BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF006N23

Length=778
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006470496.1|  PREDICTED: uncharacterized protein LOC102617255  67.8    2e-12   
ref|XP_006480463.1|  PREDICTED: putative ribonuclease H protein A...  70.1    2e-10   
ref|XP_009800085.1|  PREDICTED: uncharacterized protein LOC104246050  50.4    6e-10   Nicotiana sylvestris
gb|KHN00089.1|  hypothetical protein glysoja_046125                   55.8    1e-09   Glycine soja [wild soybean]
gb|KHN02823.1|  hypothetical protein glysoja_043630                   62.0    1e-08   Glycine soja [wild soybean]
ref|XP_006492749.1|  PREDICTED: uncharacterized protein LOC102612946  63.2    3e-08   
ref|XP_003598202.1|  60S ribosomal protein L23                        52.8    3e-08   
gb|KJB30629.1|  hypothetical protein B456_005G152500                  60.1    3e-08   Gossypium raimondii
ref|XP_002525921.1|  conserved hypothetical protein                   61.2    4e-08   
ref|XP_002531249.1|  hypothetical protein RCOM_0494170                53.5    4e-08   
ref|XP_002531759.1|  conserved hypothetical protein                   60.5    4e-08   Ricinus communis
gb|KHN23277.1|  hypothetical protein glysoja_040246                   59.3    1e-07   Glycine soja [wild soybean]
ref|XP_006485449.1|  PREDICTED: uncharacterized protein LOC102621413  52.4    1e-07   
ref|XP_006476142.1|  PREDICTED: uncharacterized protein LOC102616098  52.0    2e-07   
ref|XP_009623190.1|  PREDICTED: uncharacterized protein LOC104114439  46.2    2e-07   Nicotiana tomentosiformis
ref|XP_010687479.1|  PREDICTED: uncharacterized protein LOC104901585  51.6    3e-07   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007227312.1|  hypothetical protein PRUPE_ppa016553mg           48.1    9e-07   
ref|XP_003607370.1|  LCR-like protein                                 56.2    1e-06   
ref|XP_006489961.1|  PREDICTED: uncharacterized protein LOC102608276  55.8    3e-06   Citrus sinensis [apfelsine]
ref|XP_003620730.1|  hypothetical protein MTR_6g089560                56.2    3e-06   
gb|EMS59051.1|  E3 ubiquitin-protein ligase MARCH8                    54.7    4e-06   Triticum urartu
gb|AES76948.2|  hypothetical protein MTR_6g089560                     56.2    5e-06   Medicago truncatula
ref|XP_010679712.1|  PREDICTED: uncharacterized protein LOC104895014  53.1    5e-06   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007212995.1|  hypothetical protein PRUPE_ppa022768mg           49.3    6e-06   
ref|XP_002527468.1|  conserved hypothetical protein                   45.1    6e-06   
ref|XP_003604942.1|  Cyclin D3                                        55.1    1e-05   
gb|KHN31589.1|  hypothetical protein glysoja_043032                   53.5    2e-05   Glycine soja [wild soybean]
ref|XP_008340367.1|  PREDICTED: uncharacterized protein LOC103403304  53.9    2e-05   
gb|KHN38789.1|  hypothetical protein glysoja_047929                   53.9    2e-05   Glycine soja [wild soybean]
ref|XP_006467327.1|  PREDICTED: uncharacterized protein LOC102625297  55.5    2e-05   
ref|XP_010675428.1|  PREDICTED: uncharacterized protein LOC104891430  52.8    2e-05   Beta vulgaris subsp. vulgaris [field beet]
gb|KHN01753.1|  hypothetical protein glysoja_047834                   51.6    2e-05   Glycine soja [wild soybean]
ref|XP_010677766.1|  PREDICTED: uncharacterized protein LOC104893369  54.7    3e-05   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006593242.1|  PREDICTED: uncharacterized protein LOC102666191  53.1    4e-05   
ref|XP_003600644.1|  hypothetical protein MTR_3g064620                50.8    4e-05   
ref|XP_010673863.1|  PREDICTED: uncharacterized protein LOC104890171  53.1    4e-05   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003599089.1|  hypothetical protein MTR_3g027640                51.6    5e-05   
ref|XP_004972313.1|  PREDICTED: uncharacterized protein LOC101785285  54.3    5e-05   
ref|XP_004974918.1|  PREDICTED: uncharacterized protein LOC101786648  54.3    5e-05   
ref|XP_004963470.1|  PREDICTED: uncharacterized protein LOC101764448  54.3    5e-05   
ref|XP_004954962.1|  PREDICTED: uncharacterized protein LOC101756404  54.3    5e-05   
ref|XP_003613452.1|  hypothetical protein MTR_5g036840                53.1    7e-05   
ref|XP_002513235.1|  conserved hypothetical protein                   51.6    9e-05   
ref|XP_008232623.1|  PREDICTED: putative ribonuclease H protein A...  47.0    1e-04   
ref|XP_008227720.1|  PREDICTED: putative ribonuclease H protein A...  44.7    1e-04   
ref|XP_002442739.1|  hypothetical protein SORBIDRAFT_08g002035        51.2    1e-04   
ref|XP_010693635.1|  PREDICTED: uncharacterized protein LOC104906563  53.1    1e-04   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010667872.1|  PREDICTED: uncharacterized protein LOC104884867  47.0    2e-04   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010256191.1|  PREDICTED: uncharacterized protein LOC104596624  52.8    2e-04   Nelumbo nucifera [Indian lotus]
ref|XP_006596580.1|  PREDICTED: uncharacterized protein LOC102666294  51.2    2e-04   Glycine max [soybeans]
gb|KHN35662.1|  hypothetical protein glysoja_047989                   49.3    2e-04   Glycine soja [wild soybean]
gb|EMS46365.1|  Pattern formation protein EMB30                       52.8    2e-04   Triticum urartu
ref|XP_008222000.1|  PREDICTED: putative ribonuclease H protein A...  46.6    2e-04   
gb|ABN07957.1|  Polynucleotidyl transferase, Ribonuclease H fold      52.0    2e-04   Medicago truncatula
ref|XP_006421903.1|  hypothetical protein CICLE_v10007098mg           47.4    2e-04   
ref|XP_010675636.1|  PREDICTED: uncharacterized protein LOC104891623  52.0    2e-04   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007206269.1|  hypothetical protein PRUPE_ppa016210mg           41.2    2e-04   
gb|KDP36415.1|  hypothetical protein JCGZ_08684                       49.3    2e-04   Jatropha curcas
ref|XP_003612608.1|  Replication protein A 70 kDa DNA-binding sub...  52.0    3e-04   
ref|XP_008232034.1|  PREDICTED: uncharacterized protein LOC103331202  46.6    3e-04   
ref|XP_006471930.1|  PREDICTED: uncharacterized protein LOC102617744  51.2    4e-04   Citrus sinensis [apfelsine]
ref|XP_008358038.1|  PREDICTED: uncharacterized protein LOC103421772  41.6    4e-04   
ref|XP_006427454.1|  hypothetical protein CICLE_v10027161mg           49.7    4e-04   
ref|XP_007032521.1|  Uncharacterized protein TCM_018523               50.8    5e-04   
gb|KHN23992.1|  hypothetical protein glysoja_049729                   48.5    6e-04   Glycine soja [wild soybean]
ref|XP_003599995.1|  hypothetical protein MTR_3g050230                50.1    6e-04   
ref|XP_010682311.1|  PREDICTED: uncharacterized protein LOC104897185  50.4    7e-04   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002456488.1|  hypothetical protein SORBIDRAFT_03g037190        42.7    7e-04   Sorghum bicolor [broomcorn]
ref|XP_010667449.1|  PREDICTED: uncharacterized protein LOC104884491  49.7    7e-04   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002532007.1|  conserved hypothetical protein                   50.1    8e-04   
ref|XP_009787297.1|  PREDICTED: uncharacterized protein LOC104235275  49.3    8e-04   Nicotiana sylvestris
ref|XP_010681661.1|  PREDICTED: uncharacterized protein LOC104896591  47.4    8e-04   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010236322.1|  PREDICTED: uncharacterized protein LOC104583970  50.1    8e-04   Brachypodium distachyon [annual false brome]
gb|EMS45573.1|  Superoxide-generating NADPH oxidase heavy chain s...  41.2    9e-04   Triticum urartu
ref|XP_002510284.1|  conserved hypothetical protein                   47.4    0.001   
emb|CDP16895.1|  unnamed protein product                              49.3    0.001   Coffea canephora [robusta coffee]
ref|XP_003621450.1|  hypothetical protein MTR_7g013520                48.5    0.001   



>ref|XP_006470496.1| PREDICTED: uncharacterized protein LOC102617255 [Citrus sinensis]
Length=440

 Score = 67.8 bits (164),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 50/91 (55%), Gaps = 2/91 (2%)
 Frame = -3

Query  518  ANCWTPPTTNHLKCNVDAAIFADDA--GYGAVIRDHPGHFVAALGCKLTCGQDLYLVKTM  345
            A CW PP    LKCNVD A+FA     G+G VIRD    F+AA  C +         + +
Sbjct  278  AICWEPPVAGRLKCNVDVALFAFRGYIGFGNVIRDSNCAFMAARCCSIPGRFSARDAEAL  337

Query  344  AVKEAIKWLKDLSLDNIFLKSDYLNFCHALM  252
             V+EA+ W+K L L N+ ++ D L   +AL+
Sbjct  338  GVREALSWIKQLQLSNVTIEMDCLTVYNALV  368


 Score = 32.0 bits (71),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 33/62 (53%), Gaps = 0/62 (0%)
 Frame = -2

Query  258  SYVGAVVK*CRDIVRDIGNITVRHICRSANHVAHALGRATDSVGQRIMWLMLLEGQLILS  79
            S    +++ CR +   I +++   + RSAN VAH + +A +S+     W ++    LI +
Sbjct  375  SSFSLIIEDCRALSNSIRDVSFSFVRRSANSVAHYVAQAGNSLSGHGEWRVVPPLFLIAN  434

Query  78   LF  73
            LF
Sbjct  435  LF  436



>ref|XP_006480463.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Citrus 
sinensis]
Length=459

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 71/130 (55%), Gaps = 12/130 (9%)
 Frame = -3

Query  620  ALIICFGLKQQVN--VWRA---NSKEFYGSAFVSLRTSSANCWTPPTTNHLKCNVDAAIF  456
            A+++C+ L    N  VW+     +K+   +A V      A  W+PP    LKCN+DA +F
Sbjct  268  AVMVCWKLWCNRNNLVWQGKCDTTKQIVNAAGVG-----AVAWSPPRVGWLKCNIDATVF  322

Query  455  ADDA--GYGAVIRDHPGHFVAALGCKLTCGQDLYLVKTMAVKEAIKWLKDLSLDNIFLKS  282
            A++   G G+VIRD  G FVAAL C +         + ++++EA+  LK + L  + +++
Sbjct  323  ANEGRVGLGSVIRDESGKFVAALCCHIRGNYSPRDAEVLSIREALSLLKSMKLSKVIVET  382

Query  281  DYLNFCHALM  252
            D L   +AL+
Sbjct  383  DCLQAFNALV  392



>ref|XP_009800085.1| PREDICTED: uncharacterized protein LOC104246050 [Nicotiana sylvestris]
Length=690

 Score = 50.4 bits (119),  Expect(2) = 6e-10, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 35/67 (52%), Gaps = 2/67 (3%)
 Frame = -3

Query  509  WTPPTTNHLKCNVDA--AIFADDAGYGAVIRDHPGHFVAALGCKLTCGQDLYLVKTMAVK  336
            W PP    LKCN+DA   + +  A  G +IRD  G+FV      L    D  + + + V+
Sbjct  528  WFPPDPGTLKCNIDAFYEVNSGRAWAGMLIRDTHGNFVRGFSTLLGASHDAVIAEILTVR  587

Query  335  EAIKWLK  315
            EA+ WLK
Sbjct  588  EALSWLK  594


 Score = 40.8 bits (94),  Expect(2) = 6e-10, Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = -2

Query  258  SYVGAVVK*CRDIVRDIGNITVRHICRSANHVAHALGRATDSVGQRIMWLM  106
            SY   +V+ C++++RD  +I++  + RSA   AH L RA  S+   + W++
Sbjct  623  SYFDIIVQDCKELMRDFTSISLYFVKRSAKQRAHMLARAASSMSDAMEWIV  673



>gb|KHN00089.1| hypothetical protein glysoja_046125, partial [Glycine soja]
Length=147

 Score = 55.8 bits (133),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 44/82 (54%), Gaps = 2/82 (2%)
 Frame = -3

Query  509  WTPPTTNHLKCNVDAAIFADDAGYGAV--IRDHPGHFVAALGCKLTCGQDLYLVKTMAVK  336
            W PP    LKCN+  A   ++  +  V  IRD  G FV AL         ++  K +A+ 
Sbjct  1    WEPPPLGTLKCNIGVAFVKEENSFKLVVFIRDDRGQFVMALSHTSPFKLLIHERKALAML  60

Query  335  EAIKWLKDLSLDNIFLKSDYLN  270
             A++WLKDL +D+I ++SD L 
Sbjct  61   VALQWLKDLEIDDIIIESDCLQ  82


 Score = 34.3 bits (77),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 25/42 (60%), Gaps = 0/42 (0%)
 Frame = -2

Query  258  SYVGAVVK*CRDIVRDIGNITVRHICRSANHVAHALGRATDS  133
            S  G ++  CR ++RD+ N  V  + R AN V H+L RA +S
Sbjct  95   SKYGVILSNCRIMLRDLQNFWVCFVGRQANSVTHSLDRALNS  136



>gb|KHN02823.1| hypothetical protein glysoja_043630 [Glycine soja]
Length=148

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 45/79 (57%), Gaps = 2/79 (3%)
 Frame = -3

Query  509  WTPPTTNHLKCNVDAAIFADDA--GYGAVIRDHPGHFVAALGCKLTCGQDLYLVKTMAVK  336
            WTPP  N LKCN+DAAIF D+   G G  +RD+ G F  A+         L  V+  A+ 
Sbjct  28   WTPPPHNFLKCNLDAAIFNDNNLFGVGICLRDNNGCFFKAITLTANGKPTLKEVEAWALH  87

Query  335  EAIKWLKDLSLDNIFLKSD  279
            +AIKW + L++ NI  + D
Sbjct  88   KAIKWTQQLNIHNIIFEMD  106



>ref|XP_006492749.1| PREDICTED: uncharacterized protein LOC102612946 [Citrus sinensis]
Length=589

 Score = 63.2 bits (152),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 38/106 (36%), Positives = 55/106 (52%), Gaps = 9/106 (8%)
 Frame = -3

Query  560  EFYGSAFVSLRTSSANC-------WTPPTTNHLKCNVDAAIFAD--DAGYGAVIRDHPGH  408
            E Y +  V  R S  N        WTPP  N +K NVDAA+  D   AG G VIR+H G 
Sbjct  407  EVYQAQQVKERESHRNTVKGKMQIWTPPPNNKVKVNVDAAVKEDRKSAGLGVVIRNHRGQ  466

Query  407  FVAALGCKLTCGQDLYLVKTMAVKEAIKWLKDLSLDNIFLKSDYLN  270
             +AA    +    ++ + +  AVK  ++  KDLSL ++ +++D  N
Sbjct  467  VLAAAVKSMNFQGNIAIAEAHAVKWGMEVAKDLSLSSVIIETDCKN  512


 Score = 22.7 bits (47),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 9/36 (25%), Positives = 17/36 (47%), Gaps = 0/36 (0%)
 Frame = -2

Query  219  VRDIGNITVRHICRSANHVAHALGRATDSVGQRIMW  112
             +D   I+ +H+ R  N  AH L +      + ++W
Sbjct  538  TQDFQLISFQHVPRKCNDFAHFLAKRALCSSESVIW  573



>ref|XP_003598202.1| 60S ribosomal protein L23 [Medicago truncatula]
Length=547

 Score = 52.8 bits (125),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 40/80 (50%), Gaps = 2/80 (3%)
 Frame = -3

Query  512  CWTPPTTNHLKCNVDAAIFADDA--GYGAVIRDHPGHFVAALGCKLTCGQDLYLVKTMAV  339
             W PP    LKCNVDAAIF++    G G  +RD  G F+ A              + + +
Sbjct  56   AWQPPAAGFLKCNVDAAIFSEQNRFGTGMCVRDQRGRFLKAATNWYEGCPPPQEAEAVGL  115

Query  338  KEAIKWLKDLSLDNIFLKSD  279
            ++AI WL  L L N+ L+ D
Sbjct  116  RDAILWLGQLELSNVQLELD  135


 Score = 32.3 bits (72),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 17/59 (29%), Positives = 30/59 (51%), Gaps = 2/59 (3%)
 Frame = -2

Query  249  GAVVK*CRDIVRDIGNITVRHICRSANHVAHALGRATDSVGQRIMWLMLLEGQLILSLF  73
            G+++  CR +++   N  +  + R AN VAH+  R   S+ Q +  L   + + IL  F
Sbjct  154  GSIIDDCRSLLQQFTNFKISFVRRQANVVAHSFARV--SIFQPLFGLAFAKPESILEHF  210



>gb|KJB30629.1| hypothetical protein B456_005G152500 [Gossypium raimondii]
Length=118

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 47/80 (59%), Gaps = 2/80 (3%)
 Frame = -3

Query  512  CWTPPTTNHLKCNVDAAIFADDA--GYGAVIRDHPGHFVAALGCKLTCGQDLYLVKTMAV  339
            CW       LKCNVD AIF D+   G+ AV+R+  G+F   +   +      +L++ + V
Sbjct  8    CWCKSGLGKLKCNVDGAIFTDNGCMGWAAVLRNDEGNFFQCISGFMKSTLSPFLLEIIVV  67

Query  338  KEAIKWLKDLSLDNIFLKSD  279
            +EA+ WLK L +DN+ ++++
Sbjct  68   QEALSWLKSLHVDNVIIETN  87



>ref|XP_002525921.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF36441.1| conserved hypothetical protein [Ricinus communis]
Length=191

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/95 (34%), Positives = 50/95 (53%), Gaps = 2/95 (2%)
 Frame = -3

Query  533  LRTSSANCWTPPTTNHLKCNVDAAIFA--DDAGYGAVIRDHPGHFVAALGCKLTCGQDLY  360
            L  +++  W  P   +LK N DA IF   +  GYG V+R+H  + VAA    +    +  
Sbjct  45   LSIAASGSWRKPHNEYLKINEDAGIFQAQNRTGYGMVVRNHAANLVAARALIIHGVYEAN  104

Query  359  LVKTMAVKEAIKWLKDLSLDNIFLKSDYLNFCHAL  255
            L + MAV+EA+ W+K ++   + +  D L  C AL
Sbjct  105  LAEAMAVREALSWIKHMNWSRVSIDMDSLGVCVAL  139



>ref|XP_002531249.1| hypothetical protein RCOM_0494170 [Ricinus communis]
 gb|EEF31146.1| hypothetical protein RCOM_0494170 [Ricinus communis]
Length=329

 Score = 53.5 bits (127),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 41/77 (53%), Gaps = 2/77 (3%)
 Frame = -3

Query  503  PPTTNHLKCNVDAAIF--ADDAGYGAVIRDHPGHFVAALGCKLTCGQDLYLVKTMAVKEA  330
            PP    +KCNVD A+F  +  +G+G VIRD  G FV           ++ L + + ++EA
Sbjct  170  PPQPGFVKCNVDGAVFTASGRSGFGMVIRDSAGSFVMGADGSSPGLFNVKLAEAIGLREA  229

Query  329  IKWLKDLSLDNIFLKSD  279
            ++W+  L   N+  + D
Sbjct  230  VQWVLSLGRSNVIFEYD  246


 Score = 32.0 bits (71),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 29/47 (62%), Gaps = 6/47 (13%)
 Frame = -2

Query  279  LFKFLSCSYVGAVVK*CRDIVRDIGNITVRHICRSANHVAHALGRAT  139
            LF+F      GAV+  CR +++   N +V+ I + AN VAH+L RA+
Sbjct  261  LFEF------GAVIADCRLLLQHGCNYSVQFIRKQANLVAHSLARAS  301



>ref|XP_002531759.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF30615.1| conserved hypothetical protein [Ricinus communis]
Length=163

 Score = 60.5 bits (145),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/88 (33%), Positives = 47/88 (53%), Gaps = 2/88 (2%)
 Frame = -3

Query  509  WTPPTTNHLKCNVDAAIFA--DDAGYGAVIRDHPGHFVAALGCKLTCGQDLYLVKTMAVK  336
            W  P+   +K N+DA IF+  D  G G V++DH G FV A+           + + +A++
Sbjct  28   WNTPSLGSMKVNMDATIFSNPDSMGVGCVMKDHAGLFVCAMAVSFAGAYIPEIAEGLAIQ  87

Query  335  EAIKWLKDLSLDNIFLKSDYLNFCHALM  252
            EA+ W +D  L N+  + D L+   AL+
Sbjct  88   EALSWARDRQLLNVVFELDCLHIVEALL  115



>gb|KHN23277.1| hypothetical protein glysoja_040246, partial [Glycine soja]
Length=147

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 49/102 (48%), Gaps = 3/102 (3%)
 Frame = -3

Query  578  WRANSKEFYGSAFVSLRTSSANCWTPPTTNHLKCNVDAAIFADDAGYGA--VIRDHPGHF  405
            W+ NS         S  T+    W+PP+ N ++CNVDAAIF D   +GA   +RD  G+F
Sbjct  2    WK-NSNTINHQQQSSPETTMLTTWSPPSRNQVECNVDAAIFEDVKQFGAGLCLRDEKGNF  60

Query  404  VAALGCKLTCGQDLYLVKTMAVKEAIKWLKDLSLDNIFLKSD  279
            + A     T        +  A+ +AI W   L + N+  + D
Sbjct  61   LKAFTATTTGVPTPREAEAWALHQAINWTHHLGMQNVIFELD  102



>ref|XP_006485449.1| PREDICTED: uncharacterized protein LOC102621413 [Citrus sinensis]
Length=2303

 Score = 52.4 bits (124),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 45/79 (57%), Gaps = 2/79 (3%)
 Frame = -3

Query  509   WTPPTTNHLKCNVDAAIFADD--AGYGAVIRDHPGHFVAALGCKLTCGQDLYLVKTMAVK  336
             W PP  N LK NVDAAI   D  AG GAVI+D  G  VAA   ++   + +   +  A++
Sbjct  1176  WEPPPGNFLKVNVDAAINNRDQVAGLGAVIKDPSGKIVAAGTKQVPLREGVSFAEAEAME  1235

Query  335   EAIKWLKDLSLDNIFLKSD  279
               ++  ++LSL  + +++D
Sbjct  1236  WGLQIARELSLSALIMETD  1254


 Score = 30.8 bits (68),  Expect(2) = 1e-07, Method: Composition-based stats.
 Identities = 14/48 (29%), Positives = 23/48 (48%), Gaps = 0/48 (0%)
 Frame = -2

Query  216   RDIGNITVRHICRSANHVAHALGRATDSVGQRIMWLMLLEGQLILSLF  73
             RD   +  RHI R+ N  AH+L +         +WL  +  +++  LF
Sbjct  1284  RDFKEVKFRHIPRTCNTCAHSLAKLAVGANTSAVWLDHIPDEILNCLF  1331



>ref|XP_006476142.1| PREDICTED: uncharacterized protein LOC102616098 [Citrus sinensis]
Length=510

 Score = 52.0 bits (123),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/101 (32%), Positives = 44/101 (44%), Gaps = 2/101 (2%)
 Frame = -3

Query  527  TSSANCWTPPTTNHLKCNVDAAIFADDAG--YGAVIRDHPGHFVAALGCKLTCGQDLYLV  354
            +  A CW  P     KCNVDA  F       YGAVI++  G FV A    L         
Sbjct  348  SHGAVCWQRPCVWWFKCNVDATTFLSSGTIMYGAVIQNSEGEFVTARSNWLISSFGAREA  407

Query  353  KTMAVKEAIKWLKDLSLDNIFLKSDYLNFCHALMLVQLLSN  231
            + + V+E + WLK L   ++ ++ D L    AL +     N
Sbjct  408  EAIGVREILSWLKGLPFLHVIIEMDSLQVFTALTMDSFSPN  448


 Score = 31.2 bits (69),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 22/35 (63%), Gaps = 0/35 (0%)
 Frame = -2

Query  249  GAVVK*CRDIVRDIGNITVRHICRSANHVAHALGR  145
            G ++  CR + + +G++T   + RSAN  AH++ R
Sbjct  451  GLLIDDCRALAQSLGDVTFSFVRRSANSAAHSVTR  485



>ref|XP_009623190.1| PREDICTED: uncharacterized protein LOC104114439 [Nicotiana tomentosiformis]
Length=362

 Score = 46.2 bits (108),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 34/67 (51%), Gaps = 2/67 (3%)
 Frame = -3

Query  509  WTPPTTNHLKCNVDAA--IFADDAGYGAVIRDHPGHFVAALGCKLTCGQDLYLVKTMAVK  336
            W PP    LKCN+DA+  + +  A  G +IR    +FV      L    D  + + + V+
Sbjct  200  WFPPDPGTLKCNIDASYDVNSGRAWDGMLIRSTHENFVRGFTTPLEASHDAVIAEILTVR  259

Query  335  EAIKWLK  315
            EA+ WLK
Sbjct  260  EALSWLK  266


 Score = 36.2 bits (82),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 30/51 (59%), Gaps = 0/51 (0%)
 Frame = -2

Query  258  SYVGAVVK*CRDIVRDIGNITVRHICRSANHVAHALGRATDSVGQRIMWLM  106
            SY   +V+ C+ ++ D  +I++  + RSAN  AH L RA  S+   + W++
Sbjct  295  SYFDIIVQDCKVLMCDFTSISLSFVKRSANQCAHMLVRAASSMSDAMEWIV  345



>ref|XP_010687479.1| PREDICTED: uncharacterized protein LOC104901585 [Beta vulgaris 
subsp. vulgaris]
Length=485

 Score = 51.6 bits (122),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 43/82 (52%), Gaps = 1/82 (1%)
 Frame = -3

Query  509  WTPPTTNHLKCNVDAAIFADD-AGYGAVIRDHPGHFVAALGCKLTCGQDLYLVKTMAVKE  333
            W  P     K N DAA+FAD+  G GAV+RD  G  +AA+ CK+  G ++ + + +  + 
Sbjct  326  WKAPREGDYKLNTDAAMFADNQVGMGAVVRDFSGDVLAAMCCKMRGGDEVDIAEALCARR  385

Query  332  AIKWLKDLSLDNIFLKSDYLNF  267
             ++   +    ++ L+ D L  
Sbjct  386  GLQIAMEAGFRSLVLEVDNLKL  407


 Score = 30.0 bits (66),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 32/64 (50%), Gaps = 5/64 (8%)
 Frame = -2

Query  285  IRLFKFLS-----CSYVGAVVK*CRDIVRDIGNITVRHICRSANHVAHALGRATDSVGQR  121
            ++LF +LS      S  G +V+  + +V    +++  H  R  N VAH L +  +S+   
Sbjct  405  LKLFSYLSRNKREASPFGFIVQDIQRLVHQCSSVSFSHTRRKGNEVAHRLAKMCNSIDGL  464

Query  120  IMWL  109
             +WL
Sbjct  465  KVWL  468



>ref|XP_007227312.1| hypothetical protein PRUPE_ppa016553mg [Prunus persica]
 gb|EMJ28511.1| hypothetical protein PRUPE_ppa016553mg [Prunus persica]
Length=992

 Score = 48.1 bits (113),  Expect(2) = 9e-07, Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 38/87 (44%), Gaps = 2/87 (2%)
 Frame = -3

Query  509  WTPPTTNHLKCNVDAA--IFADDAGYGAVIRDHPGHFVAALGCKLTCGQDLYLVKTMAVK  336
            W PP  N LK NVD A      + G G V+RD  G FVA    KLT       V+ +A +
Sbjct  832  WQPPHENSLKINVDGAWKPGTTEGGVGVVVRDSTGKFVAGCATKLTNVFSAPQVEALAAR  891

Query  335  EAIKWLKDLSLDNIFLKSDYLNFCHAL  255
                   +    N+  +SD L    AL
Sbjct  892  TNTILAMERGYQNVVFESDALQIVTAL  918


 Score = 32.3 bits (72),  Expect(2) = 9e-07, Method: Composition-based stats.
 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 0/50 (0%)
 Frame = -2

Query  258  SYVGAVVK*CRDIVRDIGNITVRHICRSANHVAHALGRATDSVGQRIMWL  109
            S +G VV+  + ++  I      HI R+AN VAH L R    +G  + W 
Sbjct  926  SVIGPVVEDTKSLLTQITGEGFTHIRRTANGVAHRLARFALHIGGSLYWF  975



>ref|XP_003607370.1| LCR-like protein [Medicago truncatula]
Length=141

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 48/95 (51%), Gaps = 18/95 (19%)
 Frame = -3

Query  509  WTPPTTNHLKCNVDAAIFADDA--GYGAVIRDHPGHFVAALGCKLTCGQDLYLVKTMAVK  336
            W PP  ++LKCNVDAAIF +    G G  IRD  G+F+ A              K M ++
Sbjct  17   WQPPDADYLKCNVDAAIFEEQRSFGIGICIRDSRGNFIKA------------STKAMGLR  64

Query  335  EAIKWLKDLSLDNIFLKSDYLNFCHALMLVQLLSN  231
            +AI WL  L L  + ++ D    C +L+  Q  SN
Sbjct  65   DAILWLGQLGLSKVQIELD--RKCRSLL--QQFSN  95



>ref|XP_006489961.1| PREDICTED: uncharacterized protein LOC102608276 [Citrus sinensis]
Length=190

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 44/91 (48%), Gaps = 2/91 (2%)
 Frame = -3

Query  521  SANCWTPPTTNHLKCNVDAAIFADDA--GYGAVIRDHPGHFVAALGCKLTCGQDLYLVKT  348
             A CW  P    +KCNVDAA+F+  A  G G V+R+  G F+ A   +          + 
Sbjct  79   GAVCWKRPHVGWVKCNVDAAVFSSQAMVGLGCVVRNSEGIFLTAKCDRFLGSFGAREAEA  138

Query  347  MAVKEAIKWLKDLSLDNIFLKSDYLNFCHAL  255
              V+EA+ WLK L    + ++ D L    AL
Sbjct  139  FGVREALSWLKKLQFPRVIIEIDCLQVFKAL  169



>ref|XP_003620730.1| hypothetical protein MTR_6g089560 [Medicago truncatula]
Length=205

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 56/115 (49%), Gaps = 11/115 (10%)
 Frame = -3

Query  608  CFGLKQQVNVWRANSKEFYGSAFVSLRTSSANCWTPPTTNHLKCNVDA--AIFADDAGYG  435
            C GL+QQ     ++      S    L+      W PP +  LKCNVDA  +I  +  G G
Sbjct  38   CTGLQQQAAAVNSSVAVLAASTTAELQQIK---WQPPASGRLKCNVDATFSIPHNRIGVG  94

Query  434  AVIRDHPGHFVAALGCKLTCGQDLYLVKT---MAVKEAIKWLKDLSLDNIFLKSD  279
              +RD  G FV A   K+   + +Y V+    + +  AI+WL D+ +DNI  + D
Sbjct  95   ICLRDDEGTFVLA---KIVNFEGVYSVEVGEALGLFHAIQWLSDMQMDNIDFEVD  146



>gb|EMS59051.1| E3 ubiquitin-protein ligase MARCH8 [Triticum urartu]
Length=427

 Score = 54.7 bits (130),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 48/85 (56%), Gaps = 2/85 (2%)
 Frame = -3

Query  527  TSSANCWTPPTTNHLKCNVDAAIFADD--AGYGAVIRDHPGHFVAALGCKLTCGQDLYLV  354
            +S  N W     N    NVDA+ +  +   G GA++RD+ G+F+ A   KLT   D+   
Sbjct  20   SSRMNKWPVVLANQQVLNVDASFYVGENSGGCGAIVRDNRGNFIGATTAKLTHVADVVCA  79

Query  353  KTMAVKEAIKWLKDLSLDNIFLKSD  279
            +  A++E +K+L+ L  +N+ ++SD
Sbjct  80   EAAALREGLKFLRSLGCNNVIVRSD  104


 Score = 23.5 bits (49),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 8/30 (27%), Positives = 19/30 (63%), Gaps = 0/30 (0%)
 Frame = -2

Query  243  VVK*CRDIVRDIGNITVRHICRSANHVAHA  154
            V++ CR +++D G ++++H   S N   ++
Sbjct  125  VLEECRTLLQDFGRVSIKHCNHSLNRSTYS  154



>gb|AES76948.2| hypothetical protein MTR_6g089560 [Medicago truncatula]
Length=232

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 56/115 (49%), Gaps = 11/115 (10%)
 Frame = -3

Query  608  CFGLKQQVNVWRANSKEFYGSAFVSLRTSSANCWTPPTTNHLKCNVDA--AIFADDAGYG  435
            C GL+QQ     ++      S    L+      W PP +  LKCNVDA  +I  +  G G
Sbjct  65   CTGLQQQAAAVNSSVAVLAASTTAELQQIK---WQPPASGRLKCNVDATFSIPHNRIGVG  121

Query  434  AVIRDHPGHFVAALGCKLTCGQDLYLVKT---MAVKEAIKWLKDLSLDNIFLKSD  279
              +RD  G FV A   K+   + +Y V+    + +  AI+WL D+ +DNI  + D
Sbjct  122  ICLRDDEGTFVLA---KIVNFEGVYSVEVGEALGLFHAIQWLSDMQMDNIDFEVD  173



>ref|XP_010679712.1| PREDICTED: uncharacterized protein LOC104895014 [Beta vulgaris 
subsp. vulgaris]
Length=197

 Score = 53.1 bits (126),  Expect(2) = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 40/85 (47%), Gaps = 1/85 (1%)
 Frame = -3

Query  518  ANCWTPPTTNHLKCNVDAAIFAD-DAGYGAVIRDHPGHFVAALGCKLTCGQDLYLVKTMA  342
            +  W PP   H K N DAAI+ D   G G V+RD  G  + A    L    +++  +  A
Sbjct  32   SKVWKPPVEGHYKVNSDAAIYKDCTVGLGGVMRDANGDIMGATSMHLKLDMEVHEAEACA  91

Query  341  VKEAIKWLKDLSLDNIFLKSDYLNF  267
             + A+K   +    NI L+SD L  
Sbjct  92   ARHALKIAMEAGFRNIVLESDCLKL  116


 Score = 25.0 bits (53),  Expect(2) = 5e-06, Method: Compositional matrix adjust.
 Identities = 12/40 (30%), Positives = 17/40 (43%), Gaps = 2/40 (5%)
 Frame = -1

Query  166  CGSCSWKGN*FRRSANHVAHALGRATDSESVLGTWVSSAP  47
            C S S+     RR  N VAH L + +     +  W+   P
Sbjct  144  CSSISFSH--VRREGNRVAHILAQRSKEYDCMRVWLEEVP  181



>ref|XP_007212995.1| hypothetical protein PRUPE_ppa022768mg, partial [Prunus persica]
 gb|EMJ14194.1| hypothetical protein PRUPE_ppa022768mg, partial [Prunus persica]
Length=887

 Score = 49.3 bits (116),  Expect(2) = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 38/87 (44%), Gaps = 2/87 (2%)
 Frame = -3

Query  509  WTPPTTNHLKCNVDAA--IFADDAGYGAVIRDHPGHFVAALGCKLTCGQDLYLVKTMAVK  336
            WT P   HLK NVD A        G G VIRD  G F+A    K         ++ +A +
Sbjct  727  WTKPPMRHLKINVDGAWNAITKSGGVGVVIRDSAGAFIAGRARKFDNVFSALQIEALAAR  786

Query  335  EAIKWLKDLSLDNIFLKSDYLNFCHAL  255
            E +    +  L NI  +SD L    AL
Sbjct  787  EGVVLAVERGLTNICFESDSLQIVTAL  813


 Score = 28.1 bits (61),  Expect(2) = 6e-06, Method: Composition-based stats.
 Identities = 13/53 (25%), Positives = 25/53 (47%), Gaps = 0/53 (0%)
 Frame = -2

Query  267  LSCSYVGAVVK*CRDIVRDIGNITVRHICRSANHVAHALGRATDSVGQRIMWL  109
            L  S++G +++  + ++  I      H+CR+AN   H + R    +   I W 
Sbjct  818  LDRSFIGPILEDSKFLLLQITGEGFAHVCRTANEATHRIARFALHLETPISWF  870



>ref|XP_002527468.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34866.1| conserved hypothetical protein [Ricinus communis]
Length=158

 Score = 45.1 bits (105),  Expect(2) = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/92 (33%), Positives = 42/92 (46%), Gaps = 14/92 (15%)
 Frame = -3

Query  578  WRANSKEFYGSAFVSLRTSSANCWTPPTTNHLKCNVDAAIFADDAGYGAVIRDHPGHFVA  399
            W A ++ +  S+  S   S    W  P   +LK NVDAA F    G+G V+RDH G    
Sbjct  36   WLAATETYQPSSATS---SPLLPWQKPQLGYLKYNVDAATFNGRTGFGFVLRDHAGLLFQ  92

Query  398  ALGCKLTCGQDLYLVKT----MAVKEAIKWLK  315
             L        DL  ++     M ++E + WLK
Sbjct  93   QL-------MDLRRLRPHTEAMGLRETLSWLK  117


 Score = 32.7 bits (73),  Expect(2) = 6e-06, Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 21/30 (70%), Gaps = 0/30 (0%)
 Frame = -2

Query  219  VRDIGNITVRHICRSANHVAHALGRATDSV  130
            V ++ N++V  + RS N VAH L RA+DSV
Sbjct  124  VLELVNVSVPFVARSVNRVAHVLPRASDSV  153



>ref|XP_003604942.1| Cyclin D3 [Medicago truncatula]
Length=238

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 49/95 (52%), Gaps = 2/95 (2%)
 Frame = -3

Query  509  WTPPTTNHLKCNVDA--AIFADDAGYGAVIRDHPGHFVAALGCKLTCGQDLYLVKTMAVK  336
            WTPP +   K NVDA   I  D  G G V+RD+ G  V A   ++    D  + K +A++
Sbjct  88   WTPPFSGFYKLNVDAESPIEGDKWGIGVVVRDNEGVVVGASSWQVFSSPDSEVAKDIAMQ  147

Query  335  EAIKWLKDLSLDNIFLKSDYLNFCHALMLVQLLSN  231
            + +K++ D+S  N+  +SD  N   AL   Q   N
Sbjct  148  KGLKFVNDMSFLNLIAESDASNVVLALNARQQPPN  182



>gb|KHN31589.1| hypothetical protein glysoja_043032, partial [Glycine soja]
Length=155

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 51/89 (57%), Gaps = 7/89 (8%)
 Frame = -3

Query  509  WTPPTTNHLKCNVDAAIFADDA--GYGAVIRDHPGHFVAALG--CKLTCGQDLYLVKTMA  342
            W   ++N +KCNVDAA+F +D   G+ A IR+  G F++A+     +   Q+    ++ A
Sbjct  14   WEKTSSNFMKCNVDAALFQEDNKFGFAACIRNSEGVFISAISWFQGIPKPQE---AESYA  70

Query  341  VKEAIKWLKDLSLDNIFLKSDYLNFCHAL  255
            V   ++W+ DL L N+ +++D     HA+
Sbjct  71   VLSTLQWISDLQLTNVIIETDCKAIPHAI  99



>ref|XP_008340367.1| PREDICTED: uncharacterized protein LOC103403304 [Malus domestica]
Length=176

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/94 (32%), Positives = 46/94 (49%), Gaps = 2/94 (2%)
 Frame = -3

Query  530  RTSSANCWTPPTTNHLKCNVDAAIFADD--AGYGAVIRDHPGHFVAALGCKLTCGQDLYL  357
            R  +   W+ P    +K N+D +  A    AG+GA+IRD  G FVAA   +        L
Sbjct  38   RLRNTPRWSVPPQGRIKMNIDGSWNAGRLIAGFGAIIRDIDGSFVAARAGRFEDISSPLL  97

Query  356  VKTMAVKEAIKWLKDLSLDNIFLKSDYLNFCHAL  255
             +TMAV+  + W  D    ++ +++D L    AL
Sbjct  98   SETMAVRAGLLWAIDRGYQSLIIETDSLQIVEAL  131



>gb|KHN38789.1| hypothetical protein glysoja_047929, partial [Glycine soja]
Length=187

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 43/79 (54%), Gaps = 2/79 (3%)
 Frame = -3

Query  509  WTPPTTNHLKCNVDAAIFADDA--GYGAVIRDHPGHFVAALGCKLTCGQDLYLVKTMAVK  336
            W+PP    LKCNVDA+IF ++   G G  + D  G FV A              +  A+K
Sbjct  82   WSPPPLGSLKCNVDASIFKEEPSFGIGMCLHDDNGTFVKARTASSMSIPKPDEAEAFALK  141

Query  335  EAIKWLKDLSLDNIFLKSD  279
            ++++W++ L L N+ +++D
Sbjct  142  KSLEWIQSLHLQNVVVETD  160



>ref|XP_006467327.1| PREDICTED: uncharacterized protein LOC102625297 [Citrus sinensis]
Length=412

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 43/83 (52%), Gaps = 2/83 (2%)
 Frame = -3

Query  512  CWTPPTTNHLKCNVDAAIFADDA--GYGAVIRDHPGHFVAALGCKLTCGQDLYLVKTMAV  339
            CW  P    +KCNVDAA+F      G G VIR+  G FVAA    +         + + +
Sbjct  328  CWEQPKFGWVKCNVDAAVFESQGKIGIGCVIRNSQGGFVAARCVSVAGIFGAREAEALGI  387

Query  338  KEAIKWLKDLSLDNIFLKSDYLN  270
            +EA+ W+K+L +  + ++ D L 
Sbjct  388  REALSWMKELQIPCVIIEMDCLQ  410



>ref|XP_010675428.1| PREDICTED: uncharacterized protein LOC104891430 [Beta vulgaris 
subsp. vulgaris]
Length=315

 Score = 52.8 bits (125),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 46/79 (58%), Gaps = 3/79 (4%)
 Frame = -3

Query  509  WTPPTTNHLKCNVDAAIFADDA-GYGAVIRDHPGHFVAALGCKLTCGQ-DLYLVKTMAVK  336
            W PP  + +K N DAA+FAD + G G V+R+  G  + A+ C+   G  D+ + +  A +
Sbjct  157  WKPPGGSSIKFNTDAAVFADGSIGCGGVMRNSDGDVLGAM-CESVVGSFDIDVAEAYAAR  215

Query  335  EAIKWLKDLSLDNIFLKSD  279
             A++   D+  DNI L+SD
Sbjct  216  SALRCALDMGRDNIILESD  234


 Score = 23.1 bits (48),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 9/31 (29%), Positives = 17/31 (55%), Gaps = 0/31 (0%)
 Frame = -2

Query  201  ITVRHICRSANHVAHALGRATDSVGQRIMWL  109
             + +H+ R  N VAH L   + S+  + +W+
Sbjct  269  FSCKHVKRGGNRVAHKLAHLSKSLLVKKVWM  299



>gb|KHN01753.1| hypothetical protein glysoja_047834 [Glycine soja]
Length=80

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 27/41 (66%), Gaps = 2/41 (5%)
 Frame = -3

Query  509  WTPPTTNHLKCNVDAAIFADDA--GYGAVIRDHPGHFVAAL  393
            W PPT    KCN D++IF ++   GYGA IRDH G F+ AL
Sbjct  13   WNPPTQGFFKCNFDSSIFKNENRFGYGASIRDHEGKFIKAL  53



>ref|XP_010677766.1| PREDICTED: uncharacterized protein LOC104893369 [Beta vulgaris 
subsp. vulgaris]
Length=310

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 40/145 (28%), Positives = 64/145 (44%), Gaps = 8/145 (6%)
 Frame = -3

Query  680  FFRTKIPFDWQLRLNSAAIWALIICFGLKQQVNVWRANSKEF--YGSAFVSLRTSSANCW  507
            FFR K  F+ +   +  A +A+   F      N  R   KE   +G      R     CW
Sbjct  97   FFRNKTIFNEESVSSRRASFAISEFFS-----NGSRPKPKEVAGWGGHKCGPRRGPGCCW  151

Query  506  TPPTTNHLKCNVDAA-IFADDAGYGAVIRDHPGHFVAALGCKLTCGQDLYLVKTMAVKEA  330
            +PP T+ +K N D + +    A  G V+RDH G  + A    L C   +   +   + EA
Sbjct  152  SPPPTDVVKINFDGSKLSTGQASLGFVVRDHLGEVILAGSNALGCCTSILQAEAWGMLEA  211

Query  329  IKWLKDLSLDNIFLKSDYLNFCHAL  255
            ++    L+L N+ ++ D L   +A+
Sbjct  212  VRGSHSLNLSNVMIEGDNLKVINAV  236



>ref|XP_006593242.1| PREDICTED: uncharacterized protein LOC102666191 [Glycine max]
Length=192

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 51/89 (57%), Gaps = 7/89 (8%)
 Frame = -3

Query  509  WTPPTTNHLKCNVDAAIFADDA--GYGAVIRDHPGHFVAALG--CKLTCGQDLYLVKTMA  342
            W   ++N +KCNVDAA+F +D   G+ A IR+  G F++A+     +   Q+    ++ A
Sbjct  35   WEKTSSNFMKCNVDAALFQEDNKFGFAACIRNSEGVFISAISWFQGIPKPQE---AESYA  91

Query  341  VKEAIKWLKDLSLDNIFLKSDYLNFCHAL  255
            V   ++W+ DL L N+ +++D     HA+
Sbjct  92   VLSTLQWISDLQLTNVIIETDCKAIPHAI  120



>ref|XP_003600644.1| hypothetical protein MTR_3g064620 [Medicago truncatula]
 gb|AES70895.1| hypothetical protein MTR_3g064620 [Medicago truncatula]
Length=70

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 20/41 (49%), Positives = 28/41 (68%), Gaps = 2/41 (5%)
 Frame = -3

Query  509  WTPPTTNHLKCNVDAAIFADDA--GYGAVIRDHPGHFVAAL  393
            W PP  +++KCNVDAA+F +    G G  +R+H GHF+ AL
Sbjct  14   WQPPNEDYVKCNVDAALFGEQRCFGIGMFLRNHQGHFIKAL  54



>ref|XP_010673863.1| PREDICTED: uncharacterized protein LOC104890171 [Beta vulgaris 
subsp. vulgaris]
Length=200

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/104 (32%), Positives = 47/104 (45%), Gaps = 6/104 (6%)
 Frame = -3

Query  575  RANSKEFYGSAFVSLRTSSANCWTPPTTNHLKCNVDAAIFADDA-GYGAVIRDHPGHFVA  399
            RA  KE   +A           W  PT+   K N DAA++ D   G+G ++RD  G  + 
Sbjct  21   RAEPKEVPPAA-----GGGQKIWQAPTSGTFKINSDAAVYGDGTLGFGGIVRDEMGEVML  75

Query  398  ALGCKLTCGQDLYLVKTMAVKEAIKWLKDLSLDNIFLKSDYLNF  267
            A       G D  + + MA + A+K   +  L NI L+SD L  
Sbjct  76   ATCDVYEGGCDTDVAEAMAARHAVKVAVEAGLRNIVLESDCLKL  119



>ref|XP_003599089.1| hypothetical protein MTR_3g027640 [Medicago truncatula]
Length=137

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 45/91 (49%), Gaps = 20/91 (22%)
 Frame = -3

Query  539  VSLRTSSANC--WTPPTTNHLKCNVDAAIFADDA--GYGAVIRDHPGHFVAALGCKLTCG  372
            V +R    N   W PP TN++K NVDA++FA+    G G  I +H G F+ A+G      
Sbjct  37   VHVRQQQINIVQWHPPETNYVKYNVDASLFAEQQSFGIGMCIWNHRGQFIKAIG------  90

Query  371  QDLYLVKTMAVKEAIKWLKDLSLDNIFLKSD  279
                      + +AI WL+ L + N+  + D
Sbjct  91   ----------LHDAILWLRQLGISNMHFELD  111



>ref|XP_004972313.1| PREDICTED: uncharacterized protein LOC101785285 [Setaria italica]
Length=946

 Score = 54.3 bits (129),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 38/119 (32%), Positives = 57/119 (48%), Gaps = 13/119 (11%)
 Frame = -3

Query  626  IWALIICFGLKQQVNVWRANSKEFYGSAFVSLRTSSANCWTPPTTNHLKCNVDAAIFADD  447
            IW L++    K +V  WRA  ++      V +R    N W PP T   KCN D A F  D
Sbjct  792  IWKLLV--PPKVKVFWWRATVRQ------VEVR-QQVNRWKPPPTGWTKCNTDGA-FNPD  841

Query  446  AGYGA---VIRDHPGHFVAALGCKLTCGQDLYLVKTMAVKEAIKWLKDLSLDNIFLKSD  279
             G GA   V+RD  G FV A       G D   ++ +A ++ +   +D  + N+ +++D
Sbjct  842  RGEGATGVVLRDASGQFVGAKAVWYPHGFDALTLEALACRDGVLLARDKGVTNLIVETD  900



>ref|XP_004974918.1| PREDICTED: uncharacterized protein LOC101786648 [Setaria italica]
Length=952

 Score = 54.3 bits (129),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 38/119 (32%), Positives = 57/119 (48%), Gaps = 13/119 (11%)
 Frame = -3

Query  626  IWALIICFGLKQQVNVWRANSKEFYGSAFVSLRTSSANCWTPPTTNHLKCNVDAAIFADD  447
            IW L++    K +V  WRA  ++      V +R    N W PP T   KCN D A F  D
Sbjct  792  IWKLLV--PPKVKVFWWRATVRQ------VEVR-QQVNRWKPPPTGWTKCNTDGA-FNPD  841

Query  446  AGYGA---VIRDHPGHFVAALGCKLTCGQDLYLVKTMAVKEAIKWLKDLSLDNIFLKSD  279
             G GA   V+RD  G FV A       G D   ++ +A ++ +   +D  + N+ +++D
Sbjct  842  RGEGATGVVLRDASGQFVGAKAVWYPHGFDALTLEALACRDGVLLARDKGVTNLIVETD  900



>ref|XP_004963470.1| PREDICTED: uncharacterized protein LOC101764448 [Setaria italica]
Length=1051

 Score = 54.3 bits (129),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 38/119 (32%), Positives = 57/119 (48%), Gaps = 13/119 (11%)
 Frame = -3

Query  626  IWALIICFGLKQQVNVWRANSKEFYGSAFVSLRTSSANCWTPPTTNHLKCNVDAAIFADD  447
            IW L++    K +V  WRA  ++      V +R    N W PP T   KCN D A F  D
Sbjct  846  IWKLLV--PPKVKVFWWRATVRQ------VEVR-QQVNRWKPPPTGWTKCNTDGA-FNPD  895

Query  446  AGYGA---VIRDHPGHFVAALGCKLTCGQDLYLVKTMAVKEAIKWLKDLSLDNIFLKSD  279
             G GA   V+RD  G FV A       G D   ++ +A ++ +   +D  + N+ +++D
Sbjct  896  RGEGATGVVLRDASGQFVGAKAVWYPHGFDALTLEALACRDGVLLARDKGVTNLIVETD  954



>ref|XP_004954962.1| PREDICTED: uncharacterized protein LOC101756404 [Setaria italica]
Length=1209

 Score = 54.3 bits (129),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 38/119 (32%), Positives = 57/119 (48%), Gaps = 13/119 (11%)
 Frame = -3

Query  626   IWALIICFGLKQQVNVWRANSKEFYGSAFVSLRTSSANCWTPPTTNHLKCNVDAAIFADD  447
             IW L++    K +V  WRA  ++      V +R    N W PP T   KCN D A F  D
Sbjct  1055  IWKLLV--PPKVKVFWWRATVRQ------VEVR-QQVNRWKPPPTGWTKCNTDGA-FNPD  1104

Query  446   AGYGA---VIRDHPGHFVAALGCKLTCGQDLYLVKTMAVKEAIKWLKDLSLDNIFLKSD  279
              G GA   V+RD  G FV A       G D   ++ +A ++ +   +D  + N+ +++D
Sbjct  1105  RGEGATGVVLRDASGQFVGAKAVWYPHGFDALTLEALACRDGVLLARDKGVTNLIVETD  1163



>ref|XP_003613452.1| hypothetical protein MTR_5g036840 [Medicago truncatula]
Length=261

 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 43/79 (54%), Gaps = 2/79 (3%)
 Frame = -3

Query  509  WTPPTTNHLKCNVDAAIFA--DDAGYGAVIRDHPGHFVAALGCKLTCGQDLYLVKTMAVK  336
            W PPT++  KCN+DAA  +  +    G  IRD  G FV +      C   + + + + + 
Sbjct  70   WQPPTSDRYKCNIDAAFSSHHNHTSIGICIRDSEGSFVLSKTITSLCIVLVDVGEALGLH  129

Query  335  EAIKWLKDLSLDNIFLKSD  279
             A++WL D+ LDN+  ++D
Sbjct  130  SALQWLSDMQLDNVDFETD  148



>ref|XP_002513235.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF49103.1| conserved hypothetical protein [Ricinus communis]
Length=185

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 29/94 (31%), Positives = 49/94 (52%), Gaps = 3/94 (3%)
 Frame = -3

Query  578  WRANSKEFYGSAFVSLRTSSANCWTPPTTNHLKCNVDAAIFA--DDAGYGAVIRDHPGHF  405
            W+ N  +   +   S   S+A  W+ P + +LKCN+DA  F   D  G+G +++D     
Sbjct  93   WKTNLSDLERNGNSSSMVSNAK-WSKPPSRYLKCNMDATSFPNQDKVGFGCLLKDEFRAV  151

Query  404  VAALGCKLTCGQDLYLVKTMAVKEAIKWLKDLSL  303
            VAA    L C  D  L + +  ++A+ WLK++ +
Sbjct  152  VAARNGFLHCAIDPTLAEALTCRDALCWLKNMQV  185



>ref|XP_008232623.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
 ref|XP_008238689.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=965

 Score = 47.0 bits (110),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 41/82 (50%), Gaps = 2/82 (2%)
 Frame = -3

Query  509  WTPPTTNHLKCNVDAAIFADDA--GYGAVIRDHPGHFVAALGCKLTCGQDLYLVKTMAVK  336
            W PPT N  K NVD A   +    G GA++RD  G+ V AL  +      +   +  A+K
Sbjct  801  WRPPTGNCFKLNVDGATDMETGARGAGAIVRDSHGNLVGALAMRAPSRISVLATELYALK  860

Query  335  EAIKWLKDLSLDNIFLKSDYLN  270
              I +  D+SL  + ++SD L 
Sbjct  861  VGISFALDVSLLPLEIESDSLQ  882


 Score = 26.2 bits (56),  Expect(2) = 1e-04, Method: Composition-based stats.
 Identities = 14/47 (30%), Positives = 22/47 (47%), Gaps = 0/47 (0%)
 Frame = -2

Query  249  GAVVK*CRDIVRDIGNITVRHICRSANHVAHALGRATDSVGQRIMWL  109
            G +V   R ++    +  VRH+ R AN  AH + R +       +WL
Sbjct  898  GGLVDGVRRLLVRSASTAVRHVPRQANKAAHRIARFSLRDQSLSIWL  944



>ref|XP_008227720.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=342

 Score = 44.7 bits (104),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 37/87 (43%), Gaps = 2/87 (2%)
 Frame = -3

Query  509  WTPPTTNHLKCNVDAAIFAD--DAGYGAVIRDHPGHFVAALGCKLTCGQDLYLVKTMAVK  336
            WT P  +  K NVD A  AD    G G V+RD  G F+     K          + +A +
Sbjct  182  WTKPPMSFFKINVDGAWNADTKSGGVGVVVRDSTGAFIVGRARKFDNVFSALQSEALAAR  241

Query  335  EAIKWLKDLSLDNIFLKSDYLNFCHAL  255
            E +    +  L NI  +SD L    AL
Sbjct  242  EGVVLEAERGLTNICFESDSLQIVTAL  268


 Score = 28.9 bits (63),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 17/68 (25%), Positives = 31/68 (46%), Gaps = 0/68 (0%)
 Frame = -2

Query  276  FKFLSCSYVGAVVK*CRDIVRDIGNITVRHICRSANHVAHALGRATDSVGQRIMWLMLLE  97
            +  L  S++G +++  + ++  I      H+ R+AN  AH + R    +G  I W     
Sbjct  270  YSSLDRSFIGPILEDSKFLLLQITGEGFNHVRRTANEAAHHIARFALHIGTIISWFEEPP  329

Query  96   GQLILSLF  73
              L+  LF
Sbjct  330  DFLVDVLF  337



>ref|XP_002442739.1| hypothetical protein SORBIDRAFT_08g002035 [Sorghum bicolor]
 gb|EES16577.1| hypothetical protein SORBIDRAFT_08g002035 [Sorghum bicolor]
Length=180

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/95 (34%), Positives = 45/95 (47%), Gaps = 2/95 (2%)
 Frame = -3

Query  530  RTSSANCWTPPTTNHLKCNVDAAIF-ADDAG-YGAVIRDHPGHFVAALGCKLTCGQDLYL  357
            R S  +CW PPTT+ LK N D A   A+  G +G ++RDH G  V A   ++    D   
Sbjct  6    RKSGISCWVPPTTDVLKINFDGAFLKAEKKGAWGFIVRDHTGASVVAGAGRINVVHDALS  65

Query  356  VKTMAVKEAIKWLKDLSLDNIFLKSDYLNFCHALM  252
             ++ A   A+    D  L  I L++D      AL 
Sbjct  66   AESQACLAALYVAIDHGLSQIILETDSTTLVDALQ  100



>ref|XP_010693635.1| PREDICTED: uncharacterized protein LOC104906563 [Beta vulgaris 
subsp. vulgaris]
Length=1307

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/143 (27%), Positives = 66/143 (46%), Gaps = 6/143 (4%)
 Frame = -3

Query  680   FFRTKIPFDWQLRLNSAAIWALIICFGLKQQVNVWRANSKEFYGSAFVSLRTSSANCWTP  501
             FFR K+ F+ +   + +A +A+   +         R  SKE    A  S R+  +  W+P
Sbjct  1110  FFRNKLIFNEESVSSRSASFAIAEIYA-----KALRPKSKEGGKGAKGSPRSGPSCLWSP  1164

Query  500   PTTNHLKCNVDAA-IFADDAGYGAVIRDHPGHFVAALGCKLTCGQDLYLVKTMAVKEAIK  324
             P +   K N D + + +  A  G VIRDH G  + A    L C   +   +   + EA++
Sbjct  1165  PPSGVAKINFDGSKLSSGHATLGFVIRDHLGDVLLAGSNSLGCSLSVLQAEAWGLLEAVR  1224

Query  323   WLKDLSLDNIFLKSDYLNFCHAL  255
               + L + N+ ++ D L   +A+
Sbjct  1225  GARSLDISNVVIEGDNLAVINAV  1247



>ref|XP_010667872.1| PREDICTED: uncharacterized protein LOC104884867 [Beta vulgaris 
subsp. vulgaris]
Length=183

 Score = 47.0 bits (110),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 37/78 (47%), Gaps = 1/78 (1%)
 Frame = -3

Query  509  WTPPTTNHLKCNVDAAIF-ADDAGYGAVIRDHPGHFVAALGCKLTCGQDLYLVKTMAVKE  333
            W  P     K N DAA+   +  G G V+RDH G  V AL C+   G D+ + + ++ ++
Sbjct  23   WKAPCAGIYKLNTDAALLPGNQVGIGGVVRDHDGEVVVALCCREQGGSDVAVAEALSARK  82

Query  332  AIKWLKDLSLDNIFLKSD  279
             I+         + ++ D
Sbjct  83   GIQVAMQAGFSRLMVEVD  100


 Score = 26.2 bits (56),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 15/70 (21%), Positives = 33/70 (47%), Gaps = 1/70 (1%)
 Frame = -2

Query  294  FFKIRLFKFLSCSYVGAVVK*CRDIVRDIGNITVRHICRSANHVAHALGRATDSVGQRIM  115
            FF ++  +  +  + G +V   + +  +   +   H+ RS N VAH L + + S     +
Sbjct  105  FFHLKERRSTASPF-GKIVNDIQVMASNCQQVVFSHVRRSGNKVAHCLAQLSKSYETMRV  163

Query  114  WLMLLEGQLI  85
            WL  +  +++
Sbjct  164  WLEEVPPEVV  173



>ref|XP_010256191.1| PREDICTED: uncharacterized protein LOC104596624 [Nelumbo nucifera]
Length=862

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/118 (30%), Positives = 50/118 (42%), Gaps = 2/118 (2%)
 Frame = -3

Query  602  GLKQQVNVWRANSKEFYGSAFVSLRTSSANCWTPPTTNHLKCNVDAAIFADD--AGYGAV  429
            G  Q ++ W+    +      ++L       W  P     KCNVDA  F      G+G V
Sbjct  724  GSLQLLHDWKQAQIQKRLGMVINLNHQGDGNWRAPPPGSFKCNVDATSFTSSNLTGFGIV  783

Query  428  IRDHPGHFVAALGCKLTCGQDLYLVKTMAVKEAIKWLKDLSLDNIFLKSDYLNFCHAL  255
            IRD  G FV      +     L   + MA+  AIKW  D+ + N+  ++D L    AL
Sbjct  784  IRDELGAFVKGYTSTVPGLFVLKEGEVMALIAAIKWGTDMDIQNVVFETDALVVWKAL  841



>ref|XP_006596580.1| PREDICTED: uncharacterized protein LOC102666294 [Glycine max]
Length=216

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/87 (36%), Positives = 43/87 (49%), Gaps = 10/87 (11%)
 Frame = -3

Query  509  WTPPTTNHLKCNVDAAIFADDA--GYGAVIRDHPGHFVAALGCKLTCGQDLYLVKTMAVK  336
            W  P+  +LKCNVDA IF  D   G G  IRDH G F+ A         D  + +   + 
Sbjct  105  WKKPSFGYLKCNVDATIFNQDQQFGNGMCIRDHNGQFIQA-KTWFQGVSDPTIAEACGLY  163

Query  335  EAIKWLKD-------LSLDNIFLKSDY  276
            +A++WLK+         LDN F+  D+
Sbjct  164  QAMEWLKESYNNNIISELDNKFVVDDF  190



>gb|KHN35662.1| hypothetical protein glysoja_047989, partial [Glycine soja]
Length=81

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 38/78 (49%), Gaps = 2/78 (3%)
 Frame = -3

Query  515  NCWTPPTTNHLKCNVDAAIFADDAGYGAVIRDHPGH--FVAALGCKLTCGQDLYLVKTMA  342
            N W+PP   ++KCN+DAAIF D   +G  I  H  H  F+ A     +      + ++ A
Sbjct  4    NVWSPPPNGYIKCNLDAAIFKDTQSFGIGIYLHGMHNNFLKAASSFFSGILKPAVAESWA  63

Query  341  VKEAIKWLKDLSLDNIFL  288
            +  AI+W   L   NI  
Sbjct  64   MLNAIQWTSQLRYQNIIF  81



>gb|EMS46365.1| Pattern formation protein EMB30 [Triticum urartu]
Length=1479

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 59/139 (42%), Gaps = 29/139 (21%)
 Frame = -3

Query  608  CFGLKQQVNVWRANSK----EFYGSAF----------------------VSLRTS-SANC  510
            C+    Q+ VWRA  +    E + S F                      V+ R S   + 
Sbjct  16   CYHSPIQLAVWRARRRAIHEEIFDSPFTTNSFILSFLRDLEMIDRGGGSVTKRASLRQHT  75

Query  509  WTPPTTNHLKCNVDAAI--FADDAGYGAVIRDHPGHFVAALGCKLTCGQDLYLVKTMAVK  336
            W PP   H K NVDAA+    +    GAV RDH G F+ A   KL    D+  ++ +AV+
Sbjct  76   WMPPQEGHAKMNVDAAVSQLGEFGAMGAVCRDHRGVFLGASILKLEFITDVSTLEAIAVR  135

Query  335  EAIKWLKDLSLDNIFLKSD  279
            E     +DL  ++I +  D
Sbjct  136  EGQSLAEDLYENSIQIAID  154



>ref|XP_008222000.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus 
mume]
Length=561

 Score = 46.6 bits (109),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 41/82 (50%), Gaps = 2/82 (2%)
 Frame = -3

Query  509  WTPPTTNHLKCNVDAAIFADDA--GYGAVIRDHPGHFVAALGCKLTCGQDLYLVKTMAVK  336
            W PPT N  K NVD A   +    G GA++RD  G+ V AL  +      +   +  A+K
Sbjct  397  WRPPTGNCFKLNVDGATDMETGARGAGAIVRDSHGNLVGALAMRAPSRISVLATELYALK  456

Query  335  EAIKWLKDLSLDNIFLKSDYLN  270
              I +  D+SL  + ++SD L 
Sbjct  457  VGISFALDVSLLPLEIESDSLQ  478


 Score = 25.8 bits (55),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 0/35 (0%)
 Frame = -2

Query  249  GAVVK*CRDIVRDIGNITVRHICRSANHVAHALGR  145
            G +V   R ++    +  VRH+ R AN  AH + R
Sbjct  494  GGLVDGVRRLLVRSASTAVRHVPRQANKAAHRIAR  528



>gb|ABN07957.1| Polynucleotidyl transferase, Ribonuclease H fold [Medicago truncatula]
Length=380

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 50/93 (54%), Gaps = 8/93 (9%)
 Frame = -3

Query  533  LRTSSANC------WTPPTTNHLKCNVDAAIFAD--DAGYGAVIRDHPGHFVAALGCKLT  378
            +R+S AN       W+ P+    KCNVDAA  A     G+GA IRD  G+ V +     T
Sbjct  274  IRSSPANPHFDISKWSKPSVGRFKCNVDAAFSASLHRVGFGACIRDANGNHVISRTECFT  333

Query  377  CGQDLYLVKTMAVKEAIKWLKDLSLDNIFLKSD  279
               D+ + + + +  A++W KDL+L N+  ++D
Sbjct  334  PLLDVEMGEAIGLLHAMRWAKDLNLVNMDFETD  366



>ref|XP_006421903.1| hypothetical protein CICLE_v10007098mg, partial [Citrus clementina]
 gb|ESR35143.1| hypothetical protein CICLE_v10007098mg, partial [Citrus clementina]
Length=150

 Score = 47.4 bits (111),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 46/89 (52%), Gaps = 3/89 (3%)
 Frame = -3

Query  491  NHLKCNVDAAIFADD--AGYGAVIRDHPGHFVAALGCKLTCGQDLYLVKTMAVKEAIKWL  318
            N  K N DAAI   D  AG G VIR+  G F+ A   +     D+ L +  A+ E IK  
Sbjct  2    NWFKLNSDAAINEADGLAGLGVVIRNSKGEFMTASNYRRRFFGDIELAEASAILEGIKLA  61

Query  317  KDLSLDNIFLKSDYLNFCHALMLVQLLSN  231
            +DL L  + ++SD +N    LM  ++ SN
Sbjct  62   EDLGLTPLVVESDSINVIR-LMSRKINSN  89


 Score = 25.0 bits (53),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 11/30 (37%), Positives = 17/30 (57%), Gaps = 0/30 (0%)
 Frame = -2

Query  198  TVRHICRSANHVAHALGRATDSVGQRIMWL  109
             V+HI RS N VAH + + T    +  +W+
Sbjct  110  AVKHILRSYNSVAHKVVKMTLGQSESCIWV  139



>ref|XP_010675636.1| PREDICTED: uncharacterized protein LOC104891623 [Beta vulgaris 
subsp. vulgaris]
Length=341

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 59/145 (41%), Gaps = 19/145 (13%)
 Frame = -3

Query  632  AAIWALIICFGLKQQVNVWRANSK-------EFYGSAF-----------VSLRTSSANCW  507
            A +W  I  F  K   N    +S+       EFY   F           + LR      W
Sbjct  144  ATVWWFIWLFRNKMIFNEESVSSRSASFAIAEFYAKGFRFKAKSDRVKSIGLRRGPGCVW  203

Query  506  TPPTTNHLKCNVDAA-IFADDAGYGAVIRDHPGHFVAALGCKLTCGQDLYLVKTMAVKEA  330
            TPP    +K N D + + +  A  G VIRDH G  + A    L C   +   +   + EA
Sbjct  204  TPPACGVVKINFDGSKLMSGQASLGFVIRDHLGEVLLAGSNSLGCSLSILQAEAWGLLEA  263

Query  329  IKWLKDLSLDNIFLKSDYLNFCHAL  255
            ++  + L + N+ ++ D L   +A+
Sbjct  264  VRAARSLDISNVVIEGDNLVVVNAV  288



>ref|XP_007206269.1| hypothetical protein PRUPE_ppa016210mg [Prunus persica]
 gb|EMJ07468.1| hypothetical protein PRUPE_ppa016210mg [Prunus persica]
Length=186

 Score = 41.2 bits (95),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 35/89 (39%), Gaps = 16/89 (18%)
 Frame = -3

Query  515  NCWTPPTTNHLKCNVDAA--IFADDAGYGAVIRDHPGHFVAALGCKLTCGQDLYLVKTMA  342
              W PP  N LK NVD A      + G G V++D  G FVA              V+ +A
Sbjct  54   QMWQPPHENSLKINVDGAWKPGTTEGGVGVVVKDSTGKFVA--------------VEALA  99

Query  341  VKEAIKWLKDLSLDNIFLKSDYLNFCHAL  255
             +       +    N+  +SD L    AL
Sbjct  100  ARTGTILAMERGYQNVVFESDALQIVTAL  128


 Score = 31.2 bits (69),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 0/50 (0%)
 Frame = -2

Query  258  SYVGAVVK*CRDIVRDIGNITVRHICRSANHVAHALGRATDSVGQRIMWL  109
            S +G VV+  + ++  I      HI R+AN VAH L R    +G  + W 
Sbjct  136  SVIGPVVEDTKSLLTQITGEGFTHIRRTANGVAHRLARFALHIGGSLYWF  185



>gb|KDP36415.1| hypothetical protein JCGZ_08684 [Jatropha curcas]
Length=115

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 55/115 (48%), Gaps = 6/115 (5%)
 Frame = -3

Query  566  SKEFYGSAFVSLRTSSANCWTPPTTNHLKCNVDAA--IFADDAGYGAVIRDHPGHFVAAL  393
            SK  Y +A  +  TS    W PP    LK NVDAA  +    AG G ++RDH G  +   
Sbjct  3    SKTRYHAAVGAKATS---IWHPPLQGTLKLNVDAAFDLNTHRAGGGWILRDHLGFCLGGK  59

Query  392  GCKLTCGQDLYLVKTMAVKEAIKWLKDLSLDN-IFLKSDYLNFCHALMLVQLLSN  231
               L       + + ++++EA+ W+K   L   I ++SD +    AL    ++SN
Sbjct  60   LMDLGVVASSLMAEALSIREALSWVKTRDLTTAIQIESDSMTTIQALQRPDMISN  114



>ref|XP_003612608.1| Replication protein A 70 kDa DNA-binding subunit [Medicago truncatula]
Length=1723

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 62/135 (46%), Gaps = 14/135 (10%)
 Frame = -3

Query  650   QLRLNSAAIWALIICFGLKQQVN-VWRANSKEFYGSAFVSLR--------TSSANCWTPP  498
             +L  +   IWA ++    KQ+ + +WR    E   +A V  R         ++ + W  P
Sbjct  1511  ELDSSQRVIWACVMWSIWKQRNDCIWR---NEVMTTAAVRDRGLNLLTGWQNAQDIWRKP  1567

Query  497   TTNHLKCNVDAAIFADD--AGYGAVIRDHPGHFVAALGCKLTCGQDLYLVKTMAVKEAIK  324
                H KCNVDAA F +    G G  IRD  G  V A     T   D+   + + +  AI+
Sbjct  1568  DEGHFKCNVDAAFFKESNRVGIGICIRDDSGRLVKARTSWSTLLLDVPEGEAIGLLYAIR  1627

Query  323   WLKDLSLDNIFLKSD  279
             W K+ +L+NI  + D
Sbjct  1628  WAKEQNLNNITFELD  1642



>ref|XP_008232034.1| PREDICTED: uncharacterized protein LOC103331202 [Prunus mume]
Length=814

 Score = 46.6 bits (109),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 49/110 (45%), Gaps = 10/110 (9%)
 Frame = -3

Query  608  CFGLKQQVNVWRANSKEFYGSAFVSLRTSSANCWTPPTTNHLKCNVDAAIFADDAGYGAV  429
            C GL    + WR NS   +GS       S    W PP T  +K N D ++    A  G V
Sbjct  279  CVGL----DFWRLNSTTRFGSI-----DSMIIKWHPPPTGWIKVNFDGSLMNSHASTGFV  329

Query  428  IRDHPGHFVAALGCKLTCGQDLYLVKTMAVKEAIKWLKDLSLDNIFLKSD  279
            IRD+ GH + A G        + + + +A+++ +    D   D I ++ D
Sbjct  330  IRDYEGHVLVA-GSNNIGENSINVAECIALRDGLATALDRGWDQIVIEGD  378


 Score = 25.0 bits (53),  Expect(2) = 3e-04, Method: Composition-based stats.
 Identities = 8/33 (24%), Positives = 18/33 (55%), Gaps = 0/33 (0%)
 Frame = -2

Query  210  IGNITVRHICRSANHVAHALGRATDSVGQRIMW  112
            +  I  +H+ R AN  A+A+ +    +  +++W
Sbjct  410  VACIRFQHVLREANFTANAVAKLGHGLSNQVLW  442



>ref|XP_006471930.1| PREDICTED: uncharacterized protein LOC102617744 [Citrus sinensis]
Length=294

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 47/86 (55%), Gaps = 2/86 (2%)
 Frame = -3

Query  530  RTSSANCWTPPTTNHLKCNVDAAIFADD--AGYGAVIRDHPGHFVAALGCKLTCGQDLYL  357
            R  S   W+PP TN LK NVDAA  + D   G GAV+RD  G  VAA   + +  +D+  
Sbjct  129  REESQQRWSPPPTNVLKLNVDAATNSKDQKVGLGAVLRDSNGRVVAAGIKQASFRKDVSF  188

Query  356  VKTMAVKEAIKWLKDLSLDNIFLKSD  279
             +  A++  ++  K  +  ++ +++D
Sbjct  189  AEAEAIQWGLQIAKKAAAASLIVETD  214



>ref|XP_008358038.1| PREDICTED: uncharacterized protein LOC103421772 [Malus domestica]
Length=244

 Score = 41.6 bits (96),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 40/96 (42%), Gaps = 2/96 (2%)
 Frame = -3

Query  536  SLRTSSANCWTPPTTNHLKCNVDAAIFADD--AGYGAVIRDHPGHFVAALGCKLTCGQDL  363
            S + S+   WT P    +K N D A  A     G  A+I D  G+F+A L          
Sbjct  77   SFQVSTRXKWTKPRQGQVKLNXDGAWDATHLVGGXRAIIXDSDGNFLAGLSKSSLYISSP  136

Query  362  YLVKTMAVKEAIKWLKDLSLDNIFLKSDYLNFCHAL  255
            +  + +AV+E +         NI ++SD      AL
Sbjct  137  FFXEAIAVREGLALAYSRGFQNIIVESDSXQIVQAL  172


 Score = 30.0 bits (66),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 23/50 (46%), Gaps = 0/50 (0%)
 Frame = -2

Query  258  SYVGAVVK*CRDIVRDIGNITVRHICRSANHVAHALGRATDSVGQRIMWL  109
            S VG + +  R I   I  ++  HI R AN VAH   R + S     +W 
Sbjct  180  SXVGLIXEDSRAIAXAITGVSFTHIRRQANEVAHRXARYSFSSTIPALWF  229



>ref|XP_006427454.1| hypothetical protein CICLE_v10027161mg, partial [Citrus clementina]
 gb|ESR40694.1| hypothetical protein CICLE_v10027161mg, partial [Citrus clementina]
Length=164

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 44/83 (53%), Gaps = 2/83 (2%)
 Frame = -3

Query  512  CWTPPTTNHLKCNVDAAIFA--DDAGYGAVIRDHPGHFVAALGCKLTCGQDLYLVKTMAV  339
            CW  P  +  K NVDAA+ +  D AG G ++ +  G  +AA  C +   +D+  V+ +AV
Sbjct  2    CWQSPPPSWYKVNVDAAVSSTEDRAGIGVLVCNSTGEVMAASICTVIFSRDIEFVEAVAV  61

Query  338  KEAIKWLKDLSLDNIFLKSDYLN  270
               ++ + D+ L    ++SD  N
Sbjct  62   HNGLQLVMDIGLAPAIIESDSFN  84



>ref|XP_007032521.1| Uncharacterized protein TCM_018523 [Theobroma cacao]
 gb|EOY03447.1| Uncharacterized protein TCM_018523 [Theobroma cacao]
Length=348

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 44/81 (54%), Gaps = 2/81 (2%)
 Frame = -3

Query  509  WTPPTTNHLKCNVDAAIFAD--DAGYGAVIRDHPGHFVAALGCKLTCGQDLYLVKTMAVK  336
            W+PP+   LK N   A+ A    AG+GAVIR   G+F+AA   K    ++  + +  A+K
Sbjct  151  WSPPSAAILKINCAGAVSASSHQAGFGAVIRTQEGYFLAASSGKPAACEEAIVAEISAIK  210

Query  335  EAIKWLKDLSLDNIFLKSDYL  273
            E ++    + L  + ++SD L
Sbjct  211  EGLRLADWMKLQEVEVRSDSL  231



>gb|KHN23992.1| hypothetical protein glysoja_049729, partial [Glycine soja]
Length=136

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/79 (32%), Positives = 38/79 (48%), Gaps = 2/79 (3%)
 Frame = -3

Query  509  WTPPTTNHLKCNVDAAIFADDAGYG--AVIRDHPGHFVAALGCKLTCGQDLYLVKTMAVK  336
            WTPP  + +KCN DA IF +   +G  A IRD  G F+ A+             +  +++
Sbjct  7    WTPPPRDFVKCNTDAVIFQEQGKFGVAACIRDSNGSFIYAMSLCYNGMPSPSEAEARSLE  66

Query  335  EAIKWLKDLSLDNIFLKSD  279
              + WL     +NI L+ D
Sbjct  67   LTLIWLSSHEFNNIILEFD  85



>ref|XP_003599995.1| hypothetical protein MTR_3g050230 [Medicago truncatula]
Length=240

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 42/83 (51%), Gaps = 6/83 (7%)
 Frame = -3

Query  515  NCWTPPTTNHLKCNVDAAIFA--DDAGYGAVIRDHPGHFVAA--LGCKLTCGQDLYLVKT  348
            N W  P    LKCNVDA  F   +  G+G  IRD  G F+ A  L     C  D+   + 
Sbjct  101  NRWQKPLQGRLKCNVDADFFETLNCVGFGLCIRDEFGEFIKAKTLWSNPICSSDIG--EA  158

Query  347  MAVKEAIKWLKDLSLDNIFLKSD  279
            + +  AI+W+++L L N+  + D
Sbjct  159  LGLSHAIQWVQELQLPNVDFELD  181



>ref|XP_010682311.1| PREDICTED: uncharacterized protein LOC104897185 [Beta vulgaris 
subsp. vulgaris]
Length=345

 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 28/88 (32%), Positives = 45/88 (51%), Gaps = 1/88 (1%)
 Frame = -3

Query  515  NCWTPPTTNHLKCNVDAAIFAD-DAGYGAVIRDHPGHFVAALGCKLTCGQDLYLVKTMAV  339
            + W+ P    +KCNVDA + AD   G GAV RD  G  +     +   G ++ + +  AV
Sbjct  185  DAWSLPQGGWVKCNVDAGMVADFGVGVGAVCRDEVGEVLGCAVLQQHVGWEMRVAEARAV  244

Query  338  KEAIKWLKDLSLDNIFLKSDYLNFCHAL  255
             E ++  K+L +  + ++SD L    AL
Sbjct  245  FEGVRLAKNLGVRKLIVESDCLQVISAL  272



>ref|XP_002456488.1| hypothetical protein SORBIDRAFT_03g037190 [Sorghum bicolor]
 gb|EES01608.1| hypothetical protein SORBIDRAFT_03g037190 [Sorghum bicolor]
Length=589

 Score = 42.7 bits (99),  Expect(2) = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/79 (28%), Positives = 40/79 (51%), Gaps = 2/79 (3%)
 Frame = -3

Query  509  WTPPTTNHLKCNVDAAIFAD--DAGYGAVIRDHPGHFVAALGCKLTCGQDLYLVKTMAVK  336
            W+PP    LK N D A   D      GAV+RD  G+F AA    L     + + +  A++
Sbjct  428  WSPPAPGMLKINSDGAFLQDRGTGAAGAVVRDSSGNFCAASARWLGPVGSVLIAEAEAIR  487

Query  335  EAIKWLKDLSLDNIFLKSD  279
            + ++ +   ++++I  ++D
Sbjct  488  DGLRLIPQGTMEHIIGETD  506


 Score = 27.7 bits (60),  Expect(2) = 7e-04, Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 23/50 (46%), Gaps = 0/50 (0%)
 Frame = -2

Query  258  SYVGAVVK*CRDIVRDIGNITVRHICRSANHVAHALGRATDSVGQRIMWL  109
            S + A++K   +IV    +  + H+ R AN VAH   R   S     +W 
Sbjct  522  SEIAAILKEIEEIVSAFTSFELIHVRREANSVAHTCARFASSSLDSHVWF  571



>ref|XP_010667449.1| PREDICTED: uncharacterized protein LOC104884491 [Beta vulgaris 
subsp. vulgaris]
Length=229

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 32/95 (34%), Positives = 48/95 (51%), Gaps = 3/95 (3%)
 Frame = -3

Query  533  LRTSSANCWTPPTTNHLKCNVDAAIFADD-AGYGAVIRDHPGHFVAALGCKLTCGQ-DLY  360
            +R+   + W  P     K NVDAAIF DD  GY A++RDH G  +A   CK   G  +  
Sbjct  99   VRSRCVSKWQVPPDGSYKINVDAAIFVDDRVGYCAMMRDHVGEIMATT-CKQHYGSYEAD  157

Query  359  LVKTMAVKEAIKWLKDLSLDNIFLKSDYLNFCHAL  255
            + + MAV+  +    +  L  + L++D +   H L
Sbjct  158  IAEAMAVRHGLIIAVETGLRKVALETDCIKLFHNL  192



>ref|XP_002532007.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF30380.1| conserved hypothetical protein [Ricinus communis]
Length=273

 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 49/92 (53%), Gaps = 2/92 (2%)
 Frame = -3

Query  524  SSANCWTPPTTNHLKCNVDAAIFA--DDAGYGAVIRDHPGHFVAALGCKLTCGQDLYLVK  351
             S+  WT P    LKCN+D  +F   +  G+G + ++  G F AA    ++   D  + +
Sbjct  124  QSSGIWTCPVEGWLKCNIDVVVFVANNRLGFGFIFQNDSGTFRAATNGLISGPLDPQVAE  183

Query  350  TMAVKEAIKWLKDLSLDNIFLKSDYLNFCHAL  255
             ++++E + W+K L L+ +  +SD L   +A+
Sbjct  184  ALSLREDLCWVKGLDLNYVVSESDCLTLVNAV  215



>ref|XP_009787297.1| PREDICTED: uncharacterized protein LOC104235275 [Nicotiana sylvestris]
Length=201

 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 27/85 (32%), Positives = 43/85 (51%), Gaps = 10/85 (12%)
 Frame = -3

Query  509  WTPPTTNHLKCNVDAA--IFADDAGYGAVIRDHPGHFVAALGCKLTCGQDLYLVKTMAVK  336
            W PP    LKCN+DA+  +   +A  G V+RD    F+      +       + + +AVK
Sbjct  72   WKPPDGLALKCNIDASFNLATGEARAGMVVRDRHSEFLRGRSTYIGATFSSMMAEALAVK  131

Query  335  EAIKWLK--------DLSLDNIFLK  285
            EA+ WLK        +L +D++F+K
Sbjct  132  EALSWLKLHYDDTKIELEMDSLFVK  156



>ref|XP_010681661.1| PREDICTED: uncharacterized protein LOC104896591 [Beta vulgaris 
subsp. vulgaris]
Length=197

 Score = 47.4 bits (111),  Expect(2) = 8e-04, Method: Compositional matrix adjust.
 Identities = 29/98 (30%), Positives = 43/98 (44%), Gaps = 3/98 (3%)
 Frame = -3

Query  536  SLRTSSANC--WTPPTTNHLKCNVDAAIFADDA-GYGAVIRDHPGHFVAALGCKLTCGQD  366
             ++     C  W PP     K N DAAIF D   G G V+RD  G  + A    L     
Sbjct  24   EIKNDDGGCKVWKPPVEGSYKINADAAIFKDRTVGLGGVMRDAAGEVMGATCMHLEVELG  83

Query  365  LYLVKTMAVKEAIKWLKDLSLDNIFLKSDYLNFCHALM  252
            +   +  A + A++   ++ L +I L+SD L     L+
Sbjct  84   VDEAEACAARHALQTAVEMGLRHIVLESDSLKVISHLL  121


 Score = 23.1 bits (48),  Expect(2) = 8e-04, Method: Compositional matrix adjust.
 Identities = 9/32 (28%), Positives = 17/32 (53%), Gaps = 0/32 (0%)
 Frame = -2

Query  204  NITVRHICRSANHVAHALGRATDSVGQRIMWL  109
            +I+  H+ R  N VAH + + +   G   +W+
Sbjct  146  SISFNHVRREGNRVAHTIAQRSKEYGCMRVWM  177



>ref|XP_010236322.1| PREDICTED: uncharacterized protein LOC104583970 [Brachypodium 
distachyon]
Length=284

 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 44/88 (50%), Gaps = 2/88 (2%)
 Frame = -3

Query  509  WTPPTTNHLKCNVDAAIFAD--DAGYGAVIRDHPGHFVAALGCKLTCGQDLYLVKTMAVK  336
            W PP  +H K NVDAA+          AV RD  G F+ A    +    D   ++T+A +
Sbjct  127  WLPPPVDHAKINVDAAVAKQVCAGAITAVCRDMDGRFLGASAQVIAGINDPGTLETLACR  186

Query  335  EAIKWLKDLSLDNIFLKSDYLNFCHALM  252
            EA+   +DL L ++ + SD L    ALM
Sbjct  187  EALSLAEDLQLAHLRVASDCLEVIMALM  214



>gb|EMS45573.1| Superoxide-generating NADPH oxidase heavy chain subunit B [Triticum 
urartu]
Length=1019

 Score = 41.2 bits (95),  Expect(2) = 9e-04, Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 46/95 (48%), Gaps = 5/95 (5%)
 Frame = -3

Query  533  LRTSSANCWTPPTTNHLKCNVDAAIFADDA--GYGAVIRDHPGHFVAALGCKLTCGQDLY  360
            +R S    W  P    +K NVDAA ++D+      A++RD  G+F+ A    +    D  
Sbjct  850  VRISPEAKWCKPDPRFIKLNVDAAYYSDEGVGATAAILRDDKGNFLGAQCKFIPVAVDAI  909

Query  359  LVKTMAVKEAIKWLKDLSLDNIFLKSDYL---NFC  264
             ++ +A+++ + +      + +  +SD L   N+C
Sbjct  910  TIEALAMRDGLIFANSFGSNRVEAESDSLQVINYC  944


 Score = 29.3 bits (64),  Expect(2) = 9e-04, Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 19/48 (40%), Gaps = 0/48 (0%)
 Frame = -2

Query  252   VGAVVK*CRDIVRDIGNITVRHICRSANHVAHALGRATDSVGQRIMWL  109
               A+   C D    IG +  +H  RS N VAH L   +        WL
Sbjct  954   AAAIFTECLDTSTSIGKVVYKHCYRSCNQVAHMLAHFSYCNKTSFSWL  1001



>ref|XP_002510284.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF52471.1| conserved hypothetical protein [Ricinus communis]
Length=92

 Score = 47.4 bits (111),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 43/70 (61%), Gaps = 2/70 (3%)
 Frame = -3

Query  476  NVDAAIFADD--AGYGAVIRDHPGHFVAALGCKLTCGQDLYLVKTMAVKEAIKWLKDLSL  303
            NVDAA+FA+    G G V+R H G+F++A          + + + +A++EA++WL +   
Sbjct  2    NVDAAMFANSNKVGVGRVLRVHEGNFLSAFVNSFPGNVVVLIAEALALREALQWLVEQRY  61

Query  302  DNIFLKSDYL  273
            +++ L+SD L
Sbjct  62   NHVILESDSL  71



>emb|CDP16895.1| unnamed protein product [Coffea canephora]
Length=226

 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 41/80 (51%), Gaps = 3/80 (4%)
 Frame = -3

Query  509  WTPPTTNHLKCNVDAAIFADD--AGYGAVIRDHPGHFVAALGCKLTCG-QDLYLVKTMAV  339
            W  P    +K N D A+F DD  +G G +IRD  G F+A    K   G  +  +V++ A 
Sbjct  65   WIRPNAGFVKANFDGAVFMDDKSSGVGVIIRDDTGSFIAGHYSKKILGILEPNVVESYAA  124

Query  338  KEAIKWLKDLSLDNIFLKSD  279
            K A + L+ L  + I L+ D
Sbjct  125  KHAAQLLQSLGFNKIVLEGD  144



>ref|XP_003621450.1| hypothetical protein MTR_7g013520 [Medicago truncatula]
 gb|AES77668.1| glycosyltransferase family 28 protein [Medicago truncatula]
Length=183

 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 37/79 (47%), Gaps = 2/79 (3%)
 Frame = -3

Query  509  WTPPTTNHLKCNVDAAIFA--DDAGYGAVIRDHPGHFVAALGCKLTCGQDLYLVKTMAVK  336
            W PP     KCN DA   +  +  G G  +RD  G FV        C   + + + + + 
Sbjct  49   WQPPGVGRYKCNNDATFSSHLNHTGIGICVRDADGTFVLGKAFAYPCSVPVEVGEALGLH  108

Query  335  EAIKWLKDLSLDNIFLKSD  279
             A++WL D+  DN+  ++D
Sbjct  109  AALQWLSDMQFDNVDFETD  127



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1507754616730