BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF007A24

Length=667
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ABW89104.1|  glyceraldehyde-3-phosphate dehydrogenase                224   4e-70   Helianthus annuus
gb|ABW89099.1|  glyceraldehyde-3-phosphate dehydrogenase                224   4e-70   Helianthus annuus
gb|ABG35250.1|  glyceraldehyde-3-phosphate dehydrogenase                224   1e-69   Helianthus annuus
gb|ABG35254.1|  glyceraldehyde-3-phosphate dehydrogenase                224   2e-69   Helianthus annuus
gb|ABG35267.1|  glyceraldehyde-3-phosphate dehydrogenase                222   6e-69   Helianthus annuus
gb|KJB11770.1|  hypothetical protein B456_001G276400                    224   8e-69   Gossypium raimondii
gb|KDO63479.1|  hypothetical protein CISIN_1g013492mg                   224   1e-68   Citrus sinensis [apfelsine]
ref|XP_009118049.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    224   3e-68   Brassica rapa
dbj|BAD93961.1|  glyceraldehyde 3-phosphate dehydrogenase A subunit     218   3e-68   Arabidopsis thaliana [mouse-ear cress]
gb|AGJ50596.1|  GAPDH                                                   226   4e-68   Pericallis cruenta
ref|XP_003548805.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    226   6e-68   
gb|KHN46369.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    225   6e-68   Glycine soja [wild soybean]
ref|NP_001238484.1|  glyceraldehyde-3-phosphate dehydrogenase A s...    225   6e-68   
gb|KHN46819.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    225   7e-68   Glycine soja [wild soybean]
gb|KHG29734.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    224   9e-68   Gossypium arboreum [tree cotton]
ref|XP_010528120.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    221   1e-67   Tarenaya hassleriana [spider flower]
pdb|1RM3|O  Chain O, Crystal Structure Of Mutant T33a Of Photosyn...    223   1e-67   Spinacia oleracea
pdb|1NBO|O  Chain O, The Dual Coenzyme Specificity Of Photosynthe...    223   1e-67   Spinacia oleracea
ref|XP_010425376.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    222   2e-67   Camelina sativa [gold-of-pleasure]
pdb|1RM5|O  Chain O, Crystal Structure Of Mutant S188a Of Photosy...    222   2e-67   Spinacia oleracea
pir||DESPGA  glyceraldehyde-3-phosphate dehydrogenase (NADP)  (ph...    222   2e-67
pdb|2PKR|O  Chain O, Crystal Structure Of (a+cte)4 Chimeric Form ...    223   2e-67   Spinacia oleracea
ref|XP_010502598.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    221   2e-67   Camelina sativa [gold-of-pleasure]
emb|CCF55355.1|  Glyceraldehyde-3-phosphate dehydrogenase A             224   2e-67   Cucumis sativus [cucumbers]
dbj|BAK02737.1|  predicted protein                                      221   2e-67   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007161788.1|  hypothetical protein PHAVU_001G098100g             224   3e-67   Phaseolus vulgaris [French bean]
ref|XP_010090946.1|  Glyceraldehyde-3-phosphate dehydrogenase A         224   3e-67   Morus notabilis
ref|XP_006446865.1|  hypothetical protein CICLE_v10015476mg             224   3e-67   Citrus clementina [clementine]
ref|XP_004236849.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    224   3e-67   Solanum lycopersicum
ref|XP_004231523.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    224   3e-67   Solanum lycopersicum
gb|KJB70724.1|  hypothetical protein B456_011G088800                    221   3e-67   Gossypium raimondii
sp|P19866.2|G3PA_SPIOL  RecName: Full=Glyceraldehyde-3-phosphate ...    224   3e-67   Spinacia oleracea
ref|XP_004493116.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    224   3e-67   Cicer arietinum [garbanzo]
sp|P09672.1|G3PA_SINAL  RecName: Full=Glyceraldehyde-3-phosphate ...    218   3e-67   Sinapis alba [bai jie]
ref|XP_006468948.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    224   3e-67   Citrus sinensis [apfelsine]
gb|ACU21011.1|  unknown                                                 224   3e-67   Glycine max [soybeans]
ref|XP_006359279.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    223   3e-67   Solanum tuberosum [potatoes]
gb|AEH04452.1|  glyceraldehyde-3-phosphate dehydrogenase                223   4e-67   Arachis hypogaea [goober]
gb|AIU56856.1|  glyceraldehyde-3-phosphate dehydrogenase A              221   4e-67   Brassica rapa subsp. chinensis [bok-choy]
ref|XP_002321065.2|  hypothetical protein POPTR_0014s13660g             223   4e-67   Populus trichocarpa [western balsam poplar]
gb|KDO63477.1|  hypothetical protein CISIN_1g013492mg                   224   4e-67   Citrus sinensis [apfelsine]
ref|NP_001077529.1|  glyceraldehyde 3-phosphate dehydrogenase GAPA2     221   4e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009148557.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    221   5e-67   
ref|XP_009800449.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    223   5e-67   Nicotiana sylvestris
ref|XP_011033706.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    223   5e-67   Populus euphratica
ref|XP_004161334.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    223   5e-67   
gb|KDO63476.1|  hypothetical protein CISIN_1g013492mg                   224   6e-67   Citrus sinensis [apfelsine]
ref|XP_003624553.1|  Glyceraldehyde-3-phosphate dehydrogenase A         223   6e-67   Medicago truncatula
dbj|BAP91041.1|  glyceraldehyde 3-phosphate dehydrogenase-A             223   6e-67   Nicotiana benthamiana
ref|XP_010476270.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    220   6e-67   Camelina sativa [gold-of-pleasure]
ref|XP_004145622.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    223   6e-67   
emb|CDY16038.1|  BnaC08g40850D                                          223   6e-67   Brassica napus [oilseed rape]
ref|XP_010250427.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    223   7e-67   Nelumbo nucifera [Indian lotus]
gb|KJB11771.1|  hypothetical protein B456_001G276400                    223   7e-67   Gossypium raimondii
ref|XP_003579898.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    223   7e-67   Brachypodium distachyon [annual false brome]
gb|ACV32597.1|  putative glyceraldehyde-3-phosphate dehydrogenase       223   7e-67   Medicago sativa [alfalfa]
emb|CDY26599.1|  BnaA09g46780D                                          223   8e-67   Brassica napus [oilseed rape]
ref|XP_010694632.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    223   8e-67   Beta vulgaris subsp. vulgaris [field beet]
gb|ADX97321.1|  glyceraldehyde-3-phosphate dehydrogenase                223   8e-67   Mangifera indica
ref|XP_010494750.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    220   8e-67   Camelina sativa [gold-of-pleasure]
gb|AHZ94971.1|  glyceraldehyde-3-phosphate dehydrogenase                221   1e-66   Lilium regale
gb|KFK43560.1|  hypothetical protein AALP_AA1G142100                    222   1e-66   Arabis alpina [alpine rockcress]
gb|KHG21941.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    221   1e-66   Gossypium arboreum [tree cotton]
pdb|1JN0|O  Chain O, Crystal Structure Of The Non-regulatory A4 I...    220   1e-66   Spinacia oleracea
ref|XP_004304578.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    222   1e-66   Fragaria vesca subsp. vesca
gb|KDP41897.1|  hypothetical protein JCGZ_26915                         222   1e-66   Jatropha curcas
ref|XP_009420999.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    222   1e-66   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009631078.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    222   1e-66   Nicotiana tomentosiformis
sp|P12858.2|G3PA_PEA  RecName: Full=Glyceraldehyde-3-phosphate de...    222   1e-66   Pisum sativum [garden pea]
ref|XP_007217883.1|  hypothetical protein PRUPE_ppa006610mg             222   2e-66   Prunus persica
emb|CAA33264.1|  unnamed protein product                                222   2e-66   Pisum sativum [garden pea]
ref|XP_008449975.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    222   2e-66   Cucumis melo [Oriental melon]
ref|XP_008231212.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    222   2e-66   Prunus mume [ume]
ref|XP_008449974.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    222   2e-66   Cucumis melo [Oriental melon]
ref|XP_007032095.1|  Glyceraldehyde 3-phosphate dehydrogenase A s...    221   2e-66   Theobroma cacao [chocolate]
ref|XP_009118048.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    221   2e-66   Brassica rapa
ref|XP_009378072.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    219   3e-66   Pyrus x bretschneideri [bai li]
ref|XP_011003600.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    221   3e-66   Populus euphratica
gb|KFK33590.1|  hypothetical protein AALP_AA5G033500                    221   3e-66   Arabis alpina [alpine rockcress]
ref|XP_008379036.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    221   3e-66   Malus domestica [apple tree]
ref|XP_002512790.1|  glyceraldehyde 3-phosphate dehydrogenase, pu...    221   3e-66   Ricinus communis
ref|XP_010249379.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    221   3e-66   Nelumbo nucifera [Indian lotus]
ref|XP_009378071.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    221   3e-66   Pyrus x bretschneideri [bai li]
dbj|BAJ90530.1|  predicted protein                                      221   4e-66   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008362077.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    221   4e-66   Malus domestica [apple tree]
emb|CDX83635.1|  BnaC07g23750D                                          220   5e-66   
dbj|BAJ90885.1|  predicted protein                                      220   5e-66   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010528117.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    220   5e-66   Tarenaya hassleriana [spider flower]
gb|EMT31124.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    220   6e-66   
ref|XP_010660642.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    220   6e-66   
ref|XP_006652373.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    220   6e-66   Oryza brachyantha
ref|XP_010514317.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    220   6e-66   
ref|XP_006652372.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    220   6e-66   
ref|XP_002278352.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    220   6e-66   Vitis vinifera
ref|XP_010425375.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    220   6e-66   Camelina sativa [gold-of-pleasure]
emb|CAN78872.1|  hypothetical protein VITISV_021726                     220   6e-66   Vitis vinifera
gb|EPS59235.1|  hypothetical protein M569_15573                         220   7e-66   Genlisea aurea
ref|XP_010502597.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    220   7e-66   Camelina sativa [gold-of-pleasure]
pdb|3K2B|A  Chain A, Crystal Structure Of Photosynthetic A4 Isofo...    218   7e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009404713.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    220   7e-66   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAD10209.1|  glyceraldehyde 3-phosphate dehydrogenase A subunit      218   8e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009152035.1|  PREDICTED: LOW QUALITY PROTEIN: glyceraldehy...    220   9e-66   Brassica rapa
ref|XP_002875330.1|  gapa                                               219   9e-66   Arabidopsis lyrata subsp. lyrata
gb|KJB70723.1|  hypothetical protein B456_011G088800                    220   9e-66   Gossypium raimondii
gb|AAA32793.1|  glyceraldehyde 3-phosphate dehydrogenase                219   9e-66   Arabidopsis thaliana [mouse-ear cress]
ref|NP_566796.2|  glyceraldehyde-3-phosphate dehydrogenase A subunit    219   9e-66   Arabidopsis thaliana [mouse-ear cress]
gb|AEO45783.1|  glyceraldehyde-3-phosphate dehydrogenase A              219   1e-65   Scoparia dulcis [escobilla]
ref|XP_006291258.1|  hypothetical protein CARUB_v10017390mg             219   1e-65   Capsella rubella
dbj|BAG68209.1|  glyceraldehyde-3-phosphate dehydrogenase               217   1e-65   Brassica rapa subsp. chinensis [bok-choy]
ref|XP_008797069.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    221   1e-65   
gb|ACN39951.1|  unknown                                                 217   2e-65   Picea sitchensis
dbj|BAJ10475.1|  glyceraldehyde-3-phosphate dehydrogenase               219   2e-65   Brassica rapa subsp. chinensis [bok-choy]
ref|NP_001117276.1|  glyceraldehyde 3-phosphate dehydrogenase GAPA2     218   2e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006417176.1|  hypothetical protein EUTSA_v10007809mg             218   2e-65   
ref|XP_010028899.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    219   2e-65   Eucalyptus grandis [rose gum]
ref|XP_009148556.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    219   2e-65   Brassica rapa
emb|CDY19412.1|  BnaC05g09210D                                          219   2e-65   Brassica napus [oilseed rape]
ref|XP_006304985.1|  hypothetical protein CARUB_v10009349mg             219   2e-65   
gb|ACN40537.1|  unknown                                                 219   2e-65   Picea sitchensis
ref|XP_010476269.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    219   2e-65   Camelina sativa [gold-of-pleasure]
ref|XP_010494747.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    219   2e-65   Camelina sativa [gold-of-pleasure]
ref|XP_011070460.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    219   2e-65   Sesamum indicum [beniseed]
ref|NP_172750.1|  glyceraldehyde 3-phosphate dehydrogenase GAPA2        218   3e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002892719.1|  GAPA-2                                             218   3e-65   Arabidopsis lyrata subsp. lyrata
gb|ABK25233.1|  unknown                                                 219   3e-65   Picea sitchensis
emb|CDY13649.1|  BnaA06g32740D                                          218   3e-65   Brassica napus [oilseed rape]
ref|XP_006417177.1|  hypothetical protein EUTSA_v10007809mg             218   3e-65   Eutrema salsugineum [saltwater cress]
ref|XP_006395535.1|  hypothetical protein EUTSA_v10004349mg             218   3e-65   Eutrema salsugineum [saltwater cress]
emb|CDY28536.1|  BnaC02g36240D                                          218   3e-65   Brassica napus [oilseed rape]
ref|XP_010942312.1|  PREDICTED: LOW QUALITY PROTEIN: glyceraldehy...    219   4e-65   
ref|XP_006844714.1|  hypothetical protein AMTR_s00016p00251680          218   5e-65   Amborella trichopoda
ref|NP_001289256.1|  glyceraldehyde-3-phosphate dehydrogenase A, ...    218   5e-65   Pyrus x bretschneideri [bai li]
gb|ACN40000.1|  unknown                                                 218   6e-65   Picea sitchensis
gb|EYU35565.1|  hypothetical protein MIMGU_mgv1a005886mg                219   6e-65   Erythranthe guttata [common monkey flower]
ref|NP_001052984.1|  Os04g0459500                                       218   6e-65   
gb|AAA33780.1|  glyceraldehyde-phosphate dehydrogenase                  217   1e-64   Pinus sylvestris [Scotch pine]
gb|ABK96233.1|  unknown                                                 217   1e-64   Populus trichocarpa x Populus deltoides
gb|ABK96725.1|  unknown                                                 217   1e-64   Populus trichocarpa x Populus deltoides
ref|XP_006386825.1|  hypothetical protein POPTR_0002s22600g             217   1e-64   
gb|ABK94956.1|  unknown                                                 217   1e-64   Populus trichocarpa [western balsam poplar]
gb|ABK24313.1|  unknown                                                 217   2e-64   Picea sitchensis
dbj|BAH57068.1|  AT1G12900                                              214   2e-64   Arabidopsis thaliana [mouse-ear cress]
gb|ABK00067.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    214   2e-64   Chlorokybus atmophyticus
ref|XP_004975847.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    216   4e-64   Setaria italica
ref|XP_002970103.1|  hypothetical protein SELMODRAFT_270825             215   5e-64   Selaginella moellendorffii
emb|CDY48981.1|  BnaA02g28150D                                          214   8e-64   Brassica napus [oilseed rape]
ref|XP_010929533.1|  PREDICTED: LOW QUALITY PROTEIN: glyceraldehy...    210   9e-64   
gb|ACT21568.1|  glyceraldehyde-3-phosphate dehydrogenase                214   1e-63   Bruguiera gymnorhiza [Burma mangrove]
gb|ABD37959.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      213   1e-63   Chlorokybus atmophyticus
dbj|BAJ34149.1|  unnamed protein product                                214   2e-63   Eutrema halophilum
ref|XP_002985183.1|  hypothetical protein SELMODRAFT_181561             214   2e-63   Selaginella moellendorffii
tpg|DAA37469.1|  TPA: glyceraldehyde-3-phosphate dehydrogenase1         213   3e-63   
emb|CAA30152.1|  GADPH (383 AA)                                         212   4e-63   Zea mays [maize]
ref|NP_001105414.1|  glyceraldehyde-3-phosphate dehydrogenase A, ...    213   5e-63   Zea mays [maize]
gb|AHA84230.1|  glyceraldehyde-3-phosphate dehydrogenase A              212   9e-63   Phaseolus vulgaris [French bean]
gb|KIY93372.1|  NADP-dependent glyceraldehydephosphatedehydrogena...    204   1e-62   Monoraphidium neglectum
gb|ABY20971.1|  glyceraldehyde-3-phosphate dehydrogenase A subunit      202   2e-62   Hypericum perforatum
gb|ABK00052.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    209   7e-62   Marchantia polymorpha
emb|CAC80388.1|  glyceraldehyde-3-phosphate dehydrogenase               209   1e-61   Marchantia polymorpha
gb|AFC88822.1|  glyceraldehyde-3-phosphate dehydrogenase-like pro...    207   1e-61   Miscanthus sinensis
gb|ABD37956.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      205   1e-61   Spermatozopsis similis
gb|ADU04755.1|  glyceraldehyde-3-phosphate dehydrogenase                204   5e-61   Mesostigma viride
ref|XP_007510189.1|  glyceraldehyde-3-phosphate dehydrogenase           204   5e-60   Bathycoccus prasinos
ref|XP_001771209.1|  predicted protein                                  204   9e-60   
dbj|BAA94304.1|  NADP-glyceraldehyde-3-phosphate dehydrogenase          203   1e-59   Chlamydomonas sp. W80
ref|XP_003548929.2|  PREDICTED: LOW QUALITY PROTEIN: glyceraldehy...    202   1e-59   
gb|ADU04754.1|  glyceraldehyde-3-phosphate dehydrogenase                200   1e-59   Mesostigma viride
ref|XP_001771246.1|  predicted protein                                  204   1e-59   
gb|ABK00056.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    201   2e-59   Mesostigma viride
gb|ABD37961.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      201   3e-59   Mesostigma viride
ref|XP_001779769.1|  predicted protein                                  202   7e-59   
gb|ABD37962.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A1     201   1e-58   Physcomitrella patens
ref|XP_001779753.1|  predicted protein                                  201   1e-58   
ref|XP_001753934.1|  predicted protein                                  201   1e-58   
gb|AHZ58488.1|  glyceraldehyde-3-phosphate dehydrogenase                199   3e-58   Syntrichia caninervis
sp|P09043.1|G3PA_TOBAC  RecName: Full=Glyceraldehyde-3-phosphate ...    198   2e-57   Nicotiana tabacum [American tobacco]
ref|XP_002955293.1|  hypothetical protein VOLCADRAFT_76662              196   6e-57   Volvox carteri f. nagariensis
gb|ABA01125.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    196   7e-57   Chlamydomonas incerta
ref|XP_001420043.1|  predicted protein                                  195   8e-57   Ostreococcus lucimarinus CCE9901
gb|ABG85190.1|  chloroplast glyceraldehyde-3-phosphate dehydrogen...    196   8e-57   Ostreococcus sp. 'lucimarinus'
ref|XP_008663258.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    196   1e-56   
ref|XP_008663264.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    196   1e-56   
gb|ABD37963.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A2     194   1e-56   Physcomitrella patens
gb|AAG23799.1|  chloroplast NADP-dependent glyceraldehyde 3-phosp...    189   1e-56   Cucurbita pepo
gb|ABD37954.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      196   1e-56   Cyanophora paradoxa
ref|XP_002503470.1|  glyceraldehyde-3-phosphate dehydrogenase a c...    195   2e-56   Micromonas commoda
gb|ACX37507.1|  chloroplast glyceraldehyde 3-phosphate dehydrogenase    196   2e-56   Botryococcus braunii
gb|AFW58485.1|  hypothetical protein ZEAMMB73_956640                    194   2e-56   
ref|XP_001766703.1|  predicted protein                                  194   2e-56   
emb|CBL43264.1|  glyceraldehyde-3-phosphate dehydrogenase               196   3e-56   Solanum tuberosum [potatoes]
ref|XP_001689871.1|  glyceraldehyde-3-phosphate dehydrogenase           194   3e-56   Chlamydomonas reinhardtii
ref|XP_003055659.1|  hypothetical protein MICPUCDRAFT_49403             194   4e-56   Micromonas pusilla CCMP1545
ref|XP_009786329.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    196   4e-56   Nicotiana sylvestris
ref|XP_009595874.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    196   5e-56   Nicotiana tomentosiformis
ref|XP_008664191.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    195   5e-56   Zea mays [maize]
gb|KJB57938.1|  hypothetical protein B456_009G186400                    194   6e-56   Gossypium raimondii
dbj|BAN09110.1|  glyceraldehyde-3-phosphate dehydrogenase               189   8e-56   Artemisia indica
sp|P09044.1|G3PB_TOBAC  RecName: Full=Glyceraldehyde-3-phosphate ...    195   8e-56   Nicotiana tabacum [American tobacco]
gb|ABD37965.1|  glyceraldehyde-3-phosphate dehydrogenase subunit B      194   1e-55   Mesostigma viride
gb|AES74101.2|  glyceraldehyde-3-phosphate dehydrogenase B              191   1e-55   Medicago truncatula
ref|XP_006342537.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    194   1e-55   Solanum tuberosum [potatoes]
ref|XP_003081785.1|  NADP-glyceraldehyde-3-phosphate dehydrogenas...    192   2e-55   
ref|XP_004253122.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    194   2e-55   Solanum lycopersicum
gb|ABG85189.1|  chloroplast glyceraldehyde-3-phosphate dehydrogen...    192   2e-55   Ostreococcus tauri
gb|KHG26323.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    194   2e-55   Gossypium arboreum [tree cotton]
gb|KJB57936.1|  hypothetical protein B456_009G186400                    194   2e-55   Gossypium raimondii
ref|XP_006855683.1|  hypothetical protein AMTR_s00044p00131190          193   3e-55   
ref|XP_003558903.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    194   3e-55   
gb|ABD37955.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      192   3e-55   Scherffelia dubia
gb|KJB14201.1|  hypothetical protein B456_002G114000                    194   3e-55   Gossypium raimondii
emb|CAA33262.1|  unnamed protein product                                193   4e-55   Pisum sativum [garden pea]
sp|P12859.2|G3PB_PEA  RecName: Full=Glyceraldehyde-3-phosphate de...    193   4e-55   Pisum sativum [garden pea]
gb|ACA35006.1|  glyceraldehyde-3-phosphate dehydrogenase                191   5e-55   Dunaliella salina
ref|XP_011399143.1|  Glyceraldehyde-3-phosphate dehydrogenase A, ...    192   6e-55   Auxenochlorella protothecoides
ref|XP_003603851.1|  Glyceraldehyde-3-phosphate dehydrogenase           193   6e-55   Medicago truncatula
gb|KHG00663.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    192   7e-55   Gossypium arboreum [tree cotton]
ref|XP_007018105.1|  Glyceraldehyde-3-phosphate dehydrogenase B s...    192   7e-55   
gb|ABF93789.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    189   8e-55   Oryza sativa Japonica Group [Japonica rice]
gb|KGN49135.1|  hypothetical protein Csa_6G514950                       185   9e-55   Cucumis sativus [cucumbers]
gb|KDP36765.1|  hypothetical protein JCGZ_08056                         192   9e-55   Jatropha curcas
ref|XP_009384599.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    192   1e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009384600.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    192   1e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010539030.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    192   1e-54   Tarenaya hassleriana [spider flower]
gb|ABK00057.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    190   2e-54   Mesostigma viride
gb|ABC00187.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    190   2e-54   Dunaliella viridis
ref|XP_008786670.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    191   2e-54   Phoenix dactylifera
ref|XP_009780936.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    191   2e-54   Nicotiana sylvestris
ref|XP_010918353.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    191   2e-54   Elaeis guineensis
ref|XP_009629570.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    191   2e-54   Nicotiana tomentosiformis
ref|XP_007211185.1|  hypothetical protein PRUPE_ppa005598mg             191   2e-54   Prunus persica
ref|XP_004500847.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    193   2e-54   Cicer arietinum [garbanzo]
ref|XP_006342156.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    191   2e-54   
gb|EMS61784.1|  Glyceraldehyde-3-phosphate dehydrogenase A, chlor...    189   3e-54   Triticum urartu
ref|XP_008237955.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    191   3e-54   Prunus mume [ume]
gb|AFG28405.1|  glyceraldehyde-3-phosphate dehydrogenase B              191   3e-54   Pyrus x bretschneideri [bai li]
ref|XP_008346447.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    191   3e-54   Malus domestica [apple tree]
ref|NP_001289237.1|  glyceraldehyde-3-phosphate dehydrogenase B, ...    191   3e-54   Pyrus x bretschneideri [bai li]
ref|XP_010061201.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    191   4e-54   Eucalyptus grandis [rose gum]
emb|CAC80389.2|  glyceraldehyde-3-phosphate dehydrogenase               191   4e-54   Marchantia polymorpha
ref|XP_004238446.2|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    191   4e-54   
gb|EPS70760.1|  hypothetical protein M569_03997                         191   4e-54   Genlisea aurea
ref|XP_009362871.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    191   4e-54   Pyrus x bretschneideri [bai li]
gb|ABD37953.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      187   4e-54   Chlorella sp. JP-2005
ref|XP_005644071.1|  glyceraldehyde-3-phosphate dehydrogenase           189   4e-54   Coccomyxa subellipsoidea C-169
ref|XP_006307502.1|  hypothetical protein CARUB_v10009127mg             190   5e-54   Capsella rubella
ref|XP_006383783.1|  hypothetical protein POPTR_0005s27550g             190   5e-54   
ref|XP_006473831.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    191   5e-54   Citrus sinensis [apfelsine]
ref|XP_010270515.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    190   6e-54   Nelumbo nucifera [Indian lotus]
ref|XP_002307806.1|  glyceraldehyde-3-phosphate dehydrogenase fam...    190   6e-54   Populus trichocarpa [western balsam poplar]
ref|NP_001240080.1|  uncharacterized protein LOC100806482               190   8e-54   Glycine max [soybeans]
emb|CAC80372.1|  glyceraldehyde-3-phosphate dehydrogenase               186   8e-54   Capsicum annuum
ref|XP_004300121.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    190   9e-54   Fragaria vesca subsp. vesca
ref|XP_006577850.1|  PREDICTED: uncharacterized protein LOC100806...    190   9e-54   Glycine max [soybeans]
ref|XP_006581071.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    190   9e-54   
gb|KHN20097.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    190   9e-54   Glycine soja [wild soybean]
gb|ACU20783.1|  unknown                                                 190   1e-53   Glycine max [soybeans]
gb|ACJ84309.1|  unknown                                                 189   1e-53   Medicago truncatula
ref|NP_001048847.1|  Os03g0129300                                       189   1e-53   
ref|NP_001237135.1|  glyceraldehyde-3-phosphate dehydrogenase B s...    189   1e-53   
ref|XP_011074072.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    189   1e-53   Sesamum indicum [beniseed]
ref|XP_010478985.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    188   1e-53   Camelina sativa [gold-of-pleasure]
pdb|2PKQ|O  Chain O, Crystal Structure Of The Photosynthetic A2b2...    187   1e-53   Spinacia oleracea
gb|AIU56855.1|  glyceraldehyde-3-phosphate dehydrogenase B              187   1e-53   Brassica rapa subsp. chinensis [bok-choy]
ref|XP_011034836.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    189   1e-53   Populus euphratica
gb|AAD10210.1|  glyceraldehyde 3-phosphate dehydrogenase B subunit      188   2e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006435406.1|  hypothetical protein CICLE_v10001114mg             189   2e-53   Citrus clementina [clementine]
ref|XP_002982608.1|  hypothetical protein SELMODRAFT_179517             188   2e-53   Selaginella moellendorffii
ref|XP_006649326.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    189   2e-53   
ref|XP_010478986.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    189   2e-53   Camelina sativa [gold-of-pleasure]
emb|CDY69523.1|  BnaC08g46180D                                          187   2e-53   Brassica napus [oilseed rape]
ref|XP_010500213.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    189   2e-53   Camelina sativa [gold-of-pleasure]
ref|XP_010686856.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    189   2e-53   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_174996.1|  glyceraldehyde-3-phosphate dehydrogenase B            189   2e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006395998.1|  hypothetical protein EUTSA_v10004217mg             189   2e-53   Eutrema salsugineum [saltwater cress]
ref|XP_007135965.1|  hypothetical protein PHAVU_009G006600g             188   3e-53   Phaseolus vulgaris [French bean]
ref|XP_002891244.1|  glyceraldehyde-3-phosphate dehydrogenase B s...    188   3e-53   
emb|CDP07271.1|  unnamed protein product                                189   3e-53   Coffea canephora [robusta coffee]
gb|ABD37957.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      186   3e-53   Cladophora rupestris
emb|CAN69459.1|  hypothetical protein VITISV_021576                     188   3e-53   Vitis vinifera
ref|XP_002273754.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    188   3e-53   
ref|XP_009107645.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    188   3e-53   
ref|XP_002981126.1|  hypothetical protein SELMODRAFT_271457             188   3e-53   
sp|P12860.1|G3PB_SPIOL  RecName: Full=Glyceraldehyde-3-phosphate ...    188   3e-53   
ref|XP_011041188.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    188   4e-53   
gb|KFK29151.1|  hypothetical protein AALP_AA7G095400                    188   4e-53   
gb|EMT30317.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    188   4e-53   
dbj|BAJ86633.1|  predicted protein                                      187   5e-53   
ref|XP_009382077.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    188   5e-53   
ref|XP_004985859.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    187   5e-53   
gb|EMS49604.1|  Glyceraldehyde-3-phosphate dehydrogenase B, chlor...    187   5e-53   
dbj|BAJ87214.1|  predicted protein                                      187   6e-53   
ref|XP_010507000.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    177   8e-53   
gb|ABK24645.1|  unknown                                                 187   8e-53   
gb|ACN40006.1|  unknown                                                 187   9e-53   
gb|ACN40526.1|  unknown                                                 187   1e-52   
ref|XP_002300632.2|  hypothetical protein POPTR_0002s00840g             187   1e-52   
gb|AEO45784.1|  glyceraldehyde-3-phosphate dehydrogenase B              187   1e-52   
gb|ABD37964.1|  glyceraldehyde-3-phosphate dehydrogenase subunit B      187   1e-52   
ref|WP_015160704.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    183   2e-52   
ref|XP_004145550.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    186   2e-52   
emb|CAC80378.2|  glyceraldehyde-3-phosphate dehydrogenase               186   3e-52   
emb|CAC80394.1|  glyceraldehyde-3-phosphate dehydrogenase               181   4e-52   
ref|XP_008452998.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    185   4e-52   
ref|XP_008452997.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    185   5e-52   
emb|CAC80373.1|  glyceraldehyde-3-phosphate dehydrogenase               181   1e-51   
emb|CAC80393.1|  glyceraldehyde-3-phosphate dehydrogenase               181   1e-51   
emb|CAC80392.1|  glyceraldehyde-3-phosphate dehydrogenase               180   2e-51   
ref|XP_002510706.1|  glyceraldehyde 3-phosphate dehydrogenase, pu...    184   2e-51   
gb|ABD37958.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      180   2e-51   
gb|ABF74607.1|  chloroplast glyceraldehyde-3-phosphate dehydrogen...    176   2e-51   
ref|XP_010094540.1|  Glyceraldehyde-3-phosphate dehydrogenase B         190   3e-51   
ref|XP_008650588.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    183   3e-51   
sp|P30724.1|G3PA_GRAGA  RecName: Full=Glyceraldehyde-3-phosphate ...    182   3e-51   
emb|CEF96577.1|  Glyceraldehyde 3-phosphate dehydrogenase, NAD(P)...    182   3e-51   
gb|ELS46726.1|  glyceraldehyde-3-phosphate dehydrogenase 2              179   4e-51   
ref|XP_005715477.1|  glyceraldehyde-3-phosphate dehydrogenase           182   4e-51   
sp|P34919.1|G3PA_CHOCR  RecName: Full=Glyceraldehyde-3-phosphate ...    182   4e-51   
ref|WP_002799040.1|  glyceraldehyde-3-phosphate dehydrogenase           179   6e-51   
ref|WP_015116915.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    179   6e-51   
ref|WP_012265625.1|  glyceraldehyde-3-phosphate dehydrogenase           179   6e-51   
ref|WP_015189930.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    179   7e-51   
ref|XP_003074208.1|  NADP-glyceraldehyde-3-phosphate dehydrogenas...    182   7e-51   
gb|ABG85191.1|  chloroplast glyceraldehyde-3-phosphate dehydrogen...    182   7e-51   
ref|XP_007515295.1|  glyceraldehyde-3-phosphate dehydrogenase           181   8e-51   
emb|CCH97953.1|  Glyceraldehyde-3-phosphate dehydrogenase 2             179   8e-51   
ref|XP_009362872.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    182   9e-51   
ref|XP_001415434.1|  predicted protein                                  181   1e-50   
ref|XP_010430771.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    172   1e-50   
ref|WP_039900510.1|  glyceraldehyde-3-phosphate dehydrogenase           178   2e-50   
emb|CDP18560.1|  unnamed protein product                                179   2e-50   
ref|WP_004268080.1|  glyceraldehyde-3-phosphate dehydrogenase           178   2e-50   
ref|WP_002731954.1|  glyceraldehyde-3-phosphate dehydrogenase           178   2e-50   
dbj|GAL93645.1|  NADPH-dependent glyceraldehyde-3-phosphate dehyd...    178   2e-50   
ref|WP_002780388.1|  Glyceraldehyde-3-phosphate dehydrogenase 2         178   3e-50   
ref|WP_015199557.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    178   3e-50   
emb|CCI33980.1|  Glyceraldehyde-3-phosphate dehydrogenase 2             178   3e-50   
emb|CCH91489.1|  Glyceraldehyde-3-phosphate dehydrogenase 2             178   3e-50   
emb|CCI19184.1|  Glyceraldehyde-3-phosphate dehydrogenase 2             178   3e-50   
ref|XP_011034837.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    180   4e-50   
ref|WP_028954384.1|  glyceraldehyde-3-phosphate dehydrogenase           177   4e-50   
ref|WP_015191528.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    177   5e-50   
ref|WP_044492436.1|  glyceraldehyde-3-phosphate dehydrogenase           177   5e-50   
gb|ABK00053.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    179   5e-50   
gb|ERT05629.1|  glyceraldehyde-3-phosphate dehydrogenase, type I        176   5e-50   
gb|EGJ33840.1|  glyceraldehyde 3-phosphate dehydrogenase, NADP+         177   6e-50   
ref|WP_009459769.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    176   8e-50   
ref|WP_016865320.1|  glyceraldehyde-3-phosphate dehydrogenase           176   8e-50   
ref|WP_028949102.1|  glyceraldehyde-3-phosphate dehydrogenase           176   9e-50   
ref|WP_015156647.1|  MULTISPECIES: glyceraldehyde 3-phosphate deh...    176   1e-49   
ref|WP_036481597.1|  glyceraldehyde-3-phosphate dehydrogenase           176   1e-49   
ref|XP_002507103.1|  glyceraldehyde-3-phosphate dehydrogenase B         177   2e-49   
ref|WP_040484381.1|  glyceraldehyde-3-phosphate dehydrogenase           176   2e-49   
ref|XP_003056194.1|  hypothetical protein MICPUCDRAFT_25339             177   2e-49   
ref|WP_006634268.1|  glyceraldehyde-3-phosphate dehydrogenase           176   2e-49   
ref|WP_015220848.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    176   2e-49   
gb|ADB81491.1|  glyceraldehyde-3-phosphate dehydrogenase                174   3e-49   
ref|WP_006619928.1|  glyceraldehyde-3-phosphate dehydrogenase           175   3e-49   
ref|WP_008050956.1|  glyceraldehyde-3-phosphate dehydrogenase           175   3e-49   
dbj|BAI88897.1|  glyceraldehyde-3-phosphate dehydrogenase               175   3e-49   
gb|EDZ94203.1|  glyceraldehyde-3-phosphate dehydrogenase, type I        175   3e-49   
ref|WP_039933175.1|  glyceraldehyde-3-phosphate dehydrogenase           175   4e-49   
ref|XP_002540513.1|  glyceraldehyde 3-phosphate dehydrogenase, pu...    171   4e-49   
ref|WP_042151414.1|  glyceraldehyde-3-phosphate dehydrogenase           174   5e-49   
ref|WP_026787014.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    174   5e-49   
gb|ADB81492.1|  glyceraldehyde-3-phosphate dehydrogenase                174   5e-49   
ref|WP_007307714.1|  glyceraldehyde-3-phosphate dehydrogenase           174   7e-49   
ref|WP_015178398.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    174   7e-49   
ref|WP_039753495.1|  glyceraldehyde-3-phosphate dehydrogenase           174   7e-49   
ref|WP_041226596.1|  glyceraldehyde-3-phosphate dehydrogenase           174   7e-49   
ref|XP_005704189.1|  glyceraldehyde-3-phosphate dehydrogenase (NA...    176   8e-49   
ref|WP_015172689.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    174   9e-49   
sp|P80505.3|G3P2_SYNY3  RecName: Full=Glyceraldehyde-3-phosphate ...    174   9e-49   
emb|CAA58550.1|  glyceraldehyde-3-phosphate dehydrogenase (NADP+)...    174   9e-49   
ref|WP_010874115.1|  glyceraldehyde-3-phosphate dehydrogenase           174   1e-48   
gb|EDX77136.1|  glyceraldehyde-3-phosphate dehydrogenase, type I        174   1e-48   
ref|WP_035157424.1|  glyceraldehyde-3-phosphate dehydrogenase           174   1e-48   
gb|EDX87031.1|  glyceraldehyde-3-phosphate dehydrogenase, type I        173   1e-48   
ref|WP_029637377.1|  glyceraldehyde-3-phosphate dehydrogenase [         174   1e-48   
gb|AFZ13204.1|  glyceraldehyde 3-phosphate dehydrogenase (NADP+)        174   1e-48   
ref|WP_015954248.1|  glyceraldehyde-3-phosphate dehydrogenase           173   2e-48   
ref|WP_044205566.1|  glyceraldehyde-3-phosphate dehydrogenase           174   2e-48   
ref|WP_019493013.1|  glyceraldehyde-3-phosphate dehydrogenase           173   2e-48   
ref|WP_027840812.1|  glyceraldehyde-3-phosphate dehydrogenase           173   2e-48   
ref|WP_015222961.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    173   2e-48   
ref|WP_017320834.1|  glyceraldehyde-3-phosphate dehydrogenase           173   2e-48   
ref|WP_009544928.1|  glyceraldehyde-3-phosphate dehydrogenase           173   2e-48   
ref|WP_017291296.1|  glyceraldehyde-3-phosphate dehydrogenase           173   2e-48   
gb|AGW80488.1|  glyceraldehyde 3 phosphate dehydrogenase                172   2e-48   
ref|WP_009626155.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    172   2e-48   
ref|WP_038015315.1|  glyceraldehyde-3-phosphate dehydrogenase           172   3e-48   
ref|WP_015145817.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    172   3e-48   
dbj|BAK05515.1|  predicted protein                                      167   3e-48   
gb|ADB81490.1|  glyceraldehyde-3-phosphate dehydrogenase                167   3e-48   
ref|WP_009343864.1|  glyceraldehyde-3-phosphate dehydrogenase           172   3e-48   
ref|WP_017293448.1|  glyceraldehyde-3-phosphate dehydrogenase           172   4e-48   
ref|WP_023075014.1|  glyceraldehyde 3-phosphate dehydrogenase (na...    172   4e-48   
ref|WP_016860363.1|  glyceraldehyde-3-phosphate dehydrogenase           172   4e-48   
ref|WP_017312563.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    172   4e-48   
ref|WP_026719817.1|  glyceraldehyde-3-phosphate dehydrogenase           172   4e-48   
ref|WP_006528243.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    172   5e-48   
ref|WP_008276272.1|  glyceraldehyde-3-phosphate dehydrogenase           172   5e-48   
ref|WP_006279110.1|  glyceraldehyde-3-phosphate dehydrogenase           172   5e-48   
ref|WP_017659782.1|  glyceraldehyde-3-phosphate dehydrogenase           172   5e-48   
ref|WP_006625490.1|  glyceraldehyde-3-phosphate dehydrogenase           172   6e-48   
ref|WP_012595832.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    171   7e-48   
ref|WP_015168952.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    171   7e-48   
sp|Q8VXQ9.1|G3PA_SCEVA  RecName: Full=Glyceraldehyde-3-phosphate ...    171   9e-48   
ref|WP_017742837.1|  glyceraldehyde-3-phosphate dehydrogenase           171   1e-47   
ref|WP_015163373.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    171   1e-47   
ref|WP_015109880.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    171   1e-47   
ref|WP_011613378.1|  glyceraldehyde-3-phosphate dehydrogenase           170   2e-47   
ref|WP_013324586.1|  glyceraldehyde-3-phosphate dehydrogenase           170   2e-47   
gb|ABS86942.1|  glyceraldehyde-3-phosphate dehydrogenase                164   2e-47   
ref|WP_039200023.1|  glyceraldehyde-3-phosphate dehydrogenase           170   2e-47   
ref|WP_026731665.1|  glyceraldehyde-3-phosphate dehydrogenase           170   2e-47   
emb|CAC80391.2|  glyceraldehyde-3-phosphate dehydrogenase               169   2e-47   
ref|WP_009787048.1|  glyceraldehyde-3-phosphate dehydrogenase           170   2e-47   
ref|WP_007358062.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    170   3e-47   
ref|WP_015132368.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    170   3e-47   
ref|WP_015080375.1|  type I glyceraldehyde-3-phosphate dehydrogenase    170   3e-47   
ref|WP_015146993.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    170   3e-47   
ref|WP_015141410.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    170   3e-47   
ref|WP_024545764.1|  glyceraldehyde-3-phosphate dehydrogenase           170   3e-47   
ref|WP_026103380.1|  glyceraldehyde-3-phosphate dehydrogenase           169   4e-47   
ref|WP_022607378.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    169   4e-47   
ref|WP_026098586.1|  glyceraldehyde-3-phosphate dehydrogenase           169   4e-47   
gb|KIE07728.1|  glyceraldehyde-3-phosphate dehydrogenase                169   5e-47   
gb|ABD37960.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      169   5e-47   
ref|WP_012305745.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    169   5e-47   
gb|AAP32469.1|  glyceraldehyde-3-phosphate dehydrogenase subunit A      171   6e-47   
ref|WP_026079517.1|  glyceraldehyde-3-phosphate dehydrogenase           169   8e-47   
ref|WP_035830661.1|  glyceraldehyde-3-phosphate dehydrogenase           169   9e-47   
ref|WP_027404344.1|  glyceraldehyde-3-phosphate dehydrogenase           169   9e-47   
ref|WP_008231341.1|  NADPH-dependent glyceraldehyde-3-phosphate d...    168   1e-46   
ref|WP_026082358.1|  glyceraldehyde-3-phosphate dehydrogenase           168   1e-46   
gb|AHJ31016.1|  NADPH-dependent glyceraldehyde-3-phosphate dehydr...    166   1e-46   
ref|WP_006510998.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    168   1e-46   
ref|WP_036001291.1|  glyceraldehyde-3-phosphate dehydrogenase           168   2e-46   
ref|WP_006515538.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    168   2e-46   
ref|WP_025781786.1|  glyceraldehyde-3-phosphate dehydrogenase           168   2e-46   
ref|WP_025965118.1|  glyceraldehyde-3-phosphate dehydrogenase           164   2e-46   
ref|WP_016876187.1|  glyceraldehyde-3-phosphate dehydrogenase           167   2e-46   
ref|WP_015182060.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    167   2e-46   
ref|WP_013190254.1|  glyceraldehyde-3-phosphate dehydrogenase           167   2e-46   
gb|KIJ84331.1|  glyceraldehyde-3-phosphate dehydrogenase                167   3e-46   
ref|WP_028085442.1|  glyceraldehyde-3-phosphate dehydrogenase           167   3e-46   
ref|WP_009555393.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    167   3e-46   
gb|ABA01156.1|  chloroplast glyceraldehyde-3-phosphate dehydrogenase    167   4e-46   
ref|WP_025944290.1|  glyceraldehyde-3-phosphate dehydrogenase           165   4e-46   
ref|WP_015212526.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    167   4e-46   
gb|ACN57670.1|  At3g26650-like protein                                  160   4e-46   
ref|WP_041036790.1|  glyceraldehyde-3-phosphate dehydrogenase           167   4e-46   
ref|XP_009362873.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    168   5e-46   
ref|WP_019504971.1|  glyceraldehyde-3-phosphate dehydrogenase           166   5e-46   
ref|XP_003603850.1|  Glyceraldehyde-3-phosphate dehydrogenase           170   5e-46   
ref|WP_018398495.1|  glyceraldehyde-3-phosphate dehydrogenase           166   6e-46   
ref|WP_023172550.1|  glyceraldehyde-3-phosphate dehydrogenase           166   6e-46   
gb|KDO85174.1|  hypothetical protein CISIN_1g012940mg                   168   6e-46   
ref|XP_005534792.1|  glyceraldehyde-3-phosphate dehydrogenase           168   7e-46   
ref|WP_015210633.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    166   7e-46   
ref|WP_016951733.1|  glyceraldehyde-3-phosphate dehydrogenase           166   7e-46   
gb|AAD10216.1|  glyceraldehyde-3-phosphate dehydrogenase                169   8e-46   
ref|WP_006172746.1|  glyceraldehyde-3-phosphate dehydrogenase           166   8e-46   
gb|AES74103.2|  glyceraldehyde-3-phosphate dehydrogenase B              167   9e-46   
ref|WP_026099703.1|  glyceraldehyde-3-phosphate dehydrogenase           166   1e-45   
ref|WP_040932844.1|  glyceraldehyde-3-phosphate dehydrogenase           166   1e-45   
ref|WP_011375588.1|  glyceraldehyde-3-phosphate dehydrogenase           166   1e-45   
ref|WP_035985041.1|  glyceraldehyde-3-phosphate dehydrogenase           166   1e-45   
ref|WP_025938864.1|  glyceraldehyde-3-phosphate dehydrogenase           165   2e-45   
ref|WP_026072888.1|  glyceraldehyde-3-phosphate dehydrogenase           165   2e-45   
gb|ACN57671.1|  At3g26650-like protein                                  159   2e-45   
ref|WP_012407249.1|  glyceraldehyde-3-phosphate dehydrogenase           165   2e-45   
gb|ABD37966.1|  glyceraldehyde-3-phosphate dehydrogenase subunit B      164   2e-45   
ref|WP_006197155.1|  glyceraldehyde-3-phosphate dehydrogenase           165   2e-45   
ref|WP_025895306.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    165   2e-45   
ref|WP_025951324.1|  glyceraldehyde-3-phosphate dehydrogenase           165   2e-45   
ref|WP_025947080.1|  glyceraldehyde-3-phosphate dehydrogenase           165   3e-45   
ref|WP_025970042.1|  glyceraldehyde-3-phosphate dehydrogenase           165   3e-45   
ref|WP_025887309.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    165   3e-45   
ref|WP_025921298.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    165   3e-45   
gb|AIQ96116.1|  NADPH-dependent glyceraldehyde-3-phosphate dehydr...    164   3e-45   
emb|CAC80374.1|  glyceraldehyde-3-phosphate dehydrogenase               164   3e-45   
gb|ADD54591.1|  putative glyceraldehyde-3-phosphate dehydrogenase       160   3e-45   
ref|WP_038650443.1|  glyceraldehyde-3-phosphate dehydrogenase           164   4e-45   
ref|WP_025900197.1|  glyceraldehyde-3-phosphate dehydrogenase           162   4e-45   
ref|WP_036906091.1|  glyceraldehyde-3-phosphate dehydrogenase           164   4e-45   
ref|WP_006911098.1|  glyceraldehyde-3-phosphate dehydrogenase           164   4e-45   
ref|WP_025924004.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    164   4e-45   
ref|WP_011817500.1|  glyceraldehyde-3-phosphate dehydrogenase           164   4e-45   
ref|WP_025935563.1|  glyceraldehyde-3-phosphate dehydrogenase           164   5e-45   
gb|AAG23800.1|  chloroplast NADP-dependent glyceraldehyde 3-phosp...    159   5e-45   
ref|WP_025970551.1|  glyceraldehyde-3-phosphate dehydrogenase           164   5e-45   
ref|WP_026100517.1|  glyceraldehyde-3-phosphate dehydrogenase           164   5e-45   
gb|ADB81483.1|  glyceraldehyde-3-phosphate dehydrogenase                159   6e-45   
ref|WP_015228987.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    164   6e-45   
ref|WP_019474872.1|  glyceraldehyde-3-phosphate dehydrogenase           164   6e-45   
ref|WP_015113093.1|  glyceraldehyde 3-phosphate dehydrogenase (NA...    164   6e-45   
ref|WP_028089468.1|  glyceraldehyde-3-phosphate dehydrogenase           164   6e-45   
ref|WP_008311916.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    164   6e-45   
ref|WP_025941106.1|  glyceraldehyde-3-phosphate dehydrogenase           164   7e-45   



>gb|ABW89104.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
Length=195

 Score =   224 bits (572),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 157/164 (96%), Positives = 160/164 (98%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA
Sbjct  32   KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA  91

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRE+A NEL+GILSVCDEPLVSVDFRCSDVS
Sbjct  92   LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFREAADNELNGILSVCDEPLVSVDFRCSDVS  151

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  152  STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  195



>gb|ABW89099.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89100.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89101.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89102.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89103.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89105.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89106.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89107.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89108.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89109.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89110.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89111.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89112.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89113.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89114.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89115.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89116.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABW89117.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
Length=206

 Score =   224 bits (572),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 157/164 (96%), Positives = 160/164 (98%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA
Sbjct  43   KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA  102

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRE+A NEL+GILSVCDEPLVSVDFRCSDVS
Sbjct  103  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFREAADNELNGILSVCDEPLVSVDFRCSDVS  162

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  163  STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  206



>gb|ABG35250.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35251.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35252.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35253.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35256.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35257.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35258.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35259.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35260.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35261.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35262.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35263.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35264.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35265.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35266.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35268.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35269.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35270.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35271.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35272.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35273.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35274.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35275.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35276.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35277.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35278.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35279.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35280.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35281.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35282.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35283.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35284.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35285.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35286.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35287.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35288.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35289.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35290.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35291.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35292.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35293.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35294.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35295.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35296.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35297.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35298.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35299.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35300.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35301.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35302.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35303.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35304.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35305.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35306.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35307.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35308.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35309.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35310.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35311.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35312.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35313.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
Length=224

 Score =   224 bits (571),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 157/164 (96%), Positives = 160/164 (98%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA
Sbjct  61   KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA  120

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRE+A NEL+GILSVCDEPLVSVDFRCSDVS
Sbjct  121  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFREAADNELNGILSVCDEPLVSVDFRCSDVS  180

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  181  STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  224



>gb|ABG35254.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
 gb|ABG35255.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
Length=224

 Score =   224 bits (570),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 157/164 (96%), Positives = 160/164 (98%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA
Sbjct  61   KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA  120

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRE+A NEL+GILSVCDEPLVSVDFRCSDVS
Sbjct  121  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFREAADNELNGILSVCDEPLVSVDFRCSDVS  180

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  181  STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  224



>gb|ABG35267.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Helianthus 
annuus]
Length=224

 Score =   222 bits (566),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 156/164 (95%), Positives = 160/164 (98%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA
Sbjct  61   KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA  120

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRE+A NEL+GILSVCDEPLVSVDFRCSDVS
Sbjct  121  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFREAADNELNGILSVCDEPLVSVDFRCSDVS  180

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVDSSLTMVMGDDMVKVIAWYD+EWGYSQRVVDLADIVAN WK
Sbjct  181  STVDSSLTMVMGDDMVKVIAWYDHEWGYSQRVVDLADIVANNWK  224



>gb|KJB11770.1| hypothetical protein B456_001G276400 [Gossypium raimondii]
Length=305

 Score =   224 bits (572),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 155/164 (95%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  142  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNGIA  201

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA  EL GILSVCDEPLVSVDFRCSDVS
Sbjct  202  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESAEKELKGILSVCDEPLVSVDFRCSDVS  261

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVD+SLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  262  STVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  305



>gb|KDO63479.1| hypothetical protein CISIN_1g013492mg [Citrus sinensis]
Length=293

 Score =   224 bits (570),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 156/164 (95%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  130  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPALKGKLNGIA  189

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA NEL GILSVCDEPLVSVDFRCSDVS
Sbjct  190  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKGILSVCDEPLVSVDFRCSDVS  249

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVDSSLT+VMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  250  STVDSSLTLVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  293



>ref|XP_009118049.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Brassica rapa]
Length=317

 Score =   224 bits (570),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 153/164 (93%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  154  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIA  213

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++AANEL GIL VCDEPLVSVDFRCSDVS
Sbjct  214  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAANELKGILDVCDEPLVSVDFRCSDVS  273

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            ST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDL+DIVAN WK
Sbjct  274  STIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLSDIVANNWK  317



>dbj|BAD93961.1| glyceraldehyde 3-phosphate dehydrogenase A subunit [Arabidopsis 
thaliana]
Length=161

 Score =   218 bits (556),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 151/161 (94%), Positives = 155/161 (96%), Gaps = 0/161 (0%)
 Frame = -3

Query  623  MTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRV  444
            MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRV
Sbjct  1    MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRV  60

Query  443  PTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstv  264
            PTPNVSVVDLVVQVSKKTFAEEVNAAFR+SA  EL GIL VCDEPLVSVDFRCSD S+T+
Sbjct  61   PTPNVSVVDLVVQVSKKTFAEEVNAAFRDSAEKELKGILDVCDEPLVSVDFRCSDFSTTI  120

Query  263  dssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  121  DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  161



>gb|AGJ50596.1| GAPDH [Pericallis cruenta]
Length=399

 Score =   226 bits (575),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 157/164 (96%), Positives = 161/164 (98%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA
Sbjct  235  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA  294

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRE+AANEL+GILSVCDEPLVSVDFRCSDVS
Sbjct  295  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFREAAANELNGILSVCDEPLVSVDFRCSDVS  354

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVDSSLTMVMGDDM+KVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  355  STVDSSLTMVMGDDMLKVIAWYDNEWGYSQRVVDLADIVANNWK  398



>ref|XP_003548805.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Glycine max]
Length=403

 Score =   226 bits (575),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 156/164 (95%), Positives = 160/164 (98%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  240  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNGIA  299

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA NEL GILSVCDEPLVSVDFRC+DVS
Sbjct  300  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELQGILSVCDEPLVSVDFRCTDVS  359

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN+WK
Sbjct  360  STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKWK  403



>gb|KHN46369.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Glycine 
soja]
Length=403

 Score =   225 bits (574),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 156/164 (95%), Positives = 160/164 (98%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  240  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNGIA  299

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA NEL GILSVCDEPLVSVDFRC+DVS
Sbjct  300  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKGILSVCDEPLVSVDFRCTDVS  359

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN+WK
Sbjct  360  STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKWK  403



>ref|NP_001238484.1| glyceraldehyde-3-phosphate dehydrogenase A subunit [Glycine max]
 gb|ABA86963.1| glyceraldehyde-3-phosphate dehydrogenase A subunit [Glycine max]
Length=403

 Score =   225 bits (574),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 156/164 (95%), Positives = 160/164 (98%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  240  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNGIA  299

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA NEL GILSVCDEPLVSVDFRC+DVS
Sbjct  300  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKGILSVCDEPLVSVDFRCTDVS  359

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN+WK
Sbjct  360  STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKWK  403



>gb|KHN46819.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Glycine 
soja]
Length=403

 Score =   225 bits (574),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 156/164 (95%), Positives = 160/164 (98%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  240  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNGIA  299

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA NEL GILSVCDEPLVSVDFRC+DVS
Sbjct  300  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKGILSVCDEPLVSVDFRCTDVS  359

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN+WK
Sbjct  360  STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKWK  403



>gb|KHG29734.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Gossypium 
arboreum]
Length=360

 Score =   224 bits (570),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 155/164 (95%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  197  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNGIA  256

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA  EL GILSVCDEPLVSVDFRCSDVS
Sbjct  257  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESAEKELKGILSVCDEPLVSVDFRCSDVS  316

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVD+SLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  317  STVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  360



>ref|XP_010528120.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Tarenaya hassleriana]
Length=280

 Score =   221 bits (563),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 155/164 (95%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  117  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIA  176

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRE+A NEL GIL VCDEPLVSVDFRCSDVS
Sbjct  177  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFREAADNELKGILEVCDEPLVSVDFRCSDVS  236

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  237  STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  280



>pdb|1RM3|O Chain O, Crystal Structure Of Mutant T33a Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM3|A Chain A, Crystal Structure Of Mutant T33a Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM3|B Chain B, Crystal Structure Of Mutant T33a Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
Length=337

 Score =   223 bits (567),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 152/164 (93%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAA LNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  173  KGTMTTTHSYTGDQRLLDASHRDLRRARAACLNIVPTSTGAAKAVALVLPNLKGKLNGIA  232

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA NEL GILSVCDEPLVS+DFRC+DVS
Sbjct  233  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKGILSVCDEPLVSIDFRCTDVS  292

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            ST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN+W+
Sbjct  293  STIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKWQ  336



>pdb|1NBO|O Chain O, The Dual Coenzyme Specificity Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase Interpreted By The Crystal 
Structure Of A4 Isoform Complexed With Nad
 pdb|1NBO|A Chain A, The Dual Coenzyme Specificity Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase Interpreted By The Crystal 
Structure Of A4 Isoform Complexed With Nad
 pdb|1NBO|B Chain B, The Dual Coenzyme Specificity Of Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase Interpreted By The Crystal 
Structure Of A4 Isoform Complexed With Nad
 pdb|1RM4|O Chain O, Crystal Structure Of Recombinant Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM4|A Chain A, Crystal Structure Of Recombinant Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM4|B Chain B, Crystal Structure Of Recombinant Photosynthetic Glyceraldehyde-3- 
Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|2HKI|A Chain A, Crystal Structure Of Photosynthetic Glyceraldehyde-3-Phosphate 
Dehydrogenase A4 Isoform
 pdb|2PKQ|P Chain P, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
 pdb|2PKQ|R Chain R, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
 pdb|2PKQ|S Chain S, Crystal Structure Of The Photosynthetic A2b2-glyceraldehyde-3- 
Phosphate Dehydrogenase, Complexed With Nadp
Length=337

 Score =   223 bits (567),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 152/164 (93%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAA LNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  173  KGTMTTTHSYTGDQRLLDASHRDLRRARAACLNIVPTSTGAAKAVALVLPNLKGKLNGIA  232

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA NEL GILSVCDEPLVS+DFRC+DVS
Sbjct  233  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKGILSVCDEPLVSIDFRCTDVS  292

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            ST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN+W+
Sbjct  293  STIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKWQ  336



>ref|XP_010425376.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Camelina sativa]
Length=317

 Score =   222 bits (565),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 151/164 (92%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  154  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIA  213

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR+SA  EL GIL VCDEPLVSVDFRCSD S
Sbjct  214  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDSAEKELKGILDVCDEPLVSVDFRCSDYS  273

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            +T+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN+WK
Sbjct  274  TTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKWK  317



>pdb|1RM5|O Chain O, Crystal Structure Of Mutant S188a Of Photosynthetic 
Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM5|A Chain A, Crystal Structure Of Mutant S188a Of Photosynthetic 
Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
 pdb|1RM5|B Chain B, Crystal Structure Of Mutant S188a Of Photosynthetic 
Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed 
With Nadp
Length=337

 Score =   222 bits (566),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 151/164 (92%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDA+HRDLRRARAA LNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  173  KGTMTTTHSYTGDQRLLDAAHRDLRRARAACLNIVPTSTGAAKAVALVLPNLKGKLNGIA  232

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA NEL GILSVCDEPLVS+DFRC+DVS
Sbjct  233  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKGILSVCDEPLVSIDFRCTDVS  292

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            ST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN+W+
Sbjct  293  STIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKWQ  336



>pir||DESPGA glyceraldehyde-3-phosphate dehydrogenase (NADP)  (phosphorylating) 
(EC 1.2.1.13) A, chloroplast - spinach
Length=337

 Score =   222 bits (566),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 152/164 (93%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAA LNIVPTSTGAAKAVALVLP LKGKLNGIA
Sbjct  173  KGTMTTTHSYTGDQRLLDASHRDLRRARAACLNIVPTSTGAAKAVALVLPQLKGKLNGIA  232

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA NEL GILSVCDEPLVS+DFRC+DVS
Sbjct  233  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKGILSVCDEPLVSIDFRCTDVS  292

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            ST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN+W+
Sbjct  293  STIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKWQ  336



>pdb|2PKR|O Chain O, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|R Chain R, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|P Chain P, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|Q Chain Q, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|A Chain A, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|B Chain B, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|C Chain C, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|D Chain D, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|H Chain H, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|I Chain I, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|L Chain L, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
 pdb|2PKR|M Chain M, Crystal Structure Of (a+cte)4 Chimeric Form Of Photosyntetic 
Glyceraldehyde-3-phosphate Dehydrogenase, Complexed 
With Nadp
Length=365

 Score =   223 bits (568),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAA LNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  173  KGTMTTTHSYTGDQRLLDASHRDLRRARAACLNIVPTSTGAAKAVALVLPNLKGKLNGIA  232

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA NEL GILSVCDEPLVS+DFRC+DVS
Sbjct  233  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKGILSVCDEPLVSIDFRCTDVS  292

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK*MPAS  126
            ST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN+W+ +  S
Sbjct  293  STIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKWQGLEGS  341



>ref|XP_010502598.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=317

 Score =   221 bits (564),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 151/164 (92%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  154  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIA  213

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR+SA  EL GIL VCDEPLVSVDFRCSD S
Sbjct  214  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDSAEKELKGILDVCDEPLVSVDFRCSDYS  273

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            +T+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN+WK
Sbjct  274  TTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKWK  317



>emb|CCF55355.1| Glyceraldehyde-3-phosphate dehydrogenase A [Cucumis sativus]
Length=403

 Score =   224 bits (570),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 155/164 (95%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA
Sbjct  240  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA  299

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPN SVVDLVVQVSKKTFAEEVNAAFRESA  EL+GILSVCDEPLVSVDFRCSDVS
Sbjct  300  LRVPTPNASVVDLVVQVSKKTFAEEVNAAFRESAEKELNGILSVCDEPLVSVDFRCSDVS  359

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVDSSLTMVMGDD+VKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  360  STVDSSLTMVMGDDLVKVIAWYDNEWGYSQRVVDLADIVANNWK  403



>dbj|BAK02737.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=306

 Score =   221 bits (563),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 151/164 (92%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  143  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIA  202

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKT AEEVN AFR++AANEL GIL VCDEPLVSVDFRCSDVS
Sbjct  203  LRVPTPNVSVVDLVVQVSKKTLAEEVNQAFRDAAANELKGILDVCDEPLVSVDFRCSDVS  262

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            ST+D+SL+MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK
Sbjct  263  STIDASLSMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  306



>ref|XP_007161788.1| hypothetical protein PHAVU_001G098100g [Phaseolus vulgaris]
 gb|ESW33782.1| hypothetical protein PHAVU_001G098100g [Phaseolus vulgaris]
Length=403

 Score =   224 bits (570),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 155/164 (95%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  240  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNGIA  299

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA  EL GILSVCDEPLVSVDFRC+DVS
Sbjct  300  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESAEKELKGILSVCDEPLVSVDFRCTDVS  359

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN+WK
Sbjct  360  STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKWK  403



>ref|XP_010090946.1| Glyceraldehyde-3-phosphate dehydrogenase A [Morus notabilis]
 gb|EXB41431.1| Glyceraldehyde-3-phosphate dehydrogenase A [Morus notabilis]
Length=404

 Score =   224 bits (570),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 154/164 (94%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  241  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNGIA  300

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA  EL+GILSVCDEPLVSVDFRC+DVS
Sbjct  301  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESAEKELNGILSVCDEPLVSVDFRCTDVS  360

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVD+SLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  361  STVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  404



>ref|XP_006446865.1| hypothetical protein CICLE_v10015476mg [Citrus clementina]
 gb|ESR60105.1| hypothetical protein CICLE_v10015476mg [Citrus clementina]
Length=403

 Score =   224 bits (570),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 156/164 (95%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  240  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPALKGKLNGIA  299

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA NEL GILSVCDEPLVSVDFRCSDVS
Sbjct  300  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKGILSVCDEPLVSVDFRCSDVS  359

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVDSSLT+VMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  360  STVDSSLTLVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  403



>ref|XP_004236849.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Solanum lycopersicum]
Length=399

 Score =   224 bits (570),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 156/164 (95%), Positives = 160/164 (98%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA
Sbjct  236  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA  295

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQV+KKTFAEEVNAAFRE+A  EL+GILSVCDEPLVSVDFRCSDVS
Sbjct  296  LRVPTPNVSVVDLVVQVTKKTFAEEVNAAFREAADKELNGILSVCDEPLVSVDFRCSDVS  355

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK
Sbjct  356  STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  399



>ref|XP_004231523.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Solanum lycopersicum]
Length=409

 Score =   224 bits (570),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 156/163 (96%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA
Sbjct  246  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA  305

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA NEL GILSVCDEPLVSVDFRCSDVS
Sbjct  306  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELAGILSVCDEPLVSVDFRCSDVS  365

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  144
            STVD+SLTMVMGDDMVKVIAWYDNEWGYSQRVVDLA+IVANQW
Sbjct  366  STVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLANIVANQW  408



>gb|KJB70724.1| hypothetical protein B456_011G088800 [Gossypium raimondii]
Length=303

 Score =   221 bits (562),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 153/164 (93%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  140  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNGIA  199

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAF+ESA  EL GILSVC+EPLVSVDFRCSDVS
Sbjct  200  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFKESAEKELQGILSVCEEPLVSVDFRCSDVS  259

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVD+SLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  260  STVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANSWK  303



>sp|P19866.2|G3PA_SPIOL RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor [Spinacia oleracea]
 gb|AAD10217.1| NADP-dependent glyceraldehydephosphate dehydrogenase subunit 
A [Spinacia oleracea]
Length=401

 Score =   224 bits (570),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 152/164 (93%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAA LNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  238  KGTMTTTHSYTGDQRLLDASHRDLRRARAACLNIVPTSTGAAKAVALVLPNLKGKLNGIA  297

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA NEL GILSVCDEPLVS+DFRC+DVS
Sbjct  298  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKGILSVCDEPLVSIDFRCTDVS  357

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            ST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN+W+
Sbjct  358  STIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKWQ  401



>ref|XP_004493116.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Cicer arietinum]
Length=405

 Score =   224 bits (570),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 154/164 (94%), Positives = 160/164 (98%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  242  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNGIA  301

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQV+KKTFAEEVN AFRESAANEL+GILSVCDEPLVSVDFRC+DVS
Sbjct  302  LRVPTPNVSVVDLVVQVTKKTFAEEVNEAFRESAANELNGILSVCDEPLVSVDFRCTDVS  361

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVDSSLTMVMGDD+VKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  362  STVDSSLTMVMGDDLVKVIAWYDNEWGYSQRVVDLADIVANNWK  405



>sp|P09672.1|G3PA_SINAL RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A, partial [Sinapis alba]
 emb|CAA27845.1| chloroplast GAPDH (233aa) [Sinapis alba]
Length=233

 Score =   218 bits (556),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 152/164 (93%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  70   KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIA  129

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++A  EL GIL VCDEPLVSVDFRCSDVS
Sbjct  130  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAEKELKGILDVCDEPLVSVDFRCSDVS  189

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            ST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  190  STIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  233



>ref|XP_006468948.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Citrus sinensis]
 gb|KDO63478.1| hypothetical protein CISIN_1g013492mg [Citrus sinensis]
Length=403

 Score =   224 bits (570),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 156/164 (95%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  240  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPALKGKLNGIA  299

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA NEL GILSVCDEPLVSVDFRCSDVS
Sbjct  300  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKGILSVCDEPLVSVDFRCSDVS  359

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVDSSLT+VMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  360  STVDSSLTLVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  403



>gb|ACU21011.1| unknown [Glycine max]
Length=403

 Score =   224 bits (570),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 155/164 (95%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  240  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNGIA  299

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA NEL GILSVCDEPLVSVDFRC+DVS
Sbjct  300  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKGILSVCDEPLVSVDFRCTDVS  359

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVDSSLTMVMGDDMVKVIAWYDNEWGYSQR VDLADIVAN+WK
Sbjct  360  STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRAVDLADIVANKWK  403



>ref|XP_006359279.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Solanum tuberosum]
Length=399

 Score =   223 bits (569),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 154/164 (94%), Positives = 160/164 (98%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA
Sbjct  236  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA  295

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQV+KKTFAEEVNAAFRE+A  EL+GIL+VCDEPLVSVDFRCSDVS
Sbjct  296  LRVPTPNVSVVDLVVQVTKKTFAEEVNAAFREAADKELNGILAVCDEPLVSVDFRCSDVS  355

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            ST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK
Sbjct  356  STIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  399



>gb|AEH04452.1| glyceraldehyde-3-phosphate dehydrogenase [Arachis hypogaea]
Length=405

 Score =   223 bits (569),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 155/164 (95%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  242  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNGIA  301

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA  EL+GILSVCDEPLVSVDFRC+DVS
Sbjct  302  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESAEKELNGILSVCDEPLVSVDFRCTDVS  361

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  362  STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANSWK  405



>gb|AIU56856.1| glyceraldehyde-3-phosphate dehydrogenase A, partial [Brassica 
rapa subsp. chinensis]
Length=336

 Score =   221 bits (564),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 154/164 (94%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  173  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIA  232

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++AANEL GIL VCDEPLVSVDFRCSDVS
Sbjct  233  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAANELKGILDVCDEPLVSVDFRCSDVS  292

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            ST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  293  STIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  336



>ref|XP_002321065.2| hypothetical protein POPTR_0014s13660g [Populus trichocarpa]
 gb|ABK96062.1| unknown [Populus trichocarpa]
 gb|ABK96120.1| unknown [Populus trichocarpa]
 gb|EEE99380.2| hypothetical protein POPTR_0014s13660g [Populus trichocarpa]
Length=404

 Score =   223 bits (569),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 156/164 (95%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  241  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNGIA  300

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA  EL+GILSVCDEPLVSVDFRCSDVS
Sbjct  301  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESAEKELNGILSVCDEPLVSVDFRCSDVS  360

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  361  STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  404



>gb|KDO63477.1| hypothetical protein CISIN_1g013492mg [Citrus sinensis]
Length=416

 Score =   224 bits (570),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 156/164 (95%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  253  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPALKGKLNGIA  312

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA NEL GILSVCDEPLVSVDFRCSDVS
Sbjct  313  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKGILSVCDEPLVSVDFRCSDVS  372

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVDSSLT+VMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  373  STVDSSLTLVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  416



>ref|NP_001077529.1| glyceraldehyde 3-phosphate dehydrogenase GAPA2 [Arabidopsis thaliana]
 gb|AEE28945.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
Length=317

 Score =   221 bits (562),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 152/164 (93%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  154  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIA  213

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++A  EL GIL VCDEPLVSVDFRCSDVS
Sbjct  214  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAEKELKGILDVCDEPLVSVDFRCSDVS  273

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            ST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  274  STIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  317



>ref|XP_009148557.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Brassica rapa]
Length=317

 Score =   221 bits (562),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 152/164 (93%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  154  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIA  213

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++A  EL GIL VCDEPLVSVDFRCSDVS
Sbjct  214  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAEKELKGILDVCDEPLVSVDFRCSDVS  273

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            ST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  274  STIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  317



>ref|XP_009800449.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Nicotiana sylvestris]
Length=401

 Score =   223 bits (568),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 155/164 (95%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA
Sbjct  238  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA  297

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRE+A  EL GIL VCDEPLVSVDFRCSDVS
Sbjct  298  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFREAADKELKGILDVCDEPLVSVDFRCSDVS  357

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVD+SLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK
Sbjct  358  STVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  401



>ref|XP_011033706.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Populus euphratica]
Length=404

 Score =   223 bits (568),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 156/164 (95%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  241  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNGIA  300

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA  EL+GILSVCDEPLVSVDFRCSDVS
Sbjct  301  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESAEKELNGILSVCDEPLVSVDFRCSDVS  360

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  361  STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  404



>ref|XP_004161334.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Cucumis sativus]
Length=403

 Score =   223 bits (568),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 156/164 (95%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA
Sbjct  240  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA  299

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA  EL+GILSVCDEPLVSVDFRCSDVS
Sbjct  300  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESAEKELNGILSVCDEPLVSVDFRCSDVS  359

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVDSSLTMVMGDD+VKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  360  STVDSSLTMVMGDDLVKVIAWYDNEWGYSQRVVDLADIVANNWK  403



>gb|KDO63476.1| hypothetical protein CISIN_1g013492mg [Citrus sinensis]
Length=442

 Score =   224 bits (571),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 156/164 (95%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  279  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPALKGKLNGIA  338

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA NEL GILSVCDEPLVSVDFRCSDVS
Sbjct  339  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKGILSVCDEPLVSVDFRCSDVS  398

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVDSSLT+VMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  399  STVDSSLTLVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  442



>ref|XP_003624553.1| Glyceraldehyde-3-phosphate dehydrogenase A [Medicago truncatula]
 gb|AES80771.1| glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
Length=404

 Score =   223 bits (568),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 155/164 (95%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA
Sbjct  241  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA  300

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVN AFR+SAA EL GILSVCDEPLVSVDFRC+DVS
Sbjct  301  LRVPTPNVSVVDLVVQVSKKTFAEEVNEAFRDSAAKELSGILSVCDEPLVSVDFRCTDVS  360

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  361  STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  404



>dbj|BAP91041.1| glyceraldehyde 3-phosphate dehydrogenase-A [Nicotiana benthamiana]
Length=401

 Score =   223 bits (568),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 155/164 (95%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA
Sbjct  238  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA  297

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRE+A  EL GIL VCDEPLVSVDFRCSDVS
Sbjct  298  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFREAADKELKGILDVCDEPLVSVDFRCSDVS  357

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVD+SLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK
Sbjct  358  STVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  401



>ref|XP_010476270.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Camelina sativa]
Length=317

 Score =   220 bits (561),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 152/164 (93%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  154  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIA  213

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++A  EL GIL VCDEPLVSVDFRCSDVS
Sbjct  214  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAEKELKGILDVCDEPLVSVDFRCSDVS  273

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            ST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  274  STIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  317



>ref|XP_004145622.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Cucumis sativus]
 gb|KGN57690.1| hypothetical protein Csa_3G252490 [Cucumis sativus]
Length=403

 Score =   223 bits (568),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 156/164 (95%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA
Sbjct  240  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA  299

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA  EL+GILSVCDEPLVSVDFRCSDVS
Sbjct  300  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESAEKELNGILSVCDEPLVSVDFRCSDVS  359

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVDSSLTMVMGDD+VKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  360  STVDSSLTMVMGDDLVKVIAWYDNEWGYSQRVVDLADIVANNWK  403



>emb|CDY16038.1| BnaC08g40850D [Brassica napus]
Length=399

 Score =   223 bits (567),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 154/164 (94%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  236  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIA  295

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++AANEL GIL VCDEPLVSVDFRCSDVS
Sbjct  296  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAANELKGILDVCDEPLVSVDFRCSDVS  355

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            ST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  356  STIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  399



>ref|XP_010250427.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Nelumbo nucifera]
Length=402

 Score =   223 bits (567),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 155/164 (95%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  239  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNGIA  298

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA  EL GILSVCDEPLVSVDFRCSDVS
Sbjct  299  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADKELKGILSVCDEPLVSVDFRCSDVS  358

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVD+SLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  359  STVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  402



>gb|KJB11771.1| hypothetical protein B456_001G276400 [Gossypium raimondii]
Length=403

 Score =   223 bits (567),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 155/164 (95%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  240  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNGIA  299

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA  EL GILSVCDEPLVSVDFRCSDVS
Sbjct  300  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESAEKELKGILSVCDEPLVSVDFRCSDVS  359

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVD+SLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  360  STVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  403



>ref|XP_003579898.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Brachypodium distachyon]
Length=403

 Score =   223 bits (567),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 152/164 (93%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  240  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIA  299

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKT AEEVNAAFR++AANEL GIL VCDEPLVSVDFRCSDVS
Sbjct  300  LRVPTPNVSVVDLVVQVSKKTLAEEVNAAFRDAAANELKGILDVCDEPLVSVDFRCSDVS  359

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            ST+D+SL+MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK
Sbjct  360  STIDASLSMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  403



>gb|ACV32597.1| putative glyceraldehyde-3-phosphate dehydrogenase [Medicago sativa]
Length=404

 Score =   223 bits (567),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 155/164 (95%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA
Sbjct  241  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA  300

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVN AFR+SAA EL GILSVCDEPLVSVDFRC+DVS
Sbjct  301  LRVPTPNVSVVDLVVQVSKKTFAEEVNEAFRDSAAKELSGILSVCDEPLVSVDFRCTDVS  360

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  361  STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  404



>emb|CDY26599.1| BnaA09g46780D [Brassica napus]
Length=399

 Score =   223 bits (567),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 154/164 (94%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  236  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIA  295

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++AANEL GIL VCDEPLVSVDFRCSDVS
Sbjct  296  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAANELKGILDVCDEPLVSVDFRCSDVS  355

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            ST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  356  STIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  399



>ref|XP_010694632.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=401

 Score =   223 bits (567),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 154/164 (94%), Positives = 160/164 (98%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA
Sbjct  238  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA  297

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQV+KKTFAEEVNAAFRESA NEL GILSVCDEPLVSVDFRC+DVS
Sbjct  298  LRVPTPNVSVVDLVVQVTKKTFAEEVNAAFRESADNELKGILSVCDEPLVSVDFRCTDVS  357

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVA++W+
Sbjct  358  STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVADKWQ  401



>gb|ADX97321.1| glyceraldehyde-3-phosphate dehydrogenase [Mangifera indica]
Length=401

 Score =   223 bits (567),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 156/164 (95%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA
Sbjct  238  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA  297

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA  EL GILSVCDEPLVSVDFRCSDVS
Sbjct  298  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADKELKGILSVCDEPLVSVDFRCSDVS  357

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVDSSLT+VMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN+WK
Sbjct  358  STVDSSLTLVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKWK  401



>ref|XP_010494750.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Camelina sativa]
Length=317

 Score =   220 bits (560),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 152/164 (93%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  154  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIA  213

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++A  EL GIL VCDEPLVSVDFRCSDVS
Sbjct  214  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAEKELKGILDVCDEPLVSVDFRCSDVS  273

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            ST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  274  STIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  317



>gb|AHZ94971.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Lilium regale]
Length=344

 Score =   221 bits (562),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 156/164 (95%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA
Sbjct  181  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA  240

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA  EL GILSVCDEPLVSVDFRCSDVS
Sbjct  241  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADGELKGILSVCDEPLVSVDFRCSDVS  300

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVDSSLT+VMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  301  STVDSSLTLVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  344



>gb|KFK43560.1| hypothetical protein AALP_AA1G142100 [Arabis alpina]
Length=399

 Score =   222 bits (566),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 153/164 (93%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  236  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIA  295

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++AANE+ GIL VCDEPLVSVDFRCSDVS
Sbjct  296  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAANEMKGILDVCDEPLVSVDFRCSDVS  355

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            ST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  356  STIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  399



>gb|KHG21941.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Gossypium 
arboreum]
Length=363

 Score =   221 bits (563),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 153/164 (93%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  200  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNGIA  259

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAF+ESA  EL GILSVC+EPLVSVDFRCSDVS
Sbjct  260  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFKESAEKELQGILSVCEEPLVSVDFRCSDVS  319

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVD+SLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  320  STVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANSWK  363



>pdb|1JN0|O Chain O, Crystal Structure Of The Non-regulatory A4 Isoform Of 
Spinach Chloroplast Glyceraldehyde-3-phosphate Dehydrogenase 
Complexed With Nadp
 pdb|1JN0|A Chain A, Crystal Structure Of The Non-regulatory A4 Isoform Of 
Spinach Chloroplast Glyceraldehyde-3-phosphate Dehydrogenase 
Complexed With Nadp
 pdb|1JN0|B Chain B, Crystal Structure Of The Non-regulatory A4 Isoform Of 
Spinach Chloroplast Glyceraldehyde-3-phosphate Dehydrogenase 
Complexed With Nadp
Length=335

 Score =   220 bits (561),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 151/164 (92%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAA LNIVPTSTGAAKAVALVLP LKGKLNGIA
Sbjct  171  KGTMTTTHSYTGDQRLLDASHRDLRRARAACLNIVPTSTGAAKAVALVLPQLKGKLNGIA  230

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA  EL GILSVCDEPLVS+DFRC+DVS
Sbjct  231  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADQELKGILSVCDEPLVSIDFRCTDVS  290

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            ST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN+W+
Sbjct  291  STIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKWQ  334



>ref|XP_004304578.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=404

 Score =   222 bits (566),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 155/164 (95%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA
Sbjct  241  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA  300

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQV+KKTFAEEVNAAFRESA  EL GILSVCDEPLVSVDFRC+DVS
Sbjct  301  LRVPTPNVSVVDLVVQVTKKTFAEEVNAAFRESADKELAGILSVCDEPLVSVDFRCTDVS  360

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  361  STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  404



>gb|KDP41897.1| hypothetical protein JCGZ_26915 [Jatropha curcas]
Length=411

 Score =   222 bits (566),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 155/164 (95%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  248  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNGIA  307

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA  EL GILSVCDEPLVSVDFRC+DVS
Sbjct  308  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADKELKGILSVCDEPLVSVDFRCTDVS  367

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  368  STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  411



>ref|XP_009420999.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Musa acuminata subsp. malaccensis]
Length=402

 Score =   222 bits (565),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 156/164 (95%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA
Sbjct  239  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA  298

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++A  EL GILSVCDEPLVSVDFRCSDVS
Sbjct  299  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAADKELKGILSVCDEPLVSVDFRCSDVS  358

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK
Sbjct  359  STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  402



>ref|XP_009631078.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Nicotiana tomentosiformis]
Length=401

 Score =   222 bits (565),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 154/164 (94%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA
Sbjct  238  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA  297

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQV+KKTFAEEVNAAFRE+A  EL GIL VCDEPLVSVDFRCSDVS
Sbjct  298  LRVPTPNVSVVDLVVQVTKKTFAEEVNAAFREAADKELKGILDVCDEPLVSVDFRCSDVS  357

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVD+SLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK
Sbjct  358  STVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  401



>sp|P12858.2|G3PA_PEA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor [Pisum sativum]
 emb|CAA36396.1| glyceraldehyde-3-phosphate dehydrogenase [Pisum sativum]
Length=405

 Score =   222 bits (565),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 154/164 (94%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  242  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNGIA  301

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVN AFRESAA EL GILSVCDEPLVSVDFRC+DVS
Sbjct  302  LRVPTPNVSVVDLVVQVSKKTFAEEVNEAFRESAAKELTGILSVCDEPLVSVDFRCTDVS  361

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVDSSLTMVMGDD+VKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  362  STVDSSLTMVMGDDLVKVIAWYDNEWGYSQRVVDLADIVANNWK  405



>ref|XP_007217883.1| hypothetical protein PRUPE_ppa006610mg [Prunus persica]
 gb|EMJ19082.1| hypothetical protein PRUPE_ppa006610mg [Prunus persica]
Length=403

 Score =   222 bits (565),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 154/164 (94%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA
Sbjct  240  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA  299

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQV+KKTFAEEVNAAFR+S+A EL GILSVCDEPLVSVDFRC+DVS
Sbjct  300  LRVPTPNVSVVDLVVQVTKKTFAEEVNAAFRDSSAKELAGILSVCDEPLVSVDFRCTDVS  359

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  360  STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  403



>emb|CAA33264.1| unnamed protein product [Pisum sativum]
Length=405

 Score =   222 bits (565),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 154/164 (94%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  242  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNGIA  301

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVN AFRESAA EL GILSVCDEPLVSVDFRC+DVS
Sbjct  302  LRVPTPNVSVVDLVVQVSKKTFAEEVNEAFRESAAKELTGILSVCDEPLVSVDFRCTDVS  361

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVDSSLTMVMGDD+VKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  362  STVDSSLTMVMGDDLVKVIAWYDNEWGYSQRVVDLADIVANNWK  405



>ref|XP_008449975.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Cucumis melo]
Length=403

 Score =   222 bits (565),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 156/164 (95%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA
Sbjct  240  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA  299

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA  EL+GILSVCDEPLVSVDFRCSDVS
Sbjct  300  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESAEKELNGILSVCDEPLVSVDFRCSDVS  359

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVDSSLTMVMGDD+VKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  360  STVDSSLTMVMGDDLVKVIAWYDNEWGYSQRVVDLADIVANNWK  403



>ref|XP_008231212.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Prunus mume]
Length=403

 Score =   222 bits (565),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 154/164 (94%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA
Sbjct  240  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA  299

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQV+KKTFAEEVNAAFR+S+A EL GILSVCDEPLVSVDFRC+DVS
Sbjct  300  LRVPTPNVSVVDLVVQVTKKTFAEEVNAAFRDSSAKELAGILSVCDEPLVSVDFRCTDVS  359

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  360  STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  403



>ref|XP_008449974.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X1 [Cucumis melo]
Length=404

 Score =   222 bits (565),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 156/164 (95%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA
Sbjct  241  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA  300

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA  EL+GILSVCDEPLVSVDFRCSDVS
Sbjct  301  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESAEKELNGILSVCDEPLVSVDFRCSDVS  360

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVDSSLTMVMGDD+VKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  361  STVDSSLTMVMGDDLVKVIAWYDNEWGYSQRVVDLADIVANNWK  404



>ref|XP_007032095.1| Glyceraldehyde 3-phosphate dehydrogenase A subunit 2 [Theobroma 
cacao]
 gb|EOY03021.1| Glyceraldehyde 3-phosphate dehydrogenase A subunit 2 [Theobroma 
cacao]
Length=404

 Score =   221 bits (564),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 154/164 (94%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  241  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNGIA  300

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR+SA  EL+GILSVCDEPLVSVDFRCSDVS
Sbjct  301  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDSAEKELNGILSVCDEPLVSVDFRCSDVS  360

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVD+SLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  361  STVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  404



>ref|XP_009118048.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Brassica rapa]
Length=399

 Score =   221 bits (564),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 153/164 (93%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  236  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIA  295

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++AANEL GIL VCDEPLVSVDFRCSDVS
Sbjct  296  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAANELKGILDVCDEPLVSVDFRCSDVS  355

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            ST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDL+DIVAN WK
Sbjct  356  STIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLSDIVANNWK  399



>ref|XP_009378072.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Pyrus x bretschneideri]
Length=355

 Score =   219 bits (559),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 154/164 (94%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA
Sbjct  192  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA  251

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQV+KKTFAEEVNAAFR+SA  EL GILSVCDEPLVSVDFRC+DVS
Sbjct  252  LRVPTPNVSVVDLVVQVTKKTFAEEVNAAFRDSAEKELAGILSVCDEPLVSVDFRCTDVS  311

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  312  STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  355



>ref|XP_011003600.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Populus euphratica]
Length=404

 Score =   221 bits (563),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 155/164 (95%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  241  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNGIA  300

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVN  FRESA  EL GILSVCDEPLVSVDFRCSDVS
Sbjct  301  LRVPTPNVSVVDLVVQVSKKTFAEEVNEGFRESAEKELKGILSVCDEPLVSVDFRCSDVS  360

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK
Sbjct  361  STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  404



>gb|KFK33590.1| hypothetical protein AALP_AA5G033500 [Arabis alpina]
Length=400

 Score =   221 bits (563),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 154/164 (94%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  237  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIA  296

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA  EL GIL VCDEPLVSVDFRCSDVS
Sbjct  297  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESAEKELKGILEVCDEPLVSVDFRCSDVS  356

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            ST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  357  STIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  400



>ref|XP_008379036.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Malus domestica]
Length=403

 Score =   221 bits (563),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 154/164 (94%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA
Sbjct  240  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA  299

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQV+KKTFAEEVNAAFR+SA  EL GILSVCDEPLVSVDFRC+DVS
Sbjct  300  LRVPTPNVSVVDLVVQVTKKTFAEEVNAAFRDSAEKELAGILSVCDEPLVSVDFRCTDVS  359

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  360  STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  403



>ref|XP_002512790.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
 gb|EEF49293.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
Length=404

 Score =   221 bits (563),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 154/164 (94%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  241  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNGIA  300

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQV KKTFAEEVNAAFRESA  EL GILSVCDEPLVSVDFRC+DVS
Sbjct  301  LRVPTPNVSVVDLVVQVEKKTFAEEVNAAFRESADKELKGILSVCDEPLVSVDFRCTDVS  360

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  361  STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  404



>ref|XP_010249379.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Nelumbo nucifera]
Length=402

 Score =   221 bits (563),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 155/164 (95%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  239  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNGIA  298

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRE+A  EL+GILSVCDEPLVSVDFRCSDVS
Sbjct  299  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFREAADKELNGILSVCDEPLVSVDFRCSDVS  358

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  359  STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  402



>ref|XP_009378071.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X1 [Pyrus x bretschneideri]
Length=403

 Score =   221 bits (563),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 154/164 (94%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA
Sbjct  240  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA  299

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQV+KKTFAEEVNAAFR+SA  EL GILSVCDEPLVSVDFRC+DVS
Sbjct  300  LRVPTPNVSVVDLVVQVTKKTFAEEVNAAFRDSAEKELAGILSVCDEPLVSVDFRCTDVS  359

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  360  STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  403



>dbj|BAJ90530.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=401

 Score =   221 bits (562),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 151/164 (92%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  238  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIA  297

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKT AEEVN AFR++AANEL GIL VCDEPLVSVDFRCSDVS
Sbjct  298  LRVPTPNVSVVDLVVQVSKKTLAEEVNQAFRDAAANELKGILDVCDEPLVSVDFRCSDVS  357

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            ST+D+SL+MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK
Sbjct  358  STIDASLSMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  401



>ref|XP_008362077.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Malus domestica]
Length=403

 Score =   221 bits (562),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 154/164 (94%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA
Sbjct  240  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA  299

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQV+KKTFAEEVNAAFR+SA  EL GILSVCDEPLVSVDFRC+DVS
Sbjct  300  LRVPTPNVSVVDLVVQVTKKTFAEEVNAAFRDSAEKELAGILSVCDEPLVSVDFRCTDVS  359

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  360  STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  403



>emb|CDX83635.1| BnaC07g23750D [Brassica napus]
Length=380

 Score =   220 bits (560),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 153/164 (93%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  217  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIA  276

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQV+KKTFAEEVNAAFRESA  EL GIL VCDEPLVSVDFRCSDVS
Sbjct  277  LRVPTPNVSVVDLVVQVTKKTFAEEVNAAFRESAEKELKGILEVCDEPLVSVDFRCSDVS  336

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            ST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  337  STIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  380



>dbj|BAJ90885.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK08149.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=401

 Score =   220 bits (561),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 151/164 (92%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  238  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIA  297

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKT AEEVN AFR++AANEL GIL VCDEPLVSVDFRCSDVS
Sbjct  298  LRVPTPNVSVVDLVVQVSKKTLAEEVNQAFRDAAANELKGILDVCDEPLVSVDFRCSDVS  357

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            ST+D+SL+MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK
Sbjct  358  STIDASLSMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  401



>ref|XP_010528117.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X1 [Tarenaya hassleriana]
Length=402

 Score =   220 bits (561),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 155/164 (95%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  239  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIA  298

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRE+A NEL GIL VCDEPLVSVDFRCSDVS
Sbjct  299  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFREAADNELKGILEVCDEPLVSVDFRCSDVS  358

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  359  STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  402



>gb|EMT31124.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Aegilops 
tauschii]
Length=402

 Score =   220 bits (561),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 151/164 (92%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  239  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIA  298

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKT AEEVN AFR++AANEL GIL VCDEPLVSVDFRCSDVS
Sbjct  299  LRVPTPNVSVVDLVVQVSKKTLAEEVNQAFRDAAANELKGILDVCDEPLVSVDFRCSDVS  358

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            ST+D+SL+MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK
Sbjct  359  STIDASLSMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  402



>ref|XP_010660642.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X2 [Vitis vinifera]
Length=403

 Score =   220 bits (561),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 154/164 (94%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  240  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNGIA  299

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNA FR+SA  EL GILSVCDEPLVSVDFRCSDVS
Sbjct  300  LRVPTPNVSVVDLVVQVSKKTFAEEVNAGFRDSAEKELQGILSVCDEPLVSVDFRCSDVS  359

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN+WK
Sbjct  360  STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKWK  403



>ref|XP_006652373.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
isoform X2 [Oryza brachyantha]
Length=401

 Score =   220 bits (561),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 153/164 (93%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  238  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIA  297

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKT AEEVNAAFR+SAANEL GIL VCD PLVSVDFRCSDVS
Sbjct  298  LRVPTPNVSVVDLVVQVSKKTLAEEVNAAFRDSAANELQGILEVCDVPLVSVDFRCSDVS  357

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            ST+D+SLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK
Sbjct  358  STIDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  401



>ref|XP_010514317.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X1 [Camelina sativa]
 ref|XP_010514318.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X2 [Camelina sativa]
 ref|XP_010514319.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X3 [Camelina sativa]
Length=400

 Score =   220 bits (561),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 151/164 (92%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  237  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIA  296

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR+SA  EL GIL VCDEPLVSVDFRCSD S
Sbjct  297  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDSAEKELKGILEVCDEPLVSVDFRCSDYS  356

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            +T+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN+WK
Sbjct  357  TTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKWK  400



>ref|XP_006652372.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
isoform X1 [Oryza brachyantha]
Length=403

 Score =   220 bits (561),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 153/164 (93%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  240  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIA  299

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKT AEEVNAAFR+SAANEL GIL VCD PLVSVDFRCSDVS
Sbjct  300  LRVPTPNVSVVDLVVQVSKKTLAEEVNAAFRDSAANELQGILEVCDVPLVSVDFRCSDVS  359

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            ST+D+SLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK
Sbjct  360  STIDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  403



>ref|XP_002278352.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
isoform X1 [Vitis vinifera]
Length=404

 Score =   220 bits (561),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 154/164 (94%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  241  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNGIA  300

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNA FR+SA  EL GILSVCDEPLVSVDFRCSDVS
Sbjct  301  LRVPTPNVSVVDLVVQVSKKTFAEEVNAGFRDSAEKELQGILSVCDEPLVSVDFRCSDVS  360

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN+WK
Sbjct  361  STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKWK  404



>ref|XP_010425375.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic 
isoform X1 [Camelina sativa]
Length=400

 Score =   220 bits (561),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 151/164 (92%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  237  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIA  296

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR+SA  EL GIL VCDEPLVSVDFRCSD S
Sbjct  297  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDSAEKELKGILDVCDEPLVSVDFRCSDYS  356

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            +T+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN+WK
Sbjct  357  TTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKWK  400



>emb|CAN78872.1| hypothetical protein VITISV_021726 [Vitis vinifera]
Length=404

 Score =   220 bits (561),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 154/164 (94%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  241  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNGIA  300

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNA FR+SA  EL GILSVCDEPLVSVDFRCSDVS
Sbjct  301  LRVPTPNVSVVDLVVQVSKKTFAEEVNAGFRDSAEKELQGILSVCDEPLVSVDFRCSDVS  360

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN+WK
Sbjct  361  STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKWK  404



>gb|EPS59235.1| hypothetical protein M569_15573, partial [Genlisea aurea]
Length=395

 Score =   220 bits (560),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 154/164 (94%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP LKGKLNGIA
Sbjct  232  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPQLKGKLNGIA  291

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQV KKTFAEEVNAAFRESA  EL GILSVCDEPLVSVDFRC+DVS
Sbjct  292  LRVPTPNVSVVDLVVQVEKKTFAEEVNAAFRESADKELKGILSVCDEPLVSVDFRCTDVS  351

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN+WK
Sbjct  352  STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKWK  395



>ref|XP_010502597.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=400

 Score =   220 bits (560),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 151/164 (92%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  237  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIA  296

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR+SA  EL GIL VCDEPLVSVDFRCSD S
Sbjct  297  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDSAEKELKGILDVCDEPLVSVDFRCSDYS  356

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            +T+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN+WK
Sbjct  357  TTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKWK  400



>pdb|3K2B|A Chain A, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|B Chain B, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|C Chain C, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|D Chain D, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|E Chain E, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|F Chain F, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|G Chain G, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|H Chain H, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|O Chain O, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3K2B|Q Chain Q, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- 
Phosphate Dehydrogenase Complexed With Nad, From 
Arabidopsis Thaliana
 pdb|3QV1|A Chain A, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|B Chain B, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|C Chain C, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|D Chain D, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|E Chain E, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3QV1|F Chain F, Crystal Structure Of The Binary Complex Of Photosyntetic 
A4 Glyceraldehyde 3-phosphate Dehydrogenase (gapdh) With 
Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|A Chain A, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|B Chain B, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|C Chain C, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|D Chain D, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|E Chain E, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|F Chain F, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|G Chain G, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|H Chain H, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|O Chain O, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
 pdb|3RVD|Q Chain Q, Crystal Structure Of The Binary Complex, Obtained By 
Soaking, Of Photosyntetic A4 Glyceraldehyde 3-phosphate Dehydrogenase 
(gapdh) With Cp12-2, Both From Arabidopsis Thaliana.
Length=337

 Score =   218 bits (555),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 151/164 (92%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  174  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIA  233

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR+SA  EL GIL VCDEPLVSVDFRCSD S
Sbjct  234  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDSAEKELKGILDVCDEPLVSVDFRCSDFS  293

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            +T+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  294  TTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  337



>ref|XP_009404713.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=404

 Score =   220 bits (560),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 155/164 (95%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA
Sbjct  241  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA  300

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKT AEEVNAAFR +A  EL+GILSVCDEPLVSVDFRCSDVS
Sbjct  301  LRVPTPNVSVVDLVVQVSKKTLAEEVNAAFRNAAEKELNGILSVCDEPLVSVDFRCSDVS  360

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK
Sbjct  361  STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  404



>gb|AAD10209.1| glyceraldehyde 3-phosphate dehydrogenase A subunit [Arabidopsis 
thaliana]
Length=350

 Score =   218 bits (556),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 151/164 (92%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  187  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIA  246

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR+SA  EL GIL VCDEPLVSVDFRCSD S
Sbjct  247  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDSAEKELKGILDVCDEPLVSVDFRCSDFS  306

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            +T+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  307  TTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  350



>ref|XP_009152035.1| PREDICTED: LOW QUALITY PROTEIN: glyceraldehyde-3-phosphate dehydrogenase 
GAPA1, chloroplastic [Brassica rapa]
Length=400

 Score =   220 bits (560),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 153/164 (93%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  237  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIA  296

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQV+KKTFAEEVNAAFRESA  EL GIL VCDEPLVSVDFRCSDVS
Sbjct  297  LRVPTPNVSVVDLVVQVTKKTFAEEVNAAFRESAEKELKGILEVCDEPLVSVDFRCSDVS  356

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            ST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  357  STIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  400



>ref|XP_002875330.1| gapa [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51589.1| gapa [Arabidopsis lyrata subsp. lyrata]
Length=396

 Score =   219 bits (559),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 151/164 (92%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  233  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIA  292

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR+SA  EL GIL VCDEPLVSVDFRCSD S
Sbjct  293  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDSAEKELKGILDVCDEPLVSVDFRCSDYS  352

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            +T+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  353  TTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  396



>gb|KJB70723.1| hypothetical protein B456_011G088800 [Gossypium raimondii]
Length=408

 Score =   220 bits (560),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 153/164 (93%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  245  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNGIA  304

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAF+ESA  EL GILSVC+EPLVSVDFRCSDVS
Sbjct  305  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFKESAEKELQGILSVCEEPLVSVDFRCSDVS  364

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVD+SLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  365  STVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANSWK  408



>gb|AAA32793.1| glyceraldehyde 3-phosphate dehydrogenase [Arabidopsis thaliana]
 emb|CAA66816.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
Length=396

 Score =   219 bits (559),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 151/164 (92%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  233  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIA  292

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR+SA  EL GIL VCDEPLVSVDFRCSD S
Sbjct  293  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDSAEKELKGILDVCDEPLVSVDFRCSDFS  352

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            +T+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  353  TTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  396



>ref|NP_566796.2| glyceraldehyde-3-phosphate dehydrogenase A subunit [Arabidopsis 
thaliana]
 sp|P25856.3|G3PA1_ARATH RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase GAPA1, 
chloroplastic; AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase A subunit 1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAL16200.1|AF428431_1 AT3g26650/MLJ15_5 [Arabidopsis thaliana]
 dbj|BAB01730.1| glyceralehyde-3-phosphate dehydrogenase subunit [Arabidopsis 
thaliana]
 gb|AAL24215.1| AT3g26650/MLJ15_5 [Arabidopsis thaliana]
 gb|AAL25556.1| AT3g26650/MLJ15_5 [Arabidopsis thaliana]
 gb|AAL91645.1| AT3g26650/MLJ15_5 [Arabidopsis thaliana]
 gb|AAM98317.1| At3g26650/MLJ15_5 [Arabidopsis thaliana]
 gb|AEE77191.1| glyceraldehyde-3-phosphate dehydrogenase A subunit [Arabidopsis 
thaliana]
Length=396

 Score =   219 bits (559),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 151/164 (92%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  233  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIA  292

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR+SA  EL GIL VCDEPLVSVDFRCSD S
Sbjct  293  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDSAEKELKGILDVCDEPLVSVDFRCSDFS  352

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            +T+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  353  TTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  396



>gb|AEO45783.1| glyceraldehyde-3-phosphate dehydrogenase A [Scoparia dulcis]
Length=398

 Score =   219 bits (559),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 154/164 (94%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP LKGKLNGIA
Sbjct  235  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPQLKGKLNGIA  294

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQV KKTFAEEVNAAFRE+A  EL+GILSVCDEPLVSVDFRCSDVS
Sbjct  295  LRVPTPNVSVVDLVVQVEKKTFAEEVNAAFRETADKELNGILSVCDEPLVSVDFRCSDVS  354

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN+WK
Sbjct  355  STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKWK  398



>ref|XP_006291258.1| hypothetical protein CARUB_v10017390mg [Capsella rubella]
 gb|EOA24156.1| hypothetical protein CARUB_v10017390mg [Capsella rubella]
Length=400

 Score =   219 bits (559),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 151/164 (92%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  237  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIA  296

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR+SA  EL GIL VCDEPLVSVDFRCSD S
Sbjct  297  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDSAEKELKGILEVCDEPLVSVDFRCSDFS  356

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            +T+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  357  TTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  400



>dbj|BAG68209.1| glyceraldehyde-3-phosphate dehydrogenase [Brassica rapa subsp. 
chinensis]
Length=328

 Score =   217 bits (553),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 153/164 (93%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  165  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIA  224

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR +AANEL GIL VCDEPLVSV FRCSDVS
Sbjct  225  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRGAAANELKGILDVCDEPLVSVGFRCSDVS  284

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            ST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  285  STIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  328



>ref|XP_008797069.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Phoenix dactylifera]
 ref|XP_008797070.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Phoenix dactylifera]
Length=445

 Score =   221 bits (562),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 153/164 (93%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  282  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNGIA  341

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++A  EL GILSVCDEPLVSVDFRC+DVS
Sbjct  342  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDTAEKELKGILSVCDEPLVSVDFRCTDVS  401

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  402  STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  445



>gb|ACN39951.1| unknown [Picea sitchensis]
Length=330

 Score =   217 bits (552),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 152/164 (93%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  166  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIA  225

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQV KKTFAEEVNAAFRESA  EL+GIL+VCDEPLVS+DFRCSDVS
Sbjct  226  LRVPTPNVSVVDLVVQVEKKTFAEEVNAAFRESADKELNGILAVCDEPLVSIDFRCSDVS  285

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLADIVAN WK
Sbjct  286  STVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLADIVANNWK  329



>dbj|BAJ10475.1| glyceraldehyde-3-phosphate dehydrogenase [Brassica rapa subsp. 
chinensis]
Length=399

 Score =   219 bits (558),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 153/164 (93%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  236  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIA  295

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR +AANEL GIL VCDEPLVSV FRCSDVS
Sbjct  296  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRGAAANELKGILDVCDEPLVSVGFRCSDVS  355

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            ST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  356  STIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  399



>ref|NP_001117276.1| glyceraldehyde 3-phosphate dehydrogenase GAPA2 [Arabidopsis thaliana]
 ref|NP_001184977.1| glyceraldehyde 3-phosphate dehydrogenase GAPA2 [Arabidopsis thaliana]
 gb|AEE28946.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
 gb|AEE28947.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
Length=350

 Score =   218 bits (554),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 152/164 (93%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  187  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIA  246

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++A  EL GIL VCDEPLVSVDFRCSDVS
Sbjct  247  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAEKELKGILDVCDEPLVSVDFRCSDVS  306

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            ST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  307  STIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  350



>ref|XP_006417176.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
 ref|XP_006417178.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
 gb|ESQ35529.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
 gb|ESQ35531.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
Length=350

 Score =   218 bits (554),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 152/164 (93%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  187  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIA  246

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++A  EL GIL VCDEPLVSVDFRCSDVS
Sbjct  247  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAEKELKGILDVCDEPLVSVDFRCSDVS  306

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            ST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  307  STIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  350



>ref|XP_010028899.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Eucalyptus grandis]
 gb|KCW55732.1| hypothetical protein EUGRSUZ_I01564 [Eucalyptus grandis]
Length=402

 Score =   219 bits (557),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 153/164 (93%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  239  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNGIA  298

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNA FRESA NEL GILSVCDEPLVSVDFRCSDVS
Sbjct  299  LRVPTPNVSVVDLVVQVSKKTFAEEVNAGFRESADNELKGILSVCDEPLVSVDFRCSDVS  358

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVD+SLTMVMGDDMVKVIAWYDNEWGYSQRVVDLA IVA+ WK
Sbjct  359  STVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLAHIVADNWK  402



>ref|XP_009148556.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Brassica rapa]
Length=399

 Score =   219 bits (557),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 152/164 (93%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  236  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIA  295

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++A  EL GIL VCDEPLVSVDFRCSDVS
Sbjct  296  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAEKELKGILDVCDEPLVSVDFRCSDVS  355

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            ST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  356  STIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  399



>emb|CDY19412.1| BnaC05g09210D [Brassica napus]
 emb|CDX98028.1| BnaA06g07790D [Brassica napus]
Length=399

 Score =   219 bits (557),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 152/164 (93%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  236  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIA  295

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++A  EL GIL VCDEPLVSVDFRCSDVS
Sbjct  296  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAEKELKGILDVCDEPLVSVDFRCSDVS  355

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            ST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  356  STIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  399



>ref|XP_006304985.1| hypothetical protein CARUB_v10009349mg [Capsella rubella]
 gb|EOA37883.1| hypothetical protein CARUB_v10009349mg [Capsella rubella]
Length=399

 Score =   219 bits (557),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 152/164 (93%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  236  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIA  295

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++A  EL GIL VCDEPLVSVDFRCSDVS
Sbjct  296  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAEKELKGILDVCDEPLVSVDFRCSDVS  355

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            ST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  356  STIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  399



>gb|ACN40537.1| unknown [Picea sitchensis]
Length=410

 Score =   219 bits (558),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 152/164 (93%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  246  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIA  305

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQV KKTFAEEVNAAFRESA  EL+GIL+VCDEPLVS+DFRCSDVS
Sbjct  306  LRVPTPNVSVVDLVVQVEKKTFAEEVNAAFRESADKELNGILAVCDEPLVSIDFRCSDVS  365

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLADIVAN WK
Sbjct  366  STVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLADIVANNWK  409



>ref|XP_010476269.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Camelina sativa]
Length=399

 Score =   219 bits (557),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 152/164 (93%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  236  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIA  295

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++A  EL GIL VCDEPLVSVDFRCSDVS
Sbjct  296  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAEKELKGILDVCDEPLVSVDFRCSDVS  355

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            ST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  356  STIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  399



>ref|XP_010494747.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic 
isoform X1 [Camelina sativa]
Length=399

 Score =   219 bits (557),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 152/164 (93%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  236  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIA  295

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++A  EL GIL VCDEPLVSVDFRCSDVS
Sbjct  296  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAEKELKGILDVCDEPLVSVDFRCSDVS  355

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            ST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  356  STIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  399



>ref|XP_011070460.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic 
[Sesamum indicum]
Length=399

 Score =   219 bits (557),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 154/164 (94%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP LKGKLNGIA
Sbjct  236  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPQLKGKLNGIA  295

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQV KKTFAEEVNAAFRE+A  EL+GILSVCDEPLVSVDFRCSDVS
Sbjct  296  LRVPTPNVSVVDLVVQVEKKTFAEEVNAAFREAADKELNGILSVCDEPLVSVDFRCSDVS  355

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  356  STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  399



>ref|NP_172750.1| glyceraldehyde 3-phosphate dehydrogenase GAPA2 [Arabidopsis thaliana]
 sp|Q9LPW0.1|G3PA2_ARATH RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase GAPA2, 
chloroplastic; AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase A subunit 2; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF78494.1|AC012187_14 Strong similarity to GAPDH subunit A from Pisum sativum gb|X15190 
and contains a GAPDH PF|00044 domain. ESTs gb|T42920, gb|T43410, 
gb|T46101, gb|T04006, gb|T20630, gb|Z34677, gb|T46805, 
gb|N37754, gb|N37754, gb|Z26072, gb|H37169, gb|H76419, 
gb|T20834, gb|T21557, gb|AA713258, gb|T04005, gb|AI099909, gb|Z34793 
come from this gene [Arabidopsis thaliana]
 gb|AAP40454.1| putative calcium-binding protein, calreticulin [Arabidopsis thaliana]
 gb|AAU94430.1| At1g12900 [Arabidopsis thaliana]
 gb|AEE28944.1| glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) 
[Arabidopsis thaliana]
Length=399

 Score =   218 bits (556),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 152/164 (93%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  236  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIA  295

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++A  EL GIL VCDEPLVSVDFRCSDVS
Sbjct  296  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAEKELKGILDVCDEPLVSVDFRCSDVS  355

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            ST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  356  STIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  399



>ref|XP_002892719.1| GAPA-2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68978.1| GAPA-2 [Arabidopsis lyrata subsp. lyrata]
Length=399

 Score =   218 bits (556),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 152/164 (93%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  236  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIA  295

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++A  EL GIL VCDEPLVSVDFRCSDVS
Sbjct  296  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAEKELKGILDVCDEPLVSVDFRCSDVS  355

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            ST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  356  STIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  399



>gb|ABK25233.1| unknown [Picea sitchensis]
 gb|ABK26169.1| unknown [Picea sitchensis]
 gb|ACN40026.1| unknown [Picea sitchensis]
 gb|ACN40459.1| unknown [Picea sitchensis]
Length=410

 Score =   219 bits (557),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 152/164 (93%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  246  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIA  305

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQV KKTFAEEVNAAFRESA  EL+GIL+VCDEPLVS+DFRCSDVS
Sbjct  306  LRVPTPNVSVVDLVVQVEKKTFAEEVNAAFRESADKELNGILAVCDEPLVSIDFRCSDVS  365

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLADIVAN WK
Sbjct  366  STVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLADIVANNWK  409



>emb|CDY13649.1| BnaA06g32740D [Brassica napus]
Length=380

 Score =   218 bits (555),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 152/164 (93%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  217  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIA  276

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQV+KKTFAEEVNAAFR+SA  EL GIL VCDEPLVSVDFRCSDVS
Sbjct  277  LRVPTPNVSVVDLVVQVTKKTFAEEVNAAFRDSAEKELKGILEVCDEPLVSVDFRCSDVS  336

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            ST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  337  STIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  380



>ref|XP_006417177.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
 gb|ESQ35530.1| hypothetical protein EUTSA_v10007809mg [Eutrema salsugineum]
Length=399

 Score =   218 bits (556),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 152/164 (93%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  236  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIA  295

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++A  EL GIL VCDEPLVSVDFRCSDVS
Sbjct  296  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAEKELKGILDVCDEPLVSVDFRCSDVS  355

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            ST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  356  STIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  399



>ref|XP_006395535.1| hypothetical protein EUTSA_v10004349mg [Eutrema salsugineum]
 gb|ESQ32821.1| hypothetical protein EUTSA_v10004349mg [Eutrema salsugineum]
Length=400

 Score =   218 bits (556),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 152/164 (93%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  237  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIA  296

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++A  EL GIL VCDEPLVSVDFRCSDVS
Sbjct  297  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAEKELKGILEVCDEPLVSVDFRCSDVS  356

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            ST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  357  STIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  400



>emb|CDY28536.1| BnaC02g36240D [Brassica napus]
Length=380

 Score =   218 bits (554),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 151/164 (92%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  217  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIA  276

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQV+KKTFAEE+NAAFR+SA  EL GIL VCDEPLVSVDFRCSDVS
Sbjct  277  LRVPTPNVSVVDLVVQVTKKTFAEEINAAFRDSAEKELKGILEVCDEPLVSVDFRCSDVS  336

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            ST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  337  STIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  380



>ref|XP_010942312.1| PREDICTED: LOW QUALITY PROTEIN: glyceraldehyde-3-phosphate dehydrogenase 
A, chloroplastic-like [Elaeis guineensis]
Length=445

 Score =   219 bits (558),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 154/164 (94%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  282  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNGIA  341

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++A  EL GILSVCDEPLVSVDFRCSDVS
Sbjct  342  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDTAEKELKGILSVCDEPLVSVDFRCSDVS  401

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  402  STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  445



>ref|XP_006844714.1| hypothetical protein AMTR_s00016p00251680 [Amborella trichopoda]
 gb|ERN06389.1| hypothetical protein AMTR_s00016p00251680 [Amborella trichopoda]
Length=398

 Score =   218 bits (554),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  235  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNGIA  294

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQV KKTFAEEVNAAFRESA  EL GILSVCDEPLVSVDFRCSDVS
Sbjct  295  LRVPTPNVSVVDLVVQVEKKTFAEEVNAAFRESADKELQGILSVCDEPLVSVDFRCSDVS  354

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  144
            STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLA IVANQW
Sbjct  355  STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLAHIVANQW  397



>ref|NP_001289256.1| glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Pyrus 
x bretschneideri]
 gb|AFG28404.1| glyceraldehyde-3-phosphate dehydrogenase A [Pyrus x bretschneideri]
Length=403

 Score =   218 bits (555),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 153/164 (93%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA
Sbjct  240  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA  299

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQV+KKTFAEEVNAAFR+SA  EL GILSVCDE LVSVDFRC+DVS
Sbjct  300  LRVPTPNVSVVDLVVQVTKKTFAEEVNAAFRDSAEKELAGILSVCDESLVSVDFRCTDVS  359

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  360  STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  403



>gb|ACN40000.1| unknown [Picea sitchensis]
Length=410

 Score =   218 bits (555),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 152/161 (94%), Positives = 157/161 (98%), Gaps = 0/161 (0%)
 Frame = -3

Query  623  MTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRV  444
            MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIALRV
Sbjct  249  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRV  308

Query  443  PTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsstv  264
            PTPNVSVVDLVVQV KKTFAEEVNAAFRESA  EL+GIL+VCDEPLVS+DFRCSDVSSTV
Sbjct  309  PTPNVSVVDLVVQVEKKTFAEEVNAAFRESADKELNGILAVCDEPLVSIDFRCSDVSSTV  368

Query  263  dssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLADIVAN WK
Sbjct  369  DSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLADIVANNWK  409



>gb|EYU35565.1| hypothetical protein MIMGU_mgv1a005886mg [Erythranthe guttata]
Length=466

 Score =   219 bits (559),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 154/164 (94%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP LKGKLNGIA
Sbjct  303  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPQLKGKLNGIA  362

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQV KKTFAEEVNAAFRE+A NEL GIL+VCDEPLVSVDFRCSDVS
Sbjct  363  LRVPTPNVSVVDLVVQVEKKTFAEEVNAAFREAADNELSGILAVCDEPLVSVDFRCSDVS  422

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  423  STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  466



>ref|NP_001052984.1| Os04g0459500 [Oryza sativa Japonica Group]
 emb|CAD40906.1| OSJNBa0036B21.24 [Oryza sativa Japonica Group]
 emb|CAE01532.1| OSJNBa0072F16.1 [Oryza sativa Japonica Group]
 dbj|BAF14898.1| Os04g0459500 [Oryza sativa Japonica Group]
 emb|CAH67076.1| OSIGBa0097P08.6 [Oryza sativa Indica Group]
 emb|CAH67444.1| H0219H12.1 [Oryza sativa Indica Group]
 gb|EAY94393.1| hypothetical protein OsI_16160 [Oryza sativa Indica Group]
 gb|EAZ30968.1| hypothetical protein OsJ_15048 [Oryza sativa Japonica Group]
 dbj|BAG92628.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96321.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96327.1| unnamed protein product [Oryza sativa Japonica Group]
 emb|CBW45779.1| ORW1943Ba0077G13.7 [Oryza rufipogon]
Length=402

 Score =   218 bits (554),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 150/164 (91%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  239  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIA  298

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKT AEEVN AFR+SAANEL GIL VCD PLVSVDFRCSDVS
Sbjct  299  LRVPTPNVSVVDLVVQVSKKTLAEEVNQAFRDSAANELKGILEVCDVPLVSVDFRCSDVS  358

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
             T+D+SL+MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK
Sbjct  359  CTIDASLSMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  402



>gb|AAA33780.1| glyceraldehyde-phosphate dehydrogenase [Pinus sylvestris]
Length=411

 Score =   217 bits (553),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 152/164 (93%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA
Sbjct  247  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA  306

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQV KKTFAEEVNAAFRE+A  EL GIL+VCDEPLVS+DFRCSDVS
Sbjct  307  LRVPTPNVSVVDLVVQVEKKTFAEEVNAAFRETADKELKGILAVCDEPLVSIDFRCSDVS  366

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLADIVAN WK
Sbjct  367  STVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLADIVANNWK  410



>gb|ABK96233.1| unknown [Populus trichocarpa x Populus deltoides]
Length=404

 Score =   217 bits (553),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 153/164 (93%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  241  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNGIA  300

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVN  FRESA  EL GILSVCDEPLVSVDFRCSDVS
Sbjct  301  LRVPTPNVSVVDLVVQVSKKTFAEEVNEGFRESAEKELKGILSVCDEPLVSVDFRCSDVS  360

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLA IVA+QWK
Sbjct  361  STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLAHIVADQWK  404



>gb|ABK96725.1| unknown [Populus trichocarpa x Populus deltoides]
Length=404

 Score =   217 bits (552),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 153/164 (93%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  241  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNGIA  300

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVN  FRESA  EL GILSVCDEPLVSVDFRCSDVS
Sbjct  301  LRVPTPNVSVVDLVVQVSKKTFAEEVNLGFRESAEKELKGILSVCDEPLVSVDFRCSDVS  360

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLA IVA+QWK
Sbjct  361  STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLAHIVADQWK  404



>ref|XP_006386825.1| hypothetical protein POPTR_0002s22600g [Populus trichocarpa]
 gb|ERP64622.1| hypothetical protein POPTR_0002s22600g [Populus trichocarpa]
Length=403

 Score =   217 bits (552),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 153/164 (93%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  240  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNGIA  299

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVN  FRESA  EL GILSVCDEPLVSVDFRCSDVS
Sbjct  300  LRVPTPNVSVVDLVVQVSKKTFAEEVNEGFRESAEKELKGILSVCDEPLVSVDFRCSDVS  359

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLA IVA+QWK
Sbjct  360  STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLAHIVADQWK  403



>gb|ABK94956.1| unknown [Populus trichocarpa]
Length=403

 Score =   217 bits (552),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 153/164 (93%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  240  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNGIA  299

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVN  FRESA  EL GILSVCDEPLVSVDFRCSDVS
Sbjct  300  LRVPTPNVSVVDLVVQVSKKTFAEEVNEGFRESAEKELKGILSVCDEPLVSVDFRCSDVS  359

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLA IVA+QWK
Sbjct  360  STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLAHIVADQWK  403



>gb|ABK24313.1| unknown [Picea sitchensis]
Length=410

 Score =   217 bits (552),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 151/164 (92%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  246  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIA  305

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQV KKTFAEEVNAAFRESA  EL+GIL+VCDEPLVS+DFRCSDVS
Sbjct  306  LRVPTPNVSVVDLVVQVEKKTFAEEVNAAFRESADKELNGILAVCDEPLVSIDFRCSDVS  365

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVDSSLTMVMGDDMV V+AWYDNEWGYSQRVVDLADIVAN WK
Sbjct  366  STVDSSLTMVMGDDMVNVVAWYDNEWGYSQRVVDLADIVANNWK  409



>dbj|BAH57068.1| AT1G12900 [Arabidopsis thaliana]
Length=350

 Score =   214 bits (546),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 151/164 (92%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  187  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIA  246

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++A  EL GIL VCDEPLVSVDFRCSDVS
Sbjct  247  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAEKELKGILDVCDEPLVSVDFRCSDVS  306

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            ST+DSSLTMVMGDDMVKVIAWYDNEWGYSQR VDLADIVAN WK
Sbjct  307  STIDSSLTMVMGDDMVKVIAWYDNEWGYSQRDVDLADIVANNWK  350



>gb|ABK00067.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase, partial 
[Chlorokybus atmophyticus]
Length=325

 Score =   214 bits (544),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 145/163 (89%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP LKGKLNGIA
Sbjct  150  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPQLKGKLNGIA  209

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVS+VDLV+Q  KKTFAEEVNAAFRE+A   L GIL+VCDEPLVSVDFRC+DVS
Sbjct  210  LRVPTPNVSIVDLVIQTEKKTFAEEVNAAFREAANGPLKGILAVCDEPLVSVDFRCTDVS  269

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  144
            ST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLADIVAN W
Sbjct  270  STIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLADIVANNW  312



>ref|XP_004975847.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Setaria italica]
Length=401

 Score =   216 bits (549),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 152/164 (93%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  238  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIA  297

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKT AEEVN AFR+SAANEL GIL VCD PLVSVDFRCSDVS
Sbjct  298  LRVPTPNVSVVDLVVQVSKKTLAEEVNQAFRDSAANELAGILEVCDAPLVSVDFRCSDVS  357

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVD+SLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  358  STVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  401



>ref|XP_002970103.1| hypothetical protein SELMODRAFT_270825 [Selaginella moellendorffii]
 gb|EFJ29227.1| hypothetical protein SELMODRAFT_270825 [Selaginella moellendorffii]
Length=402

 Score =   215 bits (548),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 150/164 (91%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP LKGKLNGIA
Sbjct  239  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPKLKGKLNGIA  298

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQV KKTFAEEVNAAFRESA   L+GIL+VCDEPLVSVDFRCSDVS
Sbjct  299  LRVPTPNVSVVDLVVQVEKKTFAEEVNAAFRESADKALNGILAVCDEPLVSVDFRCSDVS  358

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            ST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA+IVA QWK
Sbjct  359  STIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLANIVAEQWK  402



>emb|CDY48981.1| BnaA02g28150D [Brassica napus]
Length=368

 Score =   214 bits (544),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 150/164 (91%), Positives = 155/164 (95%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGK NGIA
Sbjct  205  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKHNGIA  264

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQV+KKTFAEEVNAAFR SA  EL GIL VCDEPLVSVDF+CSDVS
Sbjct  265  LRVPTPNVSVVDLVVQVTKKTFAEEVNAAFRNSAEKELKGILKVCDEPLVSVDFKCSDVS  324

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            ST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  325  STIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  368



>ref|XP_010929533.1| PREDICTED: LOW QUALITY PROTEIN: glyceraldehyde-3-phosphate dehydrogenase 
A, chloroplastic [Elaeis guineensis]
Length=261

 Score =   210 bits (535),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 151/164 (92%), Positives = 155/164 (95%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLN IA
Sbjct  98   KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNEIA  157

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKK  AEE+NAAFR+SA  EL GILSVCDEPLVSVDFRCSDVS
Sbjct  158  LRVPTPNVSVVDLVVQVSKKILAEEINAAFRDSAEKELRGILSVCDEPLVSVDFRCSDVS  217

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  218  STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  261



>gb|ACT21568.1| glyceraldehyde-3-phosphate dehydrogenase [Bruguiera gymnorhiza]
Length=405

 Score =   214 bits (546),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 150/164 (91%), Positives = 155/164 (95%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAK VALVLP+L+GKLNGIA
Sbjct  242  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKPVALVLPTLRGKLNGIA  301

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA  EL GILSVCDEPLVSVDFRC DVS
Sbjct  302  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADKELKGILSVCDEPLVSVDFRCRDVS  361

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVDSSLTMVMGDDMVKVIAWYDNEWGY QRVVDLAD+VA +WK
Sbjct  362  STVDSSLTMVMGDDMVKVIAWYDNEWGYFQRVVDLADVVAEKWK  405



>gb|ABD37959.1| glyceraldehyde-3-phosphate dehydrogenase subunit A, partial [Chlorokybus 
atmophyticus]
Length=347

 Score =   213 bits (541),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 145/163 (89%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP LKGKLNGIA
Sbjct  172  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPQLKGKLNGIA  231

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVS+VDLV+Q  KKTFAEEVNAAFRE+A   L GIL+VCDEPLVSVDFRC+DVS
Sbjct  232  LRVPTPNVSIVDLVIQTEKKTFAEEVNAAFREAANGPLKGILAVCDEPLVSVDFRCTDVS  291

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  144
            ST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLADIVAN W
Sbjct  292  STIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLADIVANNW  334



>dbj|BAJ34149.1| unnamed protein product [Thellungiella halophila]
Length=400

 Score =   214 bits (545),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 151/164 (92%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTT SYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  237  KGTMTTTPSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIA  296

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFR++A  EL GIL VCDEPLVSVDFRCSDVS
Sbjct  297  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAEKELKGILEVCDEPLVSVDFRCSDVS  356

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            ST+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct  357  STIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK  400



>ref|XP_002985183.1| hypothetical protein SELMODRAFT_181561 [Selaginella moellendorffii]
 gb|EFJ13677.1| hypothetical protein SELMODRAFT_181561 [Selaginella moellendorffii]
Length=402

 Score =   214 bits (544),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 149/164 (91%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP LKGKLNGIA
Sbjct  239  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPKLKGKLNGIA  298

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQV KKTFAEEVNAAFRE+A   L+GIL+VCDEPLVSVDFRCSDVS
Sbjct  299  LRVPTPNVSVVDLVVQVEKKTFAEEVNAAFREAADKALNGILAVCDEPLVSVDFRCSDVS  358

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            ST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA+IVA QWK
Sbjct  359  STIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLANIVAEQWK  402



>tpg|DAA37469.1| TPA: glyceraldehyde-3-phosphate dehydrogenase1 [Zea mays]
Length=403

 Score =   213 bits (542),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 148/164 (90%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+LVLP+LKGKLNGIA
Sbjct  240  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPNLKGKLNGIA  299

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKT AEEVN AFR++AANEL GIL VCD PLVSVDFRCSDVS
Sbjct  300  LRVPTPNVSVVDLVVQVSKKTLAEEVNQAFRDAAANELTGILEVCDVPLVSVDFRCSDVS  359

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            ST+D+SLTMVMGDDMVKVI+WYDNEWGYSQRVVDLADI ANQWK
Sbjct  360  STIDASLTMVMGDDMVKVISWYDNEWGYSQRVVDLADICANQWK  403



>emb|CAA30152.1| GADPH (383 AA) [Zea mays]
Length=383

 Score =   212 bits (540),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 148/164 (90%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+LVLP+LKGKLNGIA
Sbjct  220  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPNLKGKLNGIA  279

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKT AEEVN AFR++AANEL GIL VCD PLVSVDFRCSDVS
Sbjct  280  LRVPTPNVSVVDLVVQVSKKTLAEEVNQAFRDAAANELTGILEVCDVPLVSVDFRCSDVS  339

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            ST+D+SLTMVMGDDMVKVI+WYDNEWGYSQRVVDLADI ANQWK
Sbjct  340  STIDASLTMVMGDDMVKVISWYDNEWGYSQRVVDLADICANQWK  383



>ref|NP_001105414.1| glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic precursor 
[Zea mays]
 sp|P09315.1|G3PA_MAIZE RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor [Zea mays]
 gb|AAA33464.1| glyceraldehyde-3-phosphate dehydrogenase [Zea mays]
 emb|CAA33455.1| glyceraldehyde-3-phosphate dehydrogenase [Zea mays]
Length=403

 Score =   213 bits (541),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 148/164 (90%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+LVLP+LKGKLNGIA
Sbjct  240  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPNLKGKLNGIA  299

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKT AEEVN AFR++AANEL GIL VCD PLVSVDFRCSDVS
Sbjct  300  LRVPTPNVSVVDLVVQVSKKTLAEEVNQAFRDAAANELTGILEVCDVPLVSVDFRCSDVS  359

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            ST+D+SLTMVMGDDMVKVI+WYDNEWGYSQRVVDLADI ANQWK
Sbjct  360  STIDASLTMVMGDDMVKVISWYDNEWGYSQRVVDLADICANQWK  403



>gb|AHA84230.1| glyceraldehyde-3-phosphate dehydrogenase A [Phaseolus vulgaris]
Length=402

 Score =   212 bits (540),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 138/164 (84%), Positives = 144/164 (88%), Gaps = 1/164 (1%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTT SYTGD+ L  +     R   AA  NIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  240  KGTMTTTPSYTGDRALDASHRDLRRARAAAL-NIVPTSTGAAKAVALVLPTLKGKLNGIA  298

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA  EL GILSVCDEP VSVDFRC+DVS
Sbjct  299  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESAEKELKGILSVCDEPFVSVDFRCTDVS  358

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN+WK
Sbjct  359  STVDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKWK  402



>gb|KIY93372.1| NADP-dependent glyceraldehydephosphatedehydrogenase subunit A 
[Monoraphidium neglectum]
Length=176

 Score =   204 bits (520),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 138/164 (84%), Positives = 154/164 (94%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPT+TGAAKAVALVLP LKGKLNGIA
Sbjct  13   KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTTTGAAKAVALVLPKLKGKLNGIA  72

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLV+QV KKTFAEEVNAAFRE+AA  + G+L+V DEPLVSVDFRC+DVS
Sbjct  73   LRVPTPNVSVVDLVIQVEKKTFAEEVNAAFREAAAGPMAGVLAVADEPLVSVDFRCTDVS  132

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            +++DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA++ A +W+
Sbjct  133  TSIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAELTAQKWE  176



>gb|ABY20971.1| glyceraldehyde-3-phosphate dehydrogenase A subunit [Hypericum 
perforatum]
Length=141

 Score =   202 bits (515),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 123/132 (93%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -3

Query  536  NIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRE  357
            NIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQV+KKTFAEEVNAAFRE
Sbjct  10   NIVPTSTGAAKAVALVLPSLKGKLNGIALRVPTPNVSVVDLVVQVTKKTFAEEVNAAFRE  69

Query  356  SAANELDGILSVCDEPLVSVDFRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRV  177
            SA  EL GIL+VCDEPLVSVDFRCSDVSSTVD+SLT VMGDDMVKVIAWYDNEWGYSQRV
Sbjct  70   SADKELKGILAVCDEPLVSVDFRCSDVSSTVDASLTTVMGDDMVKVIAWYDNEWGYSQRV  129

Query  176  VDLADIVANQWK  141
            VDLAD+VAN+WK
Sbjct  130  VDLADLVANKWK  141



>gb|ABK00052.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase, partial 
[Marchantia polymorpha]
Length=359

 Score =   209 bits (531),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 145/163 (89%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  194  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIA  253

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQV KKTFAEEVNAAFRE+A  ++ GIL+VCDEPLVSVDFRC+DVS
Sbjct  254  LRVPTPNVSVVDLVVQVEKKTFAEEVNAAFREAANGDMKGILAVCDEPLVSVDFRCTDVS  313

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  144
            STVDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA++VA +W
Sbjct  314  STVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLANLVAEKW  356



>emb|CAC80388.1| glyceraldehyde-3-phosphate dehydrogenase [Marchantia polymorpha]
Length=400

 Score =   209 bits (532),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 145/163 (89%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGKLNGIA
Sbjct  235  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIA  294

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQV KKTFAEEVNAAFRE+A  ++ GIL+VCDEPLVSVDFRC+DVS
Sbjct  295  LRVPTPNVSVVDLVVQVEKKTFAEEVNAAFREAANGDMKGILAVCDEPLVSVDFRCTDVS  354

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  144
            STVDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA++VA +W
Sbjct  355  STVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLANLVAEKW  397



>gb|AFC88822.1| glyceraldehyde-3-phosphate dehydrogenase-like protein, partial 
[Miscanthus sinensis]
Length=316

 Score =   207 bits (526),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 146/164 (89%), Positives = 155/164 (95%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+LVLP+LKGKLNGIA
Sbjct  153  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPNLKGKLNGIA  212

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKT AEEVN AFR++AANEL GIL VCD PLVSVDFRCSDVS
Sbjct  213  LRVPTPNVSVVDLVVQVSKKTLAEEVNQAFRDAAANELIGILEVCDVPLVSVDFRCSDVS  272

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            ST+D+SLTMVMGDDMVKVI+WYDNEWGYSQRVVDLADI A +WK
Sbjct  273  STIDASLTMVMGDDMVKVISWYDNEWGYSQRVVDLADICAIKWK  316



>gb|ABD37956.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Spermatozopsis 
similis]
Length=263

 Score =   205 bits (521),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 136/163 (83%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPT+TGAAKAVALVLP+LKGKLNG A
Sbjct  100  KGVMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTTTGAAKAVALVLPNLKGKLNGFA  159

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVS+VDLV+QV KKTFAEEVN AFRE+AA E+ G+L+VCDEPLVSVDFRC+DVS
Sbjct  160  LRVPTPNVSIVDLVIQVEKKTFAEEVNNAFREAAAGEMKGVLAVCDEPLVSVDFRCTDVS  219

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  144
             ++DSSLTMVMGDDMVK++AWYDNEWGYSQRVVDLA++ A++W
Sbjct  220  VSIDSSLTMVMGDDMVKIVAWYDNEWGYSQRVVDLAELAASKW  262



>gb|ADU04755.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Mesostigma 
viride]
 gb|ADU04760.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Mesostigma 
viride]
 gb|ADU04761.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Mesostigma 
viride]
 gb|ADU04762.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Mesostigma 
viride]
Length=284

 Score =   204 bits (519),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 141/162 (87%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP LKGKLNGIA
Sbjct  123  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPKLKGKLNGIA  182

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLV+QV KKTFAEEVNAA RE+A   + G+L+VCDEPLVSVDF+CSDVS
Sbjct  183  LRVPTPNVSVVDLVIQVEKKTFAEEVNAALREAANGPMKGVLAVCDEPLVSVDFKCSDVS  242

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  147
            ST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA I+ANQ
Sbjct  243  STIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHIMANQ  284



>ref|XP_007510189.1| glyceraldehyde-3-phosphate dehydrogenase [Bathycoccus prasinos]
 emb|CCO18534.1| glyceraldehyde-3-phosphate dehydrogenase [Bathycoccus prasinos]
Length=379

 Score =   204 bits (520),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 136/164 (83%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQ++LDASHRDLRRARAAALNIVPTSTGAAKAVALVLP LKGKLNGIA
Sbjct  216  KGLMTTTHSYTGDQKILDASHRDLRRARAAALNIVPTSTGAAKAVALVLPELKGKLNGIA  275

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLV+Q SKK  AEEVN AFRESAA  L GILSVCDEPLVSVDFRC+D S
Sbjct  276  LRVPTPNVSVVDLVIQTSKKVTAEEVNNAFRESAAGPLKGILSVCDEPLVSVDFRCTDQS  335

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            +T+DS+LTMV+GDDM+KV+AWYDNEWGYSQRVVDLA++ A  W+
Sbjct  336  TTIDSALTMVIGDDMLKVVAWYDNEWGYSQRVVDLAELTAANWE  379



>ref|XP_001771209.1| predicted protein [Physcomitrella patens]
 gb|EDQ63920.1| predicted protein [Physcomitrella patens]
Length=399

 Score =   204 bits (519),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 144/165 (87%), Positives = 155/165 (94%), Gaps = 1/165 (1%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGK+NGIA
Sbjct  235  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKINGIA  294

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAA-NELDGILSVCDEPLVSVDFRCsdv  276
            LRVPTPNVSVVDLVVQV KKTFAEEVN AFR++ A  EL G+L+VCDEPLVSVDFRC+DV
Sbjct  295  LRVPTPNVSVVDLVVQVEKKTFAEEVNQAFRDACATEELKGVLAVCDEPLVSVDFRCTDV  354

Query  275  sstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            SSTVDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA IVA +W+
Sbjct  355  SSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHIVAEKWQ  399



>dbj|BAA94304.1| NADP-glyceraldehyde-3-phosphate dehydrogenase [Chlamydomonas 
sp. W80]
Length=369

 Score =   203 bits (516),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 140/164 (85%), Positives = 153/164 (93%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAA+NIVPTSTGAAKAVALVLPS+KGKLNGIA
Sbjct  206  KGTMTTTHSYTGDQRLLDASHRDLRRARAAAMNIVPTSTGAAKAVALVLPSMKGKLNGIA  265

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVS+VDLVVQV KKTFAEEVNAAFRE+A     G+L+V DEPLVSVDFRCSDVS
Sbjct  266  LRVPTPNVSIVDLVVQVEKKTFAEEVNAAFREAANGAQKGVLAVSDEPLVSVDFRCSDVS  325

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            ST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA+I A +W+
Sbjct  326  STIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAEITAQKWE  369



>ref|XP_003548929.2| PREDICTED: LOW QUALITY PROTEIN: glyceraldehyde 3-phosphate dehydrogenase 
GAPA2, chloroplastic-like [Glycine max]
Length=346

 Score =   202 bits (515),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 135/165 (82%), Positives = 140/165 (85%), Gaps = 7/165 (4%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQR LD   R          NIVPTSTGAAKAV LVLP+LKGKLNGIA
Sbjct  188  KGTMTTTHSYTGDQRFLDXRARAAAL------NIVPTSTGAAKAVVLVLPTLKGKLNGIA  241

Query  452  LRVPTPNvsvvdlvvqVSKK-TFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdv  276
            LRVPTPNVSVVDLVVQV+KK TFAEEVNA FRES  NEL GILSVCDEPLVSVDFRCSDV
Sbjct  242  LRVPTPNVSVVDLVVQVTKKXTFAEEVNAVFRESTENELKGILSVCDEPLVSVDFRCSDV  301

Query  275  sstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            SSTVDS LTMV+GDDMVKVIAWYDNE GYSQRVVDLADIVA+ WK
Sbjct  302  SSTVDSXLTMVVGDDMVKVIAWYDNEXGYSQRVVDLADIVAHNWK  346



>gb|ADU04754.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Mesostigma 
viride]
Length=284

 Score =   200 bits (509),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 139/162 (86%), Positives = 151/162 (93%), Gaps = 0/162 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP LKGKLNGIA
Sbjct  123  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPKLKGKLNGIA  182

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLV+QV KKTFAEEVNAA RE+A   + G+L+VCDEPLVSVDF+CSDVS
Sbjct  183  LRVPTPNVSVVDLVIQVEKKTFAEEVNAALREAANGPMKGVLAVCDEPLVSVDFKCSDVS  242

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  147
            ST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA I+A +
Sbjct  243  STIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHIMAKE  284



>ref|XP_001771246.1| predicted protein [Physcomitrella patens]
 gb|EDQ63957.1| predicted protein [Physcomitrella patens]
Length=406

 Score =   204 bits (518),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 144/165 (87%), Positives = 155/165 (94%), Gaps = 1/165 (1%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGK+NGIA
Sbjct  242  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKINGIA  301

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANE-LDGILSVCDEPLVSVDFRCsdv  276
            LRVPTPNVSVVDLVVQV KKTFAEEVN AFR++ A E L G+L+VCDEPLVSVDFRC+DV
Sbjct  302  LRVPTPNVSVVDLVVQVEKKTFAEEVNQAFRDACATEELKGVLAVCDEPLVSVDFRCTDV  361

Query  275  sstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            SSTVDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA IVA +W+
Sbjct  362  SSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHIVAEKWQ  406



>gb|ABK00056.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase, partial 
[Mesostigma viride]
Length=310

 Score =   201 bits (510),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 139/162 (86%), Positives = 151/162 (93%), Gaps = 0/162 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP LKGKLNGIA
Sbjct  149  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPKLKGKLNGIA  208

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLV+QV KKTFAEEVNAA RE+A   + G+L+VCDEPLVSVDF+CSDVS
Sbjct  209  LRVPTPNVSVVDLVIQVEKKTFAEEVNAALREAANGPMKGVLAVCDEPLVSVDFKCSDVS  268

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  147
            ST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA I+A +
Sbjct  269  STIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHIMAKE  310



>gb|ABD37961.1| glyceraldehyde-3-phosphate dehydrogenase subunit A, partial [Mesostigma 
viride]
Length=333

 Score =   201 bits (510),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 140/164 (85%), Positives = 152/164 (93%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP LKGKLNGIA
Sbjct  170  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPKLKGKLNGIA  229

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLV+QV KKTFAEEVNAA RE+A   + G+L+VCDEPLVSVDF+CSDVS
Sbjct  230  LRVPTPNVSVVDLVIQVEKKTFAEEVNAALREAANGPMKGVLAVCDEPLVSVDFKCSDVS  289

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            ST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA I+A + K
Sbjct  290  STIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHIMAKEMK  333



>ref|XP_001779769.1| predicted protein [Physcomitrella patens]
 gb|EDQ55453.1| predicted protein [Physcomitrella patens]
Length=400

 Score =   202 bits (513),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 142/165 (86%), Positives = 155/165 (94%), Gaps = 1/165 (1%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGK+NGIA
Sbjct  236  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKINGIA  295

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANE-LDGILSVCDEPLVSVDFRCsdv  276
            LRVPTPNVSVVDLVVQV KKTFAEEVN AFR++   E L G+L+VCDEPLVSVDFRC+DV
Sbjct  296  LRVPTPNVSVVDLVVQVEKKTFAEEVNQAFRDACETEQLKGVLAVCDEPLVSVDFRCTDV  355

Query  275  sstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            SSTVDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA++VA +W+
Sbjct  356  SSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLANLVAEKWQ  400



>gb|ABD37962.1| glyceraldehyde-3-phosphate dehydrogenase subunit A1, partial 
[Physcomitrella patens]
Length=378

 Score =   201 bits (511),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 142/165 (86%), Positives = 155/165 (94%), Gaps = 1/165 (1%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGK+NGIA
Sbjct  214  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKINGIA  273

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANE-LDGILSVCDEPLVSVDFRCsdv  276
            LRVPTPNVSVVDLVVQV KKTFAEEVN AFR++   E L G+L+VCDEPLVSVDFRC+DV
Sbjct  274  LRVPTPNVSVVDLVVQVEKKTFAEEVNQAFRDACQTEQLKGVLAVCDEPLVSVDFRCTDV  333

Query  275  sstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            SSTVDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA++VA +W+
Sbjct  334  SSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLANLVAEKWE  378



>ref|XP_001779753.1| predicted protein [Physcomitrella patens]
 gb|EDQ55437.1| predicted protein [Physcomitrella patens]
Length=406

 Score =   201 bits (512),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 142/165 (86%), Positives = 155/165 (94%), Gaps = 1/165 (1%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGK+NGIA
Sbjct  242  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKINGIA  301

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANE-LDGILSVCDEPLVSVDFRCsdv  276
            LRVPTPNVSVVDLVVQV KKTFAEEVN AFR++   E L G+L+VCDEPLVSVDFRC+DV
Sbjct  302  LRVPTPNVSVVDLVVQVEKKTFAEEVNQAFRDACETEQLKGVLAVCDEPLVSVDFRCTDV  361

Query  275  sstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            SSTVDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA++VA +W+
Sbjct  362  SSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLANLVAEKWQ  406



>ref|XP_001753934.1| predicted protein [Physcomitrella patens]
 gb|EDQ81256.1| predicted protein [Physcomitrella patens]
Length=406

 Score =   201 bits (512),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 142/165 (86%), Positives = 155/165 (94%), Gaps = 1/165 (1%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGK+NGIA
Sbjct  242  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKINGIA  301

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANE-LDGILSVCDEPLVSVDFRCsdv  276
            LRVPTPNVSVVDLVVQV KKTFAEEVN AFR++   E L G+L+VCDEPLVSVDFRC+DV
Sbjct  302  LRVPTPNVSVVDLVVQVEKKTFAEEVNQAFRDACQTEQLKGVLAVCDEPLVSVDFRCTDV  361

Query  275  sstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            SSTVDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA++VA +W+
Sbjct  362  SSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLANLVAEKWE  406



>gb|AHZ58488.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Syntrichia 
caninervis]
Length=377

 Score =   199 bits (507),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 142/165 (86%), Positives = 154/165 (93%), Gaps = 1/165 (1%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP LKGK+NGIA
Sbjct  213  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPRLKGKINGIA  272

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAAN-ELDGILSVCDEPLVSVDFRCsdv  276
            LRVPTPNVSVVDLVVQV KKTFAEEVN AFR++    +L GIL+VCDEPLVSVDFRC+DV
Sbjct  273  LRVPTPNVSVVDLVVQVEKKTFAEEVNQAFRDACETPQLKGILAVCDEPLVSVDFRCTDV  332

Query  275  sstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            SSTVDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA++VA +W+
Sbjct  333  SSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLANLVAEKWQ  377



>sp|P09043.1|G3PA_TOBAC RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor, partial [Nicotiana 
tabacum]
 gb|AAA34075.1| glyceraldehyde-3-phosphate dehydrogenase A-subunit precursor, 
partial [Nicotiana tabacum]
Length=392

 Score =   198 bits (503),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 144/164 (88%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVAL   +L+G    + 
Sbjct  229  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALSSQALRGSSMALP  288

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRE+A  EL GIL VCDEPLVSVDFRCSDVS
Sbjct  289  LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFREAADKELKGILDVCDEPLVSVDFRCSDVS  348

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            STVD+SLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK
Sbjct  349  STVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  392



>ref|XP_002955293.1| hypothetical protein VOLCADRAFT_76662 [Volvox carteri f. nagariensis]
 gb|EFJ43593.1| hypothetical protein VOLCADRAFT_76662 [Volvox carteri f. nagariensis]
Length=374

 Score =   196 bits (498),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPT+TGAAKAVALVLP LKGKLNGIA
Sbjct  210  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTTTGAAKAVALVLPQLKGKLNGIA  269

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTP VSVVDLVVQV KKTFAEEVNAAFRE+AA  + G+L V D PLVS+DF+C+D S
Sbjct  270  LRVPTPTVSVVDLVVQVEKKTFAEEVNAAFREAAAGPMKGVLHVEDAPLVSIDFKCTDQS  329

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  144
            +++DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA++ A +W
Sbjct  330  TSIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAEVTAQKW  372



>gb|ABA01125.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase, partial 
[Chlamydomonas incerta]
Length=369

 Score =   196 bits (497),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPT+TGAAKAVALVLPSLKGKLNGIA
Sbjct  205  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTTTGAAKAVALVLPSLKGKLNGIA  264

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTP VSVVDLVVQV KKTFAEEVNAAFRE+A   + G+L V D PLVS+DF+C+D S
Sbjct  265  LRVPTPTVSVVDLVVQVEKKTFAEEVNAAFREAANGPMKGVLHVEDAPLVSIDFKCTDQS  324

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  144
            +++D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA+I A +W
Sbjct  325  TSIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAEITAKKW  367



>ref|XP_001420043.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98336.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=341

 Score =   195 bits (495),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 133/164 (81%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQR+LDASHRDLRRARAAALNIVPTSTGAAKAVALVLP LKGKLNGIA
Sbjct  178  KGLMTTTHSYTGDQRILDASHRDLRRARAAALNIVPTSTGAAKAVALVLPQLKGKLNGIA  237

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLV+Q SKK  A+EVNAAFRE AA +L GIL+V DEPLVS DF+CSDVS
Sbjct  238  LRVPTPNVSVVDLVIQTSKKVTADEVNAAFREEAAGKLKGILAVADEPLVSCDFKCSDVS  297

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            +++D++LTMVMGDDM+KV+AWYDNEWGYSQRVVDLA++ A  W+
Sbjct  298  TSIDAALTMVMGDDMLKVVAWYDNEWGYSQRVVDLAELCAANWE  341



>gb|ABG85190.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase subunit 
A [Ostreococcus 'lucimarinus']
Length=380

 Score =   196 bits (498),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 133/164 (81%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQR+LDASHRDLRRARAAALNIVPTSTGAAKAVALVLP LKGKLNGIA
Sbjct  217  KGLMTTTHSYTGDQRILDASHRDLRRARAAALNIVPTSTGAAKAVALVLPQLKGKLNGIA  276

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLV+Q SKK  A+EVNAAFRE AA +L GIL+V DEPLVS DF+CSDVS
Sbjct  277  LRVPTPNVSVVDLVIQTSKKVTADEVNAAFREEAAGKLKGILAVADEPLVSCDFKCSDVS  336

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            +++D++LTMVMGDDM+KV+AWYDNEWGYSQRVVDLA++ A  W+
Sbjct  337  TSIDAALTMVMGDDMLKVVAWYDNEWGYSQRVVDLAELCAANWE  380



>ref|XP_008663258.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Zea mays]
 gb|AFW58475.1| hypothetical protein ZEAMMB73_739238 [Zea mays]
Length=401

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 140/164 (85%), Positives = 149/164 (91%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTH YT DQRLLDASHRDLRRARAAALNIVPTST AAKAVALVLP+LKGKLNGIA
Sbjct  238  KGTMTTTHFYTCDQRLLDASHRDLRRARAAALNIVPTSTSAAKAVALVLPNLKGKLNGIA  297

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            L VPTPNVSV+DLVVQVS+KT AEEVN AFR++AANEL GIL VCD PLVSVDFRCSD S
Sbjct  298  LWVPTPNVSVLDLVVQVSRKTLAEEVNQAFRDAAANELQGILEVCDVPLVSVDFRCSDFS  357

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            ST+D+SLTMVMGDDMVKVI+WYD EWGYSQRVVDL DI ANQWK
Sbjct  358  STIDASLTMVMGDDMVKVISWYDKEWGYSQRVVDLDDICANQWK  401



>ref|XP_008663264.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like 
[Zea mays]
 gb|AFW58480.1| hypothetical protein ZEAMMB73_511551 [Zea mays]
Length=401

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 140/164 (85%), Positives = 149/164 (91%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTH YT DQRLLDASHRDLRRARAAALNIVPTST AAKAVALVLP+LKGKLNGIA
Sbjct  238  KGTMTTTHFYTCDQRLLDASHRDLRRARAAALNIVPTSTSAAKAVALVLPNLKGKLNGIA  297

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            L VPTPNVSV+DLVVQVS+KT AEEVN AFR++AANEL GIL VCD PLVSVDFRCSD S
Sbjct  298  LWVPTPNVSVLDLVVQVSRKTLAEEVNQAFRDAAANELQGILEVCDVPLVSVDFRCSDFS  357

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            ST+D+SLTMVMGDDMVKVI+WYD EWGYSQRVVDL DI ANQWK
Sbjct  358  STIDASLTMVMGDDMVKVISWYDKEWGYSQRVVDLDDICANQWK  401



>gb|ABD37963.1| glyceraldehyde-3-phosphate dehydrogenase subunit A2 [Physcomitrella 
patens]
Length=323

 Score =   194 bits (493),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 139/165 (84%), Positives = 155/165 (94%), Gaps = 1/165 (1%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGK+NGIA
Sbjct  159  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKINGIA  218

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESA-ANELDGILSVCDEPLVSVDFRCsdv  276
            LRVPTPNVSVVDLVVQV KKT AEEVN AFR++   ++L G+L+VCDEPLVSVDFRC+DV
Sbjct  219  LRVPTPNVSVVDLVVQVEKKTSAEEVNQAFRDACNTDQLKGVLAVCDEPLVSVDFRCTDV  278

Query  275  sstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            SSTVDSSLTMVMG+DMVKV+AWYDNEWGYSQRVVDLA++VA +W+
Sbjct  279  SSTVDSSLTMVMGEDMVKVVAWYDNEWGYSQRVVDLANLVAEKWQ  323



>gb|AAG23799.1| chloroplast NADP-dependent glyceraldehyde 3-phosphate dehydrogenase 
A subunit [Cucurbita pepo]
Length=170

 Score =   189 bits (480),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 140/147 (95%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA
Sbjct  24   KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPSLKGKLNGIA  83

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESA  EL+GILSVCDEPLVSVDFRCSDVS
Sbjct  84   LRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESAEKELNGILSVCDEPLVSVDFRCSDVS  143

Query  272  stvdssltmvMGDDMVKVIAWYDNEWG  192
            STVDSSLTMVMGDD+VKVIAWYDNEWG
Sbjct  144  STVDSSLTMVMGDDLVKVIAWYDNEWG  170



>gb|ABD37954.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Cyanophora 
paradoxa]
Length=412

 Score =   196 bits (498),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 136/161 (84%), Positives = 149/161 (93%), Gaps = 0/161 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAA+NIVPTSTGAAKAVALVLP+LKGKLNG+A
Sbjct  250  KGTMTTTHSYTGDQRLLDASHRDLRRARAAAMNIVPTSTGAAKAVALVLPNLKGKLNGLA  309

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVS+VDLVVQV KKTFA+EVNAA RE+A  +L G+L V DEPLVS DFRC+D S
Sbjct  310  LRVPTPNVSIVDLVVQVEKKTFADEVNAALREAANTDLKGVLVVSDEPLVSCDFRCTDQS  369

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVAN  150
            ST+D+SLTMVMGDDMVKVIAWYDNEWGYSQRVVDLA+IVA 
Sbjct  370  STIDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLAEIVAQ  410



>ref|XP_002503470.1| glyceraldehyde-3-phosphate dehydrogenase a chloroplast precursor 
[Micromonas sp. RCC299]
 gb|ACO64728.1| glyceraldehyde-3-phosphate dehydrogenase a chloroplast precursor 
[Micromonas sp. RCC299]
Length=377

 Score =   195 bits (495),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 129/163 (79%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQR+LDASHRDLRRARAAALNIVPTSTGAAKAVALVLP LKGKLNGIA
Sbjct  213  KGLMTTTHSYTGDQRILDASHRDLRRARAAALNIVPTSTGAAKAVALVLPQLKGKLNGIA  272

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVD+ +Q  KK  AEE+NAAFRE+A   + GIL+V DEPLVS+DFRCSDVS
Sbjct  273  LRVPTPNVSVVDMCIQTEKKCTAEEINAAFREAAEGPMKGILAVADEPLVSIDFRCSDVS  332

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  144
            +T+D++LTMVMGDD++KV+AWYDNEWGYSQRVVDLA++ A +W
Sbjct  333  TTIDAALTMVMGDDLIKVVAWYDNEWGYSQRVVDLAELTATKW  375



>gb|ACX37507.1| chloroplast glyceraldehyde 3-phosphate dehydrogenase [Botryococcus 
braunii]
Length=411

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 139/167 (83%), Positives = 150/167 (90%), Gaps = 0/167 (0%)
 Frame = -3

Query  644  LASSRAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKL  465
            L   +  +TTTHSYTGDQRLLDASHRDLRRARAAALNIVPT+TGAAKAVALVLP+LKGKL
Sbjct  244  LGIVKGTVTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTTTGAAKAVALVLPNLKGKL  303

Query  464  NGIALRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRC  285
            NGIALRVPTPNVSVVDLV+QV KKTFAEEVN AFRE+A   + GIL V DEPLVS DF C
Sbjct  304  NGIALRVPTPNVSVVDLVIQVEKKTFAEEVNEAFREAANGPMKGILVVSDEPLVSKDFAC  363

Query  284  sdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  144
            SD SST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA+IVA +W
Sbjct  364  SDQSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAEIVAKKW  410



>gb|AFW58485.1| hypothetical protein ZEAMMB73_956640 [Zea mays]
Length=372

 Score =   194 bits (494),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 139/164 (85%), Positives = 148/164 (90%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTH YT DQRLLDASHRDLRRARAAALNIVPTST AAKAV LVLP+LKGKLNGIA
Sbjct  209  KGTMTTTHFYTCDQRLLDASHRDLRRARAAALNIVPTSTSAAKAVVLVLPNLKGKLNGIA  268

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            L VPTPNVSV+DLVVQVS+KT AEEVN AFR++AANEL GIL VCD PLVSVDFRCSD S
Sbjct  269  LWVPTPNVSVLDLVVQVSRKTLAEEVNQAFRDAAANELQGILEVCDVPLVSVDFRCSDFS  328

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            ST+D+SLTMVMGDDMVKVI+WYD EWGYSQRVVDL DI ANQWK
Sbjct  329  STIDASLTMVMGDDMVKVISWYDKEWGYSQRVVDLDDICANQWK  372



>ref|XP_001766703.1| predicted protein [Physcomitrella patens]
 gb|EDQ68556.1| predicted protein [Physcomitrella patens]
Length=376

 Score =   194 bits (494),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 139/165 (84%), Positives = 155/165 (94%), Gaps = 1/165 (1%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP+LKGK+NGIA
Sbjct  212  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKINGIA  271

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESA-ANELDGILSVCDEPLVSVDFRCsdv  276
            LRVPTPNVSVVDLVVQV KKT AEEVN AFR++   ++L G+L+VCDEPLVSVDFRC+DV
Sbjct  272  LRVPTPNVSVVDLVVQVEKKTSAEEVNQAFRDACNTDQLKGVLAVCDEPLVSVDFRCTDV  331

Query  275  sstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            SSTVDSSLTMVMG+DMVKV+AWYDNEWGYSQRVVDLA++VA +W+
Sbjct  332  SSTVDSSLTMVMGEDMVKVVAWYDNEWGYSQRVVDLANLVAEKWQ  376



>emb|CBL43264.1| glyceraldehyde-3-phosphate dehydrogenase [Solanum tuberosum]
Length=450

 Score =   196 bits (499),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 138/164 (84%), Positives = 152/164 (93%), Gaps = 1/164 (1%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIA
Sbjct  258  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIA  317

Query  452  LRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdv  276
            LRVPTPNVSVVDLV+ V KK   AE+VNAAFR++A   L+GIL+VCDEPLVSVDFRCSDV
Sbjct  318  LRVPTPNVSVVDLVINVEKKGLSAEDVNAAFRKAADGPLNGILAVCDEPLVSVDFRCSDV  377

Query  275  sstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  144
            S+T+DSSLTMVMGDDMVK++AWYDNEWGYSQRVVDLA +VAN+W
Sbjct  378  STTIDSSLTMVMGDDMVKIVAWYDNEWGYSQRVVDLAHLVANKW  421



>ref|XP_001689871.1| glyceraldehyde-3-phosphate dehydrogenase [Chlamydomonas reinhardtii]
 sp|P50362.1|G3PA_CHLRE RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit A; Flags: Precursor [Chlamydomonas 
reinhardtii]
 gb|AAA86855.1| glyceraldehyde-3-phosphate dehydrogenase [Chlamydomonas reinhardtii]
 gb|EDP09609.1| glyceraldehyde-3-phosphate dehydrogenase [Chlamydomonas reinhardtii]
Length=374

 Score =   194 bits (493),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPT+TGAAKAV+LVLPSLKGKLNGIA
Sbjct  210  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTTTGAAKAVSLVLPSLKGKLNGIA  269

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTP VSVVDLVVQV KKTFAEEVNAAFRE+A   + G+L V D PLVS+DF+C+D S
Sbjct  270  LRVPTPTVSVVDLVVQVEKKTFAEEVNAAFREAANGPMKGVLHVEDAPLVSIDFKCTDQS  329

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  144
            +++D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA++ A +W
Sbjct  330  TSIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAEVTAKKW  372



>ref|XP_003055659.1| hypothetical protein MICPUCDRAFT_49403 [Micromonas pusilla CCMP1545]
 gb|EEH60911.1| hypothetical protein MICPUCDRAFT_49403 [Micromonas pusilla CCMP1545]
Length=380

 Score =   194 bits (493),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 130/163 (80%), Positives = 151/163 (93%), Gaps = 0/163 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQR+LDASHRDLRRARAAALNIVPTSTGAAKAVALVLP LKGKLNGIA
Sbjct  215  KGLMTTTHSYTGDQRILDASHRDLRRARAAALNIVPTSTGAAKAVALVLPQLKGKLNGIA  274

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVD+V+QV KK  AE+VNAAFRE+AA  + GIL V DEPLVS+DFRC+DVS
Sbjct  275  LRVPTPNVSVVDMVIQVEKKCTAEDVNAAFREAAAGPMKGILQVVDEPLVSIDFRCTDVS  334

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  144
            +++DS+LTMVMG+D+VK++AWYDNEWGYSQRVVDLA++ A++W
Sbjct  335  TSIDSALTMVMGEDLVKIVAWYDNEWGYSQRVVDLAELTASKW  377



>ref|XP_009786329.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Nicotiana sylvestris]
Length=449

 Score =   196 bits (498),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 141/170 (83%), Positives = 153/170 (90%), Gaps = 1/170 (1%)
 Frame = -3

Query  650  RNLASSRAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKG  471
              L   +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+LVLP LKG
Sbjct  251  EELGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKG  310

Query  470  KLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGILSVCDEPLVSVD  294
            KLNGIALRVPTPNVSVVDLVV V+KK   AE+VNAAFR++A   L G+L+VCDEPLVSVD
Sbjct  311  KLNGIALRVPTPNVSVVDLVVNVAKKGITAEDVNAAFRKAADGPLKGVLAVCDEPLVSVD  370

Query  293  FRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  144
            FRCSDVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VAN+W
Sbjct  371  FRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVANKW  420



>ref|XP_009595874.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Nicotiana tomentosiformis]
Length=449

 Score =   196 bits (497),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 141/170 (83%), Positives = 153/170 (90%), Gaps = 1/170 (1%)
 Frame = -3

Query  650  RNLASSRAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKG  471
              L   +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+LVLP LKG
Sbjct  251  EELGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKG  310

Query  470  KLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGILSVCDEPLVSVD  294
            KLNGIALRVPTPNVSVVDLVV V+KK   AE+VNAAFR++A   L G+L+VCDEPLVSVD
Sbjct  311  KLNGIALRVPTPNVSVVDLVVNVAKKGITAEDVNAAFRKAADGPLKGVLAVCDEPLVSVD  370

Query  293  FRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  144
            FRCSDVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VAN+W
Sbjct  371  FRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVANKW  420



>ref|XP_008664191.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic-like, 
partial [Zea mays]
Length=420

 Score =   195 bits (495),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 139/164 (85%), Positives = 148/164 (90%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTH YT DQRLLDASHRDLRRARAAALNIVPTST AAKAV LVLP+LKGKLNGIA
Sbjct  257  KGTMTTTHFYTCDQRLLDASHRDLRRARAAALNIVPTSTSAAKAVVLVLPNLKGKLNGIA  316

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            L VPTPNVSV+DLVVQVS+KT AEEVN AFR++AANEL GIL VCD PLVSVDFRCSD S
Sbjct  317  LWVPTPNVSVLDLVVQVSRKTLAEEVNQAFRDAAANELQGILEVCDVPLVSVDFRCSDFS  376

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            ST+D+SLTMVMGDDMVKVI+WYD EWGYSQRVVDL DI ANQWK
Sbjct  377  STIDASLTMVMGDDMVKVISWYDKEWGYSQRVVDLDDICANQWK  420



>gb|KJB57938.1| hypothetical protein B456_009G186400 [Gossypium raimondii]
Length=399

 Score =   194 bits (493),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 152/169 (90%), Gaps = 1/169 (1%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIA
Sbjct  206  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIA  265

Query  452  LRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdv  276
            LRVPTPNVSVVDLVV V KK   AE+VNAAFR++A   L G+L VCD PLVSVDFRCSDV
Sbjct  266  LRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAAKGPLKGVLDVCDVPLVSVDFRCSDV  325

Query  275  sstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK*MPA  129
            SST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W  MPA
Sbjct  326  SSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGMPA  374



>dbj|BAN09110.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Artemisia 
indica]
Length=241

 Score =   189 bits (480),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 140/148 (95%), Positives = 143/148 (97%), Gaps = 0/148 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKA ALVLPSLKGKLNGIA
Sbjct  94   KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAAALVLPSLKGKLNGIA  153

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LR PTPNVSVVDLVVQVSKKTFAEEVNAAFRE+A NEL+GILSVCDEPLVSVDFRCSDVS
Sbjct  154  LRAPTPNVSVVDLVVQVSKKTFAEEVNAAFREAADNELNGILSVCDEPLVSVDFRCSDVS  213

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGY  189
            STVDSSLTMVMGDDMVKVIAWYDNEWGY
Sbjct  214  STVDSSLTMVMGDDMVKVIAWYDNEWGY  241



>sp|P09044.1|G3PB_TOBAC RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit B; Flags: Precursor, partial [Nicotiana 
tabacum]
 gb|AAA34076.1| glyceraldehyde-3-phosphate dehydrogenase B-subunit precursor, 
partial [Nicotiana tabacum]
Length=438

 Score =   195 bits (495),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 141/168 (84%), Positives = 152/168 (90%), Gaps = 1/168 (1%)
 Frame = -3

Query  644  LASSRAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKL  465
            L   +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKL
Sbjct  224  LGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKL  283

Query  464  NGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFR  288
            NGIALRVPTPNVSVVDLVV V+KK   AE+VNAAFR++A   L G+L+VCDEPLVSVDFR
Sbjct  284  NGIALRVPTPNVSVVDLVVNVAKKGITAEDVNAAFRKAADGPLKGVLAVCDEPLVSVDFR  343

Query  287  CsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  144
            CSDVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VAN W
Sbjct  344  CSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVANNW  391



>gb|ABD37965.1| glyceraldehyde-3-phosphate dehydrogenase subunit B [Mesostigma 
viride]
Length=415

 Score =   194 bits (493),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 139/173 (80%), Positives = 149/173 (86%), Gaps = 1/173 (1%)
 Frame = -3

Query  650  RNLASSRAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKG  471
             N    +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+LVLP LKG
Sbjct  216  ENFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPKLKG  275

Query  470  KLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGILSVCDEPLVSVD  294
            KLNGIALRVPTPNVSVVDLV+  +KK   AEEVNAAFR+ A   + GIL+V D PLVS+D
Sbjct  276  KLNGIALRVPTPNVSVVDLVINTTKKGMTAEEVNAAFRKEANGAMKGILAVSDLPLVSID  335

Query  293  FRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK*M  135
            FRCSDVS T+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLADIVAN W  M
Sbjct  336  FRCSDVSCTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLADIVANNWPGM  388



>gb|AES74101.2| glyceraldehyde-3-phosphate dehydrogenase B [Medicago truncatula]
Length=317

 Score =   191 bits (486),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 139/168 (83%), Positives = 151/168 (90%), Gaps = 1/168 (1%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIA
Sbjct  125  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIA  184

Query  452  LRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdv  276
            LRVPTPNVSVVDLVV V+KK   AE+VNAAFR++A   L G+L VCD PLVSVDFRC+DV
Sbjct  185  LRVPTPNVSVVDLVVNVAKKGISAEDVNAAFRKAAEGPLKGVLDVCDVPLVSVDFRCTDV  244

Query  275  sstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK*MP  132
            SST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VAN+W   P
Sbjct  245  SSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVANKWPGTP  292



>ref|XP_006342537.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Solanum tuberosum]
Length=450

 Score =   194 bits (494),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 137/164 (84%), Positives = 153/164 (93%), Gaps = 1/164 (1%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIA
Sbjct  258  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIA  317

Query  452  LRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdv  276
            LRVPTPNVSVVDLV+ V+KK   AE+VNAAFR++A   L+GIL+VCDEPLVSVDFRCSDV
Sbjct  318  LRVPTPNVSVVDLVINVAKKGISAEDVNAAFRKAADGPLNGILAVCDEPLVSVDFRCSDV  377

Query  275  sstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  144
            S+T+DSSLTMVMGDDMVK++AWYDNEWGYSQRVVDLA +VA++W
Sbjct  378  STTIDSSLTMVMGDDMVKIVAWYDNEWGYSQRVVDLAHLVASKW  421



>ref|XP_003081785.1| NADP-glyceraldehyde-3-phosphate dehydrogenase (IC), partial [Ostreococcus 
tauri]
Length=378

 Score =   192 bits (488),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 132/164 (80%), Positives = 147/164 (90%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQR+LDASHRDLRRARAA LNIVPTSTGAAKAVALVLP LKGKLNGIA
Sbjct  215  KGLMTTTHSYTGDQRILDASHRDLRRARAACLNIVPTSTGAAKAVALVLPQLKGKLNGIA  274

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQ SKK  A+EVNAAFRE+A   L GIL+V DEPLVS DFRC+DVS
Sbjct  275  LRVPTPNVSVVDLVVQTSKKCTADEVNAAFREAANGPLKGILAVADEPLVSCDFRCTDVS  334

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
             T+D++LTMVMGDDM+KV++WYDNEWGYSQRVVDLA++ A  W+
Sbjct  335  CTIDAALTMVMGDDMLKVVSWYDNEWGYSQRVVDLAELCAANWE  378



>ref|XP_004253122.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Solanum lycopersicum]
Length=450

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 137/164 (84%), Positives = 152/164 (93%), Gaps = 1/164 (1%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIA
Sbjct  258  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIA  317

Query  452  LRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdv  276
            LRVPTPNVSVVDLV+ V KK   AE+VNAAFR++A   L+GIL+VCDEPLVSVDFRCSDV
Sbjct  318  LRVPTPNVSVVDLVINVEKKGISAEDVNAAFRKAADGPLNGILAVCDEPLVSVDFRCSDV  377

Query  275  sstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  144
            S+T+DSSLTMVMGDDMVK++AWYDNEWGYSQRVVDLA +VA++W
Sbjct  378  STTIDSSLTMVMGDDMVKIVAWYDNEWGYSQRVVDLAHLVADKW  421



>gb|ABG85189.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase subunit 
A [Ostreococcus tauri]
 emb|CEF99493.1| Glyceraldehyde 3-phosphate dehydrogenase, NAD(P) binding domain 
[Ostreococcus tauri]
Length=380

 Score =   192 bits (488),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 132/164 (80%), Positives = 147/164 (90%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQR+LDASHRDLRRARAA LNIVPTSTGAAKAVALVLP LKGKLNGIA
Sbjct  217  KGLMTTTHSYTGDQRILDASHRDLRRARAACLNIVPTSTGAAKAVALVLPQLKGKLNGIA  276

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQ SKK  A+EVNAAFRE+A   L GIL+V DEPLVS DFRC+DVS
Sbjct  277  LRVPTPNVSVVDLVVQTSKKCTADEVNAAFREAANGPLKGILAVADEPLVSCDFRCTDVS  336

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
             T+D++LTMVMGDDM+KV++WYDNEWGYSQRVVDLA++ A  W+
Sbjct  337  CTIDAALTMVMGDDMLKVVSWYDNEWGYSQRVVDLAELCAANWE  380



>gb|KHG26323.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Gossypium 
arboreum]
Length=455

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 152/169 (90%), Gaps = 1/169 (1%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIA
Sbjct  262  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIA  321

Query  452  LRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdv  276
            LRVPTPNVSVVDLVV V KK   AE+VNAAFR++A   L G+L VCD PLVSVDFRCSDV
Sbjct  322  LRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAAEGPLKGVLDVCDVPLVSVDFRCSDV  381

Query  275  sstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK*MPA  129
            SST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W  MPA
Sbjct  382  SSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGMPA  430



>gb|KJB57936.1| hypothetical protein B456_009G186400 [Gossypium raimondii]
Length=455

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 152/169 (90%), Gaps = 1/169 (1%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIA
Sbjct  262  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIA  321

Query  452  LRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdv  276
            LRVPTPNVSVVDLVV V KK   AE+VNAAFR++A   L G+L VCD PLVSVDFRCSDV
Sbjct  322  LRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAAKGPLKGVLDVCDVPLVSVDFRCSDV  381

Query  275  sstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK*MPA  129
            SST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W  MPA
Sbjct  382  SSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGMPA  430



>ref|XP_006855683.1| hypothetical protein AMTR_s00044p00131190 [Amborella trichopoda]
 gb|ERN17150.1| hypothetical protein AMTR_s00044p00131190 [Amborella trichopoda]
Length=413

 Score =   193 bits (490),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 140/164 (85%), Positives = 150/164 (91%), Gaps = 1/164 (1%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIA
Sbjct  221  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPKLKGKLNGIA  280

Query  452  LRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdv  276
            LRVPTPNVSVVDLVV V KK   AE+VNAAFR+SA   L GIL+VCD PLVSVDFRCSDV
Sbjct  281  LRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFRKSAEGPLKGILAVCDVPLVSVDFRCSDV  340

Query  275  sstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  144
            SST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W
Sbjct  341  SSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  384



>ref|XP_003558903.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Brachypodium distachyon]
Length=446

 Score =   194 bits (492),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 137/164 (84%), Positives = 151/164 (92%), Gaps = 1/164 (1%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP LKGKLNGIA
Sbjct  254  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPQLKGKLNGIA  313

Query  452  LRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdv  276
            LRVPTPNVSVVDLV+  +K    A++VNAAFR++AA  L+GIL VCDEPLVSVDFRCSDV
Sbjct  314  LRVPTPNVSVVDLVINTAKTGITADDVNAAFRKAAAGPLNGILDVCDEPLVSVDFRCSDV  373

Query  275  sstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  144
            SST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W
Sbjct  374  SSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  417



>gb|ABD37955.1| glyceraldehyde-3-phosphate dehydrogenase subunit A [Scherffelia 
dubia]
Length=390

 Score =   192 bits (488),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 133/162 (82%), Positives = 150/162 (93%), Gaps = 0/162 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPT+TGAAKAVALVLP LKGKLNG A
Sbjct  228  KGMMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTTTGAAKAVALVLPGLKGKLNGFA  287

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQV KKTFAEEVN AFR++AA  + G+L++ D PLVSVDFRC+DVS
Sbjct  288  LRVPTPNVSVVDLVVQVEKKTFAEEVNQAFRDAAAGPMKGVLAITDIPLVSVDFRCTDVS  347

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQ  147
            +TVD++LTMVMGDDMVK++AWYDNEWGYSQRVVDLA++VA +
Sbjct  348  TTVDAALTMVMGDDMVKIVAWYDNEWGYSQRVVDLAELVAKK  389



>gb|KJB14201.1| hypothetical protein B456_002G114000 [Gossypium raimondii]
Length=454

 Score =   194 bits (492),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 141/170 (83%), Positives = 152/170 (89%), Gaps = 1/170 (1%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIA
Sbjct  261  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIA  320

Query  452  LRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdv  276
            LRVPTPNVSVVDLVV V KK   AE+VNAAFR+SA   L G+L VCD PLVSVDFRCSDV
Sbjct  321  LRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKSAEGPLKGVLEVCDIPLVSVDFRCSDV  380

Query  275  sstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK*MPAS  126
            SST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W  MP +
Sbjct  381  SSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGMPVA  430



>emb|CAA33262.1| unnamed protein product [Pisum sativum]
Length=447

 Score =   193 bits (491),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 140/168 (83%), Positives = 151/168 (90%), Gaps = 1/168 (1%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIA
Sbjct  255  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIA  314

Query  452  LRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdv  276
            LRVPTPNVSVVDLVV V+KK   AE+VNAAFR++A   L GIL VCD PLVSVDFRCSDV
Sbjct  315  LRVPTPNVSVVDLVVNVAKKGISAEDVNAAFRKAAEGPLKGILDVCDVPLVSVDFRCSDV  374

Query  275  sstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK*MP  132
            S+T+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VAN+W   P
Sbjct  375  STTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVANKWPGTP  422



>sp|P12859.2|G3PB_PEA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic; 
AltName: Full=NADP-dependent glyceraldehydephosphate 
dehydrogenase subunit B; Flags: Precursor [Pisum sativum]
 gb|AAA84543.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Pisum sativum]
Length=451

 Score =   193 bits (491),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 140/168 (83%), Positives = 151/168 (90%), Gaps = 1/168 (1%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIA
Sbjct  259  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIA  318

Query  452  LRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdv  276
            LRVPTPNVSVVDLVV V+KK   AE+VNAAFR++A   L GIL VCD PLVSVDFRCSDV
Sbjct  319  LRVPTPNVSVVDLVVNVAKKGISAEDVNAAFRKAAEGPLKGILDVCDVPLVSVDFRCSDV  378

Query  275  sstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK*MP  132
            S+T+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VAN+W   P
Sbjct  379  STTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVANKWPGTP  426



>gb|ACA35006.1| glyceraldehyde-3-phosphate dehydrogenase [Dunaliella salina]
Length=376

 Score =   191 bits (485),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 131/163 (80%), Positives = 146/163 (90%), Gaps = 0/163 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPT+TGAAKAVALVLP LKGKLNG+A
Sbjct  212  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTTTGAAKAVALVLPELKGKLNGVA  271

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVS+VDLVVQV KKTFAEEVN AFRE+AA  +  +L+V DEPLVS DF+  D S
Sbjct  272  LRVPTPNVSIVDLVVQVEKKTFAEEVNNAFREAAAGPMKNVLAVADEPLVSADFKGMDQS  331

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  144
            + +DS+LTMVMGDDMVKV+AWYDNEWGYSQRVVDLA+I A +W
Sbjct  332  TAIDSALTMVMGDDMVKVVAWYDNEWGYSQRVVDLAEITAQRW  374



>ref|XP_011399143.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Auxenochlorella 
protothecoides]
 gb|KFM26247.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Auxenochlorella 
protothecoides]
Length=412

 Score =   192 bits (487),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 132/164 (80%), Positives = 149/164 (91%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPT+TGAAKAVALVLP LKGKLNG+A
Sbjct  249  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTTTGAAKAVALVLPQLKGKLNGVA  308

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTP VSVVDLV+Q  KKTF EEVN+AFRE++   L GIL+V DEPLVS D+R +DVS
Sbjct  309  LRVPTPTVSVVDLVIQTEKKTFTEEVNSAFREASEGYLKGILAVSDEPLVSCDYRMTDVS  368

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            ST+D++LTMVMGDDMVKVIAWYDNEWGYSQRVVDLA++VA +W+
Sbjct  369  STIDAALTMVMGDDMVKVIAWYDNEWGYSQRVVDLAELVAQKWE  412



>ref|XP_003603851.1| Glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
 gb|AES74102.1| glyceraldehyde-3-phosphate dehydrogenase B [Medicago truncatula]
Length=451

 Score =   193 bits (490),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 139/168 (83%), Positives = 151/168 (90%), Gaps = 1/168 (1%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIA
Sbjct  259  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIA  318

Query  452  LRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdv  276
            LRVPTPNVSVVDLVV V+KK   AE+VNAAFR++A   L G+L VCD PLVSVDFRC+DV
Sbjct  319  LRVPTPNVSVVDLVVNVAKKGISAEDVNAAFRKAAEGPLKGVLDVCDVPLVSVDFRCTDV  378

Query  275  sstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK*MP  132
            SST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VAN+W   P
Sbjct  379  SSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVANKWPGTP  426



>gb|KHG00663.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Gossypium 
arboreum]
Length=454

 Score =   192 bits (489),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 140/170 (82%), Positives = 152/170 (89%), Gaps = 1/170 (1%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIA
Sbjct  261  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIA  320

Query  452  LRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdv  276
            LRVPTPNVSVVDLVV V KK   AE+VNAAFR++A   L G+L VCD PLVSVDFRCSDV
Sbjct  321  LRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAAEGPLKGVLEVCDIPLVSVDFRCSDV  380

Query  275  sstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK*MPAS  126
            SST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W  MP +
Sbjct  381  SSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGMPVA  430



>ref|XP_007018105.1| Glyceraldehyde-3-phosphate dehydrogenase B subunit [Theobroma 
cacao]
 gb|EOY15330.1| Glyceraldehyde-3-phosphate dehydrogenase B subunit [Theobroma 
cacao]
Length=452

 Score =   192 bits (489),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 140/170 (82%), Positives = 153/170 (90%), Gaps = 1/170 (1%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIA
Sbjct  259  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIA  318

Query  452  LRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdv  276
            LRVPTPNVSVVDLVV V KK   AE+VNAAFR++A   L G+L VCD PLVSVDFRCSDV
Sbjct  319  LRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAAEGPLKGVLDVCDVPLVSVDFRCSDV  378

Query  275  sstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK*MPAS  126
            SST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W  +PA+
Sbjct  379  SSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVPAA  428



>gb|ABF93789.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplast precursor, 
putative, expressed [Oryza sativa Japonica Group]
 dbj|BAG90581.1| unnamed protein product [Oryza sativa Japonica Group]
Length=318

 Score =   189 bits (480),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 136/164 (83%), Positives = 148/164 (90%), Gaps = 1/164 (1%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLP LKGKLNGIA
Sbjct  125  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPQLKGKLNGIA  184

Query  452  LRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdv  276
            LRVPTPNVSVVDLV+   K    A++VNAAFR++AA  L GIL VCD PLVSVDFRCSDV
Sbjct  185  LRVPTPNVSVVDLVINTVKTGITADDVNAAFRKAAAGPLSGILDVCDVPLVSVDFRCSDV  244

Query  275  sstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  144
            SST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W
Sbjct  245  SSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  288



>gb|KGN49135.1| hypothetical protein Csa_6G514950 [Cucumis sativus]
Length=191

 Score =   185 bits (469),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 133/161 (83%), Positives = 149/161 (93%), Gaps = 1/161 (1%)
 Frame = -3

Query  623  MTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIALRV  444
            MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIALRV
Sbjct  1    MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRV  60

Query  443  PTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvsst  267
            PTPNVSVVDLVV + KK   A++VNAAFR++A   L G+L+VCD PLVSVDF+C+DVSST
Sbjct  61   PTPNVSVVDLVVNIEKKGISADDVNAAFRKAADGPLKGVLAVCDIPLVSVDFKCTDVSST  120

Query  266  vdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  144
            +DSSLTMVMGDDM+KV+AWYDNEWGYSQRVVDLA +VA++W
Sbjct  121  IDSSLTMVMGDDMLKVVAWYDNEWGYSQRVVDLAHLVADKW  161



>gb|KDP36765.1| hypothetical protein JCGZ_08056 [Jatropha curcas]
Length=452

 Score =   192 bits (489),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 139/164 (85%), Positives = 149/164 (91%), Gaps = 1/164 (1%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIA
Sbjct  259  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIA  318

Query  452  LRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdv  276
            LRVPTPNVSVVDLVV V KK   AE+VNAAFR++A   L GIL VCD PLVSVDFRC+DV
Sbjct  319  LRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAADGPLKGILDVCDVPLVSVDFRCTDV  378

Query  275  sstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  144
            SST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VAN+W
Sbjct  379  SSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVANEW  422



>ref|XP_009384599.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=449

 Score =   192 bits (488),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 140/169 (83%), Positives = 153/169 (91%), Gaps = 1/169 (1%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIA
Sbjct  256  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIA  315

Query  452  LRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdv  276
            LRVPTPNVSVVDLVV V+KK   AE+VN AFR++A   L GIL+VCD PLVSVDFRCSDV
Sbjct  316  LRVPTPNVSVVDLVVNVAKKGMTAEDVNNAFRKAAQGPLKGILAVCDVPLVSVDFRCSDV  375

Query  275  sstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK*MPA  129
            SST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W  +PA
Sbjct  376  SSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVPA  424



>ref|XP_009384600.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=447

 Score =   192 bits (488),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 140/169 (83%), Positives = 153/169 (91%), Gaps = 1/169 (1%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIA
Sbjct  254  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIA  313

Query  452  LRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdv  276
            LRVPTPNVSVVDLVV V+KK   AE+VN AFR++A   L GIL+VCD PLVSVDFRCSDV
Sbjct  314  LRVPTPNVSVVDLVVNVAKKGMTAEDVNNAFRKAAQGPLKGILAVCDVPLVSVDFRCSDV  373

Query  275  sstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK*MPA  129
            SST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W  +PA
Sbjct  374  SSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGVPA  422



>ref|XP_010539030.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
[Tarenaya hassleriana]
Length=453

 Score =   192 bits (488),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 139/164 (85%), Positives = 151/164 (92%), Gaps = 1/164 (1%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIA
Sbjct  260  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIA  319

Query  452  LRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdv  276
            LRVPTPNVSVVDLVV V KK   AE+VNAAFR++A+  L+GIL VCD PLVSVDFRCSDV
Sbjct  320  LRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFRKAASGPLNGILDVCDVPLVSVDFRCSDV  379

Query  275  sstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  144
            SST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W
Sbjct  380  SSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  423



>gb|ABK00057.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase [Mesostigma 
viride]
Length=384

 Score =   190 bits (483),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 137/173 (79%), Positives = 147/173 (85%), Gaps = 1/173 (1%)
 Frame = -3

Query  650  RNLASSRAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKG  471
             N    +  MTTTHSYTGDQRLLDASHRDLRRARAAA NIVPTSTGAAKAV+LVLP LKG
Sbjct  188  ENFGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAAFNIVPTSTGAAKAVSLVLPKLKG  247

Query  470  KLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGILSVCDEPLVSVD  294
            KLNGIALRVPTPNVSVVDLV+  +KK   AEEVNAAFR+ A   + GIL+V D PLVS+D
Sbjct  248  KLNGIALRVPTPNVSVVDLVINTTKKGMTAEEVNAAFRKEANGAMKGILAVSDLPLVSID  307

Query  293  FRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK*M  135
            FRCSDVS T+DSSLTMVMGDDMVKV+AWY NEWGYSQRVVDLADIVAN W  M
Sbjct  308  FRCSDVSCTIDSSLTMVMGDDMVKVVAWYGNEWGYSQRVVDLADIVANNWPGM  360



>gb|ABC00187.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase [Dunaliella 
viridis]
 gb|ABC00188.1| chloroplast glyceraldehyde-3-phosphate dehydrogenase [Dunaliella 
viridis]
Length=376

 Score =   190 bits (482),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 130/163 (80%), Positives = 146/163 (90%), Gaps = 0/163 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPT+TGAAKAVALVLP LKGKLNG+A
Sbjct  212  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTTTGAAKAVALVLPDLKGKLNGVA  271

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVS+VDLVVQV KKTFAEEVN AFRE+AA  +  +L+V DEPLVS DF+  D S
Sbjct  272  LRVPTPNVSIVDLVVQVEKKTFAEEVNNAFREAAAGPMSNVLAVADEPLVSADFKGMDQS  331

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  144
            + +DS+LTMVMGDDMVKV+AWYDNEWGYSQRVVDLA++ A +W
Sbjct  332  TAIDSALTMVMGDDMVKVVAWYDNEWGYSQRVVDLAELTAQRW  374



>ref|XP_008786670.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Phoenix dactylifera]
Length=452

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 151/168 (90%), Gaps = 1/168 (1%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIA
Sbjct  259  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIA  318

Query  452  LRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdv  276
            LRVPTPNVSVVDLVV V KK   AE+VN AFR++A   L GIL+VCD PLVSVDFRC+DV
Sbjct  319  LRVPTPNVSVVDLVVNVEKKGITAEDVNQAFRKAADGPLKGILAVCDVPLVSVDFRCTDV  378

Query  275  sstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK*MP  132
            SST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W  MP
Sbjct  379  SSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGMP  426



>ref|XP_009780936.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Nicotiana sylvestris]
Length=449

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 138/164 (84%), Positives = 151/164 (92%), Gaps = 1/164 (1%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIA
Sbjct  257  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIA  316

Query  452  LRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdv  276
            LRVPTPNVSVVDLVV + KK   AE+VNAAFR++A   L+GIL+VCD PLVSVDFRCSDV
Sbjct  317  LRVPTPNVSVVDLVVNIEKKGISAEDVNAAFRKAADGPLNGILAVCDVPLVSVDFRCSDV  376

Query  275  sstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  144
            SST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W
Sbjct  377  SSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  420



>ref|XP_010918353.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Elaeis guineensis]
Length=452

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 150/168 (89%), Gaps = 1/168 (1%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIA
Sbjct  259  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIA  318

Query  452  LRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdv  276
            LRVPTPNVSVVDLVV V KK   AE+VN AFR++A   L GIL VCD PLVSVDFRC+DV
Sbjct  319  LRVPTPNVSVVDLVVNVEKKGITAEDVNQAFRKAANGPLKGILDVCDVPLVSVDFRCTDV  378

Query  275  sstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK*MP  132
            SST+D+SLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W  MP
Sbjct  379  SSTIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGMP  426



>ref|XP_009629570.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=449

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 139/164 (85%), Positives = 151/164 (92%), Gaps = 1/164 (1%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIA
Sbjct  257  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIA  316

Query  452  LRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdv  276
            LRVPTPNVSVVDLVV V KK   AE+VNAAFR++A   L+GIL+VCD PLVSVDFRCSDV
Sbjct  317  LRVPTPNVSVVDLVVNVEKKGISAEDVNAAFRKAADGPLNGILAVCDVPLVSVDFRCSDV  376

Query  275  sstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  144
            SST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W
Sbjct  377  SSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  420



>ref|XP_007211185.1| hypothetical protein PRUPE_ppa005598mg [Prunus persica]
 gb|EMJ12384.1| hypothetical protein PRUPE_ppa005598mg [Prunus persica]
Length=452

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 151/168 (90%), Gaps = 1/168 (1%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIA
Sbjct  259  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIA  318

Query  452  LRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdv  276
            LRVPTPNVSVVDLV+ V KK   AE+VNAAFR++A   L GIL+VCD PLVSVDFRC+DV
Sbjct  319  LRVPTPNVSVVDLVINVEKKGISAEDVNAAFRKAAEGPLQGILAVCDIPLVSVDFRCTDV  378

Query  275  sstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK*MP  132
            SST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W   P
Sbjct  379  SSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGTP  426



>ref|XP_004500847.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Cicer arietinum]
Length=525

 Score =   193 bits (490),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 151/168 (90%), Gaps = 1/168 (1%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIA
Sbjct  333  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIA  392

Query  452  LRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdv  276
            LRVPTPNVSVVDLV+ V+KK   AE+VNAAFR++A   L G+L VCD PLVSVDFRC+DV
Sbjct  393  LRVPTPNVSVVDLVINVAKKGISAEDVNAAFRKAAEGPLKGVLDVCDLPLVSVDFRCTDV  452

Query  275  sstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK*MP  132
            SST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VAN+W   P
Sbjct  453  SSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVANKWPGTP  500



>ref|XP_006342156.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Solanum tuberosum]
Length=450

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 140/170 (82%), Positives = 150/170 (88%), Gaps = 1/170 (1%)
 Frame = -3

Query  650  RNLASSRAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKG  471
              L   +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+LVLP LKG
Sbjct  252  EELGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKG  311

Query  470  KLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGILSVCDEPLVSVD  294
            KLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR++A   L GIL VCD PLVSVD
Sbjct  312  KLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAADGPLKGILDVCDAPLVSVD  371

Query  293  FRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  144
            FRCSDVS+T+DSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLA +VA++W
Sbjct  372  FRCSDVSATIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLAHLVASKW  421



>gb|EMS61784.1| Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic [Triticum 
urartu]
Length=365

 Score =   189 bits (480),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 131/164 (80%), Gaps = 27/164 (16%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRL                           AVALVLP+LKGKLNGIA
Sbjct  229  KGTMTTTHSYTGDQRL---------------------------AVALVLPNLKGKLNGIA  261

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLVVQVSKKT AEEVN AFR++AANEL GIL VCDEPLVSVDFRCSDVS
Sbjct  262  LRVPTPNVSVVDLVVQVSKKTLAEEVNQAFRDAAANELKGILDVCDEPLVSVDFRCSDVS  321

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            ST+D+SL+MVMGDDMVKVIAWYDNEWGYSQRVVDLADIVA+QWK
Sbjct  322  STIDASLSMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVADQWK  365



>ref|XP_008237955.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Prunus mume]
Length=452

 Score =   191 bits (485),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 137/164 (84%), Positives = 150/164 (91%), Gaps = 1/164 (1%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIA
Sbjct  259  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIA  318

Query  452  LRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdv  276
            LRVPTPNVSVVDLV+ V KK   AE+VNAAFR++A   L GIL+VCD PLVSVDFRC+DV
Sbjct  319  LRVPTPNVSVVDLVINVEKKGISAEDVNAAFRKAAEGPLQGILAVCDVPLVSVDFRCTDV  378

Query  275  sstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  144
            SST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W
Sbjct  379  SSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  422



>gb|AFG28405.1| glyceraldehyde-3-phosphate dehydrogenase B [Pyrus x bretschneideri]
Length=452

 Score =   191 bits (485),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 137/164 (84%), Positives = 151/164 (92%), Gaps = 1/164 (1%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIA
Sbjct  259  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIA  318

Query  452  LRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdv  276
            LRVPTPNVSVVDLV+ V+KK   AE+VNAAFR++A   L GIL+VCD PLVSVDFRC+DV
Sbjct  319  LRVPTPNVSVVDLVINVAKKGISAEDVNAAFRKAADGPLKGILAVCDVPLVSVDFRCTDV  378

Query  275  sstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  144
            SST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W
Sbjct  379  SSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  422



>ref|XP_008346447.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Malus domestica]
Length=452

 Score =   191 bits (485),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 137/164 (84%), Positives = 151/164 (92%), Gaps = 1/164 (1%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIA
Sbjct  259  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIA  318

Query  452  LRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdv  276
            LRVPTPNVSVVDLV+ V+KK   AE+VNAAFR++A   L GIL+VCD PLVSVDFRC+DV
Sbjct  319  LRVPTPNVSVVDLVINVAKKGISAEDVNAAFRKAADGPLKGILAVCDVPLVSVDFRCTDV  378

Query  275  sstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  144
            SST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W
Sbjct  379  SSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  422



>ref|NP_001289237.1| glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Pyrus 
x bretschneideri]
 gb|AHM26621.1| glyceraldehyde-3-phosphate dehydrogenase B [Pyrus x bretschneideri]
Length=452

 Score =   191 bits (485),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 137/164 (84%), Positives = 151/164 (92%), Gaps = 1/164 (1%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIA
Sbjct  259  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIA  318

Query  452  LRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdv  276
            LRVPTPNVSVVDLV+ V+KK   AE+VNAAFR++A   L GIL+VCD PLVSVDFRC+DV
Sbjct  319  LRVPTPNVSVVDLVINVAKKGISAEDVNAAFRKAADGPLKGILAVCDVPLVSVDFRCTDV  378

Query  275  sstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  144
            SST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W
Sbjct  379  SSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  422



>ref|XP_010061201.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic 
[Eucalyptus grandis]
 gb|KCW68119.1| hypothetical protein EUGRSUZ_F01793 [Eucalyptus grandis]
Length=454

 Score =   191 bits (485),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 138/164 (84%), Positives = 150/164 (91%), Gaps = 1/164 (1%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIA
Sbjct  260  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIA  319

Query  452  LRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdv  276
            LRVPTPNVSVVDLVV V KK   AE+VNAAFR++A   L GIL+VCD+PLVSVDFRCSDV
Sbjct  320  LRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFRDAAEGPLKGILAVCDDPLVSVDFRCSDV  379

Query  275  sstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  144
            SST+DSSL+MVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA +W
Sbjct  380  SSTIDSSLSMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAVKW  423



>emb|CAC80389.2| glyceraldehyde-3-phosphate dehydrogenase [Marchantia polymorpha]
Length=457

 Score =   191 bits (485),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 138/164 (84%), Positives = 147/164 (90%), Gaps = 1/164 (1%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIA
Sbjct  265  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIA  324

Query  452  LRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdv  276
            LRVPTPNVSVVDLV+   KK   AE+VN AFRE+A   L GIL+VCD PLVS+DFRCSDV
Sbjct  325  LRVPTPNVSVVDLVINTEKKGLTAEDVNNAFREAANGPLKGILAVCDIPLVSIDFRCSDV  384

Query  275  sstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  144
            SSTVDSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA QW
Sbjct  385  SSTVDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVAAQW  428



>ref|XP_004238446.2| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Solanum lycopersicum]
Length=450

 Score =   191 bits (484),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 140/170 (82%), Positives = 150/170 (88%), Gaps = 1/170 (1%)
 Frame = -3

Query  650  RNLASSRAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKG  471
              L   +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+LVLP LKG
Sbjct  252  EELGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKG  311

Query  470  KLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGILSVCDEPLVSVD  294
            KLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR++A   L GIL VCD PLVSVD
Sbjct  312  KLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAADGPLKGILDVCDAPLVSVD  371

Query  293  FRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  144
            FRCSDVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W
Sbjct  372  FRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  421



>gb|EPS70760.1| hypothetical protein M569_03997, partial [Genlisea aurea]
Length=440

 Score =   191 bits (484),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 136/164 (83%), Positives = 149/164 (91%), Gaps = 1/164 (1%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIA
Sbjct  247  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIA  306

Query  452  LRVPTPNvsvvdlvvqVSKKTFA-EEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdv  276
            LRVPTPNVSVVDLVV V KK  A E++N+AFR++A   L G+L VCD PLVSVDFRC+DV
Sbjct  307  LRVPTPNVSVVDLVVNVEKKGIAAEDINSAFRKAAEGPLKGVLDVCDAPLVSVDFRCTDV  366

Query  275  sstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  144
            SST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VAN+W
Sbjct  367  SSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVANKW  410



>ref|XP_009362871.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
Length=452

 Score =   191 bits (484),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 137/164 (84%), Positives = 151/164 (92%), Gaps = 1/164 (1%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIA
Sbjct  259  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIA  318

Query  452  LRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdv  276
            LRVPTPNVSVVDLV+ V+KK   AE+VNAAFR++A   L GIL+VCD PLVSVDFRC+DV
Sbjct  319  LRVPTPNVSVVDLVINVAKKGISAEDVNAAFRKAADGPLKGILAVCDVPLVSVDFRCTDV  378

Query  275  sstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  144
            SST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W
Sbjct  379  SSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  422



>gb|ABD37953.1| glyceraldehyde-3-phosphate dehydrogenase subunit A, partial [Chlorella 
sp. JP-2005]
Length=316

 Score =   187 bits (475),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 135/164 (82%), Positives = 145/164 (88%), Gaps = 0/164 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPT+TGAAKAVALVLP LKGKLNG+A
Sbjct  153  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTTTGAAKAVALVLPKLKGKLNGVA  212

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTP VSVVDLVVQV KKTFAEEVN AFRE+A   L GIL V DEPLVS DF+ ++VS
Sbjct  213  LRVPTPTVSVVDLVVQVEKKTFAEEVNEAFREAANGPLKGILGVSDEPLVSCDFKMTNVS  272

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK  141
            ST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA   A  W+
Sbjct  273  STIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAAYTAKHWE  316



>ref|XP_005644071.1| glyceraldehyde-3-phosphate dehydrogenase [Coccomyxa subellipsoidea 
C-169]
 gb|EIE19527.1| glyceraldehyde-3-phosphate dehydrogenase [Coccomyxa subellipsoidea 
C-169]
Length=393

 Score =   189 bits (480),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPT+TGAAKAVALVLP LKGKLNGIA
Sbjct  231  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTTTGAAKAVALVLPELKGKLNGIA  290

Query  452  LRVPTPNvsvvdlvvqVSKKTFAEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdvs  273
            LRVPTPNVSVVDLV+QV KKT AEEVN AFR +AANEL GIL+V D PLVS DF  +DVS
Sbjct  291  LRVPTPNVSVVDLVIQVEKKTLAEEVNEAFRNAAANELKGILAVSDVPLVSRDFALTDVS  350

Query  272  stvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVA  153
            +T+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA++VA
Sbjct  351  TTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAELVA  390



>ref|XP_006307502.1| hypothetical protein CARUB_v10009127mg [Capsella rubella]
 gb|EOA40400.1| hypothetical protein CARUB_v10009127mg [Capsella rubella]
Length=447

 Score =   190 bits (483),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 136/164 (83%), Positives = 148/164 (90%), Gaps = 1/164 (1%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIA
Sbjct  255  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIA  314

Query  452  LRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdv  276
            LRVPTPNVSVVDLV+ V KK   AEEVN AFR++A   + GIL VCD PLVSVDFRCSDV
Sbjct  315  LRVPTPNVSVVDLVINVEKKGITAEEVNEAFRKAANGPMKGILDVCDAPLVSVDFRCSDV  374

Query  275  sstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  144
            S+T+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W
Sbjct  375  STTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW  418



>ref|XP_006383783.1| hypothetical protein POPTR_0005s27550g [Populus trichocarpa]
 gb|ERP61580.1| hypothetical protein POPTR_0005s27550g [Populus trichocarpa]
Length=421

 Score =   190 bits (482),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 137/164 (84%), Positives = 148/164 (90%), Gaps = 1/164 (1%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIA
Sbjct  228  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIA  287

Query  452  LRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdv  276
            LRVPTPNVSVVDLVV V KK   AE+VN AFR++A   L G+L VCD PLVSVDFRCSDV
Sbjct  288  LRVPTPNVSVVDLVVNVEKKGITAEDVNGAFRKAAEGPLKGVLDVCDVPLVSVDFRCSDV  347

Query  275  sstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  144
            SST+DSSLTMVMGDDM+KV+AWYDNEWGYSQRVVDLA +VAN+W
Sbjct  348  SSTIDSSLTMVMGDDMIKVVAWYDNEWGYSQRVVDLAHLVANKW  391



>ref|XP_006473831.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like 
[Citrus sinensis]
 gb|KDO85173.1| hypothetical protein CISIN_1g012940mg [Citrus sinensis]
Length=453

 Score =   191 bits (484),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 139/170 (82%), Positives = 150/170 (88%), Gaps = 1/170 (1%)
 Frame = -3

Query  650  RNLASSRAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKG  471
              L   +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+LV+P LKG
Sbjct  254  EELGIVKGAMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVMPQLKG  313

Query  470  KLNGIALRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGILSVCDEPLVSVD  294
            KLNGIALRVPTPNVSVVDLVV V KK   AE+VNAAFR++A   L GIL+VCD PLVSVD
Sbjct  314  KLNGIALRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAAEGPLKGILAVCDVPLVSVD  373

Query  293  FRCsdvsstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  144
            FRCSDVSST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA +W
Sbjct  374  FRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVATKW  423



>ref|XP_010270515.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic 
[Nelumbo nucifera]
Length=452

 Score =   190 bits (483),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 138/164 (84%), Positives = 150/164 (91%), Gaps = 1/164 (1%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIA
Sbjct  259  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPKLKGKLNGIA  318

Query  452  LRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdv  276
            LRVPTPNVSVVDLVV V KK   AE+VNAAFR++A   L GIL+VCD PLVSVDFRCSDV
Sbjct  319  LRVPTPNVSVVDLVVNVEKKGITAEDVNAAFRKAAEGPLKGILAVCDVPLVSVDFRCSDV  378

Query  275  sstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  144
            SST+DSSLTMVMGDDM+KV+AWYDNEWGYSQRVVDLA +VA++W
Sbjct  379  SSTIDSSLTMVMGDDMLKVVAWYDNEWGYSQRVVDLAHLVASKW  422



>ref|XP_002307806.1| glyceraldehyde-3-phosphate dehydrogenase family protein [Populus 
trichocarpa]
 gb|EEE94802.1| glyceraldehyde-3-phosphate dehydrogenase family protein [Populus 
trichocarpa]
Length=452

 Score =   190 bits (483),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 137/164 (84%), Positives = 148/164 (90%), Gaps = 1/164 (1%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIA
Sbjct  259  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIA  318

Query  452  LRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdv  276
            LRVPTPNVSVVDLVV V KK   AE+VN AFR++A   L G+L VCD PLVSVDFRCSDV
Sbjct  319  LRVPTPNVSVVDLVVNVEKKGITAEDVNGAFRKAAEGPLKGVLDVCDVPLVSVDFRCSDV  378

Query  275  sstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQW  144
            SST+DSSLTMVMGDDM+KV+AWYDNEWGYSQRVVDLA +VAN+W
Sbjct  379  SSTIDSSLTMVMGDDMIKVVAWYDNEWGYSQRVVDLAHLVANKW  422



>ref|NP_001240080.1| uncharacterized protein LOC100806482 [Glycine max]
 gb|ACU18570.1| unknown [Glycine max]
 gb|KHN33783.1| Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic [Glycine 
soja]
Length=451

 Score =   190 bits (482),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 150/168 (89%), Gaps = 1/168 (1%)
 Frame = -3

Query  632  RAPMTTTHSYTGDQrlldashrdlrraraaaLNIVPTSTGAAKAVALVLPSLKGKLNGIA  453
            +  MTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAV+LVLP LKGKLNGIA
Sbjct  259  KGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIA  318

Query  452  LRVPTPNvsvvdlvvqVSKKTF-AEEVNAAFRESAANELDGILSVCDEPLVSVDFRCsdv  276
            LRVPTPNVSVVDLVV V KK   AE+VNAAFR++A   L G+L VCD PLVS+DFRCSDV
Sbjct  319  LRVPTPNVSVVDLVVNVEKKGLTAEDVNAAFRKAAEGPLKGVLDVCDVPLVSIDFRCSDV  378

Query  275  sstvdssltmvMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK*MP  132
            SST+DSSLTMVMGDDMVKV+AWYDNEWGYSQRVVDLA +VA++W   P
Sbjct  379  SSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKWPGAP  426



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1050626367960