQPGDRYRS+ PDRQ+RFI RWV++LS
Sbjct  396  RYDPVRHAEKYPIPSTMCTGKREKCVIQKENNFKQPGDRYRSFTPDRQERFIRRWVEALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PR+T+EIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  456  DPRITYEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|NP_001237556.1| catalase-1/2 [Glycine max]
 sp|P29756.1|CATA1_SOYBN RecName: Full=Catalase-1/2 [Glycine max]
 emb|CAA78056.1| catalase [Glycine max]
 gb|AAB88169.1| catalase [Glycine max]
 gb|AAB88170.1| catalase [Glycine max]
 gb|KHN48523.1| Catalase-1/2 [Glycine soja]
Length=492

 Score =   253 bits (646),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY+ LP NAPKCA+HNN +DG+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRVFSYADTQRHRLGPNYLQLPANAPKCAHHNNHHDGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE+ P P RI+ G+R+KC+IEKENNFKQPG+RYRSW  DRQ+RF+ RWV +LS
Sbjct  396  RYDPVRHAEKVPVPPRILGGKREKCMIEKENNFKQPGERYRSWPSDRQERFVRRWVDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHEIRS WISY +QADRSLGQK+AS LN++P++
Sbjct  456  DPRVTHEIRSIWISYWSQADRSLGQKIASHLNLKPSI  492



>gb|ACL27272.1| catalase [Nicotiana benthamiana]
Length=492

 Score =   253 bits (646),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDKMLQ R F+Y+DT R+RLGPNY+ LP NAPKCA+HNN YDG MNF+HRDEE+DYFPS
Sbjct  336  SDDKMLQTRIFSYSDTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE++P P  + TG+R+KCVI+KENNFKQPGDRYRS+ PDRQ+RFI RWV++LS
Sbjct  396  RYDPVRHAEKYPIPSTMCTGKREKCVIQKENNFKQPGDRYRSFTPDRQERFIRRWVEALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PR+T+EIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  456  DPRITYEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>sp|P49316.1|CATA2_NICPL RecName: Full=Catalase isozyme 2 [Nicotiana plumbaginifolia]
 emb|CAA85425.1| catalase [Nicotiana plumbaginifolia]
Length=492

 Score =   253 bits (645),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            S+DK+LQ R FAYADT RHR+GPNYM LPVNAPKCA+HNN  DG MNF+HRDEEVDY PS
Sbjct  336  SEDKLLQTRIFAYADTQRHRIGPNYMQLPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            +FD  R+AE++P P R++ GRR+ CVIEKENNFKQ G+RYRSW PDRQDR++++WV+ LS
Sbjct  396  RFDPCRHAEQYPIPSRVLNGRREMCVIEKENNFKQAGERYRSWEPDRQDRYVSKWVEHLS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVT+EIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  456  DPRVTYEIRSIWISYLSQADKSCGQKVASRLTLKPTM  492



>ref|XP_006828715.1| hypothetical protein AMTR_s00001p00024160 [Amborella trichopoda]
 gb|ERM96131.1| hypothetical protein AMTR_s00001p00024160 [Amborella trichopoda]
Length=492

 Score =   252 bits (644),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+Y+DT RHRLGPNY++LP NAPKCA+HNN YDG+MNF HRDEEVDYFPS
Sbjct  336  SDDKLLQTRIFSYSDTQRHRLGPNYLMLPANAPKCAHHNNHYDGFMNFAHRDEEVDYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            +FD  R+AE+FP P +I +G+R+KC+IEKENNFKQPG+RYRS+A DRQ+RFI RWV +LS
Sbjct  396  RFDPVRHAEKFPMPPQICSGKREKCMIEKENNFKQPGERYRSFAIDRQERFIKRWVDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHEI S WISY +Q D+SLGQK+A+ LN++P M
Sbjct  456  DPRVTHEILSIWISYWSQCDKSLGQKLATHLNLKPNM  492



>ref|XP_002867092.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43351.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. 
lyrata]
Length=492

 Score =   252 bits (644),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 143/157 (91%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE++PTP  + +G+R++C+IEKENNFK+PG+RYRS+ P+RQ+RFI RW+++LS
Sbjct  396  RYDPVRHAEKYPTPPAVCSGKRERCIIEKENNFKEPGERYRSFTPERQERFIQRWIEALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  456  DPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|ACV92695.1| catalase [Brassica oleracea]
Length=492

 Score =   252 bits (644),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE++PTP  + +G+R++CVIEKENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS
Sbjct  396  RYDPVRHAEKYPTPPAVCSGKRERCVIEKENNFKEPGERYRSFTPERQERFIGRWIDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  456  DPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_006435363.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|ESR48603.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|KDO85096.1| hypothetical protein CISIN_1g042356mg [Citrus sinensis]
Length=492

 Score =   252 bits (644),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            S+DK+LQ R F+YADT RHRLGPNY+ LPVNAPKCA HNN YDG+MNF+HRDEE+DYFPS
Sbjct  336  SNDKLLQTRIFSYADTQRHRLGPNYLQLPVNAPKCAQHNNHYDGFMNFMHRDEEIDYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE  PTP  I  GRR+KC+I KENNFKQPG+RYRSWAPDRQ+RFI RWV +LS
Sbjct  396  RYDPVRHAEMHPTPPEICGGRREKCIIPKENNFKQPGERYRSWAPDRQERFICRWVDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHEIR  WISY +QA +SLGQK+ASRLN+RP +
Sbjct  456  DPRVTHEIRHIWISYWSQACKSLGQKLASRLNVRPNI  492



>ref|XP_006473794.1| PREDICTED: catalase isozyme 1-like isoform X4 [Citrus sinensis]
Length=492

 Score =   252 bits (644),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            S+DK+LQ R F+YADT RHRLGPNY+ LPVNAPKCA HNN YDG+MNF+HRDEE+DYFPS
Sbjct  336  SNDKLLQTRIFSYADTQRHRLGPNYLQLPVNAPKCAQHNNHYDGFMNFMHRDEEIDYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE  PTP  I  GRR+KC+I KENNFKQPG+RYRSWAPDRQ+RFI RWV +LS
Sbjct  396  RYDPVRHAEMHPTPPEICGGRREKCIIPKENNFKQPGERYRSWAPDRQERFICRWVDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHEIR  WISY +QA +SLGQK+ASRLN+RP +
Sbjct  456  DPRVTHEIRHIWISYWSQACKSLGQKLASRLNVRPNI  492



>gb|AAB62892.1| catalase-1 [Nicotiana glutinosa]
Length=492

 Score =   252 bits (644),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDKMLQ R F+Y+DT R+RLGPNY+ LP NAPKCA+HNN YDG MNF+HRDEE+DYFPS
Sbjct  336  SDDKMLQTRIFSYSDTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE++P P  + TG+R+KCVI KENNFKQPG+RYRS+ PDRQ+RFI RWV++LS
Sbjct  396  RYDPVRHAEKYPIPSTMCTGKREKCVILKENNFKQPGERYRSFTPDRQERFIRRWVEALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  456  DPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>emb|CDX76313.1| BnaA08g10870D [Brassica napus]
Length=477

 Score =   252 bits (643),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 143/157 (91%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  321  SDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPS  380

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE++PTP  + +G+R++CVIEKENNFK+PG+RYRS+ P+RQ+RFI RW+++LS
Sbjct  381  RYDPVRHAEKYPTPPAVCSGKRERCVIEKENNFKEPGERYRSFTPERQERFIRRWIEALS  440

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PR+THEIRS WISY +QAD++LGQK+ASRLN+RP++
Sbjct  441  DPRITHEIRSIWISYWSQADKTLGQKLASRLNVRPSI  477



>gb|AAD30292.1|AF139539_1 catalase 3 [Raphanus sativus]
Length=492

 Score =   252 bits (644),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R FAY DT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PS
Sbjct  336  SDDKLLQCRIFAYGDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            KFD  R AE+ P P +  TG R KC+I+KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LS
Sbjct  396  KFDPVRCAEKVPIPNKSYTGIRTKCIIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            EPR+THEIRS WISY +QAD SLGQK+ASRLN+RP++
Sbjct  456  EPRLTHEIRSIWISYWSQADASLGQKLASRLNVRPSI  492



>emb|CAA64220.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   252 bits (644),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE++PTP  + +G+R++CVIEKENNFK+PG+RYR++ P+RQ+RFI RW+ +LS
Sbjct  396  RYDQVRHAEKYPTPPAVCSGKRERCVIEKENNFKEPGERYRTFTPERQERFIQRWIDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  456  DPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|AFU90822.1| catalase, partial [Populus tomentosa]
Length=487

 Score =   252 bits (643),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 111/153 (73%), Positives = 136/153 (89%), Gaps = 0/153 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  335  SDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPS  394

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE FP P  + +G+R+KC+IEKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS
Sbjct  395  RYDPVRHAESFPIPPAVCSGKREKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALS  454

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNI  272
            +PRVTHEIRS WISY +QAD+SLGQK+ASRLN+
Sbjct  455  DPRVTHEIRSIWISYWSQADKSLGQKLASRLNV  487



>ref|XP_006473791.1| PREDICTED: catalase isozyme 1-like isoform X1 [Citrus sinensis]
 ref|XP_006473792.1| PREDICTED: catalase isozyme 1-like isoform X2 [Citrus sinensis]
 ref|XP_006473793.1| PREDICTED: catalase isozyme 1-like isoform X3 [Citrus sinensis]
Length=512

 Score =   253 bits (645),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            S+DK+LQ R F+YADT RHRLGPNY+ LPVNAPKCA HNN YDG+MNF+HRDEE+DYFPS
Sbjct  356  SNDKLLQTRIFSYADTQRHRLGPNYLQLPVNAPKCAQHNNHYDGFMNFMHRDEEIDYFPS  415

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE  PTP  I  GRR+KC+I KENNFKQPG+RYRSWAPDRQ+RFI RWV +LS
Sbjct  416  RYDPVRHAEMHPTPPEICGGRREKCIIPKENNFKQPGERYRSWAPDRQERFICRWVDALS  475

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHEIR  WISY +QA +SLGQK+ASRLN+RP +
Sbjct  476  DPRVTHEIRHIWISYWSQACKSLGQKLASRLNVRPNI  512



>ref|XP_010941422.1| PREDICTED: catalase isozyme B [Elaeis guineensis]
Length=492

 Score =   252 bits (643),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY++LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRVFSYADTQRHRLGPNYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AERFP P R++TG+R+KCVI KENNFKQPG+RYRS+ P RQ+RF++RWV++LS
Sbjct  396  RYDPVRHAERFPLPPRVLTGKREKCVIGKENNFKQPGERYRSFDPARQERFVHRWVEALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            + RVTHEIR  WI+Y +Q D+SLGQK+A+RLN+RP+M
Sbjct  456  DTRVTHEIRGIWITYWSQCDKSLGQKLATRLNMRPSM  492



>gb|AAB86582.2| catalase [Raphanus sativus]
Length=491

 Score =   252 bits (643),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  335  SDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPS  394

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE++PTP  + +G+R++C+IEKENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS
Sbjct  395  RYDPVRHAEKYPTPPAVCSGKRERCIIEKENNFKEPGERYRSFTPERQERFIGRWIDALS  454

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  455  DPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  491



>ref|XP_006283612.1| hypothetical protein CARUB_v10004668mg [Capsella rubella]
 gb|EOA16510.1| hypothetical protein CARUB_v10004668mg [Capsella rubella]
Length=492

 Score =   252 bits (643),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 143/157 (91%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE++PTP  + +G+R++CVIEKENNFK+PG+RYRS+ P+RQ+RFI RW+++LS
Sbjct  396  RYDPVRHAEKYPTPPAVCSGKRERCVIEKENNFKEPGERYRSFPPERQERFIRRWIEALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  456  DPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|AAF71742.1|AF248491_1 catalase [Raphanus sativus]
Length=492

 Score =   252 bits (643),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE++PTP  + +G+R++C+IEKENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS
Sbjct  396  RYDPVRHAEKYPTPPAVCSGKRERCIIEKENNFKEPGERYRSFTPERQERFIGRWIDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  456  DPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|AAB71764.1| catalase 1 [Nicotiana tabacum]
Length=492

 Score =   252 bits (643),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDKMLQ R F+Y+DT R+RLGPNY+ LP NAPKCA+HNN YDG MNF+HRDEE+DYFPS
Sbjct  336  SDDKMLQTRIFSYSDTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE++P P  + TG+R+KCVI+KENNFKQPGDRYRS+ PDRQ+RFI RWV++LS
Sbjct  396  RYDPVRHAEKYPIPSTMCTGKREKCVIQKENNFKQPGDRYRSFTPDRQERFIRRWVEALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PR+T+EIR+ WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  456  DPRITYEIRTIWISYWSQADKSLGQKLASRLNVRPSI  492



>sp|P49315.1|CATA1_NICPL RecName: Full=Catalase isozyme 1, partial [Nicotiana plumbaginifolia]
 emb|CAA85424.1| catalase [Nicotiana plumbaginifolia]
Length=485

 Score =   252 bits (643),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDKMLQ R F+Y+DT R+RLGPNY+ LP NAPKCA+HNN YDG MNF+HRDEE+DYFPS
Sbjct  329  SDDKMLQTRIFSYSDTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPS  388

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE++P P  + TG+R+KCVI+KENNFKQPG+RYRS+ PDRQ+RFI RWV++LS
Sbjct  389  RYDPVRHAEKYPIPSTMCTGKREKCVIQKENNFKQPGERYRSFTPDRQERFIRRWVETLS  448

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PR+T+EIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  449  DPRITYEIRSIWISYWSQADKSLGQKLASRLNVRPSI  485



>dbj|BAQ21275.1| catalase [Citrus tamurana]
Length=476

 Score =   251 bits (642),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 136/157 (87%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            S+DK+LQ R F+YADT RHRLGPNY+ LPVNAPKCA+HNN YDG+MNF+HRDEE+DYFPS
Sbjct  320  SNDKLLQTRIFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHYDGFMNFMHRDEEIDYFPS  379

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE  PTP  I  GRR+KC+I KENNFKQPG+RYRSWAPDRQ+RF+ RWV +LS
Sbjct  380  RYDPVRHAEMHPTPPEICGGRREKCIIPKENNFKQPGERYRSWAPDRQERFVCRWVDALS  439

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHEIR  WISY +QA +SLGQK+ +RLN+RP++
Sbjct  440  DPRVTHEIRHIWISYWSQACKSLGQKLTARLNVRPSI  476



>gb|ABM47415.1| catalase [Prunus avium]
Length=492

 Score =   252 bits (643),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R FAY+DT RHRLGPNYM LPVNAPKC +HNN  DG+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRIFAYSDTQRHRLGPNYMQLPVNAPKCPHHNNHQDGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AERFP P  I+TG+R++ VIEKENNFKQPG+RYRSWAPDRQ+RFI R V +LS
Sbjct  396  RYDPVRHAERFPIPSNILTGKRERRVIEKENNFKQPGERYRSWAPDRQERFIRRCVDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRV+HEIRS WISY +QAD+SLGQK+A+RLN+RP++
Sbjct  456  DPRVSHEIRSIWISYWSQADKSLGQKIATRLNVRPSI  492



>gb|AFU90823.1| catalase, partial [Populus x beijingensis]
Length=446

 Score =   251 bits (640),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 110/153 (72%), Positives = 136/153 (89%), Gaps = 0/153 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  294  SDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPS  353

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE FP P  + +G+R++C+IEKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS
Sbjct  354  RYDPVRHAESFPIPPAVCSGKRERCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALS  413

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNI  272
            +PRVTHEIRS WISY +QAD+SLGQK+ASRLN+
Sbjct  414  DPRVTHEIRSIWISYWSQADKSLGQKLASRLNV  446



>emb|CAA45564.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   252 bits (643),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 106/157 (68%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE++PTP  + +G+R++C+IEKENNFK+PG+RYR++ P+RQ+RFI RW+ +LS
Sbjct  396  RYDQVRHAEKYPTPPAVCSGKRERCIIEKENNFKEPGERYRTFTPERQERFIQRWIDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  456  DPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>prf||1906388A catalase
Length=492

 Score =   252 bits (643),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 106/157 (68%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE++PTP  + +G+R++C+IEKENNFK+PG+RYR++ P+RQ+RFI RW+ +LS
Sbjct  396  RYDQVRHAEKYPTPPAVCSGKRERCIIEKENNFKEPGERYRTFTPERQERFIQRWIDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  456  DPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_008452956.1| PREDICTED: catalase isozyme 1 [Cucumis melo]
Length=492

 Score =   251 bits (642),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+Y+DT RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            +FD  R+AER+P P  + TG+R++CVI+KENNFK+PG+RYRSW PDRQ+RFI RWV +LS
Sbjct  396  RFDPARHAERYPHPPAVCTGKRERCVIQKENNFKEPGERYRSWTPDRQERFIRRWVDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHEIRS WISY +QADRS+GQK+AS LN+RP++
Sbjct  456  DPRVTHEIRSIWISYWSQADRSVGQKLASHLNVRPSI  492



>gb|AAD30291.2|AF139538_1 catalase 2 [Raphanus sativus]
Length=492

 Score =   251 bits (642),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R FAY DT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PS
Sbjct  336  SDDKLLQCRIFAYGDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            KFD  R AE+ P P +  TG R KCVI+KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LS
Sbjct  396  KFDPVRCAEKVPIPSKSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            E R+THEIRS WISY +QADRSLGQK+ASRLN+RP++
Sbjct  456  ELRLTHEIRSIWISYWSQADRSLGQKLASRLNVRPSI  492



>ref|NP_195235.1| catalase 2 [Arabidopsis thaliana]
 sp|P25819.3|CATA2_ARATH RecName: Full=Catalase-2 [Arabidopsis thaliana]
 emb|CAA17773.1| catalase [Arabidopsis thaliana]
 emb|CAB80226.1| catalase [Arabidopsis thaliana]
 gb|AAL66998.1| putative catalase [Arabidopsis thaliana]
 gb|AAM44902.1| putative catalase [Arabidopsis thaliana]
 gb|AEE86462.1| catalase 2 [Arabidopsis thaliana]
Length=492

 Score =   251 bits (642),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 106/157 (68%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE++PTP  + +G+R++C+IEKENNFK+PG+RYR++ P+RQ+RFI RW+ +LS
Sbjct  396  RYDQVRHAEKYPTPPAVCSGKRERCIIEKENNFKEPGERYRTFTPERQERFIQRWIDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  456  DPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>sp|P17598.2|CATA1_GOSHI RecName: Full=Catalase isozyme 1 [Gossypium hirsutum]
 emb|CAA36380.1| unnamed protein product [Gossypium hirsutum]
Length=492

 Score =   251 bits (642),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+Y+DT RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEE++YFPS
Sbjct  336  SDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEINYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE FP P  + TGRR+KC+IEKENNFKQPG+RYRSWA DRQ+RFI RWV +LS
Sbjct  396  RYDPVRHAEMFPIPPAVCTGRREKCIIEKENNFKQPGERYRSWAADRQERFICRWVDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHEIRS WISY +QAD+S+GQK+AS LN+RP++
Sbjct  456  DPRVTHEIRSIWISYWSQADKSVGQKLASLLNVRPSI  492



>gb|AAD17935.1| catalase [Brassica juncea]
Length=492

 Score =   251 bits (642),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 143/157 (91%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE++PTP  + +G+R++CVIEKENNFK+PG+RYRS+ P+RQ+RFI RW+++LS
Sbjct  396  RYDPVRHAEKYPTPPAVCSGKRERCVIEKENNFKEPGERYRSFTPERQERFIRRWIEALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PR+THEIRS WISY +QAD++LGQK+ASRLN+RP++
Sbjct  456  DPRITHEIRSIWISYWSQADKTLGQKLASRLNVRPSI  492



>gb|AAK96854.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   251 bits (642),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 106/157 (68%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE++PTP  + +G+R++C+IEKENNFK+PG+RYR++ P+RQ+RFI RW+ +LS
Sbjct  396  RYDQVRHAEKYPTPPAVCSGKRERCIIEKENNFKEPGERYRTFTPERQERFIQRWIDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  456  DPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|AIA61608.1| catalase [Gynostemma pentaphyllum]
Length=492

 Score =   251 bits (642),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+Y+DT RHRLGPNY+ LP NAPKC++HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRVFSYSDTQRHRLGPNYLQLPANAPKCSHHNNHHEGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AER+P P  + TG+R++CVI+KENNFKQPG+RYRSWAPDRQ+RFI RWV +LS
Sbjct  396  RYDPARHAERYPHPPAVCTGKRERCVIDKENNFKQPGERYRSWAPDRQERFIRRWVNALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHEIRS WISY +QADRS+GQK+AS LN+RP++
Sbjct  456  DPRVTHEIRSIWISYWSQADRSVGQKLASHLNMRPSI  492



>ref|XP_010934843.1| PREDICTED: catalase isozyme 2 [Elaeis guineensis]
 gb|AFS65099.1| catalase 2 [Elaeis guineensis]
Length=492

 Score =   251 bits (642),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDKMLQ R FAYADT R+RLGPNY++LPVNAPKCA+HNN +DG MNF+ R+EEVDYFPS
Sbjct  336  SDDKMLQCRVFAYADTQRYRLGPNYLMLPVNAPKCAFHNNQFDGLMNFMQRNEEVDYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            + D  R+AERFP P R+VTG+R+K VI K+N+FKQPG+RYRSWAPDRQ+RF+ RW +SL 
Sbjct  396  RHDPLRHAERFPIPSRVVTGKREKIVIPKQNDFKQPGERYRSWAPDRQERFVRRWAESLG  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
             P+V+HE+RS WI+YLTQ D SLGQKVA+RLN++P+M
Sbjct  456  HPKVSHELRSIWITYLTQCDVSLGQKVANRLNVKPSM  492



>ref|XP_006342134.1| PREDICTED: catalase isozyme 3-like [Solanum tuberosum]
Length=492

 Score =   251 bits (642),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            + D  R+AE++P P R++TG+R+K +IEKENNFKQPG+ YRSWAP RQ+RF+ RWV +LS
Sbjct  396  RLDPCRHAEQYPIPPRVLTGKREKVIIEKENNFKQPGEHYRSWAPGRQERFVCRWVDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            + R THEIRS WISY +QAD+SLGQK+ASRLNIRPTM
Sbjct  456  DLRATHEIRSIWISYWSQADKSLGQKLASRLNIRPTM  492



>emb|CDY40645.1| BnaA03g53180D [Brassica napus]
Length=485

 Score =   251 bits (641),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  329  SDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPS  388

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE++PTP  + +G+R++C+IEKENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS
Sbjct  389  RYDPVRHAEKYPTPPAVCSGKRERCIIEKENNFKEPGERYRSFTPERQERFIGRWIDALS  448

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP +
Sbjct  449  DPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPNI  485



>ref|XP_009138342.1| PREDICTED: catalase-2 [Brassica rapa]
 gb|AAD17934.1| catalase [Brassica juncea]
Length=492

 Score =   251 bits (641),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE++PTP  + +G+R++C+IEKENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS
Sbjct  396  RYDPVRHAEKYPTPPAVCSGKRERCIIEKENNFKEPGERYRSFTPERQERFIGRWIDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP +
Sbjct  456  DPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPNI  492



>gb|AAG43363.1|AF151368_1 catalase [Hevea brasiliensis]
Length=492

 Score =   251 bits (641),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            S+DK+LQ R F+Y+DT RHRLG NY+ LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS
Sbjct  336  SEDKLLQTRIFSYSDTQRHRLGSNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            + D  R++ERFP P  I +GRRDKCVIEKENNF+QPG+RYRSWAPDRQ+RF+NR V  LS
Sbjct  396  RCDPVRHSERFPIPSTICSGRRDKCVIEKENNFEQPGERYRSWAPDRQERFLNRMVGCLS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PR+THE+RS WISY TQ DRSLGQK+A RLN+RP++
Sbjct  456  DPRITHELRSIWISYWTQCDRSLGQKLAFRLNVRPSI  492



>ref|XP_008791900.1| PREDICTED: catalase isozyme 2 [Phoenix dactylifera]
Length=492

 Score =   251 bits (641),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDKMLQ R FAYADT R+RLGPNY++LPVNAPKCA+HNN +DG MNF+ R+EEVDYFPS
Sbjct  336  SDDKMLQCRVFAYADTQRYRLGPNYLMLPVNAPKCAFHNNQFDGLMNFMQRNEEVDYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            + D  R+AERFP P R+VTG+R+K VI K+N+FKQPG+RYRSWAPDRQ+RF+ RW +SL 
Sbjct  396  RHDPLRHAERFPIPSRVVTGKREKTVIPKQNDFKQPGERYRSWAPDRQERFVRRWAESLG  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
             P+V+HE+RS WI+YLTQ D SLGQKVA+RLN++P+M
Sbjct  456  HPKVSHELRSIWITYLTQCDVSLGQKVANRLNVKPSM  492



>gb|AAD50974.1|AF170272_1 catalase CAT1 [Manihot esculenta]
Length=492

 Score =   251 bits (641),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            S+DK+ Q R FAYADT RHRLGPNY +LPVNAPKCAYHNN YDG+MNF+HRDEEVDYFPS
Sbjct  336  SNDKLFQLRTFAYADTQRHRLGPNYKMLPVNAPKCAYHNNHYDGFMNFMHRDEEVDYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AER P P  I +GRR+KCVIEKENNFKQPG+RYRSWAPDRQ+RF+ R V +LS
Sbjct  396  RYDPVRHAERSPIPNAICSGRREKCVIEKENNFKQPGERYRSWAPDRQERFLCRLVNALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            EPR+T EIRS W+SY ++ D SLGQK+ASRLN+RP +
Sbjct  456  EPRITFEIRSIWVSYWSKCDASLGQKLASRLNVRPNI  492



>gb|KFK30147.1| catalase [Arabis alpina]
Length=492

 Score =   251 bits (641),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE++P P  + +G+R++CVIEKENNFK+PG+RYRS+ P+RQ+RFI RW+++LS
Sbjct  396  RYDTVRHAEKYPAPPAVCSGKRERCVIEKENNFKEPGERYRSFPPERQERFIRRWIEALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  456  DPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>sp|P32290.1|CATA_VIGRR RecName: Full=Catalase [Vigna radiata var. radiata]
 dbj|BAA02755.1| catalase [Vigna radiata var. radiata]
Length=492

 Score =   251 bits (640),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 136/157 (87%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDKMLQ R F+YAD+ RHRLGPNY+LLP NAPK A+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKMLQTRIFSYADSQRHRLGPNYLLLPANAPKSAHHNNHHEGFMNFIHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE+FP P  + +GRR+K  IEKENNFKQ G+R+RSWAPDRQDRFI RWV +LS
Sbjct  396  RYDPVRHAEKFPIPPAVFSGRREKIAIEKENNFKQAGERFRSWAPDRQDRFIRRWVDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHEIRS WISY +QADRSLGQK+AS LN+RP +
Sbjct  456  DPRVTHEIRSVWISYWSQADRSLGQKIASHLNMRPNI  492



>gb|AAD17936.1| catalase [Brassica juncea]
Length=492

 Score =   251 bits (640),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE++PTP  I +G+R++C+IEKENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS
Sbjct  396  RYDPVRHAEKYPTPPAICSGKRERCIIEKENNFKEPGERYRSFTPERQERFIGRWIDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PR+THEIRS WISY +QAD+SLGQK+A+RLN+RP++
Sbjct  456  DPRITHEIRSIWISYWSQADKSLGQKLANRLNVRPSI  492



>ref|XP_004500876.1| PREDICTED: catalase-4-like isoform X1 [Cicer arietinum]
Length=493

 Score =   251 bits (640),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDKMLQ R F+YAD+ RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  337  SDDKMLQTRIFSYADSQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPS  396

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            + D  R+AERFPTP   ++G+R++C+  KENNFKQPG+RYR+WAPDRQDRF  RW+++LS
Sbjct  397  RHDPVRHAERFPTPPAALSGKRERCIRPKENNFKQPGERYRTWAPDRQDRFARRWIEALS  456

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHE+RS WISY +QADRSLGQK+AS LN+RP++
Sbjct  457  DPRVTHEVRSIWISYWSQADRSLGQKIASHLNMRPSI  493



>gb|AAC49807.1| catalase 3 [Arabidopsis thaliana]
 gb|AAC17732.1| catalase 3 [Arabidopsis thaliana]
Length=492

 Score =   251 bits (640),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 133/157 (85%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R FAY DT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PS
Sbjct  336  SDDKLLQCRIFAYGDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            KFD  R AE+ PTP    TG R KCVI+KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LS
Sbjct  396  KFDPVRCAEKVPTPTNSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            EPR+THEIR  W SY  +ADRSLGQK+ASRLN+RP++
Sbjct  456  EPRLTHEIRGIWTSYWLKADRSLGQKLASRLNVRPSI  492



>ref|XP_010523643.1| PREDICTED: catalase-2-like [Tarenaya hassleriana]
Length=492

 Score =   250 bits (639),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+Y+DT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRVFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AER+P P  + +GRR++C+IEKENNFKQPG+RYRS+ PDR++RFI RW+++LS
Sbjct  396  RYDPVRHAERYPVPSVVCSGRRERCIIEKENNFKQPGERYRSFTPDRKERFIRRWIEALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PR+THEIRS WISY +QAD+SLGQK+ASR+N+RP +
Sbjct  456  DPRITHEIRSIWISYWSQADQSLGQKLASRMNVRPNI  492



>ref|XP_004500877.1| PREDICTED: catalase-4-like isoform X2 [Cicer arietinum]
Length=492

 Score =   250 bits (639),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDKMLQ R F+YAD+ RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKMLQTRIFSYADSQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            + D  R+AERFPTP   ++G+R++C+  KENNFKQPG+RYR+WAPDRQDRF  RW+++LS
Sbjct  396  RHDPVRHAERFPTPPAALSGKRERCIRPKENNFKQPGERYRTWAPDRQDRFARRWIEALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHE+RS WISY +QADRSLGQK+AS LN+RP++
Sbjct  456  DPRVTHEVRSIWISYWSQADRSLGQKIASHLNMRPSI  492



>gb|ACA50528.1| putative catalase 2 [Brassica napus]
Length=492

 Score =   250 bits (639),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE++PTP  + +G+R++C+IEKENNF+QPG+RYRSW  DRQ+RF+ R+V++L+
Sbjct  396  RYDPVRHAEKYPTPPAVCSGKRERCIIEKENNFQQPGERYRSWDADRQERFVKRFVEALA  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRP  266
            EPRVTHEIRS WISY TQAD+SLGQK+ASRLN+RP
Sbjct  456  EPRVTHEIRSIWISYWTQADKSLGQKLASRLNVRP  490



>emb|CDY17510.1| BnaC03g65530D [Brassica napus]
Length=477

 Score =   250 bits (638),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 106/157 (68%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  321  SDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPS  380

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE++PTP  + +G+R++CVIEKENNFK+PG+RYRS+ P+RQ+RFI RW+++LS
Sbjct  381  RYDPVRHAEKYPTPPAVCSGKRERCVIEKENNFKEPGERYRSFTPERQERFIRRWIEALS  440

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PR+THEIRS WISY +QAD++LGQK+AS LN+RP++
Sbjct  441  DPRITHEIRSIWISYWSQADKTLGQKLASHLNVRPSI  477



>emb|CDX72514.1| BnaC07g45360D [Brassica napus]
Length=480

 Score =   250 bits (638),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY+ LPVNAPKCA+HNN ++G+MN +HRDEEV+YFPS
Sbjct  324  SDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNVMHRDEEVNYFPS  383

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE++PTP  + +G+R++CVIEKENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS
Sbjct  384  RYDPVRHAEKYPTPPAVCSGKRERCVIEKENNFKEPGERYRSFTPERQERFIGRWIDALS  443

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  444  DPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  480



>sp|P48350.1|CATA1_CUCPE RecName: Full=Catalase isozyme 1 [Cucurbita pepo]
 dbj|BAA09506.1| catalase [Cucurbita pepo]
Length=492

 Score =   250 bits (639),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            +FD +R+AER+P P  + +G+R++C+IEKENNFK+PG+RYRSW PDRQ+RF+ RWV +LS
Sbjct  396  RFDPSRHAERYPHPPAVCSGKRERCIIEKENNFKEPGERYRSWTPDRQERFVRRWVDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            + RVTHEIRS WISY +QADRSLGQK+AS LN+RP++
Sbjct  456  DTRVTHEIRSIWISYWSQADRSLGQKLASHLNVRPSI  492



>ref|XP_011074090.1| PREDICTED: catalase isoform X1 [Sesamum indicum]
Length=513

 Score =   251 bits (640),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            S+DKMLQ R FAYADT RHR+GPNY+ LPVNAPKC +HNN +DG MNF+HRDEEV+YFPS
Sbjct  357  SNDKMLQTRIFAYADTQRHRIGPNYLQLPVNAPKCPHHNNHHDGAMNFMHRDEEVNYFPS  416

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE+FP P  +++G+R K VIEKENNFKQPGDRYRSWAPDRQ+RFI RW+ +LS
Sbjct  417  RYDPCRHAEKFPIPPVVLSGQRVKTVIEKENNFKQPGDRYRSWAPDRQERFIRRWIDALS  476

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PR+T EIRS W+SY TQAD+SLGQK+ASRLN+RP M
Sbjct  477  DPRLTAEIRSIWVSYWTQADKSLGQKLASRLNVRPAM  513



>gb|AAC48918.1| salicylic acid binding catalase, partial [Nicotiana tabacum]
Length=489

 Score =   250 bits (638),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 136/157 (87%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            S+DK+LQ R FAYADT RHR+GPNYM LPVNAPKCA+HNN  DG MNF+HRDEEVDY PS
Sbjct  333  SEDKLLQTRIFAYADTQRHRIGPNYMQLPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPS  392

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            +FD  R+AE++P P R++TGRR+ CVIEKENNFKQ G+RYRSW PDRQDR++++WV+ LS
Sbjct  393  RFDPCRHAEQYPIPSRVLTGRREMCVIEKENNFKQAGERYRSWEPDRQDRYVSKWVEHLS  452

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVT+EIRS WI  L+QAD+S GQKVASRL ++PTM
Sbjct  453  DPRVTYEIRSIWICSLSQADKSCGQKVASRLTLKPTM  489



>sp|P45739.1|CATA_HELAN RecName: Full=Catalase [Helianthus annuus]
 gb|AAA69866.1| catalase [Helianthus annuus]
Length=492

 Score =   250 bits (638),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+Y+DT RHRLGPNY+ LP NAPKCA+HNN YDG+MNF+HRDEE+DYFPS
Sbjct  336  SDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCAHHNNHYDGFMNFMHRDEEIDYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE++P P   ++G+RDKCVIEKENNFKQPG+RYRS++PDRQ+RFINR V  LS
Sbjct  396  RYDPARHAEQYPIPPVRLSGKRDKCVIEKENNFKQPGERYRSFSPDRQERFINRVVGGLS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRP  266
            +PRVTHE+RS W+SY +QAD+SLGQK+ASRLN++P
Sbjct  456  DPRVTHEVRSIWVSYWSQADKSLGQKIASRLNVKP  490



>prf||2104177A catalase
Length=492

 Score =   250 bits (638),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+Y+DT RHRLGPNY+ LP NAPKCA+HNN YDG+MNF+HRDEE+DYFPS
Sbjct  336  SDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCAHHNNHYDGFMNFMHRDEEIDYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE++P P   ++G+RDKCVIEKENNFKQPG+RYRS++PDRQ+RFINR V  LS
Sbjct  396  RYDPARHAEQYPIPPVRLSGKRDKCVIEKENNFKQPGERYRSFSPDRQERFINRVVGGLS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRP  266
            +PRVTHE+RS W+SY +QAD+SLGQK+ASRLN++P
Sbjct  456  DPRVTHEVRSIWVSYWSQADKSLGQKIASRLNVKP  490



>ref|XP_009794245.1| PREDICTED: catalase isozyme 1 [Nicotiana sylvestris]
Length=492

 Score =   250 bits (638),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDKMLQ R F+Y+DT R+RLGPNY+ LP NAPKCA+HNN YDG MNF+HRDEE+DYFPS
Sbjct  336  SDDKMLQTRIFSYSDTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE++P P  + TG+R+KCVI+KENNFKQ GDRYRS+ PDRQ+RFI RWV++LS
Sbjct  396  RYDPVRHAEKYPIPSTMCTGKREKCVIQKENNFKQAGDRYRSFTPDRQERFIRRWVEALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PR+T+EIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  456  DPRITYEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_006382992.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60789.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=490

 Score =   250 bits (638),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  334  SDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPS  393

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            +FD  R+AER+P P  I TG+R+KC+IEKENNFKQPG+RYRS++PDR++RF+ RWV++LS
Sbjct  394  RFDPVRHAERYPNPSVIHTGKREKCIIEKENNFKQPGERYRSFSPDRKERFVRRWVEALS  453

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVT+EIRS WISY +QAD+SLGQK+AS LN+RP++
Sbjct  454  DPRVTYEIRSIWISYWSQADKSLGQKLASHLNMRPSI  490



>ref|NP_001235974.1| catalase-3 [Glycine max]
 sp|O48560.1|CATA3_SOYBN RecName: Full=Catalase-3 [Glycine max]
 gb|AAB88171.1| catalase [Glycine max]
 gb|KHN12602.1| Catalase-3 [Glycine soja]
Length=492

 Score =   250 bits (638),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY+ LP N+PKCA+HNN +DG+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRIFSYADTQRHRLGPNYLQLPANSPKCAHHNNHHDGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AER P P R + G+R+KC+IEKENNFKQPG+RYRSW  DRQ+RF+ RWV +LS
Sbjct  396  RYDPVRHAERVPVPPRTLGGKREKCMIEKENNFKQPGERYRSWPSDRQERFVRRWVDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHEIRS WISY +QADRSLGQK+AS LN++P++
Sbjct  456  DPRVTHEIRSIWISYWSQADRSLGQKIASHLNLKPSI  492



>gb|ACJ73906.1| CAT2 [Solanum nigrum]
Length=315

 Score =   244 bits (624),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 131/157 (83%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            S+DK+LQ R FAYADT RHR+GPNYM LPVNAPKCA+HNNS DG MNF+HRDEEVDY PS
Sbjct  159  SEDKLLQTRIFAYADTQRHRIGPNYMQLPVNAPKCAHHNNSRDGAMNFMHRDEEVDYLPS  218

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            +FD  R AE++P P  ++ G R  CV  KENNFKQ G+RYRSW PDRQDR+IN+WV+SLS
Sbjct  219  RFDPCRPAEQYPIPSCVLNGPRTMCVTPKENNFKQAGERYRSWEPDRQDRYINKWVESLS  278

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHEI S WISYL+QAD+S GQKVASRL ++P M
Sbjct  279  DPRVTHEIPSIWISYLSQADKSCGQKVASRLTVKPPM  315



>ref|XP_002306427.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382993.1| catalase family protein [Populus trichocarpa]
 emb|CAI43950.1| catalase [Populus deltoides]
 gb|EEE93423.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60790.1| catalase family protein [Populus trichocarpa]
Length=492

 Score =   250 bits (638),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            +FD  R+AER+P P  I TG+R+KC+IEKENNFKQPG+RYRS++PDR++RF+ RWV++LS
Sbjct  396  RFDPVRHAERYPNPSVIHTGKREKCIIEKENNFKQPGERYRSFSPDRKERFVRRWVEALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVT+EIRS WISY +QAD+SLGQK+AS LN+RP++
Sbjct  456  DPRVTYEIRSIWISYWSQADKSLGQKLASHLNMRPSI  492



>gb|EYU30275.1| hypothetical protein MIMGU_mgv1a005250mg [Erythranthe guttata]
Length=492

 Score =   250 bits (638),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDKMLQ R F+Y+D+ RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKMLQTRIFSYSDSQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE+ P P  +++G+RD+C IEKENNFKQPG+RYR+++PDRQ+RFI RWV +LS
Sbjct  396  RYDPCRHAEKHPIPPVVLSGKRDRCCIEKENNFKQPGERYRTFSPDRQERFIRRWVDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PR+THEIRS WISY +QAD+SLGQK+ASRLN+RPTM
Sbjct  456  DPRLTHEIRSIWISYWSQADKSLGQKLASRLNVRPTM  492



>ref|XP_008464839.1| PREDICTED: catalase isozyme 3 [Cucumis melo]
 gb|ADN33988.1| catalase [Cucumis melo subsp. melo]
Length=492

 Score =   250 bits (638),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 111/158 (70%), Positives = 142/158 (90%), Gaps = 1/158 (1%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDKMLQAR FAYADT RHRLGPNY+ LPVNAPKC +HNN ++G+MNF+HRDEEV+YFPS
Sbjct  335  SDDKMLQARSFAYADTQRHRLGPNYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPS  394

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKEN-NFKQPGDRYRSWAPDRQDRFINRWVKSL  374
            ++D  R+AE+FP P  +++G+R++CVI KEN NFKQ GDRYRSWAPDRQ+RF+ R+V++L
Sbjct  395  RYDPCRHAEKFPMPPNVLSGKRERCVIPKENHNFKQAGDRYRSWAPDRQERFVRRFVEAL  454

Query  373  SEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            S+PRVTHE+R+ WISY +QADRSLGQK+ASR+N+RP++
Sbjct  455  SDPRVTHEVRNIWISYWSQADRSLGQKIASRMNVRPSI  492



>ref|XP_009597278.1| PREDICTED: catalase isozyme 1 [Nicotiana tomentosiformis]
 emb|CCP37651.1| catalase-1 [Nicotiana tabacum]
Length=492

 Score =   249 bits (637),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDKMLQ R F+Y+DT R+RLGPNY+ LP NAPKCA+HNN YDG MNF+HRDEE+DYFPS
Sbjct  336  SDDKMLQTRIFSYSDTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE++P P  + TG+R+KCVI+KENNF QPG+RYRS+ PDRQ+RFI RWV++LS
Sbjct  396  RYDPVRHAEKYPIPSTMCTGKREKCVIQKENNFNQPGERYRSFTPDRQERFIRRWVEALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PR+T+EIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  456  DPRITYEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>emb|CDP01803.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   249 bits (637),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY+ LP NAPKCA+HNN +DG+MNF+HRDEEVDYFPS
Sbjct  336  SDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCAHHNNHHDGFMNFMHRDEEVDYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE  P P  ++TGRR+K +I KENNFKQPG+RYRS+APDRQ+RFI RWV +LS
Sbjct  396  RYDPVRHAEMHPIPSAVLTGRREKTIIPKENNFKQPGERYRSFAPDRQERFICRWVDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVT+EIRS WISY +QAD+SLGQK+ASRLNIRP++
Sbjct  456  DPRVTYEIRSIWISYWSQADKSLGQKLASRLNIRPSI  492



>ref|XP_010094556.1| Catalase isozyme 1 [Morus notabilis]
 gb|EXB56310.1| Catalase isozyme 1 [Morus notabilis]
Length=492

 Score =   249 bits (637),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+Y+DT RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HR+EEV+YFPS
Sbjct  336  SDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHREEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AER+P P  I TGRR++ VI+KENNFKQPG+RYRS++PDRQ+RFI RWV +LS
Sbjct  396  RYDPVRHAERYPIPSAICTGRRERTVIDKENNFKQPGERYRSFSPDRQERFIKRWVNALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHEIRS WISY +QADRSLGQK+ASRLN+RP++
Sbjct  456  DPRVTHEIRSIWISYWSQADRSLGQKLASRLNVRPSI  492



>ref|XP_009106100.1| PREDICTED: catalase-2 [Brassica rapa]
Length=492

 Score =   249 bits (637),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 106/157 (68%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY+ LPVN+PKC++HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRVFSYADTQRHRLGPNYLQLPVNSPKCSHHNNHHEGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE++PTP  + +G+R++CVIEKENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS
Sbjct  396  RYDPVRHAEKYPTPPAVCSGKRERCVIEKENNFKEPGERYRSFTPERQERFIGRWIDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP +
Sbjct  456  DPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPNI  492



>sp|P48352.1|CATA3_CUCPE RecName: Full=Catalase isozyme 3 [Cucurbita pepo]
 dbj|BAA09508.1| catalase [Cucurbita pepo]
Length=492

 Score =   249 bits (637),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 113/158 (72%), Positives = 140/158 (89%), Gaps = 1/158 (1%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDKMLQAR FAYADT RHRLGPNY+ LPVNAPKC +HNN ++G+MNF+HRDEEV+YFPS
Sbjct  335  SDDKMLQARSFAYADTQRHRLGPNYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPS  394

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKE-NNFKQPGDRYRSWAPDRQDRFINRWVKSL  374
            ++D  R+AE+FP P  ++TG+R++CVI KE NNFKQ GDRYRSWAPDRQDRF+ R+V++L
Sbjct  395  RYDPCRHAEKFPMPPNVLTGKRERCVIPKENNNFKQAGDRYRSWAPDRQDRFVKRFVEAL  454

Query  373  SEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            S+PRVT E+R+ WISY +QADRSLGQK+ASRLN+RP +
Sbjct  455  SDPRVTDEVRNIWISYWSQADRSLGQKIASRLNVRPNI  492



>ref|XP_010536468.1| PREDICTED: catalase-3-like [Tarenaya hassleriana]
Length=492

 Score =   249 bits (637),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 136/157 (87%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            S DK+LQAR FAY DT R+RLGPNY+ LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS
Sbjct  336  SQDKLLQARIFAYGDTQRYRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            +FD+ R+A ++P P  I +G R KCVIEKENNFKQPGDRYRSWAPDRQ+R+ NRWV++LS
Sbjct  396  RFDSVRHAAKYPIPSAICSGERVKCVIEKENNFKQPGDRYRSWAPDRQERYANRWVEALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            + RVT EIR  WISYL+Q+D+SLG KVA+RLN+RP+ 
Sbjct  456  DARVTDEIRGIWISYLSQSDKSLGMKVANRLNVRPSF  492



>sp|Q01297.2|CATA1_RICCO RecName: Full=Catalase isozyme 1 [Ricinus communis]
 gb|AAB31537.1| catalase 1 [Ricinus communis=castor beans, hypocotyls, Peptide, 
492 aa]
 dbj|BAA04697.1| catalase CAT1 [Ricinus communis]
Length=492

 Score =   249 bits (637),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            S+DK+LQ R F+Y+DT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SEDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            + D  RNAE FP P  I +G+R+KCVIEKENNFKQPG+RYRSWAPDRQ+RF+NR V  LS
Sbjct  396  RCDPARNAESFPVPSAICSGKREKCVIEKENNFKQPGERYRSWAPDRQERFLNRLVGGLS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PR+THE+R+ WISY  Q D+SLGQK+A+RLN++P++
Sbjct  456  DPRITHELRTIWISYWIQCDKSLGQKLATRLNVKPSI  492



>gb|AAD37788.1|AF149283_1 catalase 1 [Phaseolus vulgaris]
Length=428

 Score =   248 bits (632),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YAD+ RHRLGPNY+ +P NAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  277  SDDKLLQTRIFSYADSQRHRLGPNYLQIPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPS  336

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AER P P RI+ G+R+KC+IEKENNFKQPG+RYRSWA DRQ+RF+ RWV +LS
Sbjct  337  RYDPVRHAERIPVPPRILDGKREKCMIEKENNFKQPGERYRSWASDRQERFLRRWVDALS  396

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLN  275
            EPRVTHEIRS WISY +QADRSLGQK+AS LN
Sbjct  397  EPRVTHEIRSIWISYWSQADRSLGQKIASHLN  428



>dbj|BAJ87148.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=302

 Score =   243 bits (621),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 136/157 (87%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY++LPVNAPKCA+HNN +DG MNF+HRDEEV+YFPS
Sbjct  146  SDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCAHHNNHHDGLMNFIHRDEEVNYFPS  205

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            +FD TR+AE++P P R+++G R+KC+I+KENNFKQ G+RYRS+ P RQDRF+ RWV +L+
Sbjct  206  RFDPTRHAEKYPMPPRVLSGCREKCIIDKENNFKQAGERYRSFDPARQDRFLQRWVDALT  265

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            + RVTHEI+S W+SY +Q D SLGQK+ASRL I+P M
Sbjct  266  DARVTHEIQSIWVSYWSQCDASLGQKLASRLKIKPNM  302



>ref|XP_010432341.1| PREDICTED: catalase-2-like [Camelina sativa]
Length=492

 Score =   249 bits (636),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY+ LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE++P P  + +G+R++CVI KENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS
Sbjct  396  RYDQVRHAEKYPAPPAVCSGKRERCVIAKENNFKEPGERYRSFPPERQERFICRWIDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  456  DPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|KGN55499.1| hypothetical protein Csa_4G658590 [Cucumis sativus]
Length=492

 Score =   249 bits (636),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+Y+DT RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AER+P P  + TG+R++CVI+KENNFK+PG+RYRSW PDRQ+RFI RWV +LS
Sbjct  396  RYDPARHAERYPHPPAVCTGKRERCVIQKENNFKEPGERYRSWTPDRQERFIRRWVDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHEIRS WI+Y +QADRS+GQK+AS LN+RP++
Sbjct  456  DPRVTHEIRSIWITYWSQADRSVGQKLASHLNVRPSI  492



>ref|XP_010437527.1| PREDICTED: catalase-2 [Camelina sativa]
Length=492

 Score =   249 bits (636),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY+ LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE++P P  + +G+R++CVI KENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS
Sbjct  396  RYDQVRHAEKYPAPPAVCSGKRERCVIAKENNFKEPGERYRSFPPERQERFICRWIDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  456  DPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>gb|AAR14052.2| catalase [Solanum tuberosum]
Length=475

 Score =   249 bits (635),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDKMLQ R F+Y+DT R+RLGPNY+ LP NAPKCA+HNN YDG MNF+HRDEE+DYFPS
Sbjct  319  SDDKMLQTRIFSYSDTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPS  378

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE +P P  + +G+R+KC+I+KENNFKQPG+RYR++ PDRQ+RFI RWV++LS
Sbjct  379  RYDQVRHAEVYPIPSTVCSGKREKCIIQKENNFKQPGERYRTFTPDRQERFIRRWVEALS  438

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PR+T+EIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  439  DPRITYEIRSIWISYWSQADKSLGQKLASRLNVRPSI  475



>gb|AFW69584.1| catalase1 [Zea mays]
Length=353

 Score =   245 bits (625),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY++LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS
Sbjct  197  SDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPS  256

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            +FD  R+AE+ P P R++TG R+KC+I+KENNFKQ G+RYRS+ P RQDRFI RWV +L+
Sbjct  257  RFDPARHAEKVPIPPRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALT  316

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHE R+ WISY +Q D +LGQK+ASRLN++P+M
Sbjct  317  DPRVTHEHRTIWISYWSQCDAALGQKLASRLNLKPSM  353



>ref|XP_004144240.1| PREDICTED: catalase isozyme 3-like [Cucumis sativus]
Length=483

 Score =   249 bits (635),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 111/158 (70%), Positives = 141/158 (89%), Gaps = 1/158 (1%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDKMLQAR FAYADT RHRLGPNY+ LPVNAPKC +HNN ++G+MNF+HRDEEV+YFPS
Sbjct  326  SDDKMLQARSFAYADTQRHRLGPNYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPS  385

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKEN-NFKQPGDRYRSWAPDRQDRFINRWVKSL  374
            ++D  R+AE+FP P  +++G+R++CVI KEN NFKQ GDRYRSWAPDRQ+RF+ R+V++L
Sbjct  386  RYDPCRHAEKFPMPPNVLSGKRERCVIPKENHNFKQAGDRYRSWAPDRQERFVRRFVEAL  445

Query  373  SEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            S+PRVTHE+R+ WISY +QADRSLGQK+ASR+N+RP +
Sbjct  446  SDPRVTHEVRNIWISYWSQADRSLGQKIASRMNVRPNI  483



>ref|XP_011022275.1| PREDICTED: catalase-like [Populus euphratica]
Length=476

 Score =   249 bits (635),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  320  SDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPS  379

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            +FD  R+AER+P P  I TG+R+KC+IEKENNFKQPG+RYRS++PDR++RF+ RWV++LS
Sbjct  380  RFDPVRHAERYPNPSVIHTGKREKCIIEKENNFKQPGERYRSFSPDRKERFVRRWVEALS  439

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVT+EIRS WISY +QAD+SLGQK+AS LN+RP +
Sbjct  440  DPRVTYEIRSIWISYWSQADKSLGQKLASHLNMRPGI  476



>gb|ADM96039.1| catalase [Cucumis sativus]
Length=492

 Score =   249 bits (636),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 111/158 (70%), Positives = 141/158 (89%), Gaps = 1/158 (1%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDKMLQAR FAYADT RHRLGPNY+ LPVNAPKC +HNN ++G+MNF+HRDEEV+YFPS
Sbjct  335  SDDKMLQARSFAYADTQRHRLGPNYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPS  394

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKEN-NFKQPGDRYRSWAPDRQDRFINRWVKSL  374
            ++D  R+AE+FP P  +++G+R++CVI KEN NFKQ GDRYRSWAPDRQ+RF+ R+V++L
Sbjct  395  RYDPCRHAEKFPMPPNVLSGKRERCVIPKENHNFKQAGDRYRSWAPDRQERFVRRFVEAL  454

Query  373  SEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            S+PRVTHE+R+ WISY +QADRSLGQK+ASR+N+RP +
Sbjct  455  SDPRVTHEVRNIWISYWSQADRSLGQKIASRMNVRPNI  492



>ref|NP_001234186.1| catalase isozyme 2 [Solanum lycopersicum]
 sp|Q9XHH3.1|CATA2_SOLLC RecName: Full=Catalase isozyme 2 [Solanum lycopersicum]
 gb|AAD41256.1| catalase 2 [Solanum lycopersicum]
Length=492

 Score =   249 bits (636),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDKMLQ R F+Y+DT R+RLGPNY+ LP NAPKCA+HNN YDG MNF+HRDEE+DYFPS
Sbjct  336  SDDKMLQTRIFSYSDTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE +P P  + +G+R+KC+I+KENNFKQPG+RYRS+ PDRQ+RFI RWV++LS
Sbjct  396  RYDQVRHAEVYPIPSTVCSGKREKCIIQKENNFKQPGERYRSFTPDRQERFIRRWVEALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PR+T+EIRS WI+Y +QAD+SLGQK+ASRLN+RP++
Sbjct  456  DPRITYEIRSIWITYWSQADKSLGQKLASRLNVRPSI  492



>gb|AHF27429.1| catalase, partial [Cucurbita moschata]
Length=461

 Score =   248 bits (633),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 111/158 (70%), Positives = 140/158 (89%), Gaps = 1/158 (1%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDKMLQAR FAYADT RHRLGPNY+ LPVNAPKC +HNN ++G+MNF+HRDEEV+YFPS
Sbjct  304  SDDKMLQARSFAYADTQRHRLGPNYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPS  363

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKEN-NFKQPGDRYRSWAPDRQDRFINRWVKSL  374
            ++D  R+AE++P P  +++G+R++CVI KEN NFKQ GDRYRSWAPDRQ+RF+NR+V++L
Sbjct  364  RYDACRHAEKYPMPPNVLSGKRERCVIPKENHNFKQAGDRYRSWAPDRQERFVNRFVEAL  423

Query  373  SEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            S+ +VTHE+R+ WISY TQADRSLGQK+ASR+N RP M
Sbjct  424  SDSKVTHEVRNIWISYWTQADRSLGQKIASRMNARPNM  461



>ref|NP_001048861.1| Os03g0131200 [Oryza sativa Japonica Group]
 gb|ABF93810.1| Catalase-1, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF10775.1| Os03g0131200 [Oryza sativa Japonica Group]
 dbj|BAG88238.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89941.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74449.1| hypothetical protein OsI_09857 [Oryza sativa Indica Group]
 gb|EEE58275.1| hypothetical protein OsJ_09293 [Oryza sativa Japonica Group]
Length=492

 Score =   249 bits (635),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 136/157 (87%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+Y+DT RHRLGPNY+LLP NAPKCA+HNN YDG+MNF+HRDEEVDYFPS
Sbjct  336  SDDKLLQTRIFSYSDTQRHRLGPNYLLLPPNAPKCAHHNNHYDGFMNFMHRDEEVDYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  ++A R+P P   +TGRR+K VI KENNFKQPG+RYRSW P RQDRFI RW+ +LS
Sbjct  396  RYDPAKHAPRYPIPSATLTGRREKVVIAKENNFKQPGERYRSWDPARQDRFIKRWIDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PR+THEIRS W+SY +QADRSLGQK+ASRL+ +P+M
Sbjct  456  DPRLTHEIRSIWLSYWSQADRSLGQKLASRLSAKPSM  492



>gb|AHF27432.1| catalase, partial [Cucurbita maxima]
Length=461

 Score =   248 bits (633),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 111/158 (70%), Positives = 140/158 (89%), Gaps = 1/158 (1%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDKMLQAR FAYADT RHRLGPNY+ LPVNAPKC +HNN ++G+MNF+HRDEEV+YFPS
Sbjct  304  SDDKMLQARSFAYADTQRHRLGPNYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPS  363

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKEN-NFKQPGDRYRSWAPDRQDRFINRWVKSL  374
            ++D  R+AE++P P  +++G+R++CVI KEN NFKQ GDRYRSWAPDRQ+RF+NR+V++L
Sbjct  364  RYDACRHAEKYPMPPNVLSGKRERCVIPKENHNFKQAGDRYRSWAPDRQERFVNRFVEAL  423

Query  373  SEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            S+ +VTHE+R+ WISY TQADRSLGQK+ASR+N RP M
Sbjct  424  SDSKVTHEVRNIWISYWTQADRSLGQKIASRMNARPNM  461



>dbj|BAA34205.1| catalase [Oryza sativa Japonica Group]
 gb|AAQ19030.1| catalase [Oryza sativa]
Length=492

 Score =   249 bits (635),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 136/157 (87%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+Y+DT RHRLGPNY+LLP NAPKCA+HNN YDG+MNF+HRDEEVDYFPS
Sbjct  336  SDDKLLQTRIFSYSDTQRHRLGPNYLLLPPNAPKCAHHNNHYDGFMNFMHRDEEVDYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  ++A R+P P   +TGRR+K VI KENNFKQPG+RYRSW P RQDRFI RW+ +LS
Sbjct  396  RYDPAKHAPRYPIPSATLTGRREKVVIAKENNFKQPGERYRSWDPARQDRFIKRWIDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PR+THEIRS W+SY +QADRSLGQK+ASRL+ +P+M
Sbjct  456  DPRLTHEIRSIWLSYWSQADRSLGQKLASRLSAKPSM  492



>ref|XP_004158284.1| PREDICTED: catalase isozyme 3-like [Cucumis sativus]
 gb|KGN47533.1| Catalase isozyme 3 [Cucumis sativus]
Length=492

 Score =   249 bits (635),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 111/158 (70%), Positives = 141/158 (89%), Gaps = 1/158 (1%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDKMLQAR FAYADT RHRLGPNY+ LPVNAPKC +HNN ++G+MNF+HRDEEV+YFPS
Sbjct  335  SDDKMLQARSFAYADTQRHRLGPNYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPS  394

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKEN-NFKQPGDRYRSWAPDRQDRFINRWVKSL  374
            ++D  R+AE+FP P  +++G+R++CVI KEN NFKQ GDRYRSWAPDRQ+RF+ R+V++L
Sbjct  395  RYDPCRHAEKFPMPPNVLSGKRERCVIPKENHNFKQAGDRYRSWAPDRQERFVRRFVEAL  454

Query  373  SEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            S+PRVTHE+R+ WISY +QADRSLGQK+ASR+N+RP +
Sbjct  455  SDPRVTHEVRNIWISYWSQADRSLGQKIASRMNVRPNI  492



>ref|NP_001234827.1| catalase isozyme 1 [Solanum lycopersicum]
 sp|P30264.1|CATA1_SOLLC RecName: Full=Catalase isozyme 1 [Solanum lycopersicum]
 gb|AAA34145.1| catalase [Solanum lycopersicum]
 prf||1909364A catalase
Length=492

 Score =   249 bits (635),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 131/157 (83%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            S+DK+LQ R FAYADT RHR+GPNYM LPVNAPKC +HNN  DG MN  HRDEEVDY PS
Sbjct  336  SEDKLLQTRIFAYADTQRHRIGPNYMQLPVNAPKCGHHNNHRDGAMNMTHRDEEVDYLPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            +FD  R AE++P P  ++ GRR  CVI KENNFKQ G+RYRSW PDRQDR+IN+WV+SLS
Sbjct  396  RFDPCRPAEQYPIPSCVLNGRRTNCVIPKENNFKQAGERYRSWEPDRQDRYINKWVESLS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHEIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  456  DPRVTHEIRSIWISYLSQADKSCGQKVASRLTVKPTM  492



>ref|XP_011022153.1| PREDICTED: catalase-2-like isoform X2 [Populus euphratica]
Length=492

 Score =   249 bits (635),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            +FD  R+AER+P P  I TG+R+KC+IEKENNFKQPG+RYRS++PDR++RF+ RWV++LS
Sbjct  396  RFDPVRHAERYPNPSVIHTGKREKCIIEKENNFKQPGERYRSFSPDRKERFVRRWVEALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVT+EIRS WISY +QAD+SLGQK+AS LN+RP +
Sbjct  456  DPRVTYEIRSIWISYWSQADKSLGQKLASHLNMRPGI  492



>sp|P30567.1|CATA2_GOSHI RecName: Full=Catalase isozyme 2 [Gossypium hirsutum]
 emb|CAA39998.1| subunit 2 of cotton catalase [Gossypium hirsutum]
Length=492

 Score =   248 bits (634),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+Y+DT RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE+ P P  +++G+R+KC+I KENNFKQPG+RYRS++ DRQ+RFINRW+ +LS
Sbjct  396  RYDPVRHAEKHPIPSTVLSGKREKCIIGKENNFKQPGERYRSFSADRQERFINRWIDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  456  DPRVTHEIRSIWISYWSQADKSLGQKIASRLNVRPSI  492



>gb|KHG12976.1| Catalase isozyme 2 [Gossypium arboreum]
Length=492

 Score =   248 bits (634),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+Y+DT RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE+ P P  +++G+R+KC+I KENNFKQPG+RYRS++ DRQ+RFINRW+ +LS
Sbjct  396  RYDPVRHAEKHPIPSTVLSGKREKCIIGKENNFKQPGERYRSFSADRQERFINRWIDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  456  DPRVTHEIRSIWISYWSQADKSLGQKIASRLNVRPSI  492



>emb|CDY52649.1| BnaAnng11640D [Brassica napus]
Length=449

 Score =   247 bits (631),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 105/157 (67%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY+ LPVN+PKC++HNN ++G+MNF+HRDEEV+YFPS
Sbjct  293  SDDKLLQTRVFSYADTQRHRLGPNYLQLPVNSPKCSHHNNHHEGFMNFMHRDEEVNYFPS  352

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE++PTP  + +G+R++CVIEKENNFK+PG+RYRS+ P+R +RFI RW+ +LS
Sbjct  353  RYDPVRHAEKYPTPPAVCSGKRERCVIEKENNFKEPGERYRSFTPERLERFIGRWIDALS  412

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP +
Sbjct  413  DPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPNI  449



>ref|XP_006656514.1| PREDICTED: catalase isozyme B-like [Oryza brachyantha]
Length=492

 Score =   248 bits (633),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 134/157 (85%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY++LPVNAPKCAYHNN +DG MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRVFSYADTQRHRLGPNYLMLPVNAPKCAYHNNHHDGTMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            +FD  R+AE+ P P R++TG R+KCVI KENNFKQ G+RYRS+ P RQDRFI RWV +LS
Sbjct  396  RFDAARHAEKVPVPPRVLTGCREKCVINKENNFKQAGERYRSFDPARQDRFIQRWVDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PR+THE+R  WISY +Q D SLGQK+ASRLN++P M
Sbjct  456  DPRITHELRGIWISYWSQCDASLGQKLASRLNLKPNM  492



>gb|ABQ44283.1| catalase [Saccharum hybrid cultivar NCo 376]
Length=339

 Score =   243 bits (621),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 134/157 (85%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+Y+DT RHRLGPNY+LLP NAPKCA+HNN YDG+MNF+HRDEEVDYFPS
Sbjct  183  SDDKLLQTRIFSYSDTQRHRLGPNYLLLPANAPKCAHHNNHYDGFMNFMHRDEEVDYFPS  242

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  +NA R+P P   +TGRRDK VI KENNFKQPG+RYR+  P RQ+RFI RWV +LS
Sbjct  243  RYDPAKNAPRYPIPTVHITGRRDKTVIAKENNFKQPGERYRAMDPARQERFIKRWVDALS  302

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PR+THEIRS W+S  +QADRSLGQK+ASRL+ +P+M
Sbjct  303  DPRLTHEIRSIWLSNWSQADRSLGQKLASRLSAKPSM  339



>ref|XP_011022152.1| PREDICTED: catalase-2-like isoform X1 [Populus euphratica]
Length=511

 Score =   248 bits (634),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  355  SDDKLLQTRIFSYADTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPS  414

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            +FD  R+AER+P P  I TG+R+KC+IEKENNFKQPG+RYRS++PDR++RF+ RWV++LS
Sbjct  415  RFDPVRHAERYPNPSVIHTGKREKCIIEKENNFKQPGERYRSFSPDRKERFVRRWVEALS  474

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVT+EIRS WISY +QAD+SLGQK+AS LN+RP +
Sbjct  475  DPRVTYEIRSIWISYWSQADKSLGQKLASHLNMRPGI  511



>gb|AAC19397.1| leaf catalase [Mesembryanthemum crystallinum]
Length=492

 Score =   248 bits (632),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 136/157 (87%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY+ LPVNAPKCA+HNN YDG MNF+HRD+EVDYFPS
Sbjct  336  SDDKLLQTRIFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHYDGQMNFMHRDDEVDYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AER+P P  ++ G RD+ +I+KENNFKQPG+RYRSW P RQ+RFI RWV +LS
Sbjct  396  RYDPVRHAERYPIPPNVLNGNRDRQIIQKENNFKQPGERYRSWDPARQERFICRWVDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PR+THEIR+ WISY +QAD+S+G K+ASRLN+RPTM
Sbjct  456  DPRITHEIRNIWISYWSQADKSVGMKLASRLNVRPTM  492



>sp|P48351.1|CATA2_CUCPE RecName: Full=Catalase isozyme 2 [Cucurbita pepo]
 dbj|BAA09507.1| catalase [Cucurbita pepo]
Length=492

 Score =   248 bits (632),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 111/158 (70%), Positives = 140/158 (89%), Gaps = 1/158 (1%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDKMLQAR FAYADT RHRLGPNY+ LPVNAPKC +HNN ++G+MNF+HRDEEV+YFPS
Sbjct  335  SDDKMLQARSFAYADTQRHRLGPNYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPS  394

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKEN-NFKQPGDRYRSWAPDRQDRFINRWVKSL  374
            ++D  R+AE++P P  +++G+R++CVI KEN NFKQ GDRYRSWAPDRQ+RF+NR+V++L
Sbjct  395  RYDACRHAEKYPMPPNVLSGKRERCVIPKENHNFKQAGDRYRSWAPDRQERFVNRFVEAL  454

Query  373  SEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            S+ +VTHE+R+ WISY TQADRSLGQK+ASR+N RP M
Sbjct  455  SDSKVTHEVRNIWISYWTQADRSLGQKIASRMNARPNM  492



>pir||S40265 catalase (EC 1.11.1.6) - eggplant
Length=502

 Score =   248 bits (633),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 132/151 (87%), Gaps = 0/151 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            S+DK+LQ R FAYADT RHR+GPNYM LPVNAPKCA+HNN  DG MNF+HRDEEVDY PS
Sbjct  336  SEDKLLQTRIFAYADTQRHRIGPNYMQLPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            +FD  R AE++P P  ++TGRR+KCVI KENNFKQ G+RYR+W PDRQDR+IN+WV+SLS
Sbjct  396  RFDPCRPAEQYPIPSCVLTGRREKCVIPKENNFKQAGERYRTWEPDRQDRYINKWVESLS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRL  278
            +PRVTHEIRS WISYL+QAD+S GQKVASRL
Sbjct  456  DPRVTHEIRSIWISYLSQADKSCGQKVASRL  486



>gb|AAY59707.1| catalase [Oryza sativa Indica Group]
Length=492

 Score =   248 bits (632),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY++LPVNAPKCAYHNN +DG MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCAYHNNHHDGSMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            +FD  R+AE+ P P R++TG R+KCVI+KENNFKQ G+RYRS+ P RQDRF+ RWV +LS
Sbjct  396  RFDAARHAEKVPIPPRVLTGCREKCVIDKENNFKQAGERYRSFDPARQDRFLQRWVDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PR+THE+R  WISY +Q D SLGQK+ASRLN++P M
Sbjct  456  DPRITHELRGIWISYWSQCDASLGQKLASRLNLKPNM  492



>ref|XP_006340832.1| PREDICTED: catalase isozyme 2 [Solanum tuberosum]
Length=492

 Score =   248 bits (632),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 106/157 (68%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDKMLQ R F+Y+DT R+RLGPNY+ LP NAPKCA+HNN YDG MNF+HRDEE+DYFPS
Sbjct  336  SDDKMLQTRIFSYSDTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE +P P  + +G+R+KC+I+KENNFKQPG+RYR++ PDRQ+RFI RWV++LS
Sbjct  396  RYDQVRHAEVYPIPSTVCSGKREKCIIQKENNFKQPGERYRTFTPDRQERFIRRWVEALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PR+T+EIRS WI+Y +QAD+SLGQK+ASRLN+RP++
Sbjct  456  DPRITYEIRSIWITYWSQADKSLGQKLASRLNVRPSI  492



>sp|A2YH64.2|CATA2_ORYSI RecName: Full=Catalase isozyme B; Short=CAT-B [Oryza sativa Indica 
Group]
 gb|EEC81340.1| hypothetical protein OsI_24526 [Oryza sativa Indica Group]
Length=492

 Score =   248 bits (632),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY++LPVNAPKCAYHNN +DG MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCAYHNNHHDGSMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            +FD  R+AE+ P P R++TG R+KCVI+KENNFKQ G+RYRS+ P RQDRF+ RWV +LS
Sbjct  396  RFDAARHAEKVPIPPRVLTGCREKCVIDKENNFKQAGERYRSFDPARQDRFLQRWVDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PR+THE+R  WISY +Q D SLGQK+ASRLN++P M
Sbjct  456  DPRITHELRGIWISYWSQCDASLGQKLASRLNLKPNM  492



>dbj|BAH20283.1| AT1G20620 [Arabidopsis thaliana]
Length=145

 Score =   236 bits (602),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 106/145 (73%), Positives = 125/145 (86%), Gaps = 0/145 (0%)
 Frame = -3

Query  694  YADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFP  515
            Y DT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P
Sbjct  1    YGDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVP  60

Query  514  TPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTW  335
            TP    TG R KCVI+KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIR  W
Sbjct  61   TPTNSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIW  120

Query  334  ISYLTQADRSLGQKVASRLNIRPTM  260
            ISY +QADRSLGQK+ASRLN+RP++
Sbjct  121  ISYWSQADRSLGQKLASRLNVRPSI  145



>gb|ADZ45555.1| catalase [Vigna radiata]
Length=492

 Score =   248 bits (632),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDKMLQ R F+YAD+ RHRLGPNY+LLP NAPK A+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKMLQTRIFSYADSQRHRLGPNYLLLPANAPKSAHHNNHHEGFMNFIHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE+FP P  I +GRR+K  IEKENNFKQ G+R+RSWAPDRQDRF  RWV +LS
Sbjct  396  RYDPVRHAEKFPIPPAICSGRREKIAIEKENNFKQAGERFRSWAPDRQDRFTRRWVDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHEIRS WISY +QADRSLGQK+AS L++RP +
Sbjct  456  DPRVTHEIRSVWISYWSQADRSLGQKIASHLSMRPNI  492



>ref|XP_010446982.1| PREDICTED: catalase-2-like [Camelina sativa]
Length=492

 Score =   247 bits (631),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY+ LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE++P P  + +G R++CVI KENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS
Sbjct  396  RYDPVRHAEKYPAPPAVCSGTRERCVIAKENNFKEPGERYRSFPPERQERFICRWIDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PR+THEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  456  DPRITHEIRSIWISYWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_008452957.1| PREDICTED: catalase isozyme 1-like [Cucumis melo]
Length=492

 Score =   247 bits (631),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 135/154 (88%), Gaps = 0/154 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY+ LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRIFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            + D   +AER+P P  + TG+R++CVIEKENNFKQPG+RYRSW  DRQ+RF+ RWV +LS
Sbjct  396  RIDPAHHAERYPQPPAVYTGKRERCVIEKENNFKQPGERYRSWPADRQERFVGRWVDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIR  269
            +PRVTHEIR+ WISY +QAD+SLGQK+ASRLN++
Sbjct  456  DPRVTHEIRNIWISYWSQADKSLGQKLASRLNVK  489



>ref|XP_007046520.1| Catalase 2 [Theobroma cacao]
 gb|EOX90677.1| Catalase 2 [Theobroma cacao]
Length=492

 Score =   247 bits (630),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+Y+DT RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            +FD  R+AE++P P  I +G+R+KC+I+KENNF+QPG+RYRS+APDRQ+RFI RWV +LS
Sbjct  396  RFDPVRHAEKYPIPTAICSGKREKCIIDKENNFQQPGERYRSFAPDRQERFIYRWVDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVT+EIRS WISY ++AD+SLGQK+ASRL++RP++
Sbjct  456  DPRVTYEIRSIWISYWSKADKSLGQKLASRLSVRPSI  492



>gb|AAO17721.1| catalase [Hypericum perforatum]
Length=492

 Score =   247 bits (630),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+Y+DT RHRLGPNY+ LPVNAPK A+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRIFSYSDTQRHRLGPNYLQLPVNAPKSAHHNNHHEGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE++P P  ++ GRR+KC+I KENNFKQPG+RYRS++PDRQ+RF+NRW+ SLS
Sbjct  396  RYDPVRHAEKYPIPPVVLNGRREKCMIAKENNFKQPGERYRSFSPDRQERFLNRWISSLS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHEIR+ W++Y  QAD+SLGQK+ASRLN+RP M
Sbjct  456  DPRVTHEIRAIWVTYWYQADKSLGQKLASRLNVRPNM  492



>gb|AAM97541.1| catalase 2, partial [Capsicum annuum]
Length=484

 Score =   246 bits (629),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 106/157 (68%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDKMLQ R F+Y+DT R+RLGPNY+ LP NAPKCA+HNN YDG MNF+HRDEE+DYFPS
Sbjct  328  SDDKMLQTRIFSYSDTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPS  387

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE +P P  + +G+R+KC+I+KENNF+QPG+RYRS++ DRQ+RFI RWV++LS
Sbjct  388  RYDPVRHAENYPIPTTVCSGKREKCIIQKENNFQQPGERYRSFSADRQERFIRRWVEALS  447

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PR+T+EIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  448  DPRITYEIRSIWISYWSQADKSLGQKLASRLNVRPSI  484



>ref|XP_009108683.1| PREDICTED: catalase-2-like isoform X2 [Brassica rapa]
Length=496

 Score =   246 bits (629),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 108/161 (67%), Positives = 142/161 (88%), Gaps = 4/161 (2%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPD----RQDRFINRWV  383
            ++D  R+AE++PTP  + +G+R++CVIEKENNFK+PG RYRS+ PD    RQ+RFI RW+
Sbjct  396  RYDPVRHAEKYPTPPAVCSGKRERCVIEKENNFKEPGGRYRSFTPDSFDFRQERFIRRWI  455

Query  382  KSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            ++LS+PR+THEIRS WISY +QAD++LGQK+ASRLN+RP++
Sbjct  456  EALSDPRITHEIRSIWISYWSQADKTLGQKLASRLNVRPSI  496



>gb|ADZ45556.1| catalase [Vigna radiata]
Length=492

 Score =   246 bits (629),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 134/157 (85%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDKMLQ R F+YAD  RHRLGPNY+LLP NAPK A+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKMLQTRIFSYADPQRHRLGPNYLLLPANAPKSAHHNNHHEGFMNFIHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE+FP P  I +GRR+K  IEKENNFKQ G+R+RSWAPDRQDRF  RWV +LS
Sbjct  396  RYDPVRHAEKFPIPPAICSGRREKIAIEKENNFKQAGERFRSWAPDRQDRFTRRWVDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHEIRS WISY +QADRSLGQK+AS L++RP +
Sbjct  456  DPRVTHEIRSVWISYWSQADRSLGQKIASHLSMRPNI  492



>ref|XP_006649332.1| PREDICTED: catalase-1-like [Oryza brachyantha]
Length=492

 Score =   246 bits (629),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 136/157 (87%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+Y+DT RHRLGPNY+LLP NAPKCA+HNN YDG+MNF+HRDEEVDYFPS
Sbjct  336  SDDKLLQTRIFSYSDTQRHRLGPNYLLLPANAPKCAHHNNHYDGFMNFMHRDEEVDYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  ++A R+P P   +TGRR+K VI KENNFKQPG+RYRSW P RQ+RFI RW+ +LS
Sbjct  396  RYDPAKHAPRYPIPSVNLTGRREKTVIPKENNFKQPGERYRSWDPARQERFIKRWIDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PR+THEIRS W+SY +QADRSLGQK+ASRL+ +P+M
Sbjct  456  DPRLTHEIRSIWLSYWSQADRSLGQKLASRLSAKPSM  492



>dbj|BAA05494.1| catalase [Oryza sativa Japonica Group]
Length=492

 Score =   246 bits (629),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY++LPVNAPKCAYHNN +DG MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCAYHNNHHDGSMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            +FD  R+AE+ P P R++TG R+KCVI+KENNF+Q G+RYRS+ P RQDRF+ RWV +LS
Sbjct  396  RFDAARHAEKVPIPPRVLTGCREKCVIDKENNFQQAGERYRSFDPARQDRFLQRWVDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PR+THE+R  WISY +Q D SLGQK+ASRLN++P M
Sbjct  456  DPRITHELRGIWISYWSQCDASLGQKLASRLNLKPNM  492



>dbj|BAA34204.1| catalase [Oryza sativa Japonica Group]
Length=492

 Score =   246 bits (629),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY++LPVNAPKCAYHNN +DG MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCAYHNNHHDGSMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            +FD  R+AE+ P P R++TG R+KCVI+KENNF+Q G+RYRS+ P RQDRF+ RWV +LS
Sbjct  396  RFDAARHAEKVPIPPRVLTGCREKCVIDKENNFQQAGERYRSFDPARQDRFLQRWVDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PR+THE+R  WISY +Q D SLGQK+ASRLN++P M
Sbjct  456  DPRITHELRGIWISYWSQCDASLGQKLASRLNLKPNM  492



>gb|AHF21552.1| catalase [Hylocereus undatus]
Length=492

 Score =   246 bits (629),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 131/157 (83%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R FAY D  R+RLG NYM+LPVNAPKCA+HNN YDG MNF+HRDEE+DYFPS
Sbjct  336  SDDKLLQCRVFAYGDAQRYRLGANYMMLPVNAPKCAHHNNQYDGVMNFMHRDEEIDYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            KFD  R AE++P   ++ TG+R+K VI KENNFKQPGDRYRSW P RQ+RF+ RWV  LS
Sbjct  396  KFDPARQAEKYPILTKVYTGKREKTVIPKENNFKQPGDRYRSWDPARQERFVKRWVDVLS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVT E+RS W+SYL+Q DRSLG KVA+RLN+RPTM
Sbjct  456  DPRVTLELRSIWVSYLSQCDRSLGMKVATRLNMRPTM  492



>ref|NP_001058635.1| Os06g0727200 [Oryza sativa Japonica Group]
 sp|Q0D9C4.1|CATA2_ORYSJ RecName: Full=Catalase isozyme B; Short=CAT-B [Oryza sativa Japonica 
Group]
 dbj|BAD61813.1| catalase [Oryza sativa Japonica Group]
 dbj|BAF20549.1| Os06g0727200 [Oryza sativa Japonica Group]
 gb|EAZ38347.1| hypothetical protein OsJ_22721 [Oryza sativa Japonica Group]
 dbj|BAG91437.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94401.1| unnamed protein product [Oryza sativa Japonica Group]
Length=492

 Score =   246 bits (628),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY++LPVNAPKCAYHNN +DG MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCAYHNNHHDGSMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            +FD  R+AE+ P P R++TG R+KCVI+KENNF+Q G+RYRS+ P RQDRF+ RWV +LS
Sbjct  396  RFDAARHAEKVPIPPRVLTGCREKCVIDKENNFQQAGERYRSFDPARQDRFLQRWVDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PR+THE+R  WISY +Q D SLGQK+ASRLN++P M
Sbjct  456  DPRITHELRGIWISYWSQCDASLGQKLASRLNLKPNM  492



>gb|AFR53082.1| CAT [Anthurium andraeanum]
Length=492

 Score =   246 bits (628),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDKMLQ R FAY DT R+RLGPNY++LPVNAPKCA+ N+ YDG MNF+HRDEEV+YFPS
Sbjct  336  SDDKMLQCRTFAYGDTQRYRLGPNYLMLPVNAPKCAHKNSHYDGLMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            + D  R+AER+P   RIVTGRR+KC+IEK+N+FKQPGDRYRSWA DRQ+RF+ RWV++L+
Sbjct  396  RHDPLRHAERYPINNRIVTGRREKCIIEKQNDFKQPGDRYRSWAHDRQERFVRRWVEALA  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
             P+V+HE+RS W+SYL+++D SLGQKVA+RLN++P+M
Sbjct  456  HPKVSHEVRSIWVSYLSKSDVSLGQKVANRLNMKPSM  492



>gb|KDP43757.1| hypothetical protein JCGZ_22384 [Jatropha curcas]
Length=492

 Score =   246 bits (628),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 139/157 (89%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+Y+DT RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRIFSYSDTQRHRLGPNYLQLPPNAPKCAHHNNHHEGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE++P P  ++TGRR+K VI KENNFKQPG+RYRS+ PDR+DRFI RWV++LS
Sbjct  396  RYDPVRHAEKYPIPPPVLTGRREKTVIPKENNFKQPGERYRSFTPDRKDRFIRRWVEALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVT+EIRS WISY +QAD+SLGQK+AS LN+RPTM
Sbjct  456  DPRVTYEIRSIWISYWSQADKSLGQKIASHLNMRPTM  492



>gb|ABC01913.1| catalase isozyme 1-like protein [Solanum tuberosum]
Length=492

 Score =   246 bits (628),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 130/157 (83%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            S+DK+LQ R FAYADT RHR+GPNYM LPVNAPKC +HNN  DG MN  HRDEEVDY PS
Sbjct  336  SEDKLLQTRIFAYADTQRHRIGPNYMQLPVNAPKCGHHNNHRDGAMNMTHRDEEVDYLPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            +FD  R AE++P P  ++ GRR  CVI KENNFKQ G+RYRSW  DRQDR+IN+WV+SLS
Sbjct  396  RFDPCRPAEQYPIPACVLNGRRTNCVIPKENNFKQAGERYRSWESDRQDRYINKWVESLS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHEIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  456  DPRVTHEIRSIWISYLSQADKSCGQKVASRLTVKPTM  492



>gb|AAC17729.1| catalase 1, partial [Hordeum vulgare subsp. vulgare]
Length=398

 Score =   243 bits (620),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 136/157 (87%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY++LPVNAPKCA+HNN +DG MNF+HRDEEV+YFPS
Sbjct  242  SDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCAHHNNHHDGLMNFIHRDEEVNYFPS  301

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            +FD TR+AE++P P R+++G R+KC+I+KENNFKQ G+RYRS+ P RQDRF+ RWV +L+
Sbjct  302  RFDPTRHAEKYPMPPRVLSGCREKCIIDKENNFKQAGERYRSFDPARQDRFLQRWVDALT  361

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            + RVTHEI+S W+SY +Q D SLGQK+ASRL I+P M
Sbjct  362  DARVTHEIQSIWVSYWSQCDASLGQKLASRLKIKPNM  398



>gb|ACB11496.1| catalase [Pinus sylvestris]
Length=492

 Score =   246 bits (627),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            ++DK+LQ R F+Y+DT RHRLGPNY++LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  TEDKLLQTRIFSYSDTQRHRLGPNYLMLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            +FD  R+AERFP P    TG+R+KCVIEKENNFKQPG+RYRS+AP+RQ+RF+ RWV +LS
Sbjct  396  RFDPVRHAERFPIPSHTHTGKREKCVIEKENNFKQPGERYRSFAPERQERFVKRWVAALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHEI S WISY +Q D+SLGQK+A+RLN++  M
Sbjct  456  DPRVTHEICSIWISYWSQCDKSLGQKIAARLNMKANM  492



>gb|AAD17933.1| catalase [Brassica juncea]
Length=496

 Score =   246 bits (627),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 107/161 (66%), Positives = 143/161 (89%), Gaps = 4/161 (2%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPD----RQDRFINRWV  383
            ++D  R+AE++PTP  + +G+R++CVIEKENNFK+PG+RYRS+ P+    RQ+RFI RW+
Sbjct  396  RYDPVRHAEKYPTPPAVCSGKRERCVIEKENNFKEPGERYRSFTPESFDFRQERFIRRWI  455

Query  382  KSLSEPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            ++LS+PR+THEIRS WISY +QAD++LGQK+ASRLN+RP++
Sbjct  456  EALSDPRITHEIRSIWISYWSQADKTLGQKLASRLNVRPSI  496



>ref|NP_001241808.1| catalase isozyme B [Zea mays]
 gb|ACG48924.1| catalase isozyme B [Zea mays]
 gb|ACN25578.1| unknown [Zea mays]
 gb|AFW69583.1| catalase1 [Zea mays]
Length=492

 Score =   245 bits (626),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY++LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            +FD  R+AE+ P P R++TG R+KC+I+KENNFKQ G+RYRS+ P RQDRFI RWV +L+
Sbjct  396  RFDPARHAEKVPIPPRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALT  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHE R+ WISY +Q D +LGQK+ASRLN++P+M
Sbjct  456  DPRVTHEHRTIWISYWSQCDAALGQKLASRLNLKPSM  492



>gb|AAF79625.1|AC027665_26 F5M15.5 [Arabidopsis thaliana]
 gb|AAF80611.1|AC069251_4 F2D10.11 [Arabidopsis thaliana]
Length=1013

 Score =   254 bits (649),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/156 (74%), Positives = 134/156 (86%), Gaps = 0/156 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R FAY DT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEE++Y+PS
Sbjct  375  SDDKLLQCRIFAYGDTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPS  434

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            KFD  R AE+ PTP    TG R KCVI+KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LS
Sbjct  435  KFDPVRCAEKVPTPTNSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILS  494

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPT  263
            EPR+THEIR  WISY +QADRSLGQK+ASRLN+RP+
Sbjct  495  EPRLTHEIRGIWISYWSQADRSLGQKLASRLNVRPS  530


 Score =   243 bits (619),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = -3

Query  730   SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
             SDDK+LQ R F+YAD+ RHRLGPNY+ LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS
Sbjct  857   SDDKLLQTRIFSYADSQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPS  916

Query  550   KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
             + D  R+AE++PT   + +G R+KC I KENNFKQPG+RYRSW  DRQ+RF+ R+V++LS
Sbjct  917   RLDPVRHAEKYPTTPIVCSGNREKCFIGKENNFKQPGERYRSWDSDRQERFVKRFVEALS  976

Query  370   EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
             EPRVTHEIRS WISY +QAD+SLGQK+A+RLN+RP  
Sbjct  977   EPRVTHEIRSIWISYWSQADKSLGQKLATRLNVRPNF  1013



>gb|AFN81243.1| catalase 1 [Brassica rapa subsp. pekinensis]
Length=492

 Score =   245 bits (626),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 104/157 (66%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY+ LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE++PTP  + +G+R++CVIEKENNFK+PG+RYRS+ P+RQ+RFI RW+++L 
Sbjct  396  RYDPVRHAEKYPTPPAVCSGKRERCVIEKENNFKEPGERYRSFTPERQERFIRRWIEALF  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PR+THEIRS WI Y +QAD++ GQK+ASRLN+RP++
Sbjct  456  DPRITHEIRSIWIFYWSQADKTFGQKLASRLNVRPSI  492



>ref|XP_010534184.1| PREDICTED: catalase isozyme 3-like [Tarenaya hassleriana]
Length=492

 Score =   245 bits (626),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            S DK+LQAR FAY DT R+RLGPNY+ LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS
Sbjct  336  SQDKLLQARIFAYGDTQRYRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            +FD+ R+A ++P P  + +G R KCVIEKENNFKQPG+RYRSWAPDRQ+R+  RWV++LS
Sbjct  396  RFDSVRHAAKYPIPSAVCSGERIKCVIEKENNFKQPGERYRSWAPDRQERYAKRWVEALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            + RVT EIR  WISYL+Q+D+SLG KVA+RLN+RP+ 
Sbjct  456  DARVTDEIRGVWISYLSQSDKSLGMKVANRLNVRPSF  492



>emb|CAA42720.1| catalase-1 [Zea mays]
Length=492

 Score =   245 bits (626),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY++LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            +FD  R+AE+ P P R++TG R+KC+I+KENNFKQ G+RYRS+ P RQDRFI RWV +L+
Sbjct  396  RFDPARHAEKVPIPPRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALT  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHE R+ WISY +Q D +LGQK+ASRLN++P+M
Sbjct  456  DPRVTHEHRTIWISYWSQCDAALGQKLASRLNLKPSM  492



>gb|AIU99479.1| catalase [Saccharum arundinaceum]
Length=492

 Score =   245 bits (626),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY++LPVNAPKCA+HNN +DG+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            +FD  R+AE+ P P R++TG R+KC+I+KENNFKQ G+RYRS+ P RQDRFI RWV +LS
Sbjct  396  RFDPARHAEKVPIPSRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHE  + WISY +Q D SLGQK+ASRLN++P M
Sbjct  456  DPRVTHEHHTIWISYWSQCDASLGQKLASRLNLKPNM  492



>gb|ACJ22771.1| catalase 1 [Jatropha curcas]
 gb|KDP36790.1| hypothetical protein JCGZ_08081 [Jatropha curcas]
Length=492

 Score =   245 bits (625),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 134/157 (85%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            S+DK+ Q R FAY+DT RHRLGPNYM LPVNAPKC +HNN YDG+MNF+HRDEE+DYF S
Sbjct  336  SNDKLFQLRTFAYSDTQRHRLGPNYMQLPVNAPKCPHHNNHYDGFMNFMHRDEEIDYFQS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AER+P P  I++GRR+KCVI KENNFKQPG+RYRSW PDRQ+RF+ R V +LS
Sbjct  396  RYDPVRHAERYPIPNAIISGRREKCVIPKENNFKQPGERYRSWTPDRQERFLCRLVNALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PR+THEIR  W+SY +Q D+SLGQK+ASRLN+RP +
Sbjct  456  DPRITHEIRGIWVSYWSQCDQSLGQKLASRLNVRPNI  492



>sp|P49318.1|CATA2_RICCO RecName: Full=Catalase isozyme 2 [Ricinus communis]
 gb|AAB31538.1| catalase 2 [Ricinus communis=castor beans, hypocotyls, Peptide, 
492 aa]
 dbj|BAA04698.1| catalase CAT2 [Ricinus communis]
Length=492

 Score =   245 bits (625),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 134/157 (85%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            S+DK+ Q R FAY+DT RHRLG NY+ LPVNAPKC YHNN YDG+MNF+HRDEEVDYF S
Sbjct  336  SNDKLFQLRLFAYSDTQRHRLGTNYLQLPVNAPKCPYHNNHYDGFMNFMHRDEEVDYFQS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE+ P P  I +GRR+KCVIEKE+NF+QPGDRYRSWAPDRQ+RF+ R V +LS
Sbjct  396  RYDPVRHAEKVPIPNAICSGRREKCVIEKEDNFRQPGDRYRSWAPDRQERFLCRLVNALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            EPR+THEIRS W+S+ TQ D+SLGQK+ASRLN+RP +
Sbjct  456  EPRITHEIRSIWVSWWTQCDKSLGQKLASRLNVRPNI  492



>ref|NP_001274863.1| catalase isozyme 1 [Solanum tuberosum]
 gb|ABY21246.1| catalase isozyme [Solanum tuberosum]
Length=492

 Score =   244 bits (624),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 130/157 (83%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            S+DK+LQ R FAYADT RHR+GPNYM LPVNAPKC +HNN  DG MN  HRDEEVDYFPS
Sbjct  336  SEDKLLQTRIFAYADTQRHRIGPNYMQLPVNAPKCGHHNNHRDGAMNMTHRDEEVDYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            +FD  R AE++P P  ++ GRR  CVI KENN KQ G+RYRSW  DRQDR+IN+WV+SLS
Sbjct  396  RFDPCRPAEQYPIPACVLNGRRTNCVIPKENNSKQAGERYRSWESDRQDRYINKWVESLS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHEIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  456  DPRVTHEIRSIWISYLSQADKSCGQKVASRLTVKPTM  492



>sp|P49284.1|CATA1_SOLTU RecName: Full=Catalase isozyme 1 [Solanum tuberosum]
 gb|AAA80650.1| catalase [Solanum tuberosum]
Length=492

 Score =   244 bits (624),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 130/157 (83%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            S+DK+LQ R FAYADT RHR+GPNYM LPVNAPKC +HNN  DG MN  HRDEEVDYFPS
Sbjct  336  SEDKLLQTRIFAYADTQRHRIGPNYMQLPVNAPKCGHHNNHRDGAMNMTHRDEEVDYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            +FD  R AE++P P  ++ GRR  CVI KENN KQ G+RYRSW  DRQDR+IN+WV+SLS
Sbjct  396  RFDPCRPAEQYPIPACVLNGRRTNCVIPKENNSKQAGERYRSWESDRQDRYINKWVESLS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHEIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  456  DPRVTHEIRSIWISYLSQADKSCGQKVASRLTVKPTM  492



>gb|KJB17473.1| hypothetical protein B456_003G002800 [Gossypium raimondii]
Length=492

 Score =   244 bits (624),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 106/157 (68%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+Y+DT RHRLGPNY+ LP NAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRIFSYSDTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            ++D  R+AE+ P P  + +G+R+KC+I KENNFKQPG+RYRS++ DRQ+RFINRW+ +LS
Sbjct  396  RYDPVRHAEKHPIPSTVYSGKREKCIIGKENNFKQPGERYRSFSADRQERFINRWIDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            + RVTHEIRS WISY +QAD+SLGQK+ASRLN+RP++
Sbjct  456  DSRVTHEIRSIWISYWSQADKSLGQKIASRLNVRPSI  492



>gb|AIU99488.1| catalase [Saccharum hybrid cultivar ROC22]
Length=492

 Score =   244 bits (623),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY++LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            +FD  R+AE+ P P R++TG R+KC+I+KENNFKQ G+RYRS+ P RQDRFI RWV +LS
Sbjct  396  RFDPARHAEKVPIPTRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVGALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHE  + WISY +Q D SLGQK+ASRLN++P M
Sbjct  456  DPRVTHEHHTIWISYWSQCDASLGQKLASRLNLKPNM  492



>gb|AIU99481.1| catalase [Saccharum spontaneum]
Length=492

 Score =   244 bits (623),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY++LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            +FD  R+AE+ P P R++TG R+KC+I+KENNFKQ G+RYRS+ P RQDRFI RWV +LS
Sbjct  396  RFDPARHAEKVPIPTRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHE  + WISY +Q D SLGQK+ASRLN++P M
Sbjct  456  DPRVTHEHHTIWISYWSQCDASLGQKLASRLNLKPNM  492



>sp|P55312.1|CATA2_SOLTU RecName: Full=Catalase isozyme 2 [Solanum tuberosum]
Length=492

 Score =   244 bits (623),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 129/157 (82%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            S+DK+LQ R FAYADT RHR+GPNYM LPVNAPKC +HNN  DG MN  HRDEEVDY PS
Sbjct  336  SEDKLLQTRIFAYADTQRHRIGPNYMQLPVNAPKCGHHNNHRDGAMNMTHRDEEVDYLPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            +FD  R AE++P P  ++ GRR  CVI KENNFKQ G+RYRSW  DRQDR+I +WV+SLS
Sbjct  396  RFDPCRPAEQYPIPACVLNGRRTNCVIPKENNFKQAGERYRSWESDRQDRYITKWVESLS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHEIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  456  DPRVTHEIRSIWISYLSQADKSCGQKVASRLTVKPTM  492



>emb|CAG23920.1| catalase [Festuca arundinacea]
Length=492

 Score =   244 bits (623),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+Y+DT RHRLGPNY+LLP NAPKC++HNN YDG MNF+HRDEEVDYFPS
Sbjct  336  SDDKLLQTRIFSYSDTQRHRLGPNYLLLPANAPKCSHHNNHYDGLMNFMHRDEEVDYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            +FD   +A R+P P R + GRR+K VIEKENNFKQPG+RYRS  P RQ+RFINRW+ +LS
Sbjct  396  RFDPATDAPRYPIPSRTLNGRREKMVIEKENNFKQPGERYRSMDPARQERFINRWIDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PR+THEI++ W+SY +QADRSLGQK+A RL+++P+M
Sbjct  456  DPRLTHEIKAIWLSYWSQADRSLGQKLAGRLSVKPSM  492



>gb|AIM43584.1| catalase [Saccharum hybrid cultivar Yacheng05-179]
Length=492

 Score =   244 bits (623),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY++LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            +FD  R+AE+ P P R++TG R+KC+I+KENNFKQ G+RYRS+ P RQDRFI RWV +LS
Sbjct  396  RFDPARHAEKVPIPTRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHE  + WISY +Q D SLGQK+ASRLN++P M
Sbjct  456  DPRVTHEHHTIWISYWSQCDASLGQKLASRLNLKPNM  492



>emb|CDX69111.1| BnaC01g03420D [Brassica napus]
Length=480

 Score =   244 bits (622),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 104/157 (66%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY+ LPVNAPKC +HNN ++G+MNF+HRDEEV+YFPS
Sbjct  324  SDDKLLQTRVFSYADTQRHRLGPNYLQLPVNAPKCGHHNNHHEGFMNFMHRDEEVNYFPS  383

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            +++  R+AE++PTP  +  G+R++CVIEKENNFK+PG+RYR + P+RQ+RFI RW+++LS
Sbjct  384  RYNPVRHAEKYPTPPAVCAGKRERCVIEKENNFKEPGERYRYFPPERQERFIRRWIEALS  443

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PR+THEIRS WISY +QAD+SLGQK+AS LN+RP +
Sbjct  444  DPRITHEIRSIWISYWSQADKSLGQKLASHLNVRPNI  480



>emb|CAA85470.1| catalase [Solanum tuberosum]
Length=491

 Score =   244 bits (623),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 129/157 (82%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            S+DK+LQ R FAYADT RHR+GPNYM LPVNAPKC +HNN  DG MN  HRDEEVDY PS
Sbjct  335  SEDKLLQTRIFAYADTQRHRIGPNYMQLPVNAPKCGHHNNHRDGAMNMTHRDEEVDYLPS  394

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            +FD  R AE++P P  ++ GRR  CVI KENNFKQ G+RYRSW  DRQDR+I +WV+SLS
Sbjct  395  RFDPCRPAEQYPIPACVLNGRRTNCVIPKENNFKQAGERYRSWESDRQDRYITKWVESLS  454

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHEIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  455  DPRVTHEIRSIWISYLSQADKSCGQKVASRLTVKPTM  491



>gb|AIU99485.1| catalase [Saccharum spontaneum]
Length=492

 Score =   244 bits (623),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY++LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            +FD  R+AE+ P P R++TG R+KC+I+KENNFKQ G+RYRS+ P RQDRFI RWV +LS
Sbjct  396  RFDPARHAEKVPIPTRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHE  + WISY +Q D SLGQK+ASRLN++P M
Sbjct  456  DPRVTHEHHTIWISYWSQCDASLGQKLASRLNLKPNM  492



>gb|AAR97905.1| catalase [Solanum tuberosum]
Length=492

 Score =   244 bits (623),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 129/157 (82%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            S+DK+LQ R FAYADT RHR+GPNYM LPVNAPKC +HNN  DG MN  HRDEEVDY PS
Sbjct  336  SEDKLLQTRIFAYADTQRHRIGPNYMQLPVNAPKCGHHNNHRDGAMNMTHRDEEVDYLPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            +FD  R AE++P P  ++ GRR  CVI KENNFKQ G+RYRSW  DRQDR+I +WV+SLS
Sbjct  396  RFDPCRPAEQYPIPACVLNGRRTNCVIPKENNFKQAGERYRSWESDRQDRYITKWVESLS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHEIRS WISYL+QAD+S GQKVASRL ++PTM
Sbjct  456  DPRVTHEIRSIWISYLSQADKSCGQKVASRLTVKPTM  492



>gb|AIU99484.1| catalase [Saccharum arundinaceum]
Length=492

 Score =   244 bits (623),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 135/157 (86%), Gaps = 0/157 (0%)
 Frame = -3

Query  730  SDDKMLQARXFAYADTHRHRLGPNYMLLPVNAPKCAYHNNSYDGYMNFVHRDEEVDYFPS  551
            SDDK+LQ R F+YADT RHRLGPNY++LPVNAPKCA+HNN ++G+MNF+HRDEEV+YFPS
Sbjct  336  SDDKLLQTRIFSYADTQRHRLGPNYLMLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPS  395

Query  550  KFDNTRNAERFPTPLRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLS  371
            +FD  R+AE+ P P R++TG R+KC+I+KENNFKQ G+RYRS+ P RQDRFI RWV +LS
Sbjct  396  RFDPARHAEKVPIPTRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALS  455

Query  370  EPRVTHEIRSTWISYLTQADRSLGQKVASRLNIRPTM  260
            +PRVTHE  + WISY +Q D SLGQK+ASRLN++P M
Sbjct  456  DPRVTHEHHTIWISYWSQCDASLGQKLASRLNLKPNM  492



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1327220236485